WO2016081584A1 - Process for preparing cell-binding agent-cytotoxic agent conjugates - Google Patents

Process for preparing cell-binding agent-cytotoxic agent conjugates Download PDF

Info

Publication number
WO2016081584A1
WO2016081584A1 PCT/US2015/061310 US2015061310W WO2016081584A1 WO 2016081584 A1 WO2016081584 A1 WO 2016081584A1 US 2015061310 W US2015061310 W US 2015061310W WO 2016081584 A1 WO2016081584 A1 WO 2016081584A1
Authority
WO
WIPO (PCT)
Prior art keywords
hours
antibody
cell
reaction
agent
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2015/061310
Other languages
English (en)
French (fr)
Inventor
Benjamin M. HUTCHINS
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Immunogen Inc
Original Assignee
Immunogen Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CN201580060700.2A priority Critical patent/CN107592813A/zh
Priority to AU2015349985A priority patent/AU2015349985A1/en
Priority to US15/527,525 priority patent/US10413615B2/en
Priority to EP15802310.1A priority patent/EP3220959A1/en
Priority to KR1020177016749A priority patent/KR20170088905A/ko
Priority to SG11201703599VA priority patent/SG11201703599VA/en
Priority to RU2017115812A priority patent/RU2711930C2/ru
Priority to JP2017525940A priority patent/JP2018505128A/ja
Application filed by Immunogen Inc filed Critical Immunogen Inc
Priority to CA2966932A priority patent/CA2966932A1/en
Publication of WO2016081584A1 publication Critical patent/WO2016081584A1/en
Priority to IL251900A priority patent/IL251900B/en
Anticipated expiration legal-status Critical
Priority to US16/534,521 priority patent/US20200101168A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6891Pre-targeting systems involving an antibody for targeting specific cells
    • A61K47/6899Antibody-Directed Enzyme Prodrug Therapy [ADEPT]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/68033Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a maytansine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • A61K47/6817Toxins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6889Conjugates wherein the antibody being the modifying agent and wherein the linker, binder or spacer confers particular properties to the conjugates, e.g. peptidic enzyme-labile linkers or acid-labile linkers, providing for an acid-labile immuno conjugate wherein the drug may be released from its antibody conjugated part in an acidic, e.g. tumoural or environment
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered

