WO2016040856A2 - Cysteine engineered antibodies and conjugates - Google Patents
Cysteine engineered antibodies and conjugates Download PDFInfo
- Publication number
- WO2016040856A2 WO2016040856A2 PCT/US2015/049771 US2015049771W WO2016040856A2 WO 2016040856 A2 WO2016040856 A2 WO 2016040856A2 US 2015049771 W US2015049771 W US 2015049771W WO 2016040856 A2 WO2016040856 A2 WO 2016040856A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- cysteine
- cysteine engineered
- amino acid
- acid sequence
- Prior art date
Links
- 235000018417 cysteine Nutrition 0.000 title claims abstract description 447
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 title claims abstract description 436
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 claims abstract description 424
- -1 free cysteine amino acid Chemical class 0.000 claims abstract description 106
- 235000001014 amino acid Nutrition 0.000 claims abstract description 53
- 125000000539 amino acid group Chemical group 0.000 claims abstract description 19
- 150000007523 nucleic acids Chemical group 0.000 claims abstract description 16
- 108091028043 Nucleic acid sequence Proteins 0.000 claims abstract description 8
- 230000035772 mutation Effects 0.000 claims description 189
- 239000003814 drug Substances 0.000 claims description 145
- 229940079593 drug Drugs 0.000 claims description 134
- 238000000034 method Methods 0.000 claims description 121
- 230000027455 binding Effects 0.000 claims description 110
- 239000000427 antigen Substances 0.000 claims description 92
- 108091007433 antigens Proteins 0.000 claims description 92
- 102000036639 antigens Human genes 0.000 claims description 92
- 229940049595 antibody-drug conjugate Drugs 0.000 claims description 91
- 239000000611 antibody drug conjugate Substances 0.000 claims description 89
- 108090000623 proteins and genes Proteins 0.000 claims description 87
- 125000005647 linker group Chemical group 0.000 claims description 76
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 claims description 65
- 102000004169 proteins and genes Human genes 0.000 claims description 62
- 150000001413 amino acids Chemical group 0.000 claims description 57
- 235000018102 proteins Nutrition 0.000 claims description 56
- 241000282414 Homo sapiens Species 0.000 claims description 42
- 229940024606 amino acid Drugs 0.000 claims description 41
- 102100033423 GDNF family receptor alpha-1 Human genes 0.000 claims description 36
- 101000579425 Homo sapiens Proto-oncogene tyrosine-protein kinase receptor Ret Proteins 0.000 claims description 32
- 102100026711 Metalloreductase STEAP2 Human genes 0.000 claims description 32
- 102100028286 Proto-oncogene tyrosine-protein kinase receptor Ret Human genes 0.000 claims description 32
- 239000003153 chemical reaction reagent Substances 0.000 claims description 31
- 101000628535 Homo sapiens Metalloreductase STEAP2 Proteins 0.000 claims description 28
- 102000005962 receptors Human genes 0.000 claims description 28
- 108020003175 receptors Proteins 0.000 claims description 28
- 101000997961 Homo sapiens GDNF family receptor alpha-1 Proteins 0.000 claims description 24
- 108060003951 Immunoglobulin Proteins 0.000 claims description 24
- 102100032780 Semaphorin-5B Human genes 0.000 claims description 24
- 102000018358 immunoglobulin Human genes 0.000 claims description 24
- 238000001514 detection method Methods 0.000 claims description 23
- 102100022430 Melanocyte protein PMEL Human genes 0.000 claims description 22
- YUOCYTRGANSSRY-UHFFFAOYSA-N pyrrolo[2,3-i][1,2]benzodiazepine Chemical compound C1=CN=NC2=C3C=CN=C3C=CC2=C1 YUOCYTRGANSSRY-UHFFFAOYSA-N 0.000 claims description 22
- 101000654679 Homo sapiens Semaphorin-5B Proteins 0.000 claims description 20
- 101000713169 Homo sapiens Solute carrier family 52, riboflavin transporter, member 2 Proteins 0.000 claims description 20
- 102100032129 Lymphocyte antigen 6K Human genes 0.000 claims description 20
- 102100036862 Solute carrier family 52, riboflavin transporter, member 2 Human genes 0.000 claims description 20
- 239000003446 ligand Substances 0.000 claims description 20
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 claims description 19
- 108010021625 Immunoglobulin Fragments Proteins 0.000 claims description 19
- 102000008394 Immunoglobulin Fragments Human genes 0.000 claims description 19
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 claims description 19
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical group N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 claims description 18
- 102100034845 KiSS-1 receptor Human genes 0.000 claims description 18
- 102100029690 Tumor necrosis factor receptor superfamily member 13C Human genes 0.000 claims description 18
- 102100038080 B-cell receptor CD22 Human genes 0.000 claims description 17
- 102100026094 C-type lectin domain family 12 member A Human genes 0.000 claims description 17
- 101000620359 Homo sapiens Melanocyte protein PMEL Proteins 0.000 claims description 17
- 101000623901 Homo sapiens Mucin-16 Proteins 0.000 claims description 17
- 102100023123 Mucin-16 Human genes 0.000 claims description 17
- 239000012070 reactive reagent Substances 0.000 claims description 17
- 108010023729 Complement 3d Receptors Proteins 0.000 claims description 16
- 101001065550 Homo sapiens Lymphocyte antigen 6K Proteins 0.000 claims description 16
- 101000853730 Homo sapiens RING finger and transmembrane domain-containing protein 2 Proteins 0.000 claims description 16
- 101000835745 Homo sapiens Teratocarcinoma-derived growth factor 1 Proteins 0.000 claims description 16
- 102100031036 Leucine-rich repeat-containing G-protein coupled receptor 5 Human genes 0.000 claims description 16
- 102100035928 RING finger and transmembrane domain-containing protein 2 Human genes 0.000 claims description 16
- 102100026404 Teratocarcinoma-derived growth factor 1 Human genes 0.000 claims description 16
- 102100039094 Tyrosinase Human genes 0.000 claims description 16
- 229930195731 calicheamicin Natural products 0.000 claims description 16
- 239000007850 fluorescent dye Substances 0.000 claims description 16
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 claims description 15
- 102100026159 Tomoregulin-1 Human genes 0.000 claims description 15
- HAXFWIACAGNFHA-UHFFFAOYSA-N aldrithiol Chemical compound C=1C=CC=NC=1SSC1=CC=CC=N1 HAXFWIACAGNFHA-UHFFFAOYSA-N 0.000 claims description 15
- 102000011412 Complement 3d Receptors Human genes 0.000 claims description 13
- 239000003242 anti bacterial agent Substances 0.000 claims description 13
- 229940088710 antibiotic agent Drugs 0.000 claims description 13
- 229930188854 dolastatin Natural products 0.000 claims description 13
- 102100025218 B-cell differentiation antigen CD72 Human genes 0.000 claims description 12
- 102100024220 CD180 antigen Human genes 0.000 claims description 12
- 108010001445 CD79 Antigens Proteins 0.000 claims description 12
- 102000000796 CD79 Antigens Human genes 0.000 claims description 12
- 102100031511 Fc receptor-like protein 2 Human genes 0.000 claims description 12
- 101000980829 Homo sapiens CD180 antigen Proteins 0.000 claims description 12
- 101001091205 Homo sapiens KiSS-1 receptor Proteins 0.000 claims description 12
- 101001063456 Homo sapiens Leucine-rich repeat-containing G-protein coupled receptor 5 Proteins 0.000 claims description 12
- 101000844504 Homo sapiens Transient receptor potential cation channel subfamily M member 4 Proteins 0.000 claims description 12
- 102100038210 Lymphocyte antigen 6 complex locus protein G6d Human genes 0.000 claims description 12
- 102100038437 Sodium-dependent phosphate transport protein 2B Human genes 0.000 claims description 12
- 229910052739 hydrogen Inorganic materials 0.000 claims description 12
- 150000003839 salts Chemical class 0.000 claims description 12
- 102100032768 Complement receptor type 2 Human genes 0.000 claims description 11
- 101000834937 Homo sapiens Tomoregulin-1 Proteins 0.000 claims description 11
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 claims description 11
- 102100027203 B-cell antigen receptor complex-associated protein beta chain Human genes 0.000 claims description 10
- 102100032131 Lymphocyte antigen 6E Human genes 0.000 claims description 10
- 230000008569 process Effects 0.000 claims description 10
- 125000004169 (C1-C6) alkyl group Chemical group 0.000 claims description 9
- 101710188619 C-type lectin domain family 12 member A Proteins 0.000 claims description 9
- 101000914491 Homo sapiens B-cell antigen receptor complex-associated protein beta chain Proteins 0.000 claims description 9
- 102000052922 Large Neutral Amino Acid-Transporter 1 Human genes 0.000 claims description 9
- 102100036735 Prostate stem cell antigen Human genes 0.000 claims description 9
- 108091006232 SLC7A5 Proteins 0.000 claims description 9
- 125000003118 aryl group Chemical group 0.000 claims description 9
- 229960002685 biotin Drugs 0.000 claims description 9
- 235000020958 biotin Nutrition 0.000 claims description 9
- 239000011616 biotin Substances 0.000 claims description 9
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 claims description 9
- 229910052717 sulfur Inorganic materials 0.000 claims description 9
- 102100020998 Aspartate beta-hydroxylase domain-containing protein 1 Human genes 0.000 claims description 8
- 101710129514 B-cell differentiation antigen CD72 Proteins 0.000 claims description 8
- 102100031517 Fc receptor-like protein 1 Human genes 0.000 claims description 8
- 101710120224 Fc receptor-like protein 1 Proteins 0.000 claims description 8
- 101000783987 Homo sapiens Aspartate beta-hydroxylase domain-containing protein 1 Proteins 0.000 claims description 8
- 101000846911 Homo sapiens Fc receptor-like protein 2 Proteins 0.000 claims description 8
- 101000958332 Homo sapiens Lymphocyte antigen 6 complex locus protein G6d Proteins 0.000 claims description 8
- 101000829779 Homo sapiens Probable G-protein coupled receptor 19 Proteins 0.000 claims description 8
- 101001136592 Homo sapiens Prostate stem cell antigen Proteins 0.000 claims description 8
- 101000604039 Homo sapiens Sodium-dependent phosphate transport protein 2B Proteins 0.000 claims description 8
- 101000834948 Homo sapiens Tomoregulin-2 Proteins 0.000 claims description 8
- 101000606090 Homo sapiens Tyrosinase Proteins 0.000 claims description 8
- 108010006444 Leucine-Rich Repeat Proteins Proteins 0.000 claims description 8
