WO2016079143A1 - Inhibitor der viralen hepatitis c infektion - Google Patents

Inhibitor der viralen hepatitis c infektion Download PDF

Info

Publication number
WO2016079143A1
WO2016079143A1 PCT/EP2015/076866 EP2015076866W WO2016079143A1 WO 2016079143 A1 WO2016079143 A1 WO 2016079143A1 EP 2015076866 W EP2015076866 W EP 2015076866W WO 2016079143 A1 WO2016079143 A1 WO 2016079143A1
Authority
WO
WIPO (PCT)
Prior art keywords
val
lys
glu
polypeptide
leu
Prior art date
Application number
PCT/EP2015/076866
Other languages
English (en)
French (fr)
Inventor
Wolf-Georg Forssmann
Original Assignee
Pharis Biotec Gmbh
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Pharis Biotec Gmbh filed Critical Pharis Biotec Gmbh
Publication of WO2016079143A1 publication Critical patent/WO2016079143A1/de

Links

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/38—Albumins
    • A61K38/385—Serum albumin
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A61P31/14—Antivirals for RNA viruses
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • C07K14/08—RNA viruses
    • C07K14/18—Togaviridae; Flaviviridae
    • C07K14/1816—Flaviviridae, e.g. pestivirus, mucosal disease virus, bovine viral diarrhoea virus, classical swine fever virus (hog cholera virus), border disease virus
    • C07K14/1833—Hepatitis C; Hepatitis NANB
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/76—Albumins
    • C07K14/765—Serum albumin, e.g. HSA

Definitions

  • the present invention relates to a polypeptide for use as an inhibitor of viral hepatitis C infection, polypeptides which can be used as medicaments for the treatment of associated diseases.
  • hepatitis C Despite enormous effort to get the infectious disease hepatitis C under control, it is still a world-wide problem-preparing disease, which goes hand in hand with high mortality but also serious long-term consequences that are likely to occur after a surviving infection.
  • liver cirrhosis or liver cancer should be mentioned.
  • US 2011/0142864 AI and US 2004/086521 AI disclose tumor-associated peptides that bind to the HLA-DR molecules.
  • UNIPROT: P02768 discloses human albumin fragments.
  • WO 2006/004362 A1 discloses epitopes for the development of therapeutics against HCV infections, including vaccines.
  • JP 06199894 discloses a polypeptide as a vaccine for the prevention and treatment of HCV infections.
  • WO 2009/004054 A1 discloses an albumin fragment 408-423 for the inhibition of HIV-1 and can be used for the treatment of hepatitis A and B.
  • HCV hepatitis C viruses
  • polypeptide for use in the prophylaxis or treatment and diagnosis of infections with hepatitis C virus wherein the polypeptide for use in the prophylaxis or treatment and diagnosis of infections with hepatitis C virus, wherein the polypeptide is the amino acid sequence
  • Z ⁇ VEVSRNLGKVZ 1 or consists thereof, in particular a polypeptide having an 80% sequence homology, preferably 90% sequence homology with the amino acid sequence of the polypeptide, wherein
  • Z 1 a sequence of up to 152 arbitrary amino acids or represents the C-terminal end of the polypeptide
  • Z 2 the N-terminal end of the polypeptide.
  • sequence homology is understood, in particular, to mean a polypeptide related to said sequence, in which exchanges or deletions of amino acids are carried out in the stated percentage range were.
  • substitutions of amino acids having similar properties are possible so-called conservative substitutions, for example similar polarities.
  • exchanges of arginine and lysine, glutamic acid and aspartic acid, glutamine, asparagine and threonine, glycine, alanine and proline, leucine, isoleucine and valine, tyrosine, phenylalanine and tryptophan as well as serine and threonine are widely used.
  • the polypeptide has one of the amino acid sequences SEQ ID No 1 to 30, in particular SEQ ID Nos 19, 20, 21.
  • the N-terminal end of the polypeptide is chemically modified, in particular acylated, in particular acetylated or alkylated.
  • the C-terminal end of the polypeptide is chemically modified, in particular amidated.
  • At least one amino acid of the polypeptide may be phosphorylated in the polypeptide, amidated acetylated, glycosylated, PEGylated, HESylated, alone or in combination.
  • the polypeptide can be used for the treatment of diseases associated with HCV disease, in particular of the cardiovascular, pulmonary, hepatic and renal systems, including pulmonary hypertension of cardio-renal syndrome as well as renal and hepatic fibrosis.
  • polypeptide is suitable.
  • the present invention also relates to a medicament comprising at least one of the polypeptides according to the invention, in particular at least one polypeptide having the amino acid sequence SEQ ID Nos. 1 to 30, in particular a polypeptide having the sequence SEQ ID Nos. 19, 20, 21.
  • the medicament of the invention may be in liposomes be encapsulated or for use with aqueous or liposomal packaging a polypeptide according to the invention, in particular with the amino acid sequence SEQ ID No 1 to 30, in particular der containing the polypeptide with the sequence SEQ ID No 19, 20 and / or 21 and / or at least one polypeptide with the said modifications.
  • FIG. Figure 1 shows the course of activity of fractions of a chromatography as normalized infectivity of HCV.
  • Fig. 2 shows an inhibitory effect of fractions of a chromatography in a later purification step.
  • Fig. 3 shows the effect from 300 micrograms per well
  • FIG. 1 The example of carrying out the assay in the screening of a chromatography run to identify the activation or inhibition of virus particles in liver cell cultures is shown in FIG. 1 shown.
  • the upper illustration of FIG. Figure 1 shows the cell counts obtained by counting per fraction of this measurement, proving that cell cultures without infection but with inoculation by the individual fractions are unaffected in their growth.
  • the lower diagram shows the section of the same cell cultures with treatment of controls and fractions 1-18 of infected cell cultures. It can be seen that in the region of fraction 6-10 there is a clear inhibition of cell growth, that is to say killing of the cells by viral infection.
  • the determination of the activity of the polypeptides was carried out by determining the infectivity of HCV after exposure to the polypeptides, starting from Bartenschlager R, et al. (2000). Replication of hepatitis C virus. J Gen Virol 81: 1631-1648, in the technical realization according to Frentzen A, et al. (2011), Completion of hepatitis C virus replication cycle in heterokaryons excitatory dominant restrictions in human non-liver and liver cell lines, PLoS Pathogens 7: el002029.
  • FIG. 2 shows an inhibitory effect of fractions of a chromatography in a later purification step; it is evident from fraction 37-41 a strong inhibition of viral infection in the cell cultures, i.
  • Fraction 37 - 41 were used to identify the virological activity parallel to the samples, namely identification of the amino acid sequences according to Edmann degradation, mass analysis by MS and Maldi-MS and comparison in the public genome-based databases (Swiss-Prot).
  • VEV sequences have a molecular weight of 6600 to 7000 Seq Id No 19: MW 6959.11; 62 AS
  • Resynthesized peptides of the invention exhibited an inhibition of activity above 300 micrograms per well in cell cultures infected with HCV ( Figure 3). These results demonstrate that the polypeptides of the invention possess the biological activity of an HCV inhibitor.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Virology (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Communicable Diseases (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Genetics & Genomics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Oncology (AREA)
  • Toxicology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Immunology (AREA)
  • Epidemiology (AREA)
  • Peptides Or Proteins (AREA)