Definitions

  • ADC's Antibody-Drug-Conjugates
  • ADC's which are useful for the treatment of cancer and other diseases are commonly composed of three distinct elements: a cell-binding agent; a linker; and a cytotoxic agent.
  • the conventional method of conjugating a cell-binding agent, such as an antibody, to a cytotoxic agent employs two distinct reaction steps. In the first reaction step, the antibody is reacted with a bifunctional crosslinking reagent to produce a linker-modified antibody. The modified antibody product is then optionally purified from the excess linker or hydrolyzed linker reagent.
  • the linker-modified antibody is reacted with the cytotoxic agent containing a reactive group, such as thiol, to generate the antibody-cytotoxic agent conjugate, which is again purified in an additional purification step.
  • This conventional method may require two purification steps, which lowers the overall yield and makes the process cumbersome and uneconomical for large scale manufacturing of ADCs.
  • the cytotoxic agent can first react with the bifunctional crosslinking reagent to form a cytotoxic agent-linker compound, which is then reacted with a cell-binding agent to form the cell-binding agent-cyto toxic agent conjugate (conjugation reaction).
  • the cytotoxic agent, the bifunctional crosslinking reagent and the resulting cytotoxic agent-linker compound are generally hydrophobic compounds and have low solubility in water. As such, a certain amount of organic solvent is required to be present in the conjugation reaction to solubilize the cytotoxic agent-linker compound. On the other hand, the presence of large amount of organic solvent may have a detrimental effect on the antibody stability.
  • the process of the art may be limited to small scale preparation of the cell- binding agent-cytotoxic agent conjugates when low concentrations of cell-binding agents, cytotoxic agents and/or bifunctional crosslinking reagents are used.
  • the present invention provides novel processes that are suitable for large scale production of antibody-drug-conjugates (ADCs).
  • the processes comprise the steps of:
  • a buffer solution comprising a buffering agent to provide a first mixture comprising a cytotoxic agent-linker compound, wherein the buffer solution has high buffer capacity;
  • step (b) reacting the cytotoxic agent-linker compound in the first mixture from step (a) with a cell-binding agent in a solution having a pH of 4 to 9 to provide the second mixture comprising the cell-binding agent cytotoxic agent conjugate.
  • step (a) when a high buffer capacity buffer solution is used in the reaction of step (a), the resulting cell-binding agent conjugate has significantly less antibody fragmentation as compared to the conjugates prepared using low buffer capacity buffer solution in the reaction of step (a).
  • high concentrations of cell-binding agent e.g. , antibody
  • step (b) of the present processes can be used in the conjugation reaction (i.e. , step (b) of the present processes), which makes the process more economical for large-scale production.
  • step (b) of the present processes can be used in the conjugation reaction (i.e. , step (b) of the present processes), which makes the process more economical for large-scale production.
  • lower amounts of an organic solvent e.g. ,
  • DMA dimethylacetamide
  • the processes of the present invention provide cell-binding agent cytotoxic agent conjugates with high purity and/or stability. Specifically, the processes of the present invention reduces antibody fragmentation as compared to the processes described in the prior art.
  • the present invention is also directed to the cell-binding agent cytotoxic agent conjugates prepared using the processes described herein.
  • the present invention provides a novel process for preparing a cell-binding agent cytotoxic agent conjugate.
  • the process comprises the steps of:
  • sSPDB or a salt thereof in a buffer solution comprising a buffering agent to provide a first mixture comprising a cytotoxic agent-linker compound, wherein the buffer solution has high buffer capacity;
  • step (b) reacting the cytotoxic agent-linker compound in the first mixture obtained from step (a) with a cell-binding agent in a solution having a pH of 4 to 9 to provide the second mixture comprising the cell-binding agent cytotoxic agent conjugate.
  • a salt refers to a derivative of the compounds described herein wherein the parent compound is modified by making acid or base salts thereof. More specifically, a salt refers to a derivative wherein the parent compound is modified by reacting the parent compound with an inorganic or organic base, such as an alkaline hydroxide or an alkyl amine. In one embodiment, the salt is a sodium salt. Alternatively, the salt is a trialkylammonium salt, e.g., ⁇ , ⁇ -diisopropylethylammonium salt.
  • the cell-binding agent e.g., an antibody or an antigen binding fragment thereof
  • fragmentation refers to disruption of a covalent bond in a protein (e.g. , an antibody).
  • fragmentation refers to reduction of inter-chain disulfide bonds in the presence of a free thiol. Fragmentation can also includes cleavage of the protein backbone and fragmentation or modification of side chains (see, for example, Vlasak, J. and Ionescu, R. Fragmentation of monoclonal antibodies. mAbs 3:3, 253-263, May/June 2011).
  • Exemplary antibodies or antigen-binding fragments that are prone to fragmentation include, but are not limited to, IgG4, antibodies comprising a lambda light chain, Fab or F(ab') 2 . Fragmentation can be identified using separation techniques based primarily on the size of the molecule or separation techniques involving the chemistry of amino acid side chains. Separation techniques based primarily on the size of the molecule include, but are not limited to, size- exclusion chromatography (SEC), sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) and capillary electrophoresis with SDS (CE-SDS).
  • SEC size- exclusion chromatography
  • SDS-PAGE sodium dodecyl sulfate-polyacrylamide gel electrophoresis
  • CE-SDS capillary electrophoresis with SDS
  • Separation techniques involving the chemistry of amino acid side chains include, but are not limited to, liquid chromatography, such as reversed-phase HPLC, hydrophobic-interaction HPLC, cation- exchange HPLC, fast protein liquid chromatography (FPLC), ultra performance liquid chromatography (UPLC) and etc.
  • liquid chromatography such as reversed-phase HPLC, hydrophobic-interaction HPLC, cation- exchange HPLC, fast protein liquid chromatography (FPLC), ultra performance liquid chromatography (UPLC) and etc.
  • the buffer solution used in step (a) of the present process has high buffer capacity.
  • buffer capacity refers to the ability of the buffer solution to prevent significant changes in the pH of the reaction mixture in the presence of an added acid or base.
  • the buffer solution comprises a molar excess of a buffering agent relative to the bifunctional crosslinking reagent.
  • the molar ratio of the buffering agent to the bifunctional crosslinking reagent in the buffer solution is from 1.1 : 1 to 50: 1 ; from 1.2: 1 to 30: 1 ; from 1.3: 1 to 25: 1 ; or from 1.5: 1 to 12.5: 1. More specifically, the molar ratio of the buffering agent to the bifunctional crosslinking reagent is from 2: 1 to 8: 1. Even more specifically, the molar ratio of the buffering agent to the bifunctional crosslinking reagent is from 4: 1 to 6: 1. In another more specific embodiment, the molar ratio of the buffering agent to the bifunctional crosslinking reagent is 5: 1.
  • the buffer solution in step (a) of the present processes has a pH of 4 to 9. More specifically, the pH is from 4.5 to 8.5, 5.0 to 8.5, from 5.5 to 8.5, from 6.0 to 8.5, from 6.5 to 8.5, from 7.0 to 8.5, from 7.1 to 8.5, from 7.2 to 8.5, from 7.3 to 8.5, from 7.4 to 8.5, from 7.5 to 8.5, from 7.5 to 8.4, from 7.5 to 8.3, from 5.0 to 6.5, from 5.0 to 6.0, or from 5.5 to 6.5. In one specific embodiment, the pH is from 7.5 to 8.5 (e.g. , 7.5, 7.6, 7.7, 7.8, 7.9, 8.0, 8.1, 8.2, 8.3, 8.4 or 8.5).
  • the pH is from 7.5 to 8.5 (e.g. , 7.5, 7.6, 7.7, 7.8, 7.9, 8.0, 8.1, 8.2, 8.3, 8.4 or 8.5).
  • the pH is from 7.9 to 8.5, 8.0 to 8.4 or 8.1 to 8.3. Even more specifically, the pH is 8.2.
  • the pH is from 4.5 to 5.5 (e.g., 4.5, 4.6, 4.7, 4.8, 4.9, 5.0, 5.1, 5.2, 5.3, 5.4 or 5.5).
  • the pH is from 4.7 to 5.3, 4.8 to 5.2 or 4.9 to 5.1. Even more specifically, the pH is 5.0.
  • Suitable buffering agents include, for example, but are not limited to, a citrate buffer, an acetate buffer, a succinate buffer, and a phosphate buffer.
  • the buffering agent is selected from the group consisting of HEPPSO (N-(2-hydroxyethyl)piperazine-N'-(2-hydroxypropanesulfonic acid)), POPSO (piperazine- l,4-bis-(2-hydroxy-propane-sulfonic acid) dehydrate), HEPES (4- (2-hydroxyethyl)piperazine-l-ethanesulfonic acid), EPPS (4-(2-hydroxyethyl)piperazine-l- propanesulfonic acid), TES (N-[tris(hydroxymethyl)methyl]-2-aminoethanesulfonic acid), MES (2-(N-morpholino)ethanesulfonic acid) and a combination thereof. More specifically, the buffering agent is EPPS.
  • the buffer solution may further comprise an inert salt to maintain the ionic strength of the buffer.
  • the buffer solution further comprises sodium chloride.
  • the buffer solution of step (a) comprises an organic solvent. More specifically, the organic solvent is dimethylacetamide (DMA). In one embodiment, the buffer solution of step (a) comprise a mixture of water and an organic solvent. More specifically, buffer solution of step (a) comprises a mixture of water and DMA.
  • the organic solvent e.g., DMA
  • DMA can be present in the amount of l%-99%, 5%-99%, 10%-99%, 20%- 99%, 30%-99%, 40%-99%, 50%-99%, 60%-99%, 70%-99%, 80%-99%, 90%-99% by volume of the buffer solution.
  • the organic solvent e.g., DMA
  • the organic solvent is present in the amount of 50%-90%, 55%-85%, 60%-80% or 65%-75% by volume of the buffer solution.
  • the organic solvent e.g., DMA
  • the organic solvent is present in the amount of 70% by volume of the buffer solution.
  • molar equivalent amount of the cytotoxic agent and the bifunctional crosslinking reagent is used in the reaction of step (a). In certain embodiments, molar excess of the cytotoxic agent relative to the bifunctional crosslinking reagent is used in the reaction of step (a). In one embodiment, the molar ratio of the cytotoxic agent to the bifunctional crosslinking reagent is from 1.01:1 to 20:1, 1.1:1 to 20:1, from 1.1:1 to 10:1, from 1.1:1 to 5:1, from 1.1:1 to 4:1, from 1.1:1 to 3:1, from 1.1:1 to 2:1, from 1.1:1 to 1.5: 1, from 1.1:1 to 1.4:1, or from 1.1:1 to 1.3:1. More specifically, the molar ratio of the cytotoxic agent to the bifunctional crosslinking reagent is 1.2:1.
  • molar excess of the bifunctional crosslinking reagent relative to the cytotoxic agent is used in the reaction of step (a).
  • the molar ratio of the bifunctional crosslinking reagent to the cytotoxic agent is from 1.01: 1, 1.1:1 to 20:1, from 1.1:1 to 10:1, from 1.1:1 to 5:1, from 1.1:1 to 4:1, from 1.1:1 to 3:1, from 1.1:1 to 2:1, from 1.1:1 to 1.5: 1, from 1.1:1 to 1.4:1, or from 1.1:1 to 1.3:1.
  • the reaction in step (a) of the present processes is carried out by mixing a cytotoxic agent with the bifunctional crosslinking reagent sSPDB in a buffer solution described above.
  • the reaction is allowed to proceed for 2 minutes to 1 week, 1 hour to 48 hours, 1 hour to 36 hours, 1 hour to 24 hours, 5 hours to 20 hours, 5 hours to 15 hours, 6 hours to 14 hours, 4 hours to 8 hours, 5 hours to 7 hours, 1 hours to 5 hours, 1 hours to 4 hours, 1 hours to 2 hours, or 2 hours to 5 hours.
  • the reaction is allowed to proceed for 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 9 hours, 10 hours, 11 hours, 12 hours, 13 hours, 14 hours, 15 hours, etc.
  • the reaction of step (a) can be carried out at any suitable temperature.
  • the reaction can be carried out at a temperature from 10 °C to 50 °C, from 10 °C to 40 °C, or from 10 °C to 30 °C.
  • the reaction can be carried out at a temperature from 15 °C to 25 °C, from 16 °C to 24 °C, from 17 °C to 23 °C, from 18 °C to 22 °C or from 19 °C to 21 °C.
  • the reaction can be carried out at 15 °C, 16 °C, 17 °C, 18 °C, 19 °C, 20 °C, 21 °C, 22 °C, 23 °C, 24 °C or 25 °C.
  • the reaction can be carried out at a low temperature, such as less than 10 °C or less than 0 °C (provided that the solution is prevented from freezing, e.g., by the presence of an organic solvent used to dissolve the cytotoxic agent and/or the bifunctional crosslinking reagent).
  • the reaction can be carried out at a temperature from - 10 °C to 0 °C, from 0°C to 10 °C, or from 0 °C to 5 °C.
  • the first mixture obtained from reacting the cytotoxic agent and the bifunctional crosslinking reagent in step (a) of the present processes can be stored for a long period of time (such as for 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 1 week, 2 weeks, 3 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 1 year, 2 years or 5 years) before reacting with the cell-binding agent.
  • the first mixture can be stored in a frozen state, at a low temperature (e.g.
  • the first mixture can be stored at room temperature or at a temperature from 10 °C to 25 °C, from 15 °C to 25 °C, or from 20 °C to 25 °C upon completion of the reaction of step (a).
  • the first mixture comprises the cytotoxic agent-linker compound and impurities, such as unreacted cytotoxic agent, unreacted bifunctional crosslinking reagent and reaction by-products, such as hydrolyzed bifunctional crosslinking reagent and/or dimer of the cytotoxic agents.
  • the first reaction mixture is not substantially purified before reacting the cytotoxic agent-linker compound in the first mixture with the cell-binding agent in step (b) of the present processes.
  • substantially purified means that less than 50%, less than 40%, less than 30%, less than 20%, less than 10%, less than 9%, less than 8%, less than 7%, less than 6%, less than 5%, less than 4%, less than 3%, less than 2% or less than 1% of the impurities (such as unreacted cytotoxic agent, unreacted bifunctional crosslinking reagent and reaction by-products, such as hydrolyzed bifunctional crosslinking reagent and/or dimer of the cytotoxic agents) are removed before the cytotoxic agent-linker compound in the first reaction mixture is reacted with the cell-binding agent in step (b) of the present processes.
  • the first mixture obtained from step (a) of the present processes is reacted with a cell-binding agent in a solution (e.g. , conjugation buffer solution) having a pH of 4 to 9, 5 to 9, 5.5 to 9, 6 to 9, 6.3 to 9, or 6.3 to 8.7, 6.4 to 8.6, 6.5 to 8.5, 7.3 to 8.7, or 7.4 to 8.6, to provide a second mixture comprising the cell-binding agent cytotoxic agent conjugate.
  • a solution e.g. , conjugation buffer solution
  • the solution has a pH of 7.5 to 8.5 (e.g. , 7.5, 7.6, 7.7, 7.8, 7.9, 8.0, 8.1, 8.2, 8.3, 8.4 or 8.5).
  • the solution has a pH of 7.9 to 8.5, 8.0 to 8.4, or 8.1 to 8.3. In a even more specific embodiment, the solution has a pH of 8.2. In another specific embodiment, the solution has a pH of 6.5 to 7.5 (e.g. , 6.5, 6.6, 6.7, 6.8, 6.9, 7.0, 7.1, 7.2, 7.3, 7.4 or 7.5).
  • the solution in step (b) comprises a buffering agent.
  • a buffering agent Any suitable buffering agent known in the art can be used. Suitable buffering agents include, for example, but are not limited to, a citrate buffer, an acetate buffer, a succinate buffer, and a phosphate buffer.