- PEEHTFAAVSWFBL-UHFFFAOYSA-N Maleimide Chemical compound O=C1NC(=O)C=C1 PEEHTFAAVSWFBL-UHFFFAOYSA-N 0.000 claims description 8
- 102000003735 Mesothelin Human genes 0.000 claims description 8
- 108090000015 Mesothelin Proteins 0.000 claims description 8
- 102100037603 P2X purinoceptor 5 Human genes 0.000 claims description 8
- 102100023417 Probable G-protein coupled receptor 19 Human genes 0.000 claims description 8
- 102100026160 Tomoregulin-2 Human genes 0.000 claims description 8
- 102100031228 Transient receptor potential cation channel subfamily M member 4 Human genes 0.000 claims description 8
- 101710178300 Tumor necrosis factor receptor superfamily member 13C Proteins 0.000 claims description 8
- 108060008724 Tyrosinase Proteins 0.000 claims description 8
- IEDXPSOJFSVCKU-HOKPPMCLSA-N [4-[[(2S)-5-(carbamoylamino)-2-[[(2S)-2-[6-(2,5-dioxopyrrolidin-1-yl)hexanoylamino]-3-methylbutanoyl]amino]pentanoyl]amino]phenyl]methyl N-[(2S)-1-[[(2S)-1-[[(3R,4S,5S)-1-[(2S)-2-[(1R,2R)-3-[[(1S,2R)-1-hydroxy-1-phenylpropan-2-yl]amino]-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl]-3-methoxy-5-methyl-1-oxoheptan-4-yl]-methylamino]-3-methyl-1-oxobutan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]-N-methylcarbamate Chemical compound CC[C@H](C)[C@@H]([C@@H](CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C)[C@@H](O)c1ccccc1)OC)N(C)C(=O)[C@@H](NC(=O)[C@H](C(C)C)N(C)C(=O)OCc1ccc(NC(=O)[C@H](CCCNC(N)=O)NC(=O)[C@@H](NC(=O)CCCCCN2C(=O)CCC2=O)C(C)C)cc1)C(C)C IEDXPSOJFSVCKU-HOKPPMCLSA-N 0.000 claims description 8
- 239000002299 complementary DNA Substances 0.000 claims description 8
- 125000005843 halogen group Chemical group 0.000 claims description 8
- 210000004901 leucine-rich repeat Anatomy 0.000 claims description 8
- 210000002307 prostate Anatomy 0.000 claims description 8
- 229960000575 trastuzumab Drugs 0.000 claims description 8
- 108010090804 Streptavidin Proteins 0.000 claims description 7
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Chemical compound CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 claims description 7
- 108010044540 auristatin Proteins 0.000 claims description 7
- AMRJKAQTDDKMCE-UHFFFAOYSA-N dolastatin Chemical compound CC(C)C(N(C)C)C(=O)NC(C(C)C)C(=O)N(C)C(C(C)C)C(OC)CC(=O)N1CCCC1C(OC)C(C)C(=O)NC(C=1SC=CN=1)CC1=CC=CC=C1 AMRJKAQTDDKMCE-UHFFFAOYSA-N 0.000 claims description 7
- 125000000623 heterocyclic group Chemical group 0.000 claims description 7
- 239000000833 heterodimer Substances 0.000 claims description 7
- 125000005439 maleimidyl group Chemical group C1(C=CC(N1*)=O)=O 0.000 claims description 7
- 229930013292 trichothecene Natural products 0.000 claims description 7
- 102100032312 Brevican core protein Human genes 0.000 claims description 6
- 101001065568 Homo sapiens Lymphocyte antigen 6E Proteins 0.000 claims description 6
- 101000825475 Homo sapiens Protein shisa-2 homolog Proteins 0.000 claims description 6
- 108010076800 Kisspeptin-1 Receptors Proteins 0.000 claims description 6
- 102100022938 Protein shisa-2 homolog Human genes 0.000 claims description 6
- 229940123237 Taxane Drugs 0.000 claims description 6
- 229940045799 anthracyclines and related substance Drugs 0.000 claims description 6
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 claims description 6
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 claims description 6
- 238000002741 site-directed mutagenesis Methods 0.000 claims description 6
- OMRPLUKQNWNZAV-CONSDPRKSA-N (6as)-3-[3-[[(6as)-2-methoxy-8-(4-methoxyphenyl)-11-oxo-6a,7-dihydropyrrolo[2,1-c][1,4]benzodiazepin-3-yl]oxy]propoxy]-8-(4-aminophenyl)-2-methoxy-6a,7-dihydropyrrolo[2,1-c][1,4]benzodiazepin-11-one Chemical compound C1=CC(OC)=CC=C1C1=CN2C(=O)C3=CC(OC)=C(OCCCOC=4C(=CC=5C(=O)N6C=C(C[C@H]6C=NC=5C=4)C=4C=CC(N)=CC=4)OC)C=C3N=C[C@@H]2C1 OMRPLUKQNWNZAV-CONSDPRKSA-N 0.000 claims description 5
- RHKRZQHJRZVTBP-UHFFFAOYSA-N 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole Chemical compound C1=CC=CC2=C3C(CCl)CNC3=CC=C21 RHKRZQHJRZVTBP-UHFFFAOYSA-N 0.000 claims description 5
- 108091008875 B cell receptors Proteins 0.000 claims description 5
- 108010046304 B-Cell Activation Factor Receptor Proteins 0.000 claims description 5
- 102100025473 Carcinoembryonic antigen-related cell adhesion molecule 6 Human genes 0.000 claims description 5
- 229930188224 Cryptophycin Natural products 0.000 claims description 5
- 101000914326 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 6 Proteins 0.000 claims description 5
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 claims description 5
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 claims description 5
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 claims description 5
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 claims description 5
- 101100182721 Mus musculus Ly6e gene Proteins 0.000 claims description 5
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 claims description 5
- 206010060862 Prostate cancer Diseases 0.000 claims description 5
- 208000000236 Prostatic Neoplasms Diseases 0.000 claims description 5
- 108010029485 Protein Isoforms Proteins 0.000 claims description 5
- 102000001708 Protein Isoforms Human genes 0.000 claims description 5
- BQCADISMDOOEFD-UHFFFAOYSA-N Silver Chemical compound [Ag] BQCADISMDOOEFD-UHFFFAOYSA-N 0.000 claims description 5
- WDLRUFUQRNWCPK-UHFFFAOYSA-N Tetraxetan Chemical compound OC(=O)CN1CCN(CC(O)=O)CCN(CC(O)=O)CCN(CC(O)=O)CC1 WDLRUFUQRNWCPK-UHFFFAOYSA-N 0.000 claims description 5
- 210000003719 b-lymphocyte Anatomy 0.000 claims description 5
- PSNOPSMXOBPNNV-VVCTWANISA-N cryptophycin 1 Chemical compound C1=C(Cl)C(OC)=CC=C1C[C@@H]1C(=O)NC[C@@H](C)C(=O)O[C@@H](CC(C)C)C(=O)O[C@H]([C@H](C)[C@@H]2[C@H](O2)C=2C=CC=CC=2)C/C=C/C(=O)N1 PSNOPSMXOBPNNV-VVCTWANISA-N 0.000 claims description 5
- PSNOPSMXOBPNNV-UHFFFAOYSA-N cryptophycin-327 Natural products C1=C(Cl)C(OC)=CC=C1CC1C(=O)NCC(C)C(=O)OC(CC(C)C)C(=O)OC(C(C)C2C(O2)C=2C=CC=CC=2)CC=CC(=O)N1 PSNOPSMXOBPNNV-UHFFFAOYSA-N 0.000 claims description 5
- 230000001419 dependent effect Effects 0.000 claims description 5
- 229910052751 metal Inorganic materials 0.000 claims description 5
- 239000002184 metal Substances 0.000 claims description 5
- 229910052757 nitrogen Inorganic materials 0.000 claims description 5
- 229910052760 oxygen Inorganic materials 0.000 claims description 5
- 229910052709 silver Inorganic materials 0.000 claims description 5
- 239000004332 silver Substances 0.000 claims description 5
- 239000012453 solvate Substances 0.000 claims description 5
- 230000005945 translocation Effects 0.000 claims description 5
- 239000004474 valine Substances 0.000 claims description 5
- LDGWQMRUWMSZIU-LQDDAWAPSA-M 2,3-bis[(z)-octadec-9-enoxy]propyl-trimethylazanium;chloride Chemical compound [Cl-].CCCCCCCC\C=C/CCCCCCCCOCC(C[N+](C)(C)C)OCCCCCCCC\C=C/CCCCCCCC LDGWQMRUWMSZIU-LQDDAWAPSA-M 0.000 claims description 4
- 101710111653 2-methylisocitrate lyase Proteins 0.000 claims description 4
- 102100027205 B-cell antigen receptor complex-associated protein alpha chain Human genes 0.000 claims description 4
- 102000007350 Bone Morphogenetic Proteins Human genes 0.000 claims description 4
- 108010007726 Bone Morphogenetic Proteins Proteins 0.000 claims description 4
- 108010085074 Brevican Proteins 0.000 claims description 4
- 208000011691 Burkitt lymphomas Diseases 0.000 claims description 4
- 102100031658 C-X-C chemokine receptor type 5 Human genes 0.000 claims description 4
- 101100004180 Chironomus tentans BR3 gene Proteins 0.000 claims description 4
- 102100030886 Complement receptor type 1 Human genes 0.000 claims description 4
- 102100026245 E3 ubiquitin-protein ligase RNF43 Human genes 0.000 claims description 4
- 102000002045 Endothelin Human genes 0.000 claims description 4
- 108050009340 Endothelin Proteins 0.000 claims description 4
- 102000003688 G-Protein-Coupled Receptors Human genes 0.000 claims description 4
- 108090000045 G-Protein-Coupled Receptors Proteins 0.000 claims description 4
- 101710105157 GDNF family receptor alpha-1 Proteins 0.000 claims description 4
- 108090000722 Glial cell line-derived neurotrophic factor receptors Proteins 0.000 claims description 4
- 102100031546 HLA class II histocompatibility antigen, DO beta chain Human genes 0.000 claims description 4
- 102000018713 Histocompatibility Antigens Class II Human genes 0.000 claims description 4
- 108010027412 Histocompatibility Antigens Class II Proteins 0.000 claims description 4
- 101000914489 Homo sapiens B-cell antigen receptor complex-associated protein alpha chain Proteins 0.000 claims description 4
- 101000922405 Homo sapiens C-X-C chemokine receptor type 5 Proteins 0.000 claims description 4
- 101000912622 Homo sapiens C-type lectin domain family 12 member A Proteins 0.000 claims description 4
- 101100496086 Homo sapiens CLEC12A gene Proteins 0.000 claims description 4
- 101000727061 Homo sapiens Complement receptor type 1 Proteins 0.000 claims description 4
- 101000941929 Homo sapiens Complement receptor type 2 Proteins 0.000 claims description 4
- 101000692702 Homo sapiens E3 ubiquitin-protein ligase RNF43 Proteins 0.000 claims description 4
- 101100119857 Homo sapiens FCRL2 gene Proteins 0.000 claims description 4
- 101000866281 Homo sapiens HLA class II histocompatibility antigen, DO beta chain Proteins 0.000 claims description 4
- 101000576802 Homo sapiens Mesothelin Proteins 0.000 claims description 4
- 101001024605 Homo sapiens Next to BRCA1 gene 1 protein Proteins 0.000 claims description 4
- 101000883798 Homo sapiens Probable ATP-dependent RNA helicase DDX53 Proteins 0.000 claims description 4
- 101100425948 Homo sapiens TNFRSF13C gene Proteins 0.000 claims description 4
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 claims description 4
- 101710174256 Leucine-rich repeat-containing G-protein coupled receptor 5 Proteins 0.000 claims description 4
- 102000004086 Ligand-Gated Ion Channels Human genes 0.000 claims description 4
- 108090000543 Ligand-Gated Ion Channels Proteins 0.000 claims description 4
- 101710160635 Lymphocyte antigen 6 complex locus protein G6d Proteins 0.000 claims description 4
- 101710158212 Lymphocyte antigen 6K Proteins 0.000 claims description 4
- 102000018697 Membrane Proteins Human genes 0.000 claims description 4
- 108010052285 Membrane Proteins Proteins 0.000 claims description 4
- 102100025096 Mesothelin Human genes 0.000 claims description 4
- 101710147242 Metalloreductase STEAP2 Proteins 0.000 claims description 4