Abstract

Polypeptid zur Verwendung in der Prophylaxe oder Behandlung von Infektionen mit Hepatitis C Virus, wobei das Polypeptid die Aminosäuresequenz: Z2 VEVSRNLGKV Z1 aufweist, insbesondere ein Polypeptid, das eine 80 % Sequenzhomologie, bevorzugt 90 % Sequenzhomologie mit der Aminosäuresequenz des Polypeptids aufweist, wobei Z1 = eine Folge von bis zu 152 beliebigen Aminosäuren ist oder das C-terminale Ende des Polypeptidsdarstellt; und Z2 = das N-terminale Ende des Polypeptids darstellt.

Description

Inhibitor der viralen Hepatitis C Infektion
Die vorliegende Erfindung betrifft ein Polypeptid zur Verwendung als Inhibitor der viralen Hepatitis C Infektion, Polypeptide, die als Arzneimittel zur Behandlung damit verbundener Erkrankungen verwendet werden können.
Trotz enormen Aufwandes die Infektionserkrankung Hepatitis C in den Griff zu bekommen, handelt es sich dabei immer noch um eine weltweit große Probleme bereitende Erkrankung, die mit hoher Mortalität aber auch gravierenden Spätfolgen, die nach einer überstandenen Infektion mit hoher Wahrscheinlichkeit eintreten werden, einhergeht. Zu nennen ist dabei insbesondere die Leberzirrhose oder Leberkrebs. US 2011/0142864 AI sowie US 2004/086521 AI offenbaren tumor-assozierte Peptide, die die an HLA-DR Moleküle binden. UNIPROT: P02768 offenbart humane Albuminfragmente. WO 2006/004362 AI offenbart Epitope zur Entwicklung von Therapeutika gegen HCV Infektionen, unter anderem Vakzine. JP 06199894 offenbart ein Polypeptid als Vakzine zur Prävention und Behandlung von HCV-Infektionen . WO 2009/004054 AI offenbart ein Albumin Fragment 408-423 zur Inhibierung von HIV-1 und kann zur Behandlung von Hepatitis A und B eingesetzt werden.
Eine der Erfindung zu Grunde liegende Aufgabe besteht mithin darin Substanzen bereitzustellen, die bei einer Infektion mit Hepatitis C Viren (HCV) als Inhibitoren der Infektion zu wirken in der Lage sind.
Gelöst wird diese Aufgabe, durch ein Polypeptid zur Verwendung in der Prophylaxe oder Behandlung und Diagnostik von Infektionen mit Hepatitis C Virus, wobei das Polypeptid zur Verwendung in der Prophylaxe oder Behandlung und Diagnostik von Infektionen mit Hepatitis C Virus, wobei das Polypeptid die Aminosäuresequenz
Z^VEVSRNLGKV- Z 1 aufweist oder daraus besteht, insbesondere ein Polypeptid, das eine 80 % Sequenzhomologie, bevorzugt 90 % Sequenzhomologie mit der Aminosäuresequenz des Polypeptids aufweist, wobei
Z1 = eine Folge von bis zu 152 beliebigen Aminosäuren ist oder das C-terminale Ende des Polypeptids darstellt; und
Z2 = das N-terminale Ende des Polypeptids darstellt.
Unter dem Begriff Sequenzhomologie wird erfindungsgemäß insbesondere ein mit der genannten Sequenz verwandtes Polypeptid verstanden, bei denen im genannten prozentualen Umfang Austausche oder Deletionen von Aminosäuren vorgenommen wurden. Insbesondere sind Austausche von Aminosäuren, die ähnliche Eigenschaften haben, sogenannte konservative Austausche, beispielsweise ähnliche Polaritäten, möglich. So sind Austausche von Arginin und Lysin, Glutaminsäure und Asparagin- säure, Glutamin, Asparagin und Threonin, Glycin, Alanin und Prolin, Leucin, Isoleucin und Valin, Thyrosin, Phenylalanin und Tryptophan sowie Serin und Threonin weit verbreitet.