  • the buffering agent is selected from the group consisting of HEPPSO (N-(2-hydroxyethyl)piperazine-N'-(2-hydroxypropanesulfonic acid)), POPSO (piperazine-l,4-bis-(2-hydroxy-propane- sulfonic acid) dehydrate), HEPES (4-(2- hydroxyethyl)piperazine- l-ethanesulfonic acid), EPPS (4-(2-hydroxyethyl)piperazine-l- propanesulfonic acid), TES (N-[tris(hydroxymethyl)methyl]-2-aminoethanesulfonic acid), MES (2-(N-morpholino)ethanesulfonic acid) and a combination thereof. More specifically, the buffering agent is EPPS.
  • the solution may further comprise an inert salt to maintain the ionic strength of the buffer.
  • the buffer solution further comprises sodium chloride.
  • the solution of step (b) of the present processes further comprises an organic solvent. More specifically, the organic solvent is dimethylacetamide (DMA).
  • the solution of step (b) comprises a mixture of water and an organic solvent. More specifically, the solution of step (b) comprises a mixture of water and DMA.
  • the organic solvent e.g.
  • DMA can be present in the amount of l -99 , l -90 , l -80 , l%-70%, l%-60%, l%-50%, l%-40%, l%-30%, l%-25%, 2%-20%, 2% -15%, 2%- 10%, 2.5%-7.5%, 3%-7%, 4%-6%, or 4.5%-5.5% by volume of the solution. More specifically, the organic solvent (e.g. , DMA) is present in the amount of 5% by volume of the solution.
  • the first mixture in step (b) of the present processes, is reacted with a cell-binding agent by adding an aqueous solution comprising the cell-binding agent to the first mixture obtained from step (a) of the present processes.
  • the first mixture obtained from step (a) is added to an aqueous solution comprising the cell- binding agent.
  • the first mixture obtained from step (a) is pH adjusted before reacting with the cell-binding agent.
  • the first mixture is pH adjusted to have a pH equal to the pH of the aqueous solution comprising the cell-binding agent before reacting with the cell-binding agent.
  • the reaction in step (b) is carried out with high concentration of the cell-binding agent.
  • the concentration for the cell-binding agent in the solution of step (b) is from 5 g/L to 100 g/L. More specifically, the concentration is from 5 g/L to 50g/L, from 5 g/L to 40 g/L, from 10 g/L to 40 g/L, from 10 g/L to 30 g/L, or from 15 g/L to 25 g/L. In a more specific embodiment, the concentration is from 15 g/L to 25 g/L, from 18 g/L to 22 g/L or from 19 g/L to 21 g/L. In a even more specific embodiment, the concentration is 20 g/L.
  • excess amount of the bifunctional crosslinking reagent relative to the cell-binding agent is used in the processes of the present invention.
  • the molar ratio of the bifunctional crosslinking reagent to the cell-binding agent is in the range of 1 to 20, 2 to 10, 3 to 8, or 3 to 6.
  • the molar ratio of the bifunctional crosslinking reagent to the cell-binding agent is 3.5 to 5, e.g., 3.5, 3.6, 3.7, 3.8, 3.9, 4.0, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, or 5.0.
  • the reaction in step (b) is allowed to proceed for 5 hours to 48 hours, 10 hours to 48 hours, 10 hours to 30 hours, 15 hours to 25 hours.
  • the reaction is step (b) is allowed to proceed for 8 hours to 24 hours, 12 hours to 20 hours, 14 hours to 18 hours, or 15 hours to 17 hours.
  • the reaction in step (b) is allowed to proceed for 16 hours.
  • the reaction in step (b) is allowed to proceed for 14 hours to 30 hours, 18 hours to 26 hours, 20 hours to 24 hours or 19 hours to 23 hours.
  • the reaction in step (b) is allowed to proceed for 22 hours.
  • the reaction in step (b) can be carried out at any suitable temperature.
  • the reaction can be carried out at a temperature from 10 °C to 50 °C, from 10 °C to 40 °C, or from 10 °C to 30 °C.
  • the reaction can be carried out at a temperature from 15 °C to 25 °C, from 16 °C to 24 °C, from 17 °C to 23 °C, from 18 °C to 22 °C or from 19 °C to 21 °C.
  • the reaction can be carried out at 15 °C, 16 °C, 17 °C, 18 °C, 19 °C, 20 °C, 21 °C, 22 °C, 23 °C, 24 °C or 25 °C.
  • the reaction can be carried out at a low temperature, such as less than 10 °C or less than 0 °C (provided that the solution is prevented from freezing, e.g., by the presence of an organic solvent used to dissolve the cytotoxic agent and/or the bifunctional crosslinking reagent).
  • the reaction can be carried out at a temperature from - 10 °C to 0 °C, from 0°C to 10 °C, or from 0 °C to 5 °C.
  • the processes of the present invention further comprises a quenching step after step (b).
  • the quenching is achieved by rapidly adjusting the pH of the second mixture obtained from step (b) to a low pH (e.g., pH less than or equal to 6.5, less than or equal to 6.0, less than or equal to 5.5, less than or equal to 5.4, less than or equal to 5.3, less than or equal to 5.2 , less than or equal to 5.1, less than or equal to 5.0).
  • the pH of the second mixture is adjusted to a pH of 4.0 to 6.5, 4.5 to 6.0, 4.5 to 5.5, 4.6 to 5.4, 4.7 to 5.3, 4.8 to 5.2 or 4.9 to 5.1.
  • the pH of the second mixture is adjusted to pH 5.0.
  • the pH of the second mixture can be adjusted by adding an acid to the second mixture. More specifically, the pH of the second mixture can be adjusted by adding acetic acid to the second mixture.
  • quenching is achieved by adding one or more quenching agents to the second mixture to quench any unreacted cytotoxic agent and/or unreacted bifunctional crosslinking reagent.
  • quenching agent refers to a reagent that reacts with the free cytotoxic agent and/or bifunctional crosslinking reagent.
  • maleimide or haloacetamide quenching reagents such as 4- maleimidobutyric acid, 3-maleimidopropionic acid, N-ethylmaleimide, iodoacetamide, or iodoacetamidopropionic acid, can be used to ensure that any unreacted group (such as thiol) in the cytotoxic agent is quenched.
  • the quenching step can help prevent the dimerization of the cytotoxic agent, particular the cytotoxic agent having an unreacted thiol group (such as DM1).
  • the dimerized cytotoxic agent can be difficult to remove.
  • the quenching step may also minimize any unwanted thiol-disulfide interchange reaction with the native antibody disulfide groups.
  • polar, charged thiol-quenching reagents such as 4- maleimidobutyric acid or 3-maleimidopropionic acid
  • the excess, unreacted cytotoxic agent is converted into a polar, charged, water-soluble adduct that can be easily separated from the covalently-linked conjugate during the purification step.
  • Quenching with non-polar and neutral thiol-quenching reagents can also be used.
  • the mixture is quenched by contacting the mixture with a quenching reagent that reacts with the unreacted bifunctional crosslinking reagent.
  • a quenching reagent that reacts with the unreacted bifunctional crosslinking reagent.
  • nucleophiles can be added to the mixture in order to quench any unreacted bifunctional crosslinking reagent.
  • the nucleophile preferably is an amino group containing nucleophile, such as lysine, taurine and hydroxylamine.
  • step (b) the reaction of step (b) is allowed to proceed to completion before the quenching step, i.e. , adjusting the pH and/or contacting the second mixture with a quenching agent described above.
  • the cell-binding agent cytotoxic agent conjugate is subjected to a purification step.
  • the cell-binding agent cytotoxic agent conjugate can be purified from the other components of the mixture (e.g. , free bifunctional crosslinking agent, free cytotoxic agent and reaction by-products) using tangential flow filtration (TFF), which is a membrane -based tangential flow filtration process, non-adsorptive chromatography, adsorptive chromatography, adsorptive filtration, selective precipitation, or any other suitable purification process, as well as combinations thereof.
  • TMF tangential flow filtration
  • the cell-binding agent cytotoxic agent conjugate is purified using a single purification step (e.g. , TFF).
  • TFF a single purification step
  • the conjugate is purified and exchanged into the appropriate formulation using a single purification step (e.g., TFF).
  • the cell-binding agent cytotoxic agent conjugate is purified using two sequential purification steps.
  • the conjugate can be first purified by selective precipitation, adsorptive filtration, absorptive chromatography or non- absorptive chromatography, followed by purification with TFF.
  • purification of the cell-binding agent cytotoxic agent conjugate enables the isolation of a stable conjugate comprising the cell-binding agent chemically coupled to the cytotoxic agent.
  • TFF systems may be utilized for purification, including a Pellicon type system (Millipore, Billerica, Mass.), a Sartocon Cassette system (Sartorius AG, Edgewood, N.Y.), and a Centrasette type system (Pall Corp., East Hills, N.Y.).
  • Pellicon type system Millipore, Billerica, Mass.
  • Sartocon Cassette system Sartorius AG, Edgewood, N.Y.
  • Centrasette type system Pall Corp., East Hills, N.Y.
  • Any suitable adsorptive chromatography resin may be utilized for purification.
  • Preferred adsorptive chromatography resins include hydroxyapatite chromatography, hydrophobic charge induction chromatography (HCIC), hydrophobic interaction
  • hydroxyapatite resins include ceramic hydroxyapatite (CHT Type I and Type II, Bio-Rad Laboratories, Hercules, Calif.), HA Ultrogel hydroxyapatite (Pall Corp., East Hills, N.Y.), and ceramic fluoroapatite (CFT Type I and Type II, Bio-Rad Laboratories, Hercules, Calif.).
  • HCIC resin An example of a suitable HCIC resin is MEP Hypercel resin (Pall Corp., East Hills, N.Y.).
  • suitable HIC resins include Butyl-Sepharose, Hexyl-Sepaharose, Phenyl-Sepharose, and Octyl Sepharose resins (all from GE Healthcare, Piscataway, N.J.), as well as Macro-prep Methyl and Macro-Prep t-Butyl resins (Biorad Laboratories, Hercules, Calif.).
  • Suitable ion exchange resins include SP- Sepharose, CM-Sepharose, and Q-Sepharose resins (all from GE Healthcare, Piscataway, N.J.), and Unosphere S resin (Bio-Rad Laboratories, Hercules, Calif.).
  • suitable mixed mode ion exchangers include Bakerbond ABx resin (JT Baker, Phillipsburg N.J.).
  • suitable IMAC resins include Chelating Sepharose resin (GE Healthcare, Piscataway, N.J.) and Profinity IMAC resin (Bio-Rad Laboratories, Hercules, Calif.).
  • Suitable dye ligand resins include Blue Sepharose resin (GE Healthcare, Piscataway, N.J.) and Affi-gel Blue resin (Bio-Rad Laboratories, Hercules, Calif.).
  • suitable affinity resins include Protein A Sepharose resin (e.g. , MabSelect, GE Healthcare, Piscataway, N.J.), where the cell-binding agent is an antibody, and lectin affinity resins, e.g. Lentil Lectin Sepharose resin (GE Healthcare, Piscataway, N.J.), where the cell-binding agent bears appropriate lectin binding sites.
  • an antibody specific to the cell-binding agent may be used.
  • Such an antibody can be immobilized to, for instance, Sepharose 4 Fast Flow resin (GE Healthcare, Piscataway, N.J.).
  • suitable reversed phase resins include C4, C8, and C18 resins (Grace Vydac, Hesperia, Calif.).
  • non-adsorptive chromatography resin Any suitable non-adsorptive chromatography resin may be utilized for purification.
  • suitable non-adsorptive chromatography resins include, but are not limited to, SEPHADEXTM G-25, G-50, G-100, SEPHACRYLTM resins (e.g. , S-200 and S-300),
  • SUPERDEXTM resins e.g. , SUPERDEXTM 75 and SUPERDEXTM 200
  • BIO-GEL ® resins e.g. , P-6, P-10, P-30, P-60, and P-100
  • a cell-binding agent-cytotoxic agent conjugate of substantially high purity has one or more of the following features: (a) less than 25%, less than 20%, less than 15% (e.g. , less than or equal to 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2% or 1%) of antibody fragmentation, (b) greater than 90% (e.g.
  • conjugate species are monomeric, (c) unconjugated linker level in the conjugate preparation is less than about 10% (e.g. , less than or equal to about 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or 0%) (relative to total linker), (d) less than 10% of conjugate species are crosslinked (e.g.
  • free cytotoxic agent level in the conjugate preparation is less than about 2% (e.g. , less than or equal to about 1.5%, 1.4%, 1.3%, 1.2%, 1.1%, 1.0%, 0.9%, 0.8%, 0.7%, 0.6%, 0.5%, 0.4%, 0.3%, 0.2%, 0.1%, or 0%) (mol/mol relative to total cytotoxic agent) and/or (f) no substantial increase in the level of free cytotoxic agent upon storage (e.g.
  • Substantial increase in the level of free cytotoxic agent means that after certain storage time (e.g.
  • the increase in the level of free cytotoxic agent is less than about 0.1%, about 0.2%, about 0.3%, about 0.4%, about 0.5%, about 0.6%, about 0.7%, about 0.8%, about 0.9%, about 1.0%, about 1.1 %, about 1.2%, about 1.3%, about 1.4%, about 1.5%, about 1.6%, about 1.7%, about 1.8%, about 1.9%, about 2.0%, about 2.2%, about 2.5%, about 2.7%, about 3.0%, about 3.2%, about 3.5%, about 3.7%, or about 4.0%.
  • the term "unconjugated linker” refers to the cell-binding agent that is covalently linked with the bifunctional crosslinking reagent, wherein the cell-binding agent is not covalently coupled to the cytotoxic agent through the linker of the bifunctional crosslinking reagent (i.e., the "unconjugated linker” can be represented by CBA-L, wherein CBA represents the cell-binding agent and L represents the bifunctional crosslinking reagent.
  • the cell-binding agent cytotoxic agent conjugate can be represented by CBA-L-D, wherein D represents the cytotoxic agent).
  • the average molar ratio of the cytotoxic agent to the cell-binding agent (i.e., DAR) in the cell-binding agent cytotoxic agent conjugate is about 1 to about 10, about 2 to about 7, about 3 to about 5, about 2.5 to about 4.5 (e.g.
  • the cell-binding agent can be any suitable agent that binds to a cell, typically and preferably an animal cell (e.g., a human cell).
  • the cell-binding agent preferably is a peptide or a polypeptide.
  • Suitable cell-binding agents include, for example, antibodies (e.g., monoclonal antibodies and fragments thereof), interferons (e.g.
  • lymphokines e.g., IL-2, IL-3, IL-4, IL-6
  • hormones e.g., insulin, TRH (thyrotropin releasing hormone), MSH (melanocyte- stimulating hormone), steroid hormones, such as androgens and estrogens
  • growth factors and colony- stimulating factors such as EGF, TGF-alpha, FGF, VEGF, G-CSF, M-CSF and GM-CSF (Burgess, Immunology Today 5: 155-158 (1984)
  • nutrient-transport molecules e.g., transferrin
  • vitamins e.g., folate
  • any other agent or molecule that specifically binds a target molecule on the surface of a cell e.g., folate
  • the cell-binding agent is an antibody, it binds to an antigen that is a
  • polypeptide or a glycotope may be a transmembrane molecule (e.g., receptor) or a ligand such as a growth factor.
  • exemplary antigens include molecules such as renin; a growth hormone, including human growth hormone and bovine growth hormone; growth hormone releasing factor; parathyroid hormone; thyroid stimulating hormone; lipoproteins; alpha- 1- antitrypsin; insulin A-chain; insulin B-chain; proinsulin; follicle stimulating hormone;
  • calcitonin luteinizing hormone; glucagon; clotting factors such as factor vmc, factor IX, tissue factor (TF), and von Willebrands factor; anti-clotting factors such as Protein C; atrial natriuretic factor; lung surfactant; a plasminogen activator, such as urokinase or human urine or tissue-type plasminogen activator (t-PA); bombesin; thrombin; hemopoietic growth factor; tumor necrosis factor-alpha and -beta; enkephalinase; RANTES (regulated on activation normally T-cell expressed and secreted); human macrophage inflammatory protein (MIP-1- alpha); a serum albumin, such as human serum albumin; Muellerian-inhibiting substance; relaxin A-chain; relaxin B-chain; prorelaxin; mouse gonadotropin-associated peptide; a microbial protein, such as beta-lactamase; DNase; IgE;