- 101000623899 Mus musculus Mucin-13 Proteins 0.000 claims description 4
- 101100042271 Mus musculus Sema3b gene Proteins 0.000 claims description 4
- QPCDCPDFJACHGM-UHFFFAOYSA-N N,N-bis{2-[bis(carboxymethyl)amino]ethyl}glycine Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(=O)O)CCN(CC(O)=O)CC(O)=O QPCDCPDFJACHGM-UHFFFAOYSA-N 0.000 claims description 4
- 102000007399 Nuclear hormone receptor Human genes 0.000 claims description 4
- 108010092528 Phosphate Transport Proteins Proteins 0.000 claims description 4
- 102000016462 Phosphate Transport Proteins Human genes 0.000 claims description 4
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 claims description 4
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 claims description 4
- 102100038236 Probable ATP-dependent RNA helicase DDX53 Human genes 0.000 claims description 4
- 108010067787 Proteoglycans Proteins 0.000 claims description 4
- 102000016611 Proteoglycans Human genes 0.000 claims description 4
- 108010080192 Purinergic Receptors Proteins 0.000 claims description 4
- 102000014400 SH2 domains Human genes 0.000 claims description 4
- 108050003452 SH2 domains Proteins 0.000 claims description 4
- 108091058557 SILV Proteins 0.000 claims description 4
- 108091006576 SLC34A2 Proteins 0.000 claims description 4
- 101710199399 Semaphorin-5B Proteins 0.000 claims description 4
- 101100523267 Staphylococcus aureus qacC gene Proteins 0.000 claims description 4
- 102000003618 TRPM4 Human genes 0.000 claims description 4
- 101710098080 Teratocarcinoma-derived growth factor Proteins 0.000 claims description 4
- 101710175559 Tomoregulin-1 Proteins 0.000 claims description 4
- 125000002947 alkylene group Chemical group 0.000 claims description 4
- 229940112869 bone morphogenetic protein Drugs 0.000 claims description 4
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 claims description 4
- 229960002173 citrulline Drugs 0.000 claims description 4
- 108010006226 cryptophycin Proteins 0.000 claims description 4
- 125000001295 dansyl group Chemical group [H]C1=C([H])C(N(C([H])([H])[H])C([H])([H])[H])=C2C([H])=C([H])C([H])=C(C2=C1[H])S(*)(=O)=O 0.000 claims description 4
- BJAJDJDODCWPNS-UHFFFAOYSA-N dotp Chemical compound O=C1N2CCOC2=NC2=C1SC=C2 BJAJDJDODCWPNS-UHFFFAOYSA-N 0.000 claims description 4
- ZUBDGKVDJUIMQQ-UBFCDGJISA-N endothelin-1 Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(O)=O)NC(=O)[C@H]1NC(=O)[C@H](CC=2C=CC=CC=2)NC(=O)[C@@H](CC=2C=CC(O)=CC=2)NC(=O)[C@H](C(C)C)NC(=O)[C@H]2CSSC[C@@H](C(N[C@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N2)=O)NC(=O)[C@@H](CO)NC(=O)[C@H](N)CSSC1)C1=CNC=N1 ZUBDGKVDJUIMQQ-UBFCDGJISA-N 0.000 claims description 4
- PGLTVOMIXTUURA-UHFFFAOYSA-N iodoacetamide Chemical compound NC(=O)CI PGLTVOMIXTUURA-UHFFFAOYSA-N 0.000 claims description 4
- 229910052708 sodium Inorganic materials 0.000 claims description 4
- 239000011734 sodium Substances 0.000 claims description 4
- 239000007787 solid Substances 0.000 claims description 4
- 208000035782 susceptibility to 1 Hirschsprung disease Diseases 0.000 claims description 4
- DKPFODGZWDEEBT-QFIAKTPHSA-N taxane Chemical class C([C@]1(C)CCC[C@@H](C)[C@H]1C1)C[C@H]2[C@H](C)CC[C@@H]1C2(C)C DKPFODGZWDEEBT-QFIAKTPHSA-N 0.000 claims description 4
- MPLHNVLQVRSVEE-UHFFFAOYSA-N texas red Chemical compound [O-]S(=O)(=O)C1=CC(S(Cl)(=O)=O)=CC=C1C(C1=CC=2CCCN3CCCC(C=23)=C1O1)=C2C1=C(CCC1)C3=[N+]1CCCC3=C2 MPLHNVLQVRSVEE-UHFFFAOYSA-N 0.000 claims description 4
- LZAJKCZTKKKZNT-PMNGPLLRSA-N trichothecene Chemical compound C12([C@@]3(CC[C@H]2OC2C=C(CCC23C)C)C)CO1 LZAJKCZTKKKZNT-PMNGPLLRSA-N 0.000 claims description 4
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 claims description 3
- 101710157879 Lymphocyte antigen 6E Proteins 0.000 claims description 3
- 101100365741 Mus musculus Shisa2 gene Proteins 0.000 claims description 3
- RHGKLRLOHDJJDR-UHFFFAOYSA-N Ndelta-carbamoyl-DL-ornithine Natural products OC(=O)C(N)CCCNC(N)=O RHGKLRLOHDJJDR-UHFFFAOYSA-N 0.000 claims description 3
- 108010004729 Phycoerythrin Proteins 0.000 claims description 3
- 101100365738 Xenopus laevis shisa1 gene Proteins 0.000 claims description 3
- 235000013477 citrulline Nutrition 0.000 claims description 3
- 125000004400 (C1-C12) alkyl group Chemical group 0.000 claims description 2
- 125000004209 (C1-C8) alkyl group Chemical group 0.000 claims description 2
- 125000001963 4 membered heterocyclic group Chemical group 0.000 claims description 2
- RHGKLRLOHDJJDR-BYPYZUCNSA-N L-citrulline Chemical group NC(=O)NCCC[C@H]([NH3+])C([O-])=O RHGKLRLOHDJJDR-BYPYZUCNSA-N 0.000 claims description 2
- 150000001768 cations Chemical class 0.000 claims description 2
- 125000004433 nitrogen atom Chemical group N* 0.000 claims description 2
- 239000008194 pharmaceutical composition Substances 0.000 claims description 2
- 125000004450 alkenylene group Chemical group 0.000 claims 4
- UHOVQNZJYSORNB-UHFFFAOYSA-N Benzene Chemical compound C1=CC=CC=C1 UHOVQNZJYSORNB-UHFFFAOYSA-N 0.000 claims 3
- 125000001072 heteroaryl group Chemical group 0.000 claims 3
- BQWBEDSJTMWJAE-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-[(2-iodoacetyl)amino]benzoate Chemical compound C1=CC(NC(=O)CI)=CC=C1C(=O)ON1C(=O)CCC1=O BQWBEDSJTMWJAE-UHFFFAOYSA-N 0.000 claims 2
- AGGWFDNPHKLBBV-YUMQZZPRSA-N (2s)-2-[[(2s)-2-amino-3-methylbutanoyl]amino]-5-(carbamoylamino)pentanoic acid Chemical compound CC(C)[C@H](N)C(=O)N[C@H](C(O)=O)CCCNC(N)=O AGGWFDNPHKLBBV-YUMQZZPRSA-N 0.000 claims 2
- POBZYODNVHQLFG-ZRBKHQLFSA-N (2s,4r)-4-[[2-[(1r,3r)-1-acetyloxy-4-methyl-3-[methyl-[(2s,3s)-3-methyl-2-[[(2r)-1-methylpiperidine-2-carbonyl]amino]pentanoyl]amino]pentyl]-1,3-thiazole-4-carbonyl]amino]-2-methyl-5-phenylpentanoic acid Chemical compound N([C@@H]([C@@H](C)CC)C(=O)N(C)[C@H](C[C@@H](OC(C)=O)C=1SC=C(N=1)C(=O)N[C@H](C[C@H](C)C(O)=O)CC=1C=CC=CC=1)C(C)C)C(=O)[C@H]1CCCCN1C POBZYODNVHQLFG-ZRBKHQLFSA-N 0.000 claims 2
- 125000003161 (C1-C6) alkylene group Chemical group 0.000 claims 2
- 229910003827 NRaRb Inorganic materials 0.000 claims 2
- JUJWROOIHBZHMG-UHFFFAOYSA-N Pyridine Chemical compound C1=CC=NC=C1 JUJWROOIHBZHMG-UHFFFAOYSA-N 0.000 claims 2
- 125000004419 alkynylene group Chemical group 0.000 claims 2
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 claims 2
- 229910052698 phosphorus Inorganic materials 0.000 claims 2
- JJAHTWIKCUJRDK-UHFFFAOYSA-N succinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate Chemical compound C1CC(CN2C(C=CC2=O)=O)CCC1C(=O)ON1C(=O)CCC1=O JJAHTWIKCUJRDK-UHFFFAOYSA-N 0.000 claims 2
- JSHOVKSMJRQOGY-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-(pyridin-2-yldisulfanyl)butanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCSSC1=CC=CC=N1 JSHOVKSMJRQOGY-UHFFFAOYSA-N 0.000 claims 1
- WMZYAQQKYLKWGI-UHFFFAOYSA-N 1-hydroxypyrrolidine-2,5-dione 4-(pyridin-2-yldisulfanyl)butanoic acid Chemical compound ON1C(=O)CCC1=O.OC(=O)CCCSSC1=CC=CC=N1 WMZYAQQKYLKWGI-UHFFFAOYSA-N 0.000 claims 1
- VILCJCGEZXAXTO-UHFFFAOYSA-N 2,2,2-tetramine Chemical compound NCCNCCNCCN VILCJCGEZXAXTO-UHFFFAOYSA-N 0.000 claims 1
- JUIKUQOUMZUFQT-UHFFFAOYSA-N 2-bromoacetamide Chemical compound NC(=O)CBr JUIKUQOUMZUFQT-UHFFFAOYSA-N 0.000 claims 1
- MJYFVDNMTKLGTH-UHFFFAOYSA-N 4-bromo-6-(3,4-dichlorophenyl)sulfanyl-1-[[4-(dimethylcarbamoyl)phenyl]methyl]indole-2-carboxylic acid Chemical compound BrC1=C2C=C(N(C2=CC(=C1)SC1=CC(=C(C=C1)Cl)Cl)CC1=CC=C(C=C1)C(N(C)C)=O)C(=O)O MJYFVDNMTKLGTH-UHFFFAOYSA-N 0.000 claims 1
- 125000002373 5 membered heterocyclic group Chemical group 0.000 claims 1
- 125000004070 6 membered heterocyclic group Chemical group 0.000 claims 1
- 125000003341 7 membered heterocyclic group Chemical group 0.000 claims 1
- OMNVYXHOSHNURL-WPRPVWTQSA-N Ala-Phe Chemical compound C[C@H](N)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 OMNVYXHOSHNURL-WPRPVWTQSA-N 0.000 claims 1
- 108010011559 alanylphenylalanine Proteins 0.000 claims 1
- 125000000217 alkyl group Chemical group 0.000 claims 1
- 229940125644 antibody drug Drugs 0.000 claims 1
- 125000001797 benzyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])* 0.000 claims 1
- HXCHCVDVKSCDHU-LULTVBGHSA-N calicheamicin Chemical compound C1[C@H](OC)[C@@H](NCC)CO[C@H]1O[C@H]1[C@H](O[C@@H]2C\3=C(NC(=O)OC)C(=O)C[C@](C/3=C/CSSSC)(O)C#C\C=C/C#C2)O[C@H](C)[C@@H](NO[C@@H]2O[C@H](C)[C@@H](SC(=O)C=3C(=C(OC)C(O[C@H]4[C@@H]([C@H](OC)[C@@H](O)[C@H](C)O4)O)=C(I)C=3C)OC)[C@@H](O)C2)[C@@H]1O HXCHCVDVKSCDHU-LULTVBGHSA-N 0.000 claims 1
- 125000002147 dimethylamino group Chemical group [H]C([H])([H])N(*)C([H])([H])[H] 0.000 claims 1
- 125000001153 fluoro group Chemical group F* 0.000 claims 1
- 125000002485 formyl group Chemical group [H]C(*)=O 0.000 claims 1
- 125000005842 heteroatom Chemical group 0.000 claims 1
- UMJSCPRVCHMLSP-UHFFFAOYSA-N pyridine Natural products COC1=CC=CN=C1 UMJSCPRVCHMLSP-UHFFFAOYSA-N 0.000 claims 1
- ANRHNWWPFJCPAZ-UHFFFAOYSA-M thionine Chemical compound [Cl-].C1=CC(N)=CC2=[S+]C3=CC(N)=CC=C3N=C21 ANRHNWWPFJCPAZ-UHFFFAOYSA-M 0.000 claims 1
- 108010037277 thymic shared antigen-1 Proteins 0.000 claims 1
- NQPDZGIKBAWPEJ-UHFFFAOYSA-N valeric acid Chemical compound CCCCC(O)=O NQPDZGIKBAWPEJ-UHFFFAOYSA-N 0.000 claims 1
- 108090000765 processed proteins & peptides Proteins 0.000 description 71
- 102000004196 processed proteins & peptides Human genes 0.000 description 59
- 206010028980 Neoplasm Diseases 0.000 description 58
- 210000004027 cell Anatomy 0.000 description 58
- 229920001184 polypeptide Polymers 0.000 description 55
- 125000003396 thiol group Chemical class [H]S* 0.000 description 51
- 230000009257 reactivity Effects 0.000 description 44
- 201000011510 cancer Diseases 0.000 description 37
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 37
- 125000003275 alpha amino acid group Chemical group 0.000 description 33
- 108020004414 DNA Proteins 0.000 description 27
- 238000006467 substitution reaction Methods 0.000 description 23
- 238000003556 assay Methods 0.000 description 22
- 230000021615 conjugation Effects 0.000 description 22
- 229940127089 cytotoxic agent Drugs 0.000 description 19
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 17
- 230000006870 function Effects 0.000 description 17
- 150000001875 compounds Chemical class 0.000 description 16
- 239000000562 conjugate Substances 0.000 description 16
- 230000000694 effects Effects 0.000 description 16
- 102000001301 EGF receptor Human genes 0.000 description 15
- 239000012634 fragment Substances 0.000 description 15