In einer Ausführungsform der Erfindung hat das Polypeptid eine der Aminosäuresequenzen SEQ ID No 1 bis 30, insbesondere SEQ ID Nos 19, 20, 21.
In einer anderen Ausführungsform der Erfindung ist im Polypeptid das N-terminale Ende des Polypeptids chemisch modifiziert, insbesondere acyliert, insbesondere acetyliert oder alkyliert.
In noch einer anderen Ausführungsform der Erfindung ist im Polypeptid das C- terminale Ende des Polypeptids chemisch modifiziert, insbesondere amidiert.
In einer weiteren Ausführungsform kann im Polypeptid mindestens eine Aminosäure des Polypeptids phosphoryliert, amidiert acetyliert, glycosyliert, PEGyliert, HESyliert sein, einzeln oder in Kombination.
Erfindungsgemäß kann das Polypeptid zur Behandlung von Erkrankungen, die im Zusammenhang mit einer HCV-Erkrankung stehen, insbesondere des kardiovaskulären, pulmonalen, hepatischen und renalen Systeme, inklusive der pulmonalen Hy- pertonie des kardio-renalen Syndroms sowie der renalen und hepatischen Fibrose verwendet werden.
Auch zur Verwendung in der Diagnostik von Erkrankungen der kardiovaskulären, pulmonalen, hepatischen und renalen Systeme inklusive der pulmonalen Hypertonie des kardio-renalen Syndroms sowie der renalen und hepatischen Fibrose ist das Polypeptid geeignet.
Gegenstand der vorliegenden Erfindung ist auch ein Arzneimittel enthaltend mindestens eines der erfindungsgemäßen Polypeptide, insbesondere mindestens ein Polypeptid mit der Aminosäuresequenz SEQ ID No 1 bis 30, insbesondere ein Polypeptid mit der Sequenz SEQ ID No 19, 20, 21. Das erfindungsgemäße Arzneimittel kann in Liposomen verkapselt sein oder für eine Anwendung mit wässrigen oder liposomalen Verpackungen ein Polypeptid gemäß der Erfindung, insbesondere mit der Aminosäuresequenz SEQ ID No 1 bis 30, insbeson- dere das Polypeptid mit der Sequenz SEQ ID No 19, 20 und/oder 21 und/oder mindestens ein Polypeptid mit den genannten Modifikationen enthalten.
Fig . 1 zeigt den Aktivitätsverlauf von Fraktionen einer Chromatographie als normalisierte Infektiosität von HCV.
Fig. 2 zeigt eine Inhibitionswirkung von Fraktionen einer Chromatographie in einer späteren Aufreinigungsstufe.
Fig. 3 zeigt die Wirkung ab 300 Mikrogramm pro Well
Das Beispiel der Durchführung des Assays beim Screening eines Chromatographie- Laufes zur Identifizierung der Aktivierung oder Inhibierung von Viruspartikeln in Le- berzellkulturen wird in Fig . 1 gezeigt. Die obere Darstellung der Fig . 1 zeigt die Zellzahlen, die durch eine Zählung pro Fraktion diese Messung erhalten wurden, was beweist, dass die Zellkulturen ohne Infektion, aber mit Impfung durch die einzelnen Fraktionen in ihrem Wachstum nicht beeinflusst werden.
Die untere Darstellung zeigt den Ausschnitt der gleichen Zellkulturen mit Behand- lung der Kontrollen und den Fraktionen 1 - 18 von infizierten Zellkulturen. Man erkennt, dass im Bereich von Fraktion 6 - 10 eine deutliche Hemmung des Zellwachstums, also Abtötung der Zellen durch Virusinfektion stattfindet. Die Bestimmung der Aktivität der Polypeptide erfolgte durch Ermittlung der Infektiosität von HCV nach Einwirkung der Polypeptide, ausgehend von Bartenschlager R, et al. (2000). Replica- tion of hepatitis C virus. J Gen Virol 81 : 1631-1648, in der technischen Verwirklichung gemäß Frentzen A, et al. (2011), Completion of Hepatitis C virus replication cycle in heterokaryons exciudes dominant restrictions in human non-liver and mouse liver cell lines, PLoS Pathogens 7 : el002029.