  • erythropoietin erythropoietin
  • osteoinductive factors immunotoxins
  • a bone morphogenetic protein BMP
  • an interferon such as interferon- alpha, -beta, and -gamma
  • colony stimulating factors CSFs
  • ILs interleukins
  • superoxide dismutase T-cell receptors
  • surface membrane proteins surface membrane proteins
  • decay accelerating factor viral antigen such as, for example, a portion of the HIV envelope; transport proteins; homing receptors; addressins; regulatory proteins; integrins, such as CDl la, CDl lb, CDl lc, CD 18, an ICAM, VLA-4 and VCAM; a tumor associated antigen such as HER2, HER3, or HER4 receptor; endoglin; c-Met; IGF1R
  • GM-CSF which binds to myeloid cells can be used as a cell-binding agent to diseased cells from acute myelogenous leukemia.
  • IL-2 which binds to activated T- cells can be used for prevention of transplant graft rejection, for therapy and prevention of graft-versus-host disease, and for treatment of acute T-cell leukemia.
  • MSH which binds to melanocytes, can be used for the treatment of melanoma, as can antibodies directed towards melanomas.
  • Folic acid can be used to target the folate receptor expressed on ovarian and other tumors.
  • Epidermal growth factor can be used to target squamous cancers such as lung and head and neck.
  • Somatostatin can be used to target neuroblastomas and other tumor types.
  • an antibody refers to any immunoglobulin, any immunoglobulin fragment, such as Fab, Fab', F(ab').sub.2, dsFv, sFv, minibodies, diabodies, tribodies, tetrabodies (Parham, J. Immunol., 131: 2895-2902 (1983); Spring et al. J.
  • Any suitable antibody can be used as the cell-binding agent.
  • One of ordinary skill in the art will appreciate that the selection of an appropriate antibody will depend upon the cell population to be targeted.
  • cell surface molecules i.e., antigens
  • a particular cell population typically and preferably a diseased cell population
  • Cell surface expression profiles are known for a wide variety of cell types, including tumor cell types, or, if unknown, can be determined using routine molecular biology and histochemistry techniques.
  • the antibody can be polyclonal or monoclonal, but is most preferably a monoclonal antibody.
  • polyclonal antibodies refer to heterogeneous populations of antibody molecules, typically contained in the sera of immunized animals.
  • Monoclonal antibodies refer to homogenous populations of antibody molecules that are specific to a particular antigen.
  • Monoclonal antibodies are typically produced by a single clone of B lymphocytes ("B cells").
  • B cells B cells
  • Monoclonal antibodies may be obtained using a variety of techniques known to those skilled in the art, including standard hybridoma technology (see, e.g., Kohler and Milstein, Eur. J.
  • the hybridoma method of producing monoclonal antibodies typically involves injecting any suitable animal, typically and preferably a mouse, with an antigen (i.e., an "immunogen"). The animal is subsequently sacrificed, and B cells isolated from its spleen are fused with human myeloma cells.
  • an antigen i.e., an "immunogen”
  • hybrid cell is produced (i.e., a "hybridoma"), which proliferates indefinitely and continuously secretes high titers of an antibody with the desired specificity in vitro.
  • Any appropriate method known in the art can be used to identify hybridoma cells that produce an antibody with the desired specificity. Such methods include, for example, enzyme-linked immunosorbent assay (ELISA), Western blot analysis, and
  • each hybridoma is a clone derived from fusion with a single B cell, all the antibody molecules it produces are identical in structure, including their antigen binding site and isotype.
  • Monoclonal antibodies also may be generated using other suitable techniques including EBV-hybridoma technology (see, e.g., Haskard and Archer, J. Immunol.
  • the monoclonal antibody can be isolated from or produced in any suitable animal, but is preferably produced in a mammal, more preferably a mouse or human, and most preferably a human. Methods for producing an antibody in mice are well known to those skilled in the art and are described herein. With respect to human antibodies, one of ordinary skill in the art will appreciate that polyclonal antibodies can be isolated from the sera of human subjects vaccinated or immunized with an appropriate antigen. Alternatively, human antibodies can be generated by adapting known techniques for producing human antibodies in non-human animals such as mice (see, e.g., U.S. Pat. Nos. 5,545,806, 5,569,825, and 5,714,352, and U.S. Patent Application Publication No. 2002/0197266 Al).
  • human antibodies While being the ideal choice for therapeutic applications in humans, human antibodies, particularly human monoclonal antibodies, typically are more difficult to generate than mouse monoclonal antibodies.
  • Mouse monoclonal antibodies induce a rapid host antibody response when administered to humans, which can reduce the therapeutic or diagnostic potential of the antibody-cytotoxic agent conjugate.
  • a monoclonal antibody preferably is not recognized as "foreign" by the human immune system.
  • phage display can be used to generate the antibody.
  • phage libraries encoding antigen-binding variable (V) domains of antibodies can be generated using standard molecular biology and recombinant DNA techniques (see, e.g., Sambrook et al. (eds.), Molecular Cloning, A Laboratory Manual, 3.sup.rd Edition, Cold Spring Harbor Laboratory Press, New York (2001)). Phages encoding a variable region with the desired specificity are selected for specific binding to the desired antigen, and a complete human antibody is reconstituted comprising the selected variable domain.
  • Nucleic acid sequences encoding the reconstituted antibody are introduced into a suitable cell line, such as a myeloma cell used for hybridoma production, such that human antibodies having the characteristics of monoclonal antibodies are secreted by the cell (see, e.g., Janeway et al., supra, Huse et al., supra, and U.S. Pat. No. 6,265,150).
  • a suitable cell line such as a myeloma cell used for hybridoma production
  • monoclonal antibodies can be generated from mice that are transgenic for specific human heavy and light chain immunoglobulin genes.
  • Such methods are known in the art and described in, for example, U.S. Pat. Nos. 5,545,806 and 5,569,825, and Janeway et al., supra.
  • the antibody is a humanized antibody.
  • a "humanized” antibody is one in which the complementarity-determining regions (CDR) of a mouse monoclonal antibody, which form the antigen binding loops of the antibody, are grafted onto the framework of a human antibody molecule. Owing to the similarity of the frameworks of mouse and human antibodies, it is generally accepted in the art that this approach produces a monoclonal antibody that is antigenically identical to a human antibody but binds the same antigen as the mouse monoclonal antibody from which the CDR sequences were derived. Methods for generating humanized antibodies are well known in the art and are described in detail in, for example, Janeway et al., supra, U.S. Pat. Nos. 5,225,539, 5,585,089 and
  • Humanized antibodies can also be generated using the antibody resurfacing technology described in U.S. Pat. No. 5,639,641 and Pedersen et al., J. Mol. Biol., 235: 959-973 (1994). While the antibody employed in the conjugate of the inventive composition most preferably is a humanized monoclonal antibody, a human monoclonal antibody and a mouse monoclonal antibody, as described above, are also within the scope of the invention.
  • Antibody fragments that have at least one antigen binding site, and thus recognize and bind to at least one antigen or receptor present on the surface of a target cell also are within the scope of the invention.
  • proteolytic cleavage of an intact antibody molecule can produce a variety of antibody fragments that retain the ability to recognize and bind antigens.
  • limited digestion of an antibody molecule with the protease papain typically produces three fragments, two of which are identical and are referred to as the Fab fragments, as they retain the antigen binding activity of the parent antibody molecule.
  • F(ab').sub.2 fragment Cleavage of an antibody molecule with the enzyme pepsin normally produces two antibody fragments, one of which retains both antigen-binding arms of the antibody molecule, and is thus referred to as the F(ab').sub.2 fragment.
  • Reduction of a F(ab').sub.2 fragment with dithiothreitol or mercaptoethylamine produces a fragment referred to as a Fab' fragment.
  • a single-chain variable region fragment (sFv) antibody fragment which consists of a truncated Fab fragment comprising the variable (V) domain of an antibody heavy chain linked to a V domain of a light antibody chain via a synthetic peptide, can be generated using routine recombinant DNA technology techniques (see, e.g., Janeway et al., supra).
  • disulfide-stabilized variable region fragments (dsFv) can be prepared by recombinant DNA technology (see, e.g., Reiter et al., Protein Engineering, 7: 697-704 (1994)).
  • Antibody fragments in the context of the invention are not limited to these exemplary types of antibody fragments.
  • any suitable antibody fragment that recognizes and binds to a desired cell surface receptor or antigen can be employed.
  • Antibody fragments are further described in, for example, Parham, J. Immunol., 131: 2895-2902 (1983), Spring et al., J. Immunol., 113: 470-478 (1974), and Nisonoff et al., Arch. Biochem. Biophys., 89: 230-244 (1960).
  • Antibody-antigen binding can be assayed using any suitable method known in the art, such as, for example, radioimmunoassay (RIA), ELISA, Western blot, immunoprecipitation, and competitive inhibition assays (see, e.g., Janeway et al., supra, and U.S. Patent Application Publication No. 2002/0197266 Al).
  • RIA radioimmunoassay
  • ELISA ELISA
  • Western blot Western blot
  • immunoprecipitation immunoprecipitation
  • competitive inhibition assays see, e.g., Janeway et al., supra, and U.S. Patent Application Publication No. 2002/0197266 Al.
  • the antibody can be a chimeric antibody or an antigen binding fragment thereof.
  • chimeric it is meant that the antibody comprises at least two immunoglobulins, or fragments thereof, obtained or derived from at least two different species (e.g., two different immunoglobulins, such as a human immunoglobulin constant region combined with a murine immunoglobulin variable region).
  • the antibody also can be a domain antibody (dAb) or an antigen binding fragment thereof, such as, for example, a camelid antibody (see, e.g., Desmyter et al., Nature Struct.
  • a shark antibody such as, for example, a new antigen receptor (IgNAR) (see, e.g., Greenberg et al., Nature, 374: 168 (1995), and Stanfield et al., Science, 305: 1770-1773 (2004)).
  • IgNAR new antigen receptor
  • the monoclonal antibody J5 is a murine IgG2a antibody that is specific for Common Acute Lymphoblastic Leukemia Antigen (CALLA) (Ritz et al., Nature, 283: 583-585 (1980)), and can be used to target cells that express CALLA (e.g., acute lymphoblastic leukemia cells).
  • the monoclonal antibody MY9 is a murine IgGl antibody that binds specifically to the CD33 antigen (Griffin et al., Leukemia Res., 8: 521 (1984)), and can be used to target cells that express CD33 (e.g., acute myelogenous leukemia (AML) cells).
  • the monoclonal antibody anti-B4 (also referred to as B4) is a murine IgGl antibody that binds to the CD19 antigen on B cells (Nadler et al., J. Immunol., 131: 244-250 (1983)), and can be used to target B cells or diseased cells that express CD19 (e.g., non- Hodgkin's lymphoma cells and chronic lymphoblastic leukemia cells).
  • N901 is a murine monoclonal antibody that binds to the CD56 (neural cell adhesion molecule) antigen found on cells of neuroendocrine origin, including small cell lung tumor, which can be used in the conjugate to target drugs to cells of neuroendocrine origin.
  • the J5, MY9, and B4 antibodies preferably are resurfaced or humanized prior to their use as part of the conjugate. Resurfacing or humanization of antibodies is described in, for example, Roguska et al., Proc. Natl. Acad. Sci. USA, 91: 969-73 (1994).
  • the monoclonal antibody C242 binds to the CanAg antigen (see, e.g., U.S. Pat. No. 5,552,293), and can be used to target the conjugate to CanAg expressing tumors, such as colorectal, pancreatic, non-small cell lung, and gastric cancers.
  • HuC242 is a humanized form of the monoclonal antibody C242 (see, e.g., U.S. Pat. No. 5,552,293).
  • the hybridoma from which HuC242 is produced is deposited with ECACC identification Number 90012601.
  • HuC242 can be prepared using CDR-grafting methodology (see, e.g., U.S. Pat. Nos.
  • HuC242 can be used to target the conjugate to tumor cells expressing the CanAg antigen, such as, for example, colorectal, pancreatic, non-small cell lung, and gastric cancer cells.
  • an anti-MUCl antibody can be used as the cell-binding agent in the conjugate.
  • Anti-MUCl antibodies include, for example, anti-HMFG-2 (see, e.g., Taylor-Papadimitriou et al., Int. J. Cancer, 28: 17-21 (1981)), hCTMOl (see, e.g., van H of et al., Cancer Res., 56: 5179-5185 (1996)), and DS6.
  • Prostate cancer cells also can be targeted with the conjugate by using an anti-pro state- specific membrane antigen (PSMA) as the cell-binding agent, such as J591 (see, e.g., Liu et al., Cancer Res., 57: 3629-3634 (1997)).
  • PSMA anti-pro state- specific membrane antigen
  • cancer cells that express the Her2 antigen such as breast, prostate, and ovarian cancers, can be targeted with the conjugate by using anti- Her2 antibodies, e.g., trastuzumab, as the cell-binding agent.
  • Cells that express epidermal growth factor receptor (EGFR) and variants thereof, such as the type III deletion mutant, EGFRvIII, can be targeted with the conjugate by using anti-EGFR antibodies.
  • EGFR epidermal growth factor receptor
  • Anti-EGFR antibodies are described in International Patent Application Nos. PCT/US 11/058,385 and PCT/US 11/058,378.
  • Anti-EGFRvIII antibodies are described in U.S. Pat. Nos. 7,736,644 and 7,628,986 and U.S. Application Publications 2010/0111979, 2009/0240038, 2009/0175887, 2009/0156790, and 2009/0155282.
  • Anti-IGF-IR antibodies that bind to insulin-like growth factor receptor such as those described in U.S. Pat. No. 7,982,024, also can be used in the conjugate.
  • Antibodies that bind to CD27L, Cripto, CD138, CD38, EphA2, integrins, CD37, folate, CD20, PSGR, NGEP, PSCA, TMEFF2, STEAPl, endoglin, and Her3 also can be used in the conjugate.
  • the antibody is selected from the group consisting of huN901, huMy9-6, huB4, huC242, an anti-HER2 antibody (e.g., trastuzumab), bivatuzumab, sibrotuzumab, rituximab, huDS6, anti-mesothelin antibodies described in International Patent Application Publication WO 2010/124797 (such as MF-T), anti-cripto antibodies described in U.S. Patent Application Publication 2010/0093980 (such as huB3F6), anti-CD138 antibodies described in U.S. Patent Application Publication 2007/0183971 (such as huB-B4), anti-EGFR antibodies described in International Patent Application Nos.
  • an anti-HER2 antibody e.g., trastuzumab
  • bivatuzumab sibrotuzumab
  • rituximab e.g., huDS6, anti-mesothelin antibodies described in