- HXCHCVDVKSCDHU-PJKCJEBCSA-N s-[(2r,3s,4s,6s)-6-[[(2r,3s,4s,5r,6r)-5-[(2s,4s,5s)-5-(ethylamino)-4-methoxyoxan-2-yl]oxy-4-hydroxy-6-[[(2s,5z,9r,13e)-9-hydroxy-12-(methoxycarbonylamino)-13-[2-(methyltrisulfanyl)ethylidene]-11-oxo-2-bicyclo[7.3.1]trideca-1(12),5-dien-3,7-diynyl]oxy]-2-m Chemical compound C1[C@H](OC)[C@@H](NCC)CO[C@H]1O[C@H]1[C@H](O[C@@H]2C\3=C(NC(=O)OC)C(=O)C[C@@](C/3=C/CSSSC)(O)C#C\C=C/C#C2)O[C@H](C)[C@@H](NO[C@@H]2O[C@H](C)[C@@H](SC(=O)C=3C(=C(OC)C(O[C@H]4[C@@H]([C@H](OC)[C@@H](O)[C@H](C)O4)O)=C(I)C=3C)OC)[C@@H](O)C2)[C@@H]1O HXCHCVDVKSCDHU-PJKCJEBCSA-N 0.000 description 15
- 241000894007 species Species 0.000 description 15
- 108060006698 EGF receptor Proteins 0.000 description 14
- 238000006243 chemical reaction Methods 0.000 description 14
- 238000004895 liquid chromatography mass spectrometry Methods 0.000 description 14
- 230000002776 aggregation Effects 0.000 description 13
- 238000004220 aggregation Methods 0.000 description 13
- 239000000539 dimer Substances 0.000 description 13
- 238000002703 mutagenesis Methods 0.000 description 13
- 231100000350 mutagenesis Toxicity 0.000 description 13
- 230000015572 biosynthetic process Effects 0.000 description 12
- 230000000875 corresponding effect Effects 0.000 description 12
- 231100000433 cytotoxic Toxicity 0.000 description 12
- 230000001472 cytotoxic effect Effects 0.000 description 12
- 239000000203 mixture Substances 0.000 description 12
- 238000012986 modification Methods 0.000 description 12
- 238000011282 treatment Methods 0.000 description 12
- 238000002965 ELISA Methods 0.000 description 11
- 108091034117 Oligonucleotide Proteins 0.000 description 11
- 238000004458 analytical method Methods 0.000 description 11
- 239000002246 antineoplastic agent Substances 0.000 description 11
- 239000003795 chemical substances by application Substances 0.000 description 11
- 230000004048 modification Effects 0.000 description 11
- 102000039446 nucleic acids Human genes 0.000 description 11
- 108020004707 nucleic acids Proteins 0.000 description 11
- 239000013612 plasmid Substances 0.000 description 11
- 210000004369 blood Anatomy 0.000 description 10
- 239000008280 blood Substances 0.000 description 10
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 10
- 239000001257 hydrogen Substances 0.000 description 10
- 238000003156 radioimmunoprecipitation Methods 0.000 description 10
- 238000011160 research Methods 0.000 description 10
- 230000008685 targeting Effects 0.000 description 10
- 229940124597 therapeutic agent Drugs 0.000 description 10
- DJQYYYCQOZMCRC-UHFFFAOYSA-N 2-aminopropane-1,3-dithiol Chemical group SCC(N)CS DJQYYYCQOZMCRC-UHFFFAOYSA-N 0.000 description 9
- 239000000872 buffer Substances 0.000 description 9
- 210000000349 chromosome Anatomy 0.000 description 9
- 239000002254 cytotoxic agent Substances 0.000 description 9
- 238000003384 imaging method Methods 0.000 description 9
- 238000001727 in vivo Methods 0.000 description 9
- 238000011534 incubation Methods 0.000 description 9
- 102220005400 rs34324664 Human genes 0.000 description 9
- QWPXBEHQFHACTK-KZVYIGENSA-N (10e,12e)-86-chloro-12,14,4-trihydroxy-85,14-dimethoxy-33,2,7,10-tetramethyl-15,16-dihydro-14h-7-aza-1(6,4)-oxazina-3(2,3)-oxirana-8(1,3)-benzenacyclotetradecaphane-10,12-dien-6-one Chemical compound CN1C(=O)CC(O)C2(C)OC2C(C)C(OC(=O)N2)CC2(O)C(OC)\C=C\C=C(C)\CC2=CC(OC)=C(Cl)C1=C2 QWPXBEHQFHACTK-KZVYIGENSA-N 0.000 description 8
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 8
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 8
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 8
- 108700020796 Oncogene Proteins 0.000 description 8
- 231100000599 cytotoxic agent Toxicity 0.000 description 8
- 239000000032 diagnostic agent Substances 0.000 description 8
- 229940039227 diagnostic agent Drugs 0.000 description 8
- 238000010494 dissociation reaction Methods 0.000 description 8
- 230000005593 dissociations Effects 0.000 description 8
- 239000012636 effector Substances 0.000 description 8
- 230000014509 gene expression Effects 0.000 description 8
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 8
- 230000008676 import Effects 0.000 description 8
- 239000000543 intermediate Substances 0.000 description 8
- 238000003127 radioimmunoassay Methods 0.000 description 8
- 210000002966 serum Anatomy 0.000 description 8
- 230000001225 therapeutic effect Effects 0.000 description 8
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 7
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 7
- 241001529936 Murinae Species 0.000 description 7
- 235000004279 alanine Nutrition 0.000 description 7
- 239000000090 biomarker Substances 0.000 description 7
- 238000005516 engineering process Methods 0.000 description 7
- 239000002245 particle Substances 0.000 description 7
- 238000003752 polymerase chain reaction Methods 0.000 description 7
- 239000002904 solvent Substances 0.000 description 7
- 239000000126 substance Substances 0.000 description 7
- 108700012359 toxins Proteins 0.000 description 7
- 206010009944 Colon cancer Diseases 0.000 description 6
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 6
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 6
- 102000004190 Enzymes Human genes 0.000 description 6
- 108090000790 Enzymes Proteins 0.000 description 6
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 6
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 6
- 102100026120 IgG receptor FcRn large subunit p51 Human genes 0.000 description 6
- QWPXBEHQFHACTK-UHFFFAOYSA-N Maytansinol Natural products CN1C(=O)CC(O)C2(C)OC2C(C)C(OC(=O)N2)CC2(O)C(OC)C=CC=C(C)CC2=CC(OC)=C(Cl)C1=C2 QWPXBEHQFHACTK-UHFFFAOYSA-N 0.000 description 6
- 239000002253 acid Substances 0.000 description 6
- 230000001093 anti-cancer Effects 0.000 description 6
- 238000013459 approach Methods 0.000 description 6
- 230000004540 complement-dependent cytotoxicity Effects 0.000 description 6
- 238000013461 design Methods 0.000 description 6
- 229940088598 enzyme Drugs 0.000 description 6
- 238000002866 fluorescence resonance energy transfer Methods 0.000 description 6
- 239000000463 material Substances 0.000 description 6
- WKPWGQKGSOKKOO-RSFHAFMBSA-N maytansine Chemical compound CO[C@@H]([C@@]1(O)C[C@](OC(=O)N1)([C@H]([C@@H]1O[C@@]1(C)[C@@H](OC(=O)[C@H](C)N(C)C(C)=O)CC(=O)N1C)C)[H])\C=C\C=C(C)\CC2=CC(OC)=C(Cl)C1=C2 WKPWGQKGSOKKOO-RSFHAFMBSA-N 0.000 description 6
- 229960002087 pertuzumab Drugs 0.000 description 6
- 238000002360 preparation method Methods 0.000 description 6
- 230000002829 reductive effect Effects 0.000 description 6
- 239000000758 substrate Substances 0.000 description 6
- 210000001519 tissue Anatomy 0.000 description 6
- 239000003053 toxin Substances 0.000 description 6
- 231100000765 toxin Toxicity 0.000 description 6
- 108010088751 Albumins Proteins 0.000 description 5
- 102000009027 Albumins Human genes 0.000 description 5
- 102000000844 Cell Surface Receptors Human genes 0.000 description 5
- 108010001857 Cell Surface Receptors Proteins 0.000 description 5
- 108010087819 Fc receptors Proteins 0.000 description 5
- 102000009109 Fc receptors Human genes 0.000 description 5
- 239000004471 Glycine Substances 0.000 description 5
- 108091007491 NSP3 Papain-like protease domains Proteins 0.000 description 5
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 5
- BPEGJWRSRHCHSN-UHFFFAOYSA-N Temozolomide Chemical compound O=C1N(C)N=NC2=C(C(N)=O)N=CN21 BPEGJWRSRHCHSN-UHFFFAOYSA-N 0.000 description 5
- 230000004071 biological effect Effects 0.000 description 5
- 229910052794 bromium Inorganic materials 0.000 description 5
- 201000010099 disease Diseases 0.000 description 5
- 208000035475 disorder Diseases 0.000 description 5
- 238000002474 experimental method Methods 0.000 description 5
- 229960002949 fluorouracil Drugs 0.000 description 5
- 108020001507 fusion proteins Proteins 0.000 description 5
- 102000037865 fusion proteins Human genes 0.000 description 5
- 238000000338 in vitro Methods 0.000 description 5
- 230000003993 interaction Effects 0.000 description 5
- 229910052740 iodine Inorganic materials 0.000 description 5
- 125000001449 isopropyl group Chemical group [H]C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 5
- 238000002372 labelling Methods 0.000 description 5
- 239000003068 molecular probe Substances 0.000 description 5
- 238000002823 phage display Methods 0.000 description 5
- 210000002381 plasma Anatomy 0.000 description 5
- QFJCIRLUMZQUOT-HPLJOQBZSA-N sirolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 QFJCIRLUMZQUOT-HPLJOQBZSA-N 0.000 description 5
- 238000013389 whole blood assay Methods 0.000 description 5
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 4
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 4
- 239000004475 Arginine Substances 0.000 description 4
- 101710132601 Capsid protein Proteins 0.000 description 4
- 101710094648 Coat protein Proteins 0.000 description 4
- 102100020743 Dipeptidase 1 Human genes 0.000 description 4
- 102100031968 Ephrin type-B receptor 2 Human genes 0.000 description 4
- 101710177940 IgG receptor FcRn large subunit p51 Proteins 0.000 description 4
- 101710125418 Major capsid protein Proteins 0.000 description 4
- 241001465754 Metazoa Species 0.000 description 4
- 101710141454 Nucleoprotein Proteins 0.000 description 4
- 102220621527 Peroxiredoxin-5, mitochondrial_Y33C_mutation Human genes 0.000 description 4
- 239000002202 Polyethylene glycol Substances 0.000 description 4
- 101710083689 Probable capsid protein Proteins 0.000 description 4
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 4
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 4
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 4
- 125000004429 atom Chemical group 0.000 description 4
- 230000008901 benefit Effects 0.000 description 4
- 238000004364 calculation method Methods 0.000 description 4
- 230000004663 cell proliferation Effects 0.000 description 4
- 230000008859 change Effects 0.000 description 4
- 230000001268 conjugating effect Effects 0.000 description 4
- 238000004132 cross linking Methods 0.000 description 4
- 230000004069 differentiation Effects 0.000 description 4
- 229940022353 herceptin Drugs 0.000 description 4
- 239000008241 heterogeneous mixture Substances 0.000 description 4
- 229940127121 immunoconjugate Drugs 0.000 description 4
- 230000002998 immunogenetic effect Effects 0.000 description 4
- 229940072221 immunoglobulins Drugs 0.000 description 4