Fig . 2 zeigt eine Inhibitionswirkung von Fraktionen einer Chromatographie in einer späteren Aufreinigungsstufe, man erkennt von Fraktion 37 - 41 eine starke Inhibition der Virusinfektion in den Zellkulturen, d .h. in Fraktion 37 - 41 wurde jeweils die virologische Aktivität parallel zu den Proben identifiziert, nämlich mit Feststellung der Aminosäurensequenzen nach Edmann-Abbau, Massenanalyse durch MS und Maldi-MS sowie dem Abgleich in den öffentlichen auf genombasierten Datenbanken (Swiss-Prot).
Die häufigste VEV Sequenzen haben ein Molekulargewicht von 6600 bis 7000 Seq Id No 19 : MW 6959,11; 62 AS
VEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKC CTESLVNRR Seq Id No 20 : MW 6802,93; 61 AS
VEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNR Seq Id No 21 : MW 6646,74; 60 AS
VEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVN) und besteht aus 60, 61 und 62 Aminosäurenresten.
Resynthetisierte erfindungsgemäße Peptide vom zeigen in Zellkulturen, die mit HCV infiziert sind, eine Inhibition der Aktivität ab 300 Mikrogramm pro Well (Fig . 3). Diese Ergebnisse belegen, dass die erfindungsgemäßen Polypeptide die biologische Aktivität eines HCV-Inhibitors besitzen.
Liste der Sequenzen
1
Val Glu Val Ser Arg Asn Leu Gly Lys Val Gly Ser Lys Cys Cys Lys His Pro Glu Ala Lys Arg
2
Val Glu Val Ser Arg Asn Leu Gly Lys Val Gly Ser Lys Cys Cys Lys His Pro Glu Ala Lys Arg
Met Pro Cys Ala Glu Asp Tyr Leu Ser Val Val Leu Asn Gin Leu Cys Val Leu His Glu Lys Thr
Pro Val Ser Asp Arg Val Thr Lys Cys Cys Thr Glu Ser Leu Val Asn Arg Arg Pro Cys Phe Ser
Ala Leu Glu Val Asp Glu Thr Tyr Val Pro Lys Glu Phe Asn Ala Glu Thr Phe Thr Phe His Ala
Asp Ile Cys Thr Leu Ser Glu Lys Glu Arg Gin Ile Lys Lys Gin Thr Ala Leu Val Glu Leu Val
Lys His Lys Pro Lys Ala Thr Lys Glu Gin Leu Lys Ala Val Met Asp Asp Phe Ala Ala Phe Val
Glu Lys Cys Cys Lys Ala Asp Asp Lys Glu Thr Cys Phe Ala Glu Glu Gly Lys Lys Leu Val Ala
Ala Ser Gin Ala Ala Leu Gly Leu
3
Val Glu Val Ser Arg Asn Leu Gly Lys Val
4
Val Glu Val Ser Arg Asn Leu Gly Lys Val Gly Ser Lys Cys Cys Lys His Pro Glu Ala Lys Arg
Met Pro Cys Ala Glu Asp Tyr Leu Ser Val Val Leu Asn Gin Leu Cys Val Leu His Glu Lys Thr
Pro Val Ser Asp Arg Val Thr Lys Cys Cys Thr Glu Ser Leu Val Asn Arg Arg Pro Cys Phe Ser
Ala Leu Glu Val Asp Glu Thr Tyr Val Pro Lys Glu Phe Asn Ala Glu Thr Phe Thr Phe His Ala
Asp Ile Cys Thr Leu Ser Glu Lys Glu Arg Gin Ile Lys Lys Gin Thr Ala Leu Val Glu Leu Val
Lys His Lys Pro Lys Ala Thr Lys Glu Gin Leu Lys Ala Val Met Asp Asp Phe Ala Ala Phe Val
Glu Lys Cys Cys Lys Ala Asp Asp Lys Glu Thr Cys Phe Ala Glu Glu Gly Lys Lys
5
Val Glu Val Ser Arg Asn Leu Gly Lys Val Gly Ser Lys Cys Cys Lys His Pro Glu Ala Lys Arg
Met Pro Cys Ala Glu Asp Tyr Leu Ser Val Val Leu Asn Gin Leu Cys Val Leu His Glu Lys Thr
Pro Val Ser Asp Arg Val Thr Lys Cys Cys Thr Glu Ser Leu Val Asn Arg Arg Pro Cys Phe Ser
Ala Leu Glu Val Asp Glu Thr Tyr Val Pro Lys Glu Phe Asn Ala Glu Thr Phe Thr Phe His Ala
Asp Ile Cys Thr Leu Ser Glu Lys Glu Arg Gin Ile Lys Lys Gin Thr Ala Leu Val Glu Leu Val
Lys His Lys Pro Lys Ala Thr Lys Glu Gin Leu Lys Ala Val Met Asp Asp Phe Ala Ala Phe Val
Glu Lys Cys Cys Lys Ala Asp Asp Lys Glu Thr Cys Phe Ala Glu Glu Gly Lys