  • PCT/US 11/058,385 and PCT/US 11/058,378 (such as EGFR-7), anti-EGFRvIII antibodies described U.S. Pat. Nos. 7,736,644 and 7,628,986 and U.S. Patent Application Publications 2010/0111979,
  • the cell-binding agent is an antibody or an antigen binding fragment thereof that binds to FGFR2 (e.g. , those described in US2014/030820, the entire teachings of which is incorporated herein by reference).
  • the cell-binding agent is an antibody or an antigen binding fragment thereof that binds to FGFR2 and FGFR4 (e.g. , those described in US 2014/301946, the entire teachings of which is incorporated herein by reference).
  • the cell-binding agent binds to human FGFR3 (SEQ ID NO: 11). More specifically, the cell-binding agent binds to human FGFR3 (SEQ ID NO 11) and comprises a CDRHl having the sequence GYMFTSYGIS (SEQ ID NO 1), a CDRH2 having the sequence WVSTYNGDTNYAQKFQG (SEQ ID NO 2), a CDRH3 having the sequence VLGYYDSIDGYYYGMDV (SEQ ID NO 3), a CDRL1 having the sequence GGNNIGDKSVH (SEQ ID NO 4), a CDRL2 having the sequence LDTERPS (SEQ ID NO 5), and a CDRL3 having the sequence QVWDSGSDHVV (SEQ ID NO 6). Even more specifically, the cell binding agent further comprises a variable heavy amino acid sequence of: EVQLVQSGAEVKKPGASVKVSCKASGYMFTSYGISWVRQAPGQGLEWMGW
  • variable light amino acid sequence of:
  • the cell-binding agent further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 10 and a heavy chain comprising the amino acid sequence of SEQ ID NO: 9. In another embodiment, the cell-binding agent further comprises two light chains each comprising the amino acid sequence of SEQ ID NO: 10 and two heavy chains each comprising the amino acid sequence of SEQ ID NO: 9.
  • antibodies are humanized monoclonal antibodies described herein. Examples include, but are not limited to, huN901, huMy9-6, huB4, huC242, a humanized monoclonal anti-Her2 antibody (e.g., trastuzumab), bivatuzumab, sibrotuzumab, CNT095, huDS6, and rituximab (see, e.g., U.S. Pat. Nos. 5,639,641 and 5,665,357, U.S. Provisional Patent Application No. 60/424,332 (which is related to U.S. Pat. No.
  • the cell-binding agent is huMy9-6, or other related antibodies, which are described in U.S. Pat. Nos. 7,342,110 and 7,557,189 (incorporated herein by reference).
  • the cell-binding agent is an anti-folate receptor antibody described in U.S. Provisional Application Nos. 61/307,797, 61/346,595, 61/413,172 and U.S. Application No. 13/033,723 (published as US 2012-0009181 Al). The teachings of all these applications are incorporated herein by reference in its entirety.
  • the cell-binding agent is an humanized anti-folate antibody or antigen binding fragment thereof that specifically binds a human folate receptor 1 (FOLR1), wherein the antibody comprises: (a) a heavy chain CDR1 comprising GYFMN; a heavy chain CDR2 comprising RIHP YDGDTF YNQXaa i FXaa 2 Xaa 3 ; and a heavy chain CDR3 comprising YDGSRAMDY; and (b) a light chain CDR1 comprising
  • KASQSVSFAGTSLMH a light chain CDR2 comprising RASNLEA; and a light chain CDR3 comprising QQSREYPYT; wherein Xaai is selected from K, Q, H, and R; Xaa 2 is selected from Q, H, N, and R; and Xaa 3 is selected from G, E, T, S, A, and V.
  • the heavy chain CDR2 sequence comprises RIHP YDGDTFYNQKFQG .
  • the anti-folate antibody is a humanized antibody or antigen binding fragment thereof that specifically binds the human folate receptor 1 comprising the heavy chain having the amino acid sequence of
  • the anti-folate antibody is a humanized antibody or antigen binding fragment thereof encoded by the plasmid DNA deposited with the ATCC on Apr. 7, 2010 and having ATCC deposit nos. PTA- 10772 and PTA- 10773 or 10774.
  • the anti-folate antibody is a humanized antibody or antigen binding fragment thereof comprising a heavy chain variable domain at least about 90%, 95%, 99% or 100% identical to
  • the cell-binding agent preferably is an antibody
  • the cell-binding agent also can be a non-antibody molecule.
  • Suitable non-antibody molecules include, for example, interferons (e.g., alpha, beta, or gamma interferon), lymphokines (e.g., interleukin 2 (IL-2), IL-3, IL-4, or IL-6), hormones (e.g., insulin), growth factors (e.g., EGF, TGF-alpha, FGF, and VEGF), colony- stimulating factors (e.g., G-CSF, M-CSF, and GM-CSF (see, e.g., Burgess, Immunology Today, 5: 155-158 (1984)), somatostatin, and transferrin (see, e.g., O'Keefe et al., J.
  • interferons e.g., alpha, beta, or gamma interferon
  • lymphokines e.g., interleukin 2 (IL-2), IL-3, IL-4, or IL-6
  • hormones e
  • GM-CSF which binds to myeloid cells
  • IL-2 which binds to activated T-cells
  • EGF epidermal growth factor
  • Somatostatin can be used to target neuroblastoma cells and other tumor cell types
  • cytotoxic agent refers to any compound that results in the death of a cell, induces cell death, or decreases cell viability.
  • Suitable cytotoxic agents include, for example, maytansinoids and conjugatable ansamitocins (see, for example, International Patent Application No. PCT/US 11/59131, filed Nov. 3, 2011), taxoids, CC-1065 and CC- 1065 analogs, and dolastatin and dolastatin analogs.
  • the cytotoxic agent is a maytansinoid, including maytansinol and maytansinol analogs.
  • Maytansinoids are compounds that inhibit microtubule formation and are highly toxic to mammalian cells. Examples of suitable maytansinol analogues include those having a modified aromatic ring and those having modifications at other positions.
  • maytansinoids are described in, for example, U.S. Pat. Nos. 4,256,746, 4,294,757, 4,307,016, 4,313,946, 4,315,929, 4,322,348, 4,331,598, 4,361,650, 4,362,663, 4,364,866, 4,424,219, 4,371,533, 4,450,254, 5,475,092, 5,585,499, 5,846,545, and 6,333,410.
  • Examples of maytansinol analogs having a modified aromatic ring include: (1) C-19- dechloro (U.S. Pat. No. 4,256,746) (prepared by LAH reduction of ansamytocin P2), (2) C- 20-hydroxy (or C-20-demethyl)+/-C-19-dechloro (U.S. Pat. Nos. 4,361,650 and 4,307,016) (prepared by demethylation using Streptomyces or Actinomyces or dechlorination using LAH), and (3) C-20-demethoxy, C-20-acyloxy (-OCOR), +/-dechloro (U.S. Pat. No.
  • acyloxymethyl (CH.sub.20H or CH.sub.20Ac) (U.S. Pat. No. 4,450,254) (prepared from Nocardia), (4) C-15-hydroxy/acyloxy (U.S. Pat. No. 4,364,866) (prepared by the conversion of maytansinol by Streptomyces), (5) C-15-methoxy (U.S. Pat. Nos. 4,313,946 and
  • the cytotoxic agent can be used in the processes of the present invention is the thiol-containing maytansinoid DM1, also known as
  • DM1 N 2' -deacetyl-N 2' -(3-mercapto-l-oxopropyl)-maytansine.
  • the structure of DM1 is represented by formula (I):
  • t the cytotoxic agent can be used in the processes of the present invention is the thiol-containing maytansinoid DM1, also known as N 2' -deacetyl-N 2' -(4-methyl-4-mercapto-l-oxopentyl)-maytansine.
  • DM4 is represented by formula (II):
  • maytansinoids may be used in the context of the invention, including, for example, thiol and disulfide-containing maytansinoids bearing a mono or di-alkyl substitution on the carbon atom bearing the sulfur atom.
  • Particularly preferred is a maytansinoid having at the C-3 position (a) C-14 hydroxymethyl, C-15 hydroxy, or C-20 desmethyl functionality, and (b) an acylated amino acid side chain with an acyl group bearing a hindered sulfhydryl group, wherein the carbon atom of the acyl group bearing the thiol functionality has one or two substituents, said substituents being a linear or branched alkyl or alkenyl having from 1 to 10 carbon atoms, cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl, or heterocyclic aromatic or heterocycloalkyl radical, and further wherein one of the substituents can be H, and wherein
  • Ri and R 2 are each independently a linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl or heterocyclic aromatic or heterocycloalkyl radical, and wherein R 2 also can be H, wherein A, B, D are cycloalkyl or cycloalkenyl having 3-10 carbon atoms, simple or substituted aryl, or heterocyclic aromatic, or heterocycloalkyl radical, wherein R 3 , R 4 , R5, R 6 , R 7 , R 8 , R9, Rio, R 11
  • Preferred embodiments of formula (III) include compounds of formula (III) wherein (a) Ri is H, R 2 is methyl and Z is H, (b) Ri and R 2 are methyl and Z is H, (c) Ri is H, R 2 is methyl, and Z is -SCH 3 , and (d) Ri and R 2 are methyl , and Z is -SCH 3 .
  • Such additional maytansinoids also include compounds represented by formula (IV- L), (IV-D), or (IV-D,L):
  • Y represents (CR 7 R 8 )i(CR 5 R 6 ) m (CR 3 R 4 ) n CRiR 2 SZ
  • Ri and R 2 are each independently linear alkyl, or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl, or heterocyclic aromatic or heterocycloalkyl radical, and wherein R 2 also can be H, wherein R 3 , R ⁇ , R 5 , R 6 , R 7 , and Rg are each independently H, linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl, or heterocyclic aromatic or heterocycloalkyl radical, wherein 1, m, and n are each independently an integer of from 1 to 5, and in addition n can be zero
  • Preferred embodiments of formulas (IV-L), (IV-D) and (IV-D,L) include compounds of formulas (IV-L), (IV-D) and (IV-D,L) wherein (a) Ri is H, R 2 is methyl, R5, R 6 , R 7 , R8 are each H, 1 and m are each 1, n is 0, and Z is H, (b) Ri is H, R 2 is methyl, R5, R 6 , R 7 , R & are each H, 1 and m are 1, n is 0, and Z is H, (c) Ri is H, R 2 is methyl, R 5 , R 6 , R 7 , Rg are each H, 1 and m are each 1, n is 0, and Z is -SCH 3 , or (d) Ri and R 2 are methyl, R 5 , R 6 , R 7 , Rg are each H, 1 and m are 1, n is 0, and Z is -SCH 3 .
  • the cytotoxic agent is represented by formula (IV-
  • Additional preferred maytansinoids also include compounds represented by formula
  • Ri and R 2 are each independently linear alkyl, or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl, or heterocyclic aromatic or heterocycloalkyl radical, and wherein R 2 also can be H, wherein R 3 , R 4 , R5, R 6 , R 7 , and R 8 are each independently H, linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl, or heterocyclic aromatic or heterocycloalkyl radical, wherein 1, m, and n are each independently an integer of from 1 to 5, and in addition n can be zero, wherein Z
  • Preferred embodiments of formulas (IV-L), (IV-D) and (IV-D,L) include compounds of formulas (IV-L), (IV-D) and (IV-D,L) wherein (a) Ri is H, R 2 is methyl, R 5 , R 6 , R 7 , R 8 are each H, 1 and m are each 1, n is 0, and Z is H, (b) Ri is H, R 2 is methyl, R 5 , R 6 , R 7 , Rs are each H, 1 and m are 1, n is 0, and Z is H, (c) Ri is H, R 2 is methyl, R 5 , R 6 , R 7 , Rg are each H, 1 and m are each 1, n is 0, and Z is -SCH 3 , or (d) Ri and R 2 are methyl, R5, R 6 , R 7 , Rg are each H, 1 and m are 1, n is 0, and Z is— SCH.sub.3.
  • Preferred embodiments of formula (V) include compounds of formula (V) wherein (a) Ri is H, R 2 is methyl, R 5 , R 6 , R 7 , and Rg are each H; 1 and m are each 1; n is 0; and Z is H, (b) Ri and R 2 are methyl; R5, R 6 , R 7 , and Rg are each H, 1 and m are 1; n is 0; and Z is H, (c) Ri is H, R 2 is methyl, R5, R 6 , R 7 , and Rg are each H, 1 and m are each 1, n is 0, and Z is -SCH 3 , or (d) Ri and R 2 are methyl; R 5 , R 6 , R 7 , and Rg are each H, 1 and m are 1, n is 0, and Z is -SCH 3 .
  • the cytotoxic agent used in the conjugate can be a taxane or derivative thereof.
  • Taxanes are a family of compounds that includes paclitaxel (Taxol.RTM.), a cytotoxic natural product, and docetaxel (Taxotere.RTM.), a semi-synthetic derivative, which are both widely used in the treatment of cancer. Taxanes are mitotic spindle poisons that inhibit the depolymerization of tubulin, resulting in cell death. While docetaxel and paclitaxel are useful agents in the treatment of cancer, their antitumor activity is limited because of their non-specific toxicity towards normal cells. Further, compounds like paclitaxel and docetaxel themselves are not sufficiently potent to be used in conjugates of cell-binding agents.
  • Antibody and conjugate concentrations were measured using experimentally determined or calculated extinction coefficients for the antibody and DM4 components at 252nm and 280nm.
  • Monomer, high molecular weight species were determined by SEC-HPLC, using a Tosoh Bioscience TSK G3000SWXL (7.8x300mm), 5um particle size column.
  • the mobile phase was 160 mM Potassium Phosphate, 212 mM Potassium Chloride pH 7.0 containing 15% Isopropanol, run at a flow rate of 0.5mL/minute, with detection by absorbance at 280nm.
  • Antibody fragments were measured using an Agilent 2100 Bioanalyzer with 2100 Expert Software, using a Protein 230 kit (Part#5087-1518).
  • Denatured samples are prepared by addition of denaturation buffer, supplemented to contain 1.6mM N-ethylmaleimide (NEM), and samples are heated to 70 °C for 5 minutes. All other steps, including dilutions, sample and ladder loading and analysis is performed according to the Agilent Protein 230 kit instructions.
  • Antibody fragmentation percentages are calculated by the sum of all peaks that are smaller than the antibody monomer species (excluding known glycosylation artifacts) divided by the sum of all antibody related peaks.
  • cytotoxic agent-linker compounds were carried out by reacting DM4 (12mM) with SPDB or sulfo-SPDB linker (lOmM) in 70.0% (v/v) DMA, and 30% (v/v) of one of four study buffers (200mM Succinate, pH 5.0; 20mM
  • Conjugation mixtures were prepared by mixing the appropriate quantity of conjugation buffer (50mM EPPS, 20mM sodium chloride, 2mM EDTA, pH 8.2) with the calculated amount of DMA to reach a final DMA level of 2.5% or 10%.
  • Antibodyl an anti- FOLR1 antibody, which had been previously buffer exchanged into conjugation buffer by gel filtration chromatography, was then added to this mixture to achieve the final target antibody concentration.
  • the conjugation reactions were then incubated at 20.0 °C for 22 hours with mixing on an orbital shaker at 160 rpm.
  • pH 8.2 reaction mixtures were pH adjusted by addition of 6.5% (v/v) of 1M acetic acid, and filtered through a 0.22um PVDF filter. Filtered, pH adjusted reaction mixtures were purified by gel filtration, and the purified conjugates were analyzed by UV- Visible absorbance spectroscopy, size exclusion chromatography by high performance liquid chromatography (SEC-HPLC), and non-reduced CE-SDS (GelChip).
  • SEC-HPLC size exclusion chromatography
  • CE-SDS GelChip
  • Antibody2 an anti-FGFR3 antibody having a light chain with amino acid sequence of SEQ ID No: 10 and a heavy chain with amino acid sequence of SEQ ID NO: 9, was concentrated to 30 mg/mL and diafiltered into reaction buffer (50 mM EPPS, 20mM sodium chloride, 2 mM EDTA, pH 8.2) for 10 diavolumes, and further concentrated to 45 g/L.
  • reaction buffer 50 mM EPPS, 20mM sodium chloride, 2 mM EDTA, pH 8.2
  • a 1.2 molar ratio of DM4 (12mM) relative to sulfo-SPDB (lOmM) was reacted with a 4.68 molar ratio of sulfo-SPDB relative to antibody in 167 mM EPPS, 66.7 mM NaCl, 2 mM EDTA, pH 8.2 and 70.0% (v/v) DMA.
  • the in-situ reaction was carried out for 10 + 4 hours at 20 + 3°C, then added to Antibody2 with DMA to achieve a final Ab concentration of 20 mg/mL in 50 mM EPPS, 20mM NaCl, 2 mM EDTA, pH 8.2 + 0.2 and 5.0% DMA (v/v).
  • the conjugation reaction was carried out at 20.0 + 3.0°C for 16 + 8 hours. After reaction, the conjugation mixture was rapidly pH adjusted to 5.0 by addition of 6.5% (v/v) of 1M acetic acid. The pH adjusted mixture is concentrated to 20 mg/mL, and diafiltered against basal formulation buffer (10 mM Acetate, pH 5.0 + 0.1) for 16 diavolumes. The purified conjugate was formulated at 5.0 mg/mL in 10 mM Acetate, 9% (w/v) Sucrose, 0.01% (w/v) Polysorbate-20 (Tween-20), pH 5.0 , using concentrated stock solutions of sucrose (45%, w/v) and polysorbate-20 (10%, w/v).