- GURKHSYORGJETM-WAQYZQTGSA-N irinotecan hydrochloride (anhydrous) Chemical compound Cl.C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 GURKHSYORGJETM-WAQYZQTGSA-N 0.000 description 4
- 210000004962 mammalian cell Anatomy 0.000 description 4
- 238000004519 manufacturing process Methods 0.000 description 4
- 238000004949 mass spectrometry Methods 0.000 description 4
- 229920001223 polyethylene glycol Polymers 0.000 description 4
- 230000009145 protein modification Effects 0.000 description 4
- 230000002285 radioactive effect Effects 0.000 description 4
- 230000009467 reduction Effects 0.000 description 4
- 102200097248 rs121912511 Human genes 0.000 description 4
- 102220099307 rs144750850 Human genes 0.000 description 4
- 102220058215 rs202168814 Human genes 0.000 description 4
- 102200068714 rs281865217 Human genes 0.000 description 4
- 102220106606 rs749361514 Human genes 0.000 description 4
- 102200050000 rs7564372 Human genes 0.000 description 4
- 102220087975 rs777340009 Human genes 0.000 description 4
- 102220102960 rs9895963 Human genes 0.000 description 4
- 239000000523 sample Substances 0.000 description 4
- 125000004434 sulfur atom Chemical group 0.000 description 4
- 230000004083 survival effect Effects 0.000 description 4
- WYWHKKSPHMUBEB-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 4
- 238000012546 transfer Methods 0.000 description 4
- 229960001612 trastuzumab emtansine Drugs 0.000 description 4
- 210000004881 tumor cell Anatomy 0.000 description 4
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 4
- 239000013598 vector Substances 0.000 description 4
- MFRNYXJJRJQHNW-DEMKXPNLSA-N (2s)-2-[[(2r,3r)-3-methoxy-3-[(2s)-1-[(3r,4s,5s)-3-methoxy-5-methyl-4-[methyl-[(2s)-3-methyl-2-[[(2s)-3-methyl-2-(methylamino)butanoyl]amino]butanoyl]amino]heptanoyl]pyrrolidin-2-yl]-2-methylpropanoyl]amino]-3-phenylpropanoic acid Chemical compound CN[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N(C)[C@@H]([C@@H](C)CC)[C@H](OC)CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 MFRNYXJJRJQHNW-DEMKXPNLSA-N 0.000 description 3
- 125000004398 2-methyl-2-butyl group Chemical group CC(C)(CC)* 0.000 description 3
- 125000004918 2-methyl-2-pentyl group Chemical group CC(C)(CCC)* 0.000 description 3
- 125000004922 2-methyl-3-pentyl group Chemical group CC(C)C(CC)* 0.000 description 3
- 125000004493 2-methylbut-1-yl group Chemical group CC(C*)CC 0.000 description 3
- 125000004917 3-methyl-2-butyl group Chemical group CC(C(C)*)C 0.000 description 3
- 125000004919 3-methyl-2-pentyl group Chemical group CC(C(C)*)CC 0.000 description 3
- 125000004921 3-methyl-3-pentyl group Chemical group CC(CC)(CC)* 0.000 description 3
- 125000004920 4-methyl-2-pentyl group Chemical group CC(CC(C)*)C 0.000 description 3
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 3
- MLDQJTXFUGDVEO-UHFFFAOYSA-N BAY-43-9006 Chemical compound C1=NC(C(=O)NC)=CC(OC=2C=CC(NC(=O)NC=3C=C(C(Cl)=CC=3)C(F)(F)F)=CC=2)=C1 MLDQJTXFUGDVEO-UHFFFAOYSA-N 0.000 description 3
- 206010006187 Breast cancer Diseases 0.000 description 3
- 208000026310 Breast neoplasm Diseases 0.000 description 3
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 3
- 101150034590 DAR1 gene Proteins 0.000 description 3
- SBJKKFFYIZUCET-JLAZNSOCSA-N Dehydro-L-ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(=O)C1=O SBJKKFFYIZUCET-JLAZNSOCSA-N 0.000 description 3
- SBJKKFFYIZUCET-UHFFFAOYSA-N Dehydroascorbic acid Natural products OCC(O)C1OC(=O)C(=O)C1=O SBJKKFFYIZUCET-UHFFFAOYSA-N 0.000 description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 3
- 241000588724 Escherichia coli Species 0.000 description 3
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 3
- 241000724791 Filamentous phage Species 0.000 description 3
- 102100021181 Golgi phosphoprotein 3 Human genes 0.000 description 3
- 101001064462 Homo sapiens Ephrin type-B receptor 2 Proteins 0.000 description 3
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 3
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 3
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 3
- 229930126263 Maytansine Natural products 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- 241000699666 Mus <mouse, genus> Species 0.000 description 3
- 108010021466 Mutant Proteins Proteins 0.000 description 3
- 102000008300 Mutant Proteins Human genes 0.000 description 3
- 239000012828 PI3K inhibitor Substances 0.000 description 3
- 102000035195 Peptidases Human genes 0.000 description 3
- 108091005804 Peptidases Proteins 0.000 description 3
- 101100393304 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GPD1 gene Proteins 0.000 description 3
- 241000187747 Streptomyces Species 0.000 description 3
- FOCVUCIESVLUNU-UHFFFAOYSA-N Thiotepa Chemical compound C1CN1P(N1CC1)(=S)N1CC1 FOCVUCIESVLUNU-UHFFFAOYSA-N 0.000 description 3
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 3
- 239000004473 Threonine Substances 0.000 description 3
- WYHIICXRPHEJKI-UHFFFAOYSA-N Trientine hydrochloride Chemical compound Cl.Cl.NCCNCCNCCN WYHIICXRPHEJKI-UHFFFAOYSA-N 0.000 description 3
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 3
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 3
- 150000007513 acids Chemical class 0.000 description 3
- 238000007792 addition Methods 0.000 description 3
- 150000001412 amines Chemical class 0.000 description 3
- 125000003277 amino group Chemical group 0.000 description 3
- 230000001580 bacterial effect Effects 0.000 description 3
- 230000015556 catabolic process Effects 0.000 description 3
- 230000001413 cellular effect Effects 0.000 description 3
- 238000007385 chemical modification Methods 0.000 description 3
- 239000003593 chromogenic compound Substances 0.000 description 3
- 238000010668 complexation reaction Methods 0.000 description 3
- 239000010949 copper Substances 0.000 description 3
- 230000001085 cytostatic effect Effects 0.000 description 3
- 238000002784 cytotoxicity assay Methods 0.000 description 3
- 231100000263 cytotoxicity test Toxicity 0.000 description 3
- 238000006731 degradation reaction Methods 0.000 description 3
- 235000020960 dehydroascorbic acid Nutrition 0.000 description 3
- 239000011615 dehydroascorbic acid Substances 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000018109 developmental process Effects 0.000 description 3
- 239000003534 dna topoisomerase inhibitor Substances 0.000 description 3
- 230000009977 dual effect Effects 0.000 description 3
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 description 3
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 description 3
- 150000002148 esters Chemical class 0.000 description 3
- 125000000524 functional group Chemical group 0.000 description 3
- 230000004927 fusion Effects 0.000 description 3
- 150000002431 hydrogen Chemical class 0.000 description 3
- 125000000959 isobutyl group Chemical group [H]C([H])([H])C([H])(C([H])([H])[H])C([H])([H])* 0.000 description 3
- 125000001972 isopentyl group Chemical group [H]C([H])([H])C([H])(C([H])([H])[H])C([H])([H])C([H])([H])* 0.000 description 3
- BCFGMOOMADDAQU-UHFFFAOYSA-N lapatinib Chemical compound O1C(CNCCS(=O)(=O)C)=CC=C1C1=CC=C(N=CN=C2NC=3C=C(Cl)C(OCC=4C=C(F)C=CC=4)=CC=3)C2=C1 BCFGMOOMADDAQU-UHFFFAOYSA-N 0.000 description 3
- 238000002595 magnetic resonance imaging Methods 0.000 description 3
- 239000011159 matrix material Substances 0.000 description 3
- 238000005259 measurement Methods 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 3
- 229960000485 methotrexate Drugs 0.000 description 3
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 3
- YOHYSYJDKVYCJI-UHFFFAOYSA-N n-[3-[[6-[3-(trifluoromethyl)anilino]pyrimidin-4-yl]amino]phenyl]cyclopropanecarboxamide Chemical compound FC(F)(F)C1=CC=CC(NC=2N=CN=C(NC=3C=C(NC(=O)C4CC4)C=CC=3)C=2)=C1 YOHYSYJDKVYCJI-UHFFFAOYSA-N 0.000 description 3
- 125000004108 n-butyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 3
- 125000001280 n-hexyl group Chemical group C(CCCCC)* 0.000 description 3
- 125000000740 n-pentyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 3
- 125000004123 n-propyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])* 0.000 description 3
- 229930014626 natural product Natural products 0.000 description 3
- 230000000269 nucleophilic effect Effects 0.000 description 3
- 125000003538 pentan-3-yl group Chemical group [H]C([H])([H])C([H])([H])C([H])(*)C([H])([H])C([H])([H])[H] 0.000 description 3
- 102000013415 peroxidase activity proteins Human genes 0.000 description 3
- 108040007629 peroxidase activity proteins Proteins 0.000 description 3
- 229940043441 phosphoinositide 3-kinase inhibitor Drugs 0.000 description 3
- 150000008300 phosphoramidites Chemical class 0.000 description 3
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 238000000746 purification Methods 0.000 description 3
- 238000000163 radioactive labelling Methods 0.000 description 3
- ZAHRKKWIAAJSAO-UHFFFAOYSA-N rapamycin Natural products COCC(O)C(=C/C(C)C(=O)CC(OC(=O)C1CCCCN1C(=O)C(=O)C2(O)OC(CC(OC)C(=CC=CC=CC(C)CC(C)C(=O)C)C)CCC2C)C(C)CC3CCC(O)C(C3)OC)C ZAHRKKWIAAJSAO-UHFFFAOYSA-N 0.000 description 3
- 230000010076 replication Effects 0.000 description 3
- 239000011347 resin Substances 0.000 description 3
- 229920005989 resin Polymers 0.000 description 3
- 230000004044 response Effects 0.000 description 3
- 125000002914 sec-butyl group Chemical group [H]C([H])([H])C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 3
- 229960002930 sirolimus Drugs 0.000 description 3
- 206010041823 squamous cell carcinoma Diseases 0.000 description 3
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 description 3
- 238000003786 synthesis reaction Methods 0.000 description 3
- 125000000999 tert-butyl group Chemical group [H]C([H])([H])C(*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 3
- 229940044693 topoisomerase inhibitor Drugs 0.000 description 3
- 150000003327 trichothecene derivatives Chemical class 0.000 description 3
- 241001515965 unidentified phage Species 0.000 description 3
- 229960000241 vandetanib Drugs 0.000 description 3
- UHTHHESEBZOYNR-UHFFFAOYSA-N vandetanib Chemical compound COC1=CC(C(/N=CN2)=N/C=3C(=CC(Br)=CC=3)F)=C2C=C1OCC1CCN(C)CC1 UHTHHESEBZOYNR-UHFFFAOYSA-N 0.000 description 3
- DLKUYSQUHXBYPB-NSSHGSRYSA-N (2s,4r)-4-[[2-[(1r,3r)-1-acetyloxy-4-methyl-3-[3-methylbutanoyloxymethyl-[(2s,3s)-3-methyl-2-[[(2r)-1-methylpiperidine-2-carbonyl]amino]pentanoyl]amino]pentyl]-1,3-thiazole-4-carbonyl]amino]-2-methyl-5-(4-methylphenyl)pentanoic acid Chemical compound N([C@@H]([C@@H](C)CC)C(=O)N(COC(=O)CC(C)C)[C@H](C[C@@H](OC(C)=O)C=1SC=C(N=1)C(=O)N[C@H](C[C@H](C)C(O)=O)CC=1C=CC(C)=CC=1)C(C)C)C(=O)[C@H]1CCCCN1C DLKUYSQUHXBYPB-NSSHGSRYSA-N 0.000 description 2