6
Val Glu Val Ser Arg Asn Leu Gly Lys Val Gly Ser Lys Cys Cys Lys His Pro Glu Ala Lys Arg
Met Pro Cys Ala Glu Asp Tyr Leu Ser Val Val Leu Asn Gin Leu Cys Val Leu His Glu Lys Thr
Pro Val Ser Asp Arg Val Thr Lys Cys Cys Thr Glu Ser Leu Val Asn Arg Arg Pro Cys Phe Ser
Ala Leu Glu Val Asp Glu Thr Tyr Val Pro Lys Glu Phe Asn Ala Glu Thr Phe Thr Phe His Ala
Asp Ile Cys Thr Leu Ser Glu Lys Glu Arg Gin Ile Lys Lys Gin Thr Ala Leu Val Glu Leu Val
Lys His Lys Pro Lys Ala Thr Lys Glu Gin Leu Lys Ala Val Met Asp Asp Phe Ala Ala Phe Val
Glu Lys Cys Cys Lys Ala Asp Asp Lys
7
Val Glu Val Ser Arg Asn Leu Gly Lys Val Gly Ser Lys Cys Cys Lys His Pro Glu Ala Lys Arg
Met Pro Cys Ala Glu Asp Tyr Leu Ser Val Val Leu Asn Gin Leu Cys Val Leu His Glu Lys Thr
Pro Val Ser Asp Arg Val Thr Lys Cys Cys Thr Glu Ser Leu Val Asn Arg Arg Pro Cys Phe Ser
Ala Leu Glu Val Asp Glu Thr Tyr Val Pro Lys Glu Phe Asn Ala Glu Thr Phe Thr Phe His Ala
Asp Ile Cys Thr Leu Ser Glu Lys Glu Arg Gin Ile Lys Lys Gin Thr Ala Leu Val Glu Leu Val
Lys His Lys Pro Lys Ala Thr Lys Glu Gin Leu Lys Ala Val Met Asp Asp Phe Ala Ala Phe Val
Glu Lys Cys Cys Lys
8
Val Glu Val Ser Arg Asn Leu Gly Lys Val Gly Ser Lys Cys Cys Lys His Pro Glu Ala Lys Arg
Met Pro Cys Ala Glu Asp Tyr Leu Ser Val Val Leu Asn Gin Leu Cys Val Leu His Glu Lys Thr
Pro Val Ser Asp Arg Val Thr Lys Cys Cys Thr Glu Ser Leu Val Asn Arg Arg Pro Cys Phe Ser
Ala Leu Glu Val Asp Glu Thr Tyr Val Pro Lys Glu Phe Asn Ala Glu Thr Phe Thr Phe His Ala
Asp Ile Cys Thr Leu Ser Glu Lys Glu Arg Gin Ile Lys Lys Gin Thr Ala Leu Val Glu Leu Val
Lys His Lys Pro Lys Ala Thr Lys Glu Gin Leu Lys Ala Val Met Asp Asp Phe Ala Ala Phe Val
Glu Lys
9
Val Glu Val Ser Arg Asn Leu Gly Lys Val Gly Ser Lys Cys Cys Lys His Pro Glu Ala Lys Arg
Met Pro Cys Ala Glu Asp Tyr Leu Ser Val Val Leu Asn Gin Leu Cys Val Leu His Glu Lys Thr
Pro Val Ser Asp Arg Val Thr Lys Cys Cys Thr Glu Ser Leu Val Asn Arg Arg Pro Cys Phe Ser
Ala Leu Glu Val Asp Glu Thr Tyr Val Pro Lys Glu Phe Asn Ala Glu Thr Phe Thr Phe His Ala Asp Ile Cys Thr Leu Ser Glu Lys Glu Arg Gin Ile Lys Lys Gin Thr Ala Leu Val Glu Leu Val Lys His Lys Pro Lys Ala Thr Lys Glu Gin Leu Lys
10
Val Glu Val Ser Arg Asn Leu Gly Lys Val Gly Ser Lys Cys Cys Lys His Pro Glu Ala Lys Arg
Met Pro Cys Ala Glu Asp Tyr Leu Ser Val Val Leu Asn Gin Leu Cys Val Leu His Glu Lys Thr
Pro Val Ser Asp Arg Val Thr Lys Cys Cys Thr Glu Ser Leu Val Asn Arg Arg Pro Cys Phe Ser
Ala Leu Glu Val Asp Glu Thr Tyr Val Pro Lys Glu Phe Asn Ala Glu Thr Phe Thr Phe His Ala
Asp Ile Cys Thr Leu Ser Glu Lys Glu Arg Gin Ile Lys Lys Gin Thr Ala Leu Val Glu Leu Val
Lys His Lys Pro Lys Ala Thr Lys
11
Val Glu Val Ser Arg Asn Leu Gly Lys Val Gly Ser Lys Cys Cys Lys His Pro Glu Ala Lys Arg
Met Pro Cys Ala Glu Asp Tyr Leu Ser Val Val Leu Asn Gin Leu Cys Val Leu His Glu Lys Thr
Pro Val Ser Asp Arg Val Thr Lys Cys Cys Thr Glu Ser Leu Val Asn Arg Arg Pro Cys Phe Ser
Ala Leu Glu Val Asp Glu Thr Tyr Val Pro Lys Glu Phe Asn Ala Glu Thr Phe Thr Phe His Ala
Asp Ile Cys Thr Leu Ser Glu Lys Glu Arg Gin Ile Lys Lys Gin Thr Ala Leu Val Glu Leu Val
Lys His Lys Pro Lys
12
Val Glu Val Ser Arg Asn Leu Gly Lys Val Gly Ser Lys Cys Cys Lys His Pro Glu Ala Lys Arg
Met Pro Cys Ala Glu Asp Tyr Leu Ser Val Val Leu Asn Gin Leu Cys Val Leu His Glu Lys Thr