Landscapes

  • Health & Medical Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Toxicology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicinal Preparation (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
PCT/US2015/061310 2014-11-19 2015-11-18 Process for preparing cell-binding agent-cytotoxic agent conjugates Ceased WO2016081584A1 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
RU2017115812A RU2711930C2 (ru) 2014-11-19 2015-11-18 Способ получения конъюгатов агента, связывающегося с клетками, и цитотоксического агента
US15/527,525 US10413615B2 (en) 2014-11-19 2015-11-18 Process for preparing cell-binding agent-cytotoxic agent conjugates
EP15802310.1A EP3220959A1 (en) 2014-11-19 2015-11-18 Process for preparing cell-binding agent-cytotoxic agent conjugates
KR1020177016749A KR20170088905A (ko) 2014-11-19 2015-11-18 세포 결합 작용제-세포독성 작용제 접합체를 제조하기 위한 공정
SG11201703599VA SG11201703599VA (en) 2014-11-19 2015-11-18 Process for preparing cell-binding agent-cytotoxic agent conjugates
CN201580060700.2A CN107592813A (zh) 2014-11-19 2015-11-18 用于制备细胞结合剂‑细胞毒性剂缀合物的方法
AU2015349985A AU2015349985A1 (en) 2014-11-19 2015-11-18 Process for preparing cell-binding agent-cytotoxic agent conjugates
JP2017525940A JP2018505128A (ja) 2014-11-19 2015-11-18 細胞結合剤−細胞毒性剤コンジュゲートを調製するためのプロセス
CA2966932A CA2966932A1 (en) 2014-11-19 2015-11-18 Process for preparing cell-binding agent-cytotoxic agent conjugates
IL251900A IL251900B (en) 2014-11-19 2017-04-25 A process for the preparation of conjugates of a cell binding agent-cytotoxic agent
US16/534,521 US20200101168A1 (en) 2014-11-19 2019-08-07 Process for preparing cell-binding agent-cytotoxic agent conjugates

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201462081914P 2014-11-19 2014-11-19
US62/081,914 2014-11-19

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/527,525 A-371-Of-International US10413615B2 (en) 2014-11-19 2015-11-18 Process for preparing cell-binding agent-cytotoxic agent conjugates
US16/534,521 Continuation US20200101168A1 (en) 2014-11-19 2019-08-07 Process for preparing cell-binding agent-cytotoxic agent conjugates

Publications (1)

Publication Number Publication Date
WO2016081584A1 true WO2016081584A1 (en) 2016-05-26

Family

ID=54754814

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2015/061310 Ceased WO2016081584A1 (en) 2014-11-19 2015-11-18 Process for preparing cell-binding agent-cytotoxic agent conjugates