- QGKMIGUHVLGJBR-UHFFFAOYSA-M (4z)-1-(3-methylbutyl)-4-[[1-(3-methylbutyl)quinolin-1-ium-4-yl]methylidene]quinoline;iodide Chemical compound [I-].C12=CC=CC=C2N(CCC(C)C)C=CC1=CC1=CC=[N+](CCC(C)C)C2=CC=CC=C12 QGKMIGUHVLGJBR-UHFFFAOYSA-M 0.000 description 2
- GEYOCULIXLDCMW-UHFFFAOYSA-N 1,2-phenylenediamine Chemical compound NC1=CC=CC=C1N GEYOCULIXLDCMW-UHFFFAOYSA-N 0.000 description 2
- HZAXFHJVJLSVMW-UHFFFAOYSA-N 2-Aminoethan-1-ol Chemical compound NCCO HZAXFHJVJLSVMW-UHFFFAOYSA-N 0.000 description 2
- CIVGYTYIDWRBQU-UFLZEWODSA-N 5-[(3as,4s,6ar)-2-oxo-1,3,3a,4,6,6a-hexahydrothieno[3,4-d]imidazol-4-yl]pentanoic acid;pyrrole-2,5-dione Chemical compound O=C1NC(=O)C=C1.N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 CIVGYTYIDWRBQU-UFLZEWODSA-N 0.000 description 2
- VVIAGPKUTFNRDU-UHFFFAOYSA-N 6S-folinic acid Natural products C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-UHFFFAOYSA-N 0.000 description 2
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 2
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 2
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 108020003591 B-Form DNA Proteins 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- 102000002086 C-type lectin-like Human genes 0.000 description 2
- 108050009406 C-type lectin-like Proteins 0.000 description 2
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 description 2
- 108050005493 CD3 protein, epsilon/gamma/delta subunit Proteins 0.000 description 2
- GAGWJHPBXLXJQN-UORFTKCHSA-N Capecitabine Chemical compound C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](C)O1 GAGWJHPBXLXJQN-UORFTKCHSA-N 0.000 description 2
- 201000009030 Carcinoma Diseases 0.000 description 2
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 2
- 108020004705 Codon Proteins 0.000 description 2
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 2
- 108010092160 Dactinomycin Proteins 0.000 description 2
- 206010061818 Disease progression Diseases 0.000 description 2
- 241000196324 Embryophyta Species 0.000 description 2
- VWUXBMIQPBEWFH-WCCTWKNTSA-N Fulvestrant Chemical compound OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3[C@H](CCCCCCCCCS(=O)CCCC(F)(F)C(F)(F)F)CC2=C1 VWUXBMIQPBEWFH-WCCTWKNTSA-N 0.000 description 2
- 102000003886 Glycoproteins Human genes 0.000 description 2
- 108090000288 Glycoproteins Proteins 0.000 description 2
- 102220531903 Guanylate cyclase soluble subunit beta-2_Y55C_mutation Human genes 0.000 description 2
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 description 2
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 2
- 208000008839 Kidney Neoplasms Diseases 0.000 description 2
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical group OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 2
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 2
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 2
- 239000005551 L01XE03 - Erlotinib Substances 0.000 description 2
- 239000002147 L01XE04 - Sunitinib Substances 0.000 description 2
- 239000005511 L01XE05 - Sorafenib Substances 0.000 description 2
- 239000002136 L01XE07 - Lapatinib Substances 0.000 description 2
- 206010025323 Lymphomas Diseases 0.000 description 2
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- 229940124647 MEK inhibitor Drugs 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 101100327295 Mus musculus Cd22 gene Proteins 0.000 description 2
- 101100335081 Mus musculus Flt3 gene Proteins 0.000 description 2
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 2
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 2
- 238000005481 NMR spectroscopy Methods 0.000 description 2
- 108091005461 Nucleic proteins Chemical group 0.000 description 2
- 208000008589 Obesity Diseases 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 102000004316 Oxidoreductases Human genes 0.000 description 2
- 108090000854 Oxidoreductases Proteins 0.000 description 2
- 229910019142 PO4 Inorganic materials 0.000 description 2
- 229930012538 Paclitaxel Natural products 0.000 description 2
- 108010067902 Peptide Library Proteins 0.000 description 2
- 206010035226 Plasma cell myeloma Diseases 0.000 description 2
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M Potassium chloride Chemical compound [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 description 2
- 101710193132 Pre-hexon-linking protein VIII Proteins 0.000 description 2
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- 238000011529 RT qPCR Methods 0.000 description 2
- 101710100969 Receptor tyrosine-protein kinase erbB-3 Proteins 0.000 description 2
- 102100029986 Receptor tyrosine-protein kinase erbB-3 Human genes 0.000 description 2
- 102100029981 Receptor tyrosine-protein kinase erbB-4 Human genes 0.000 description 2
- 101710100963 Receptor tyrosine-protein kinase erbB-4 Proteins 0.000 description 2
- 206010038389 Renal cancer Diseases 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 208000005718 Stomach Neoplasms Diseases 0.000 description 2
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 description 2
- CBPNZQVSJQDFBE-FUXHJELOSA-N Temsirolimus Chemical compound C1C[C@@H](OC(=O)C(C)(CO)CO)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 CBPNZQVSJQDFBE-FUXHJELOSA-N 0.000 description 2
- 239000007983 Tris buffer Substances 0.000 description 2
- VGQOVCHZGQWAOI-UHFFFAOYSA-N UNPD55612 Natural products N1C(O)C2CC(C=CC(N)=O)=CN2C(=O)C2=CC=C(C)C(O)=C12 VGQOVCHZGQWAOI-UHFFFAOYSA-N 0.000 description 2
- NLMBVBUNULOTNS-HOKPPMCLSA-N [4-[[(2s)-5-(carbamoylamino)-2-[[(2s)-2-[6-(2,5-dioxopyrrol-1-yl)hexanoylamino]-3-methylbutanoyl]amino]pentanoyl]amino]phenyl]methyl n-[(2s)-1-[[(2s)-1-[[(3r,4s,5s)-1-[(2s)-2-[(1r,2r)-3-[[(1s,2r)-1-hydroxy-1-phenylpropan-2-yl]amino]-1-methoxy-2-methyl-3-o Chemical compound C1([C@H](O)[C@@H](C)NC(=O)[C@H](C)[C@@H](OC)[C@@H]2CCCN2C(=O)C[C@H]([C@H]([C@@H](C)CC)N(C)C(=O)[C@@H](NC(=O)[C@H](C(C)C)N(C)C(=O)OCC=2C=CC(NC(=O)[C@H](CCCNC(N)=O)NC(=O)[C@@H](NC(=O)CCCCCN3C(C=CC3=O)=O)C(C)C)=CC=2)C(C)C)OC)=CC=CC=C1 NLMBVBUNULOTNS-HOKPPMCLSA-N 0.000 description 2
- 238000002835 absorbance Methods 0.000 description 2
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin D Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 description 2
- 101150115889 al gene Proteins 0.000 description 2
- 230000004075 alteration Effects 0.000 description 2
- 238000006470 amide elimination reaction Methods 0.000 description 2
- 150000001408 amides Chemical class 0.000 description 2
- VGQOVCHZGQWAOI-HYUHUPJXSA-N anthramycin Chemical compound N1[C@@H](O)[C@@H]2CC(\C=C\C(N)=O)=CN2C(=O)C2=CC=C(C)C(O)=C12 VGQOVCHZGQWAOI-HYUHUPJXSA-N 0.000 description 2
- 230000000843 anti-fungal effect Effects 0.000 description 2
- 230000000340 anti-metabolite Effects 0.000 description 2
- 230000000259 anti-tumor effect Effects 0.000 description 2
- 230000000890 antigenic effect Effects 0.000 description 2
- 229940100197 antimetabolite Drugs 0.000 description 2
- 239000002256 antimetabolite Substances 0.000 description 2
- 239000011324 bead Substances 0.000 description 2
- 102000005936 beta-Galactosidase Human genes 0.000 description 2
- 108010005774 beta-Galactosidase Proteins 0.000 description 2
- 230000003115 biocidal effect Effects 0.000 description 2
- 238000001815 biotherapy Methods 0.000 description 2
- 230000006287 biotinylation Effects 0.000 description 2
- 238000007413 biotinylation Methods 0.000 description 2
- GXJABQQUPOEUTA-RDJZCZTQSA-N bortezomib Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)B(O)O)NC(=O)C=1N=CC=NC=1)C1=CC=CC=C1 GXJABQQUPOEUTA-RDJZCZTQSA-N 0.000 description 2
- 229940098773 bovine serum albumin Drugs 0.000 description 2
- 229960004562 carboplatin Drugs 0.000 description 2
- YAYRGNWWLMLWJE-UHFFFAOYSA-L carboplatin Chemical compound O=C1O[Pt](N)(N)OC(=O)C11CCC1 YAYRGNWWLMLWJE-UHFFFAOYSA-L 0.000 description 2
- 238000012219 cassette mutagenesis Methods 0.000 description 2
- 230000010261 cell growth Effects 0.000 description 2
- 230000015861 cell surface binding Effects 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 239000013522 chelant Substances 0.000 description 2
- 239000003638 chemical reducing agent Substances 0.000 description 2
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 2
- 229960004316 cisplatin Drugs 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 238000004590 computer program Methods 0.000 description 2
- 238000012790 confirmation Methods 0.000 description 2
- 238000010168 coupling process Methods 0.000 description 2
- 210000005220 cytoplasmic tail Anatomy 0.000 description 2
- 230000006378 damage Effects 0.000 description 2
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 230000017858 demethylation Effects 0.000 description 2
- 238000010520 demethylation reaction Methods 0.000 description 2
- 238000001212 derivatisation Methods 0.000 description 2
- 238000003745 diagnosis Methods 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- 229960005156 digoxin Drugs 0.000 description 2
- 230000003292 diminished effect Effects 0.000 description 2
- 230000005750 disease progression Effects 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 150000002019 disulfides Chemical class 0.000 description 2
- 229960004679 doxorubicin Drugs 0.000 description 2
- 239000000975 dye Substances 0.000 description 2
- VLCYCQAOQCDTCN-UHFFFAOYSA-N eflornithine Chemical compound NCCCC(N)(C(F)F)C(O)=O VLCYCQAOQCDTCN-UHFFFAOYSA-N 0.000 description 2
- 238000000132 electrospray ionisation Methods 0.000 description 2
- 230000002255 enzymatic effect Effects 0.000 description 2
- AAKJLRGGTJKAMG-UHFFFAOYSA-N erlotinib Chemical compound C=12C=C(OCCOC)C(OCCOC)=CC2=NC=NC=1NC1=CC=CC(C#C)=C1 AAKJLRGGTJKAMG-UHFFFAOYSA-N 0.000 description 2
- 238000000855 fermentation Methods 0.000 description 2
- 230000004151 fermentation Effects 0.000 description 2
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 2
- 238000002509 fluorescent in situ hybridization Methods 0.000 description 2
- OVBPIULPVIDEAO-LBPRGKRZSA-N folic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-LBPRGKRZSA-N 0.000 description 2
- VVIAGPKUTFNRDU-ABLWVSNPSA-N folinic acid Chemical compound C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-ABLWVSNPSA-N 0.000 description 2
- 235000008191 folinic acid Nutrition 0.000 description 2
- 239000011672 folinic acid Substances 0.000 description 2
- 238000009472 formulation Methods 0.000 description 2