Pro Val Ser Asp Arg Val Thr Lys Cys Cys Thr Glu Ser Leu Val Asn Arg Arg Pro Cys Phe Ser
Ala Leu Glu Val Asp Glu Thr Tyr Val Pro Lys Glu Phe Asn Ala Glu Thr Phe Thr Phe His Ala
Asp Ile Cys Thr Leu Ser Glu Lys Glu Arg Gin Ile Lys Lys Gin Thr Ala Leu Val Glu Leu Val
Lys His Lys
13
Val Glu Val Ser Arg Asn Leu Gly Lys Val Gly Ser Lys Cys Cys Lys His Pro Glu Ala Lys Arg
Met Pro Cys Ala Glu Asp Tyr Leu Ser Val Val Leu Asn Gin Leu Cys Val Leu His Glu Lys Thr
Pro Val Ser Asp Arg Val Thr Lys Cys Cys Thr Glu Ser Leu Val Asn Arg Arg Pro Cys Phe Ser
Ala Leu Glu Val Asp Glu Thr Tyr Val Pro Lys Glu Phe Asn Ala Glu Thr Phe Thr Phe His Ala
Asp Ile Cys Thr Leu Ser Glu Lys Glu Arg Gin Ile Lys Lys Gin Thr Ala Leu Val Glu Leu Val
Lys
14
Val Glu Val Ser Arg Asn Leu Gly Lys Val Gly Ser Lys Cys Cys Lys His Pro Glu Ala Lys Arg
Met Pro Cys Ala Glu Asp Tyr Leu Ser Val Val Leu Asn Gin Leu Cys Val Leu His Glu Lys Thr
Pro Val Ser Asp Arg Val Thr Lys Cys Cys Thr Glu Ser Leu Val Asn Arg Arg Pro Cys Phe Ser
Ala Leu Glu Val Asp Glu Thr Tyr Val Pro Lys Glu Phe Asn Ala Glu Thr Phe Thr Phe His Ala
Asp Ile Cys Thr Leu Ser Glu Lys Glu Arg Gin Ile Lys Lys
15
Val Glu Val Ser Arg Asn Leu Gly Lys Val Gly Ser Lys Cys Cys Lys His Pro Glu Ala Lys Arg
Met Pro Cys Ala Glu Asp Tyr Leu Ser Val Val Leu Asn Gin Leu Cys Val Leu His Glu Lys Thr
Pro Val Ser Asp Arg Val Thr Lys Cys Cys Thr Glu Ser Leu Val Asn Arg Arg Pro Cys Phe Ser
Ala Leu Glu Val Asp Glu Thr Tyr Val Pro Lys Glu Phe Asn Ala Glu Thr Phe Thr Phe His Ala
Asp Ile Cys Thr Leu Ser Glu Lys Glu Arg Gin Ile Lys
16
Val Glu Val Ser Arg Asn Leu Gly Lys Val Gly Ser Lys Cys Cys Lys His Pro Glu Ala Lys Arg
Met Pro Cys Ala Glu Asp Tyr Leu Ser Val Val Leu Asn Gin Leu Cys Val Leu His Glu Lys Thr
Pro Val Ser Asp Arg Val Thr Lys Cys Cys Thr Glu Ser Leu Val Asn Arg Arg Pro Cys Phe Ser
Ala Leu Glu Val Asp Glu Thr Tyr Val Pro Lys Glu Phe Asn Ala Glu Thr Phe Thr Phe His Ala
Asp Ile Cys Thr Leu Ser Glu Lys Glu Arg
17
Val Glu Val Ser Arg Asn Leu Gly Lys Val Gly Ser Lys Cys Cys Lys His Pro Glu Ala Lys Arg
Met Pro Cys Ala Glu Asp Tyr Leu Ser Val Val Leu Asn Gin Leu Cys Val Leu His Glu Lys Thr
Pro Val Ser Asp Arg Val Thr Lys Cys Cys Thr Glu Ser Leu Val Asn Arg Arg Pro Cys Phe Ser
Ala Leu Glu Val Asp Glu Thr Tyr Val Pro Lys Glu Phe Asn Ala Glu Thr Phe Thr Phe His Ala
Asp Ile Cys Thr Leu Ser Glu Lys
18
Val Glu Val Ser Arg Asn Leu Gly Lys Val Gly Ser Lys Cys Cys Lys His Pro Glu Ala Lys Arg
Met Pro Cys Ala Glu Asp Tyr Leu Ser Val Val Leu Asn Gin Leu Cys Val Leu His Glu Lys Thr
Pro Val Ser Asp Arg Val Thr Lys Cys Cys Thr Glu Ser Leu Val Asn Arg Arg Pro Cys Phe Ser
Ala Leu Glu Val Asp Glu Thr Tyr Val Pro Lys 19
Val Glu Val Ser Arg
Met Pro Cys Ala Glu
Pro Val Ser Asp Arg
20
Val Glu Val Ser Arg
Met Pro Cys Ala Glu
Pro Val Ser Asp Arg
21
Val Glu Val Ser Arg
Met Pro Cys Ala Glu
Pro Val Ser Asp Arg
22
Val Glu Val Ser Arg
Met Pro Cys Ala Glu
Pro Val Ser Asp Arg
23
Val Glu Val Ser Arg
Met Pro Cys Ala Glu
Pro Val Ser Asp Arg
24
Val Glu Val Ser Arg
Met Pro Cys Ala Glu
25
Val Glu Val Ser Arg
Met Pro Cys Ala Glu
26
Val GGlluu VVaall SSeerr AArrgg Asn Leu Gly Lys Val Gly Ser Lys Cys Cys Lys His Pro Glu Ala Lys
27
Val GGlluu VVaall SSeerr AArrgg Asn Leu Gly Lys Val Gly Ser Lys Cys Cys Lys His Pro Glu Ala
28
Val Glu Val Ser Arg
29
Val Glu Val Ser Arg
30
Val Glu Val Ser Arg Asn Leu Gly Lys Val Gly