Country Status (12)

Country Link
US (2) US10413615B2 (enExample)
EP (1) EP3220959A1 (enExample)
JP (1) JP2018505128A (enExample)
KR (1) KR20170088905A (enExample)
CN (1) CN107592813A (enExample)
AU (1) AU2015349985A1 (enExample)
CA (1) CA2966932A1 (enExample)
IL (1) IL251900B (enExample)
MA (1) MA40934A (enExample)
RU (1) RU2711930C2 (enExample)
SG (1) SG11201703599VA (enExample)
WO (1) WO2016081584A1 (enExample)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11555019B2 (en) 2019-07-10 2023-01-17 Cybrexa 3, Inc. Peptide conjugates of microtubule-targeting agents as therapeutics
US11634508B2 (en) 2019-07-10 2023-04-25 Cybrexa 2, Inc. Peptide conjugates of cytotoxins as therapeutics

Citations (50)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4256746A (en) 1978-11-14 1981-03-17 Takeda Chemical Industries Dechloromaytansinoids, their pharmaceutical compositions and method of use
US4294757A (en) 1979-01-31 1981-10-13 Takeda Chemical Industries, Ltd 20-O-Acylmaytansinoids
US4307016A (en) 1978-03-24 1981-12-22 Takeda Chemical Industries, Ltd. Demethyl maytansinoids
US4313946A (en) 1981-01-27 1982-02-02 The United States Of America As Represented By The Secretary Of Agriculture Chemotherapeutically active maytansinoids from Trewia nudiflora
US4315929A (en) 1981-01-27 1982-02-16 The United States Of America As Represented By The Secretary Of Agriculture Method of controlling the European corn borer with trewiasine
US4322348A (en) 1979-06-05 1982-03-30 Takeda Chemical Industries, Ltd. Maytansinoids
US4331598A (en) 1979-09-19 1982-05-25 Takeda Chemical Industries, Ltd. Maytansinoids
US4362663A (en) 1979-09-21 1982-12-07 Takeda Chemical Industries, Ltd. Maytansinoid compound
US4364866A (en) 1979-09-21 1982-12-21 Takeda Chemical Industries, Ltd. Maytansinoids
US4371533A (en) 1980-10-08 1983-02-01 Takeda Chemical Industries, Ltd. 4,5-Deoxymaytansinoids, their use and pharmaceutical compositions thereof
US4424219A (en) 1981-05-20 1984-01-03 Takeda Chemical Industries, Ltd. 9-Thiomaytansinoids and their pharmaceutical compositions and use
US4450254A (en) 1980-11-03 1984-05-22 Standard Oil Company Impact improvement of high nitrile resins
GB2188638A (en) 1986-03-27 1987-10-07 Gregory Paul Winter Chimeric antibodies
WO1992001047A1 (en) 1990-07-10 1992-01-23 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US5475092A (en) 1992-03-25 1995-12-12 Immunogen Inc. Cell binding agent conjugates of analogues and derivatives of CC-1065
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5552293A (en) 1991-07-03 1996-09-03 Pharmacia Aktiebolag Tumor antigen specific antibody
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
US5639641A (en) 1992-09-09 1997-06-17 Immunogen Inc. Resurfacing of rodent antibodies
US5665357A (en) 1993-12-03 1997-09-09 Zeneca Limited Antibodies recognizing tumor associated antigen CA 55.1
US5714352A (en) 1996-03-20 1998-02-03 Xenotech Incorporated Directed switch-mediated DNA recombination
WO1999006587A2 (en) 1997-08-01 1999-02-11 Morphosys Ag Novel method and phage for the identification of nucleic acid sequences encoding members of a multimeric (poly)peptide complex
US5885793A (en) 1991-12-02 1999-03-23 Medical Research Council Production of anti-self antibodies from antibody segment repertoires and displayed on phage
US5958872A (en) 1996-04-01 1999-09-28 Apoptosis Technology, Inc. Active survival domains of IGF-IR and methods of use
US6265150B1 (en) 1995-06-07 2001-07-24 Becton Dickinson & Company Phage antibodies
US6333410B1 (en) 2000-08-18 2001-12-25 Immunogen, Inc. Process for the preparation and purification of thiol-containing maytansinoids
WO2002016401A2 (en) 2000-08-18 2002-02-28 East Carolina University Monoclonal antibody ds6, tumor-associated antigen ca6, and methods of use thereof
US20020197266A1 (en) 2000-02-08 2002-12-26 Waldemar Debinski Immunotherapy using interleukin 13 receptor subunit alpha 2
US6596743B2 (en) 1999-04-20 2003-07-22 Hoffmann-La Roche Inc. Carbamic acid derivatives
US20060127407A1 (en) 2004-12-09 2006-06-15 Qiming Chen Anti-integrin immunoconjugates, methods and uses
US20070183971A1 (en) 2004-08-30 2007-08-09 Biotest Ag Immunoconjugates targeting syndecan-1 expressing cells and use thereof
US7342110B2 (en) 2002-11-07 2008-03-11 Immunogen Inc. Anti-CD33 antibodies and method for treatment of acute myeloid leukemia using the same
WO2008047242A2 (en) 2006-10-19 2008-04-24 Sanofi-Aventis Novel anti-cd38 antibodies for the treatment of cancer
US20080171040A1 (en) 2004-06-01 2008-07-17 Genentech, Inc. Antibody-drug conjugates and methods
US20080305044A1 (en) 2004-11-29 2008-12-11 Seattle Genetics, Inc. Engineered Antibodies and Immunoconjugates
US20090156790A1 (en) 2003-06-27 2009-06-18 Amgen Fremont Inc. Antibodies directed to the deletion mutants of epidermal growth factor receptor and uses thereof
US20100093980A1 (en) 2005-03-04 2010-04-15 Biogen Idec Ma Inc. Methods of Humanizing Immunoglobulin Variable Regions Through Rational Modification Of Complementarity Determining Residues
WO2010124797A1 (en) 2009-04-29 2010-11-04 Bayer Schering Pharma Aktiengesellschaft Anti-mesothelin immunoconjugates and uses therefor
WO2011039724A1 (en) 2009-10-02 2011-04-07 Sanofi-Aventis Antibodies that specifically bind to the epha2 receptor
WO2011039721A1 (en) 2009-10-02 2011-04-07 Sanofi-Aventis New maytansinoids and the use of said maytansinoids to prepare conjugates with an antibody
US7982024B2 (en) 2001-01-05 2011-07-19 Amgen Fremont Inc. Antibodies to insulin-like growth factor I receptor
WO2011106528A1 (en) 2010-02-24 2011-09-01 Immunogen, Inc. Folate receptor 1 antibodies and immunoconjugates and uses thereof
US20110256153A1 (en) 2010-03-12 2011-10-20 Jutta Deckert CD37-Binding Molecules and Immunoconjugates Thereof
WO2012019024A2 (en) 2010-08-04 2012-02-09 Immunogen, Inc. Her3-binding molecules and immunoconjugates thereof
WO2012112687A1 (en) * 2011-02-15 2012-08-23 Immunogen, Inc. Methods of preparation of conjugates
US20140030820A1 (en) 2011-01-10 2014-01-30 Technische Universitaet Muenchen Triazacyclononane-based phosphinate ligand and its use for molecular imaging
WO2014134483A2 (en) * 2013-02-28 2014-09-04 Immunogen, Inc. Conjugates comprising cell-binding agents and cytotoxic agents
WO2014160160A2 (en) * 2013-03-13 2014-10-02 Novartis Ag Antibody drug conjugates

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2607663C (en) * 2005-05-19 2014-08-12 Amgen Inc. Compositions and methods for increasing the stability of antibodies
ME03479B (me) * 2009-06-03 2020-01-20 Immunogen Inc Metodi konjugacije
US20120282282A1 (en) * 2011-04-04 2012-11-08 Immunogen, Inc. Methods for Decreasing Ocular Toxicity of Antibody Drug Conjugates
RU2018130108A (ru) * 2016-02-05 2020-03-06 Иммуноджен, Инк. Эффективный способ получения конъюгатов связывающийся с клеткой агент цитотоксический агент
JP7474195B2 (ja) * 2018-01-12 2024-04-24 イミュノジェン, インコーポレイテッド 抗体薬物のコンジュゲーション、精製、及び製剤のための方法