- CHPZKNULDCNCBW-UHFFFAOYSA-N gallium nitrate Chemical compound [Ga+3].[O-][N+]([O-])=O.[O-][N+]([O-])=O.[O-][N+]([O-])=O CHPZKNULDCNCBW-UHFFFAOYSA-N 0.000 description 2
- 206010017758 gastric cancer Diseases 0.000 description 2
- XGALLCVXEZPNRQ-UHFFFAOYSA-N gefitinib Chemical compound C=12C=C(OCCCN3CCOCC3)C(OC)=CC2=NC=NC=1NC1=CC=C(F)C(Cl)=C1 XGALLCVXEZPNRQ-UHFFFAOYSA-N 0.000 description 2
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 2
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 2
- 210000003714 granulocyte Anatomy 0.000 description 2
- 239000003102 growth factor Substances 0.000 description 2
- 125000005179 haloacetyl group Chemical group 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 2
- 210000004408 hybridoma Anatomy 0.000 description 2
- 230000007062 hydrolysis Effects 0.000 description 2
- 238000006460 hydrolysis reaction Methods 0.000 description 2
- 125000004029 hydroxymethyl group Chemical group [H]OC([H])([H])* 0.000 description 2
- 229960001101 ifosfamide Drugs 0.000 description 2
- HOMGKSMUEGBAAB-UHFFFAOYSA-N ifosfamide Chemical compound ClCCNP1(=O)OCCCN1CCCl HOMGKSMUEGBAAB-UHFFFAOYSA-N 0.000 description 2
- YLMAHDNUQAMNNX-UHFFFAOYSA-N imatinib methanesulfonate Chemical compound CS(O)(=O)=O.C1CN(C)CCN1CC1=CC=C(C(=O)NC=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=CC=2)C=C1 YLMAHDNUQAMNNX-UHFFFAOYSA-N 0.000 description 2
- 125000000879 imine group Chemical group 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 238000011065 in-situ storage Methods 0.000 description 2
- 208000015181 infectious disease Diseases 0.000 description 2
- 230000002458 infectious effect Effects 0.000 description 2
- 239000003112 inhibitor Substances 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 201000010982 kidney cancer Diseases 0.000 description 2
- HPJKCIUCZWXJDR-UHFFFAOYSA-N letrozole Chemical compound C1=CC(C#N)=CC=C1C(N1N=CN=C1)C1=CC=C(C#N)C=C1 HPJKCIUCZWXJDR-UHFFFAOYSA-N 0.000 description 2
- 229960001691 leucovorin Drugs 0.000 description 2
- 208000032839 leukemia Diseases 0.000 description 2
- 108020001756 ligand binding domains Proteins 0.000 description 2
- 238000004811 liquid chromatography Methods 0.000 description 2
- 208000014018 liver neoplasm Diseases 0.000 description 2
- DHMTURDWPRKSOA-RUZDIDTESA-N lonafarnib Chemical compound C1CN(C(=O)N)CCC1CC(=O)N1CCC([C@@H]2C3=C(Br)C=C(Cl)C=C3CCC3=CC(Br)=CN=C32)CC1 DHMTURDWPRKSOA-RUZDIDTESA-N 0.000 description 2
- 210000004698 lymphocyte Anatomy 0.000 description 2
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- 230000036210 malignancy Effects 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 230000010534 mechanism of action Effects 0.000 description 2
- 229960001428 mercaptopurine Drugs 0.000 description 2
- 230000008880 microtubule cytoskeleton organization Effects 0.000 description 2
- 239000002829 mitogen activated protein kinase inhibitor Substances 0.000 description 2
- 230000011278 mitosis Effects 0.000 description 2
- 229960001156 mitoxantrone Drugs 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 210000001616 monocyte Anatomy 0.000 description 2
- 239000000178 monomer Substances 0.000 description 2
- 201000000050 myeloid neoplasm Diseases 0.000 description 2
- QZGIWPZCWHMVQL-UIYAJPBUSA-N neocarzinostatin chromophore Chemical compound O1[C@H](C)[C@H](O)[C@H](O)[C@@H](NC)[C@H]1O[C@@H]1C/2=C/C#C[C@H]3O[C@@]3([C@@H]3OC(=O)OC3)C#CC\2=C[C@H]1OC(=O)C1=C(O)C=CC2=C(C)C=C(OC)C=C12 QZGIWPZCWHMVQL-UIYAJPBUSA-N 0.000 description 2
- 108010068617 neonatal Fc receptor Proteins 0.000 description 2
- QJGQUHMNIGDVPM-UHFFFAOYSA-N nitrogen group Chemical group [N] QJGQUHMNIGDVPM-UHFFFAOYSA-N 0.000 description 2
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 2
- 235000020824 obesity Nutrition 0.000 description 2
- 238000011275 oncology therapy Methods 0.000 description 2
- 150000002894 organic compounds Chemical class 0.000 description 2
- 230000002018 overexpression Effects 0.000 description 2
- 239000007800 oxidant agent Substances 0.000 description 2
- 229960001592 paclitaxel Drugs 0.000 description 2
- 229940124633 peptidic drug Drugs 0.000 description 2
- 125000001151 peptidyl group Chemical group 0.000 description 2
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 2
- 230000003285 pharmacodynamic effect Effects 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 229940002612 prodrug Drugs 0.000 description 2
- 239000000651 prodrug Substances 0.000 description 2
- 238000000159 protein binding assay Methods 0.000 description 2
- 230000005180 public health Effects 0.000 description 2
- RXWNCPJZOCPEPQ-NVWDDTSBSA-N puromycin Chemical compound C1=CC(OC)=CC=C1C[C@H](N)C(=O)N[C@H]1[C@@H](O)[C@H](N2C3=NC=NC(=C3N=C2)N(C)C)O[C@@H]1CO RXWNCPJZOCPEPQ-NVWDDTSBSA-N 0.000 description 2
- 239000012217 radiopharmaceutical Substances 0.000 description 2
- 229940121896 radiopharmaceutical Drugs 0.000 description 2
- 230000002799 radiopharmaceutical effect Effects 0.000 description 2
- 102000037983 regulatory factors Human genes 0.000 description 2
- 108091008025 regulatory factors Proteins 0.000 description 2
- 125000006853 reporter group Chemical group 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- 206010039073 rheumatoid arthritis Diseases 0.000 description 2
- 102200141019 rs11545137 Human genes 0.000 description 2
- 102220238255 rs1556856142 Human genes 0.000 description 2
- 102220201386 rs752794296 Human genes 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- CYOHGALHFOKKQC-UHFFFAOYSA-N selumetinib Chemical compound OCCONC(=O)C=1C=C2N(C)C=NC2=C(F)C=1NC1=CC=C(Br)C=C1Cl CYOHGALHFOKKQC-UHFFFAOYSA-N 0.000 description 2
- 230000011664 signaling Effects 0.000 description 2
- 230000003007 single stranded DNA break Effects 0.000 description 2
- 238000002603 single-photon emission computed tomography Methods 0.000 description 2
- 238000001542 size-exclusion chromatography Methods 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 239000007790 solid phase Substances 0.000 description 2
- 229960003787 sorafenib Drugs 0.000 description 2
- 208000017572 squamous cell neoplasm Diseases 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 239000007858 starting material Substances 0.000 description 2
- 201000011549 stomach cancer Diseases 0.000 description 2
- PVYJZLYGTZKPJE-UHFFFAOYSA-N streptonigrin Chemical compound C=1C=C2C(=O)C(OC)=C(N)C(=O)C2=NC=1C(C=1N)=NC(C(O)=O)=C(C)C=1C1=CC=C(OC)C(OC)=C1O PVYJZLYGTZKPJE-UHFFFAOYSA-N 0.000 description 2
- WINHZLLDWRZWRT-ATVHPVEESA-N sunitinib Chemical compound CCN(CC)CCNC(=O)C1=C(C)NC(\C=C/2C3=CC(F)=CC=C3NC\2=O)=C1C WINHZLLDWRZWRT-ATVHPVEESA-N 0.000 description 2
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 238000001308 synthesis method Methods 0.000 description 2
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 2
- 229960004964 temozolomide Drugs 0.000 description 2
- 229960001196 thiotepa Drugs 0.000 description 2
- 229960003087 tioguanine Drugs 0.000 description 2
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 2
- 102000035160 transmembrane proteins Human genes 0.000 description 2
- 108091005703 transmembrane proteins Proteins 0.000 description 2
- 102000027257 transmembrane receptors Human genes 0.000 description 2
- 108091008578 transmembrane receptors Proteins 0.000 description 2
- LWIHDJKSTIGBAC-UHFFFAOYSA-K tripotassium phosphate Chemical compound [K+].[K+].[K+].[O-]P([O-])([O-])=O LWIHDJKSTIGBAC-UHFFFAOYSA-K 0.000 description 2
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 2
- 125000000430 tryptophan group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C2=C([H])C([H])=C([H])C([H])=C12 0.000 description 2
- 229930184737 tubulysin Natural products 0.000 description 2
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- NNJPGOLRFBJNIW-HNNXBMFYSA-N (-)-demecolcine Chemical compound C1=C(OC)C(=O)C=C2[C@@H](NC)CCC3=CC(OC)=C(OC)C(OC)=C3C2=C1 NNJPGOLRFBJNIW-HNNXBMFYSA-N 0.000 description 1
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- WDQLRUYAYXDIFW-RWKIJVEZSA-N (2r,3r,4s,5r,6r)-4-[(2s,3r,4s,5r,6r)-3,5-dihydroxy-4-[(2r,3r,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-6-[[(2r,3r,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxymethyl]oxan-2-yl]oxy-6-(hydroxymethyl)oxane-2,3,5-triol Chemical compound O[C@@H]1[C@@H](CO)O[C@@H](O)[C@H](O)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)O)[C@H](O)[C@@H](CO[C@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)O)O1 WDQLRUYAYXDIFW-RWKIJVEZSA-N 0.000 description 1
- SVNJBEMPMKWDCO-KCHLEUMXSA-N (2s)-2-[[(2s)-3-carboxy-2-[[2-[[(2s)-5-(diaminomethylideneamino)-2-[[4-oxo-4-[[4-(4-oxo-8-phenylchromen-2-yl)morpholin-4-ium-4-yl]methoxy]butanoyl]amino]pentanoyl]amino]acetyl]amino]propanoyl]amino]-3-hydroxypropanoate Chemical compound C=1C(=O)C2=CC=CC(C=3C=CC=CC=3)=C2OC=1[N+]1(COC(=O)CCC(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C([O-])=O)CCOCC1 SVNJBEMPMKWDCO-KCHLEUMXSA-N 0.000 description 1
- FLWWDYNPWOSLEO-HQVZTVAUSA-N (2s)-2-[[4-[1-(2-amino-4-oxo-1h-pteridin-6-yl)ethyl-methylamino]benzoyl]amino]pentanedioic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1C(C)N(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FLWWDYNPWOSLEO-HQVZTVAUSA-N 0.000 description 1
- NECZZOFFLFZNHL-XVGZVFJZSA-N (2s)-2-amino-5-[[(2r)-3-[2-[bis[bis(2-chloroethyl)amino]-oxidophosphaniumyl]oxyethylsulfonyl]-1-[[(r)-carboxy(phenyl)methyl]amino]-1-oxopropan-2-yl]amino]-5-oxopentanoic acid;hydron;chloride Chemical compound Cl.ClCCN(CCCl)P(=O)(N(CCCl)CCCl)OCCS(=O)(=O)C[C@H](NC(=O)CC[C@H](N)C(O)=O)C(=O)N[C@@H](C(O)=O)C1=CC=CC=C1 NECZZOFFLFZNHL-XVGZVFJZSA-N 0.000 description 1
- CGMTUJFWROPELF-YPAAEMCBSA-N (3E,5S)-5-[(2S)-butan-2-yl]-3-(1-hydroxyethylidene)pyrrolidine-2,4-dione Chemical compound CC[C@H](C)[C@@H]1NC(=O)\C(=C(/C)O)C1=O CGMTUJFWROPELF-YPAAEMCBSA-N 0.000 description 1
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 1
- TVIRNGFXQVMMGB-OFWIHYRESA-N (3s,6r,10r,13e,16s)-16-[(2r,3r,4s)-4-chloro-3-hydroxy-4-phenylbutan-2-yl]-10-[(3-chloro-4-methoxyphenyl)methyl]-6-methyl-3-(2-methylpropyl)-1,4-dioxa-8,11-diazacyclohexadec-13-ene-2,5,9,12-tetrone Chemical compound C1=C(Cl)C(OC)=CC=C1C[C@@H]1C(=O)NC[C@@H](C)C(=O)O[C@@H](CC(C)C)C(=O)O[C@H]([C@H](C)[C@@H](O)[C@@H](Cl)C=2C=CC=CC=2)C/C=C/C(=O)N1 TVIRNGFXQVMMGB-OFWIHYRESA-N 0.000 description 1
- XRBSKUSTLXISAB-XVVDYKMHSA-N (5r,6r,7r,8r)-8-hydroxy-7-(hydroxymethyl)-5-(3,4,5-trimethoxyphenyl)-5,6,7,8-tetrahydrobenzo[f][1,3]benzodioxole-6-carboxylic acid Chemical compound COC1=C(OC)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@H](O)[C@@H](CO)[C@@H]2C(O)=O)=C1 XRBSKUSTLXISAB-XVVDYKMHSA-N 0.000 description 1