Claims

Patentansprüche
Polypeptid zur Verwendung in der Prophylaxe oder Behandlung von Infektionen mit Hepatitis C Virus, wobei das Polypeptid die Aminosäuresequenz
Z 2 - VE VSRNLGKV- Z 1 aufweist, insbesondere ein Polypeptid, das eine 80 % Sequenzhomologie, bevorzugt 90 % Sequenzhomologie mit der Aminosäuresequenz des Polypeptids aufweist, wobei
Z1 = eine Folge von bis zu 152 beliebigen Aminosäuren ist oder das C- terminale Ende des Polypeptids darstellt; und
Z2 = das N-terminale Ende des Polypeptids darstellt.
Polypeptid nach Anspruch 1 zur Verwendung gemäß Anspruch 1; wobei Z1 eine Folge von bis zu 60, insbesondere 40, insbesondere 20 oder 12 beliebigen Aminosäuren ist.
Polypeptid nach Anspruch 1 zur Verwendung gemäß Anspruch 1 oder 2 mit einer der Aminosäuresequenzen SEQ ID No 1 bis 30, insbesondere SEQ ID Nos 19, 20, 21.
Polypeptid nach Anspruch 1 bis 3 zur Verwendung gemäß Anspruch 1, wobei das N-terminale Ende des Polypeptids chemisch modifiziert, insbesondere acyliert oder alkyliert ist.
Polypeptid nach Anspruch 1 bis 4 zur Verwendung gemäß Anspruch 1, wobei das C-terminale Ende des Polypeptids chemisch modifiziert, insbesondere amidiert ist.
Polypeptid nach Anspruch 1 bis 5 zur Verwendung gemäß Anspruch 1, wobei mindestens eine Aminosäure des Polypeptids phosphoryliert, amidiert acetyliert, glycosyliert, PEGyliert, HESyliert ist oder Kombinationen davon aufweist.
Polypeptid nach Anspruch 1 bis 6 zur Verwendung in der Behandlung von Erkrankungen der kardiovaskulären, pulmonalen, hepatischen und renalen Systeme inklusive der pulmonalen Hypertonie des kardio-renalen Syndroms sowie der renalen und hepatischen Fibrose.
Polypeptid nach Anspruch 1 bis 7 zur Verwendung in der Diagnostik von Erkrankungen der kardiovaskulären, pulmonalen, hepatischen und renalen Sys- teme inklusive der pulmonalen Hypertonie des kardio-renalen Syndroms sowie der renalen und hepatischen Fibrose.
9. Polypeptid mit einer Aminosäuresequenz
Z 2 - VE VSRNLGKV- Z 1 insbesondere ein Polypeptid, das eine 80 % Sequenzhomologie, bevorzugt
90 % Sequenzhomologie mit der Aminosäuresequenz des Polypeptids aufweist, wobei
Z1 = eine Folge von bis zu 152 beliebigen Aminosäuren ist oder das C- terminale Ende des Polypeptids darstellt; und
Z2 = das N-terminale Ende des Polypeptids darstellt.
10. Polypeptid nach Anspruch 9, wobei Z1 eine Folge von bis zu 60, insbesondere 40, insbesondere 20 oder 12 beliebigen Aminosäuren ist.
11. Polypeptid nach Anspruch 9 oder 10 mit der Aminosäuresequenz SEQ ID No 1 bis 30, insbesondere SEQ ID No 19, 20, 21.
12. Polypeptid nach einem der Ansprüche 9 bis 11, wobei das N-terminale Ende des Polypeptids chemisch modifiziert, insbesondere acyliert oder alkyliert ist.
13. Polypeptid nach einem der Ansprüche 9 bis 12, wobei das C-terminale Ende des Polypeptids chemisch modifiziert, insbesondere amidiert ist.
14. Polypeptid nach einem der Ansprüche 9 bis 12, wobei mindestens eine Amino- säure des Polypeptids phosphoryliert, amidiert acetyliert, glycosyliert,
PEGyliert, HESyliert ist oder Kombinationen davon aufweist.
PCT/EP2015/076866 2014-11-17 2015-11-17 Inhibitor der viralen hepatitis c infektion WO2016079143A1 (de)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP14193438.0 2014-11-17
EP14193438 2014-11-17

Publications (1)

Publication Number Publication Date
WO2016079143A1 true WO2016079143A1 (de) 2016-05-26

Family

ID=51947162

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2015/076866 WO2016079143A1 (de) 2014-11-17 2015-11-17 Inhibitor der viralen hepatitis c infektion

Country Status (1)

Country Link
WO (1) WO2016079143A1 (de)

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPH06199894A (ja) 1992-08-27 1994-07-19 Asahi Chem Ind Co Ltd Ｃ型肝炎ウイルスのコア蛋白質領域に存在するｔ細胞エピトープ
US20040086521A1 (en) 2002-10-02 2004-05-06 Harald Kropshofer Method for the identification of antigenic peptides
WO2006004362A1 (en) 2004-07-03 2006-01-12 Mogam Biotechnology Research Institute Supertype epitopes, oligonucleotides coding the same which induce effective ctl response against hcv and the use thereof
WO2009004054A2 (en) 2007-07-03 2009-01-08 Pharis Biotec Gmbh A cxc chemokine receptor 4 (cxcr4) antagonistic polypeptide
US20110142864A1 (en) 1970-02-11 2011-06-16 Immatics Biotechnologies Gmbh Tumor-associated Peptides Binding Promiscuously to Human Leukocyte Antigen (HLA) Class II Molecules