Patent Citations (66)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4307016A (en) 1978-03-24 1981-12-22 Takeda Chemical Industries, Ltd. Demethyl maytansinoids
US4361650A (en) 1978-03-24 1982-11-30 Takeda Chemical Industries, Ltd. Fermentation process of preparing demethyl maytansinoids
US4256746A (en) 1978-11-14 1981-03-17 Takeda Chemical Industries Dechloromaytansinoids, their pharmaceutical compositions and method of use
US4294757A (en) 1979-01-31 1981-10-13 Takeda Chemical Industries, Ltd 20-O-Acylmaytansinoids
US4322348A (en) 1979-06-05 1982-03-30 Takeda Chemical Industries, Ltd. Maytansinoids
US4331598A (en) 1979-09-19 1982-05-25 Takeda Chemical Industries, Ltd. Maytansinoids
US4364866A (en) 1979-09-21 1982-12-21 Takeda Chemical Industries, Ltd. Maytansinoids
US4362663A (en) 1979-09-21 1982-12-07 Takeda Chemical Industries, Ltd. Maytansinoid compound
US4371533A (en) 1980-10-08 1983-02-01 Takeda Chemical Industries, Ltd. 4,5-Deoxymaytansinoids, their use and pharmaceutical compositions thereof
US4450254A (en) 1980-11-03 1984-05-22 Standard Oil Company Impact improvement of high nitrile resins
US4315929A (en) 1981-01-27 1982-02-16 The United States Of America As Represented By The Secretary Of Agriculture Method of controlling the European corn borer with trewiasine
US4313946A (en) 1981-01-27 1982-02-02 The United States Of America As Represented By The Secretary Of Agriculture Chemotherapeutically active maytansinoids from Trewia nudiflora
US4424219A (en) 1981-05-20 1984-01-03 Takeda Chemical Industries, Ltd. 9-Thiomaytansinoids and their pharmaceutical compositions and use
GB2188638A (en) 1986-03-27 1987-10-07 Gregory Paul Winter Chimeric antibodies
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
EP0239400B1 (en) 1986-03-27 1994-08-03 Medical Research Council Recombinant antibodies and methods for their production
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
US5693762A (en) 1988-12-28 1997-12-02 Protein Design Labs, Inc. Humanized immunoglobulins
US5693761A (en) 1988-12-28 1997-12-02 Protein Design Labs, Inc. Polynucleotides encoding improved humanized immunoglobulins
WO1992001047A1 (en) 1990-07-10 1992-01-23 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
US5969108A (en) 1990-07-10 1999-10-19 Medical Research Council Methods for producing members of specific binding pairs
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5552293A (en) 1991-07-03 1996-09-03 Pharmacia Aktiebolag Tumor antigen specific antibody
US5885793A (en) 1991-12-02 1999-03-23 Medical Research Council Production of anti-self antibodies from antibody segment repertoires and displayed on phage
US5585499A (en) 1992-03-25 1996-12-17 Immunogen Inc. Cyclopropylbenzindole-containing cytotoxic drugs
US5475092A (en) 1992-03-25 1995-12-12 Immunogen Inc. Cell binding agent conjugates of analogues and derivatives of CC-1065
US5846545A (en) 1992-03-25 1998-12-08 Immunogen, Inc. Targeted delivery of cyclopropylbenzindole-containing cytotoxic drugs
US5639641A (en) 1992-09-09 1997-06-17 Immunogen Inc. Resurfacing of rodent antibodies
US5665357A (en) 1993-12-03 1997-09-09 Zeneca Limited Antibodies recognizing tumor associated antigen CA 55.1
US6265150B1 (en) 1995-06-07 2001-07-24 Becton Dickinson & Company Phage antibodies
US5714352A (en) 1996-03-20 1998-02-03 Xenotech Incorporated Directed switch-mediated DNA recombination
US5958872A (en) 1996-04-01 1999-09-28 Apoptosis Technology, Inc. Active survival domains of IGF-IR and methods of use
WO1999006587A2 (en) 1997-08-01 1999-02-11 Morphosys Ag Novel method and phage for the identification of nucleic acid sequences encoding members of a multimeric (poly)peptide complex
US6596743B2 (en) 1999-04-20 2003-07-22 Hoffmann-La Roche Inc. Carbamic acid derivatives
US20020197266A1 (en) 2000-02-08 2002-12-26 Waldemar Debinski Immunotherapy using interleukin 13 receptor subunit alpha 2
WO2002016401A2 (en) 2000-08-18 2002-02-28 East Carolina University Monoclonal antibody ds6, tumor-associated antigen ca6, and methods of use thereof
US6333410B1 (en) 2000-08-18 2001-12-25 Immunogen, Inc. Process for the preparation and purification of thiol-containing maytansinoids
US7982024B2 (en) 2001-01-05 2011-07-19 Amgen Fremont Inc. Antibodies to insulin-like growth factor I receptor
US7342110B2 (en) 2002-11-07 2008-03-11 Immunogen Inc. Anti-CD33 antibodies and method for treatment of acute myeloid leukemia using the same
US7557189B2 (en) 2002-11-07 2009-07-07 Immunogen Inc. Anti-CD33 antibodies and method for treatment of acute myeloid leukemia using the same
US7628986B2 (en) 2003-06-27 2009-12-08 Amgen Fremont Inc. Antibodies directed to the deletion mutants of epidermal growth factor receptor and uses thereof
US7736644B2 (en) 2003-06-27 2010-06-15 Amgen Fremont Inc. Antibodies directed to the deletion mutants of epidermal growth factor receptor and uses thereof
US20100111979A1 (en) 2003-06-27 2010-05-06 Amgen Fremont Inc. Antibodies directed to the deletion mutants of epidermal growth factor receptor and uses thereof
US20090156790A1 (en) 2003-06-27 2009-06-18 Amgen Fremont Inc. Antibodies directed to the deletion mutants of epidermal growth factor receptor and uses thereof
US20090155282A1 (en) 2003-06-27 2009-06-18 Amgen Fremont Inc. Antibodies directed to the deletion mutants of epidermal growth factor receptor and uses thereof
US20090175887A1 (en) 2003-06-27 2009-07-09 Amgen Fremont Inc. Antibodies directed to the deletion mutants of epidermal growth factor receptor and uses thereof
US20090240038A1 (en) 2003-06-27 2009-09-24 Amgen Fremont Inc. Antibodies directed to the deletion mutants of epidermal growth factor receptor and uses thereof
US20080171040A1 (en) 2004-06-01 2008-07-17 Genentech, Inc. Antibody-drug conjugates and methods
US20070183971A1 (en) 2004-08-30 2007-08-09 Biotest Ag Immunoconjugates targeting syndecan-1 expressing cells and use thereof
US20080305044A1 (en) 2004-11-29 2008-12-11 Seattle Genetics, Inc. Engineered Antibodies and Immunoconjugates
US20060127407A1 (en) 2004-12-09 2006-06-15 Qiming Chen Anti-integrin immunoconjugates, methods and uses
US20100093980A1 (en) 2005-03-04 2010-04-15 Biogen Idec Ma Inc. Methods of Humanizing Immunoglobulin Variable Regions Through Rational Modification Of Complementarity Determining Residues
WO2008047242A2 (en) 2006-10-19 2008-04-24 Sanofi-Aventis Novel anti-cd38 antibodies for the treatment of cancer
WO2010124797A1 (en) 2009-04-29 2010-11-04 Bayer Schering Pharma Aktiengesellschaft Anti-mesothelin immunoconjugates and uses therefor
WO2011039724A1 (en) 2009-10-02 2011-04-07 Sanofi-Aventis Antibodies that specifically bind to the epha2 receptor
WO2011039721A1 (en) 2009-10-02 2011-04-07 Sanofi-Aventis New maytansinoids and the use of said maytansinoids to prepare conjugates with an antibody
US20120009181A1 (en) 2010-02-24 2012-01-12 Ab Olga Folate Receptor 1 Antibodies and Immunoconjugates and Uses Thereof
WO2011106528A1 (en) 2010-02-24 2011-09-01 Immunogen, Inc. Folate receptor 1 antibodies and immunoconjugates and uses thereof
US20110256153A1 (en) 2010-03-12 2011-10-20 Jutta Deckert CD37-Binding Molecules and Immunoconjugates Thereof
WO2012019024A2 (en) 2010-08-04 2012-02-09 Immunogen, Inc. Her3-binding molecules and immunoconjugates thereof
US20140030820A1 (en) 2011-01-10 2014-01-30 Technische Universitaet Muenchen Triazacyclononane-based phosphinate ligand and its use for molecular imaging
WO2012112687A1 (en) * 2011-02-15 2012-08-23 Immunogen, Inc. Methods of preparation of conjugates
WO2014134483A2 (en) * 2013-02-28 2014-09-04 Immunogen, Inc. Conjugates comprising cell-binding agents and cytotoxic agents
WO2014160160A2 (en) * 2013-03-13 2014-10-02 Novartis Ag Antibody drug conjugates
US20140301946A1 (en) 2013-03-13 2014-10-09 Novartis Ag Antibody drug conjugates

Non-Patent Citations (31)

* Cited by examiner, † Cited by third party
Title
BURGESS, IMMUNOLOGY TODAY, vol. 5, 1984, pages 155 - 158
C. A. JANEWAY ET AL: "Immunobiology", 2001, GARLAND PUBLISHING
CARTER, NATURE REVS., vol. 6, 2006, pages 343 - 357
COLOMER ET AL., CANCER INVEST., vol. 19, 2001, pages 49 - 56
DESMYTER ET AL., NATURE STRUCT. BIOL., vol. 3, 1996, pages 752
GREENBERG ET AL., NATURE, vol. 374, 1995, pages 168
GRIFFIN ET AL., LEUKEMIA RES., vol. 8, 1984, pages 521
HARLOW AND LANE: "Antibodies: A Laboratory Manual", 1988, CSH PRESS
HASKARD; ARCHER, J. IMMUNOL. METHODS, vol. 74, no. 2, 1984, pages 361 - 367
HEIDER ET AL., EUR. J. CANCER, vol. 31A, 1995, pages 2385 - 2391
HUSE ET AL., SCIENCE, vol. 246, 1989, pages 1275 - 1281
KIM ET AL., MOL. CANCER THER., vol. 7, 2008, pages 2486 - 2497
KOHLER; MILSTEIN, EUR. J. IMMUNOL., vol. 5, 1976, pages 511 - 519
LIU ET, CANCER RES., vol. 57, 1997, pages 3629 - 3634
MALONEY ET AL., BLOOD, vol. 90, 1997, pages 2188 - 2195
NADLER ET AL., J. IMMUNOL., vol. 131, 1983, pages 244 - 250
NISONOFF ET AL., ARCH. BIOCHEM. BIOPHYS., vol. 89, 1960, pages 230 - 244
O'KEEFE ET AL., J. BIOL. CHEM., vol. 260, 1985, pages 932 - 937
PARHAM, J. IMMUNOL., vol. 131, 1983, pages 2895 - 2902
PEDERSEN ET AL., J. MOL. BIOL., vol. 235, 1994, pages 959 - 973
REITER ET AL., PROTEIN ENGINEERING, vol. 7, 1994, pages 697 - 704
RITZ ET AL., NATURE, vol. 283, 1980, pages 583 - 585
RODER ET AL., METHODS ENZYMOL., vol. 121, 1986, pages 140 - 167
ROGUSKA ET AL., PROC. NATL. ACAD. SCI. USA, vol. 91, 1994, pages 969 - 973
SAMBROOK ET AL: "Molecular Cloning, A Laboratory Manual", 2001, COLD SPRING HARBOR LABORATORY PRESS
SPRING ET AL., J. IMMUNOL., vol. 113, 1974, pages 470 - 478
STANFIELD ET AL., SCIENCE, vol. 305, 2004, pages 1770 - 1773
TAYLOR-PAPADIMITRIOU ET AL., INT. J. CANCER, vol. 28, 1981, pages 17 - 21
VAN H ET AL., CANCER RES., vol. 56, 1996, pages 5179 - 5185
VLASAK, J.; LONESCU, R.: "Fragmentation of monoclonal antibodies", MABS, vol. 3, no. 3, May 2011 (2011-05-01), pages 253 - 263
WELT ET AL., J. CLIN. ONCOL., vol. 12, 1994, pages 1193 - 1203

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11555019B2 (en) 2019-07-10 2023-01-17 Cybrexa 3, Inc. Peptide conjugates of microtubule-targeting agents as therapeutics
US11634508B2 (en) 2019-07-10 2023-04-25 Cybrexa 2, Inc. Peptide conjugates of cytotoxins as therapeutics
US12234212B2 (en) 2019-07-10 2025-02-25 Cybrexa 3, Inc. Peptide conjugates of microtubule-targeting agents as therapeutics
US12410262B2 (en) 2019-07-10 2025-09-09 Cybrexa 2, Inc. Peptide conjugates of cytotoxins as therapeutics

Also Published As

Publication number Publication date
US20170354742A1 (en) 2017-12-14
AU2015349985A1 (en) 2017-05-25
MA40934A (fr) 2017-09-27
RU2711930C2 (ru) 2020-01-23
SG11201703599VA (en) 2017-06-29
RU2017115812A3 (enExample) 2019-06-18
US20200101168A1 (en) 2020-04-02
KR20170088905A (ko) 2017-08-02
US10413615B2 (en) 2019-09-17
IL251900B (en) 2019-12-31
IL251900A0 (en) 2017-07-31
CN107592813A (zh) 2018-01-16
RU2017115812A (ru) 2018-12-19
EP3220959A1 (en) 2017-09-27
JP2018505128A (ja) 2018-02-22
CA2966932A1 (en) 2016-05-26

Similar Documents

Publication Publication Date Title
US11744900B2 (en) Preparation of maytansinoid antibody conjugates by a one-step process
WO2012135517A2 (en) Preparation of maytansinoid antibody conjugates by a one-step process
WO2013090590A1 (en) Use of n-hydroxysuccinimide to improve conjugate stability
WO2017136623A1 (en) Efficient process for preparing cell-binding agent-cytotoxic agent conjugates
US20200101168A1 (en) Process for preparing cell-binding agent-cytotoxic agent conjugates
NZ616509B2 (en) Preparation of maytansinoid antibody conjugates by a one-step process
HK1194700A (en) Preparation of maytansinoid antibody conjugates by a one-step process
HK1194700B (en) Preparation of maytansinoid antibody conjugates by a one-step process

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15802310

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 251900

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2966932

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 11201703599V

Country of ref document: SG

ENP Entry into the national phase

Ref document number: 2017525940

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 15527525

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2015349985

Country of ref document: AU

Date of ref document: 20151118

Kind code of ref document: A

REEP Request for entry into the european phase

Ref document number: 2015802310

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2017115812

Country of ref document: RU

Kind code of ref document: A

Ref document number: 20177016749

Country of ref document: KR

Kind code of ref document: A