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20110142864A1 (en) 1970-02-11 2011-06-16 Immatics Biotechnologies Gmbh Tumor-associated Peptides Binding Promiscuously to Human Leukocyte Antigen (HLA) Class II Molecules
JPH06199894A (ja) 1992-08-27 1994-07-19 Asahi Chem Ind Co Ltd Ｃ型肝炎ウイルスのコア蛋白質領域に存在するｔ細胞エピトープ
US20040086521A1 (en) 2002-10-02 2004-05-06 Harald Kropshofer Method for the identification of antigenic peptides
WO2006004362A1 (en) 2004-07-03 2006-01-12 Mogam Biotechnology Research Institute Supertype epitopes, oligonucleotides coding the same which induce effective ctl response against hcv and the use thereof
WO2009004054A2 (en) 2007-07-03 2009-01-08 Pharis Biotec Gmbh A cxc chemokine receptor 4 (cxcr4) antagonistic polypeptide

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
DATABASE UniParc [online] EBI; 18 March 2013 (2013-03-18), ANONYMOUS: "UPI0000D4E3EB", XP002738726, retrieved from www.uniprot.org Database accession no. UPI0000D4E3EB *
DATABASE UniProt [online] 29 October 2014 (2014-10-29), "Human Serum Albumin Precursor", XP002738725, retrieved from EBI accession no. UNIPROT:P02768 Database accession no. P02768 *
FRENTZEN A ET AL.: "Completion of Hepatitis C virus replication cycle in heterokaryons excludes dominant restrictions in human non-liver and mouse liver cell lines", PLOS PATHOGENS, vol. 7, 2011
NEEDLEMAN S B ET AL: "A general method applicable to the search for similarities in the amino acid sequence of two proteins", JOURNAL OF MOLECULAR BIOLOGY, ACADEMIC PRESS, UNITED KINGDOM, vol. 48, no. 3, 28 March 1970 (1970-03-28), pages 443 - 453, XP024011703, ISSN: 0022-2836, [retrieved on 19700328], DOI: 10.1016/0022-2836(70)90057-4 *
VON BARTENSCHLAGER R ET AL.: "Replication of hepatitis C virus", J GEN VIROL, vol. 81, 2000, pages 1631 - 1648

Similar Documents

Publication Publication Date Title
Khong et al. Improved collagen extraction from jellyfish (Acromitus hardenbergi) with increased physical-induced solubilization processes
López-Abarrategui et al. Functional characterization of a synthetic hydrophilic antifungal peptide derived from the marine snail Cenchritis muricatus
Zeng et al. Scorpion venom peptides without disulfide bridges
Kim et al. Complete nucleotide sequence and organization of the mitochondrial genome of eri-silkworm, Samia cynthia ricini (Lepidoptera: Saturniidae)
Junkunlo et al. A novel lectin domain-containing protein (LvCTLD) associated with response of the whiteleg shrimp Penaeus (Litopenaeus) vannamei to yellow head virus (YHV)
CORZO et al. Characterization of unique amphipathic antimicrobial peptides from venom of the scorpion Pandinus imperator
US20220127306A1 (en) Peptide compounds to regulate the complement system
Gronemus et al. Potent inhibition of the classical pathway of complement by a novel C1q-binding peptide derived from the human astrovirus coat protein
Marani et al. Characterization and biological activities of ocellatin peptides from the skin secretion of the frog Leptodactylus pustulatus
RU2015110250A (ru) ВАРИАНТЫ FcγRIIB-СПЕЦИФИЧЕСКОЙ Fc-ОБЛАСТИ
Bloch Jr et al. 1H NMR structure of an antifungal γ‐thionin protein SIα1: Similarity to scorpion toxins
Touchard et al. Venom peptide repertoire of the European myrmicine ant Manica rubida: identification of insecticidal toxins
Seyedjavadi et al. Isolation, functional characterization, and biological properties of MCh‐AMP1, a novel antifungal peptide from Matricaria chamomilla L.
Doss et al. Hapivirins and diprovirins: novel θ-defensin analogs with potent activity against influenza A virus
HRP20110386T1 (hr) Sintetička sekvenca mecp2 za zamjensku proteinsku terapiju
Rajasekhar et al. Isolation and characterization of a novel antihyperglycemic protein from the fruits of Momordica cymbalaria
JPH0662677B2 (ja) アンギオゲニン活性を有する精製蛋白及びその製造方法
NZ731143A (en) A method of treatment
Yang et al. Structures and functions of crotoxin-like heterodimers and acidic phospholipases A2 from Gloydius intermedius venom: insights into the origin of neurotoxic-type rattlesnakes
EP1012287A1 (de) Synthetische polypeptide zur diagnose und therapie von prionerkrankungen
Ha et al. Isolation and structure determination of a paralytic peptide from the hemolymph of the silkworm, Bombyx mori
WO2016079143A1 (de) Inhibitor der viralen hepatitis c infektion
DE60112424T2 (de) Protonen-abhängiges na+-kanal hemmendes polypeptid
EP3412681B1 (de) Protransduzin b ein enhancer des gentransfers
DE60030587T2 (de) Mit bh4 fusionierte polypeptide

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15807820

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 15807820

Country of ref document: EP

Kind code of ref document: A1