- OMJKFYKNWZZKTK-POHAHGRESA-N (5z)-5-(dimethylaminohydrazinylidene)imidazole-4-carboxamide Chemical compound CN(C)N\N=C1/N=CN=C1C(N)=O OMJKFYKNWZZKTK-POHAHGRESA-N 0.000 description 1
- XRBSKUSTLXISAB-UHFFFAOYSA-N (7R,7'R,8R,8'R)-form-Podophyllic acid Natural products COC1=C(OC)C(OC)=CC(C2C3=CC=4OCOC=4C=C3C(O)C(CO)C2C(O)=O)=C1 XRBSKUSTLXISAB-UHFFFAOYSA-N 0.000 description 1
- AESVUZLWRXEGEX-DKCAWCKPSA-N (7S,9R)-7-[(2S,4R,5R,6R)-4-amino-5-hydroxy-6-methyloxan-2-yl]oxy-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-4-methoxy-8,10-dihydro-7H-tetracene-5,12-dione iron(3+) Chemical compound [Fe+3].COc1cccc2C(=O)c3c(O)c4C[C@@](O)(C[C@H](O[C@@H]5C[C@@H](N)[C@@H](O)[C@@H](C)O5)c4c(O)c3C(=O)c12)C(=O)CO AESVUZLWRXEGEX-DKCAWCKPSA-N 0.000 description 1
- JXVAMODRWBNUSF-KZQKBALLSA-N (7s,9r,10r)-7-[(2r,4s,5s,6s)-5-[[(2s,4as,5as,7s,9s,9ar,10ar)-2,9-dimethyl-3-oxo-4,4a,5a,6,7,9,9a,10a-octahydrodipyrano[4,2-a:4',3'-e][1,4]dioxin-7-yl]oxy]-4-(dimethylamino)-6-methyloxan-2-yl]oxy-10-[(2s,4s,5s,6s)-4-(dimethylamino)-5-hydroxy-6-methyloxan-2 Chemical compound O([C@@H]1C2=C(O)C=3C(=O)C4=CC=CC(O)=C4C(=O)C=3C(O)=C2[C@@H](O[C@@H]2O[C@@H](C)[C@@H](O[C@@H]3O[C@@H](C)[C@H]4O[C@@H]5O[C@@H](C)C(=O)C[C@@H]5O[C@H]4C3)[C@H](C2)N(C)C)C[C@]1(O)CC)[C@H]1C[C@H](N(C)C)[C@H](O)[C@H](C)O1 JXVAMODRWBNUSF-KZQKBALLSA-N 0.000 description 1
- INAUWOVKEZHHDM-PEDBPRJASA-N (7s,9s)-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-7-[(2r,4s,5s,6s)-5-hydroxy-6-methyl-4-morpholin-4-yloxan-2-yl]oxy-4-methoxy-8,10-dihydro-7h-tetracene-5,12-dione;hydrochloride Chemical compound Cl.N1([C@H]2C[C@@H](O[C@@H](C)[C@H]2O)O[C@H]2C[C@@](O)(CC=3C(O)=C4C(=O)C=5C=CC=C(C=5C(=O)C4=C(O)C=32)OC)C(=O)CO)CCOCC1 INAUWOVKEZHHDM-PEDBPRJASA-N 0.000 description 1
- RCFNNLSZHVHCEK-IMHLAKCZSA-N (7s,9s)-7-(4-amino-6-methyloxan-2-yl)oxy-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-4-methoxy-8,10-dihydro-7h-tetracene-5,12-dione;hydrochloride Chemical compound [Cl-].O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)C1CC([NH3+])CC(C)O1 RCFNNLSZHVHCEK-IMHLAKCZSA-N 0.000 description 1
- NOPNWHSMQOXAEI-PUCKCBAPSA-N (7s,9s)-7-[(2r,4s,5s,6s)-4-(2,3-dihydropyrrol-1-yl)-5-hydroxy-6-methyloxan-2-yl]oxy-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-4-methoxy-8,10-dihydro-7h-tetracene-5,12-dione Chemical compound N1([C@H]2C[C@@H](O[C@@H](C)[C@H]2O)O[C@H]2C[C@@](O)(CC=3C(O)=C4C(=O)C=5C=CC=C(C=5C(=O)C4=C(O)C=32)OC)C(=O)CO)CCC=C1 NOPNWHSMQOXAEI-PUCKCBAPSA-N 0.000 description 1
- FPVKHBSQESCIEP-UHFFFAOYSA-N (8S)-3-(2-deoxy-beta-D-erythro-pentofuranosyl)-3,6,7,8-tetrahydroimidazo[4,5-d][1,3]diazepin-8-ol Natural products C1C(O)C(CO)OC1N1C(NC=NCC2O)=C2N=C1 FPVKHBSQESCIEP-UHFFFAOYSA-N 0.000 description 1
- GHOKWGTUZJEAQD-ZETCQYMHSA-N (D)-(+)-Pantothenic acid Chemical compound OCC(C)(C)[C@@H](O)C(=O)NCCC(O)=O GHOKWGTUZJEAQD-ZETCQYMHSA-N 0.000 description 1
- AGNGYMCLFWQVGX-AGFFZDDWSA-N (e)-1-[(2s)-2-amino-2-carboxyethoxy]-2-diazonioethenolate Chemical compound OC(=O)[C@@H](N)CO\C([O-])=C\[N+]#N AGNGYMCLFWQVGX-AGFFZDDWSA-N 0.000 description 1
- FONKWHRXTPJODV-DNQXCXABSA-N 1,3-bis[2-[(8s)-8-(chloromethyl)-4-hydroxy-1-methyl-7,8-dihydro-3h-pyrrolo[3,2-e]indole-6-carbonyl]-1h-indol-5-yl]urea Chemical compound C1([C@H](CCl)CN2C(=O)C=3NC4=CC=C(C=C4C=3)NC(=O)NC=3C=C4C=C(NC4=CC=3)C(=O)N3C4=CC(O)=C5NC=C(C5=C4[C@H](CCl)C3)C)=C2C=C(O)C2=C1C(C)=CN2 FONKWHRXTPJODV-DNQXCXABSA-N 0.000 description 1
- DGHHQBMTXTWTJV-BQAIUKQQSA-N 119413-54-6 Chemical compound Cl.C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 DGHHQBMTXTWTJV-BQAIUKQQSA-N 0.000 description 1
- BTOTXLJHDSNXMW-POYBYMJQSA-N 2,3-dideoxyuridine Chemical compound O1[C@H](CO)CC[C@@H]1N1C(=O)NC(=O)C=C1 BTOTXLJHDSNXMW-POYBYMJQSA-N 0.000 description 1
- KGLPWQKSKUVKMJ-UHFFFAOYSA-N 2,3-dihydrophthalazine-1,4-dione Chemical class C1=CC=C2C(=O)NNC(=O)C2=C1 KGLPWQKSKUVKMJ-UHFFFAOYSA-N 0.000 description 1
- BOMZMNZEXMAQQW-UHFFFAOYSA-N 2,5,11-trimethyl-6h-pyrido[4,3-b]carbazol-2-ium-9-ol;acetate Chemical compound CC([O-])=O.C[N+]1=CC=C2C(C)=C(NC=3C4=CC(O)=CC=3)C4=C(C)C2=C1 BOMZMNZEXMAQQW-UHFFFAOYSA-N 0.000 description 1
- WXTMDXOMEHJXQO-UHFFFAOYSA-N 2,5-dihydroxybenzoic acid Chemical compound OC(=O)C1=CC(O)=CC=C1O WXTMDXOMEHJXQO-UHFFFAOYSA-N 0.000 description 1
- QEVGZEDELICMKH-UHFFFAOYSA-L 2-(carboxylatomethoxy)acetate Chemical compound [O-]C(=O)COCC([O-])=O QEVGZEDELICMKH-UHFFFAOYSA-L 0.000 description 1
- QCXJFISCRQIYID-IAEPZHFASA-N 2-amino-1-n-[(3s,6s,7r,10s,16s)-3-[(2s)-butan-2-yl]-7,11,14-trimethyl-2,5,9,12,15-pentaoxo-10-propan-2-yl-8-oxa-1,4,11,14-tetrazabicyclo[14.3.0]nonadecan-6-yl]-4,6-dimethyl-3-oxo-9-n-[(3s,6s,7r,10s,16s)-7,11,14-trimethyl-2,5,9,12,15-pentaoxo-3,10-di(propa Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N=C2C(C(=O)N[C@@H]3C(=O)N[C@H](C(N4CCC[C@H]4C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]3C)=O)[C@@H](C)CC)=C(N)C(=O)C(C)=C2O2)C2=C(C)C=C1 QCXJFISCRQIYID-IAEPZHFASA-N 0.000 description 1
- VNBAOSVONFJBKP-UHFFFAOYSA-N 2-chloro-n,n-bis(2-chloroethyl)propan-1-amine;hydrochloride Chemical compound Cl.CC(Cl)CN(CCCl)CCCl VNBAOSVONFJBKP-UHFFFAOYSA-N 0.000 description 1
- YIMDLWDNDGKDTJ-QLKYHASDSA-N 3'-deamino-3'-(3-cyanomorpholin-4-yl)doxorubicin Chemical compound N1([C@H]2C[C@@H](O[C@@H](C)[C@H]2O)O[C@H]2C[C@@](O)(CC=3C(O)=C4C(=O)C=5C=CC=C(C=5C(=O)C4=C(O)C=32)OC)C(=O)CO)CCOCC1C#N YIMDLWDNDGKDTJ-QLKYHASDSA-N 0.000 description 1
- NDMPLJNOPCLANR-UHFFFAOYSA-N 3,4-dihydroxy-15-(4-hydroxy-18-methoxycarbonyl-5,18-seco-ibogamin-18-yl)-16-methoxy-1-methyl-6,7-didehydro-aspidospermidine-3-carboxylic acid methyl ester Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 NDMPLJNOPCLANR-UHFFFAOYSA-N 0.000 description 1
- PWMYMKOUNYTVQN-UHFFFAOYSA-N 3-(8,8-diethyl-2-aza-8-germaspiro[4.5]decan-2-yl)-n,n-dimethylpropan-1-amine Chemical compound C1C[Ge](CC)(CC)CCC11CN(CCCN(C)C)CC1 PWMYMKOUNYTVQN-UHFFFAOYSA-N 0.000 description 1
- IWCQHVUQEFDRIW-UHFFFAOYSA-N 3-[1-[[4-(6-phenyl-8H-imidazo[4,5-g]quinoxalin-7-yl)phenyl]methyl]piperidin-4-yl]-1H-benzimidazol-2-one Chemical compound O=c1[nH]c2ccccc2n1C1CCN(Cc2ccc(cc2)-c2[nH]c3cc4ncnc4cc3nc2-c2ccccc2)CC1 IWCQHVUQEFDRIW-UHFFFAOYSA-N 0.000 description 1
- HVCOBJNICQPDBP-UHFFFAOYSA-N 3-[3-[3,5-dihydroxy-6-methyl-4-(3,4,5-trihydroxy-6-methyloxan-2-yl)oxyoxan-2-yl]oxydecanoyloxy]decanoic acid;hydrate Chemical compound O.OC1C(OC(CC(=O)OC(CCCCCCC)CC(O)=O)CCCCCCC)OC(C)C(O)C1OC1C(O)C(O)C(O)C(C)O1 HVCOBJNICQPDBP-UHFFFAOYSA-N 0.000 description 1
- FEWJPZIEWOKRBE-UHFFFAOYSA-M 3-carboxy-2,3-dihydroxypropanoate Chemical compound OC(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-M 0.000 description 1
- AOJJSUZBOXZQNB-VTZDEGQISA-N 4'-epidoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-VTZDEGQISA-N 0.000 description 1
- OBWSOTREAMFOCQ-UHFFFAOYSA-N 4-(4-amino-3,5-dimethylphenyl)-2,6-dimethylaniline;hydrochloride Chemical compound Cl.CC1=C(N)C(C)=CC(C=2C=C(C)C(N)=C(C)C=2)=C1 OBWSOTREAMFOCQ-UHFFFAOYSA-N 0.000 description 1
- XZKIHKMTEMTJQX-UHFFFAOYSA-N 4-Nitrophenyl Phosphate Chemical compound OP(O)(=O)OC1=CC=C([N+]([O-])=O)C=C1 XZKIHKMTEMTJQX-UHFFFAOYSA-N 0.000 description 1
- QFVHZQCOUORWEI-UHFFFAOYSA-N 4-[(4-anilino-5-sulfonaphthalen-1-yl)diazenyl]-5-hydroxynaphthalene-2,7-disulfonic acid Chemical compound C=12C(O)=CC(S(O)(=O)=O)=CC2=CC(S(O)(=O)=O)=CC=1N=NC(C1=CC=CC(=C11)S(O)(=O)=O)=CC=C1NC1=CC=CC=C1 QFVHZQCOUORWEI-UHFFFAOYSA-N 0.000 description 1
- TVZGACDUOSZQKY-LBPRGKRZSA-N 4-aminofolic acid Chemical compound C1=NC2=NC(N)=NC(N)=C2N=C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 TVZGACDUOSZQKY-LBPRGKRZSA-N 0.000 description 1
- IDPUKCWIGUEADI-UHFFFAOYSA-N 5-[bis(2-chloroethyl)amino]uracil Chemical compound ClCCN(CCCl)C1=CNC(=O)NC1=O IDPUKCWIGUEADI-UHFFFAOYSA-N 0.000 description 1
- NMUSYJAQQFHJEW-KVTDHHQDSA-N 5-azacytidine Chemical compound O=C1N=C(N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 NMUSYJAQQFHJEW-KVTDHHQDSA-N 0.000 description 1
- NJYVEMPWNAYQQN-UHFFFAOYSA-N 5-carboxyfluorescein Chemical compound C12=CC=C(O)C=C2OC2=CC(O)=CC=C2C21OC(=O)C1=CC(C(=O)O)=CC=C21 NJYVEMPWNAYQQN-UHFFFAOYSA-N 0.000 description 1
- WYXSYVWAUAUWLD-SHUUEZRQSA-N 6-azauridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=N1 WYXSYVWAUAUWLD-SHUUEZRQSA-N 0.000 description 1
- BZTDTCNHAFUJOG-UHFFFAOYSA-N 6-carboxyfluorescein Chemical compound C12=CC=C(O)C=C2OC2=CC(O)=CC=C2C11OC(=O)C2=CC=C(C(=O)O)C=C21 BZTDTCNHAFUJOG-UHFFFAOYSA-N 0.000 description 1
- YCWQAMGASJSUIP-YFKPBYRVSA-N 6-diazo-5-oxo-L-norleucine Chemical compound OC(=O)[C@@H](N)CCC(=O)C=[N+]=[N-] YCWQAMGASJSUIP-YFKPBYRVSA-N 0.000 description 1
- 229960005538 6-diazo-5-oxo-L-norleucine Drugs 0.000 description 1
- 102100031126 6-phosphogluconolactonase Human genes 0.000 description 1
- 108010029731 6-phosphogluconolactonase Proteins 0.000 description 1
- HBAQYPYDRFILMT-UHFFFAOYSA-N 8-[3-(1-cyclopropylpyrazol-4-yl)-1H-pyrazolo[4,3-d]pyrimidin-5-yl]-3-methyl-3,8-diazabicyclo[3.2.1]octan-2-one Chemical class C1(CC1)N1N=CC(=C1)C1=NNC2=C1N=C(N=C2)N1C2C(N(CC1CC2)C)=O HBAQYPYDRFILMT-UHFFFAOYSA-N 0.000 description 1
- ZGXJTSGNIOSYLO-UHFFFAOYSA-N 88755TAZ87 Chemical compound NCC(=O)CCC(O)=O ZGXJTSGNIOSYLO-UHFFFAOYSA-N 0.000 description 1
- HDZZVAMISRMYHH-UHFFFAOYSA-N 9beta-Ribofuranosyl-7-deazaadenin Natural products C1=CC=2C(N)=NC=NC=2N1C1OC(CO)C(O)C1O HDZZVAMISRMYHH-UHFFFAOYSA-N 0.000 description 1
- 208000030507 AIDS Diseases 0.000 description 1
- 241000186046 Actinomyces Species 0.000 description 1
- CEIZFXOZIQNICU-UHFFFAOYSA-N Alternaria alternata Crofton-weed toxin Natural products CCC(C)C1NC(=O)C(C(C)=O)=C1O CEIZFXOZIQNICU-UHFFFAOYSA-N 0.000 description 1
- 206010061424 Anal cancer Diseases 0.000 description 1
- 101100330723 Arabidopsis thaliana DAR2 gene Proteins 0.000 description 1
- 101100067974 Arabidopsis thaliana POP2 gene Proteins 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- NOWKCMXCCJGMRR-UHFFFAOYSA-N Aziridine Chemical class C1CN1 NOWKCMXCCJGMRR-UHFFFAOYSA-N 0.000 description 1
- 230000024704 B cell apoptotic process Effects 0.000 description 1
- 101710166261 B-cell antigen receptor complex-associated protein beta chain Proteins 0.000 description 1
- 101710187595 B-cell receptor CD22 Proteins 0.000 description 1
- 230000003844 B-cell-activation Effects 0.000 description 1
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 1
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 108090000363 Bacterial Luciferases Proteins 0.000 description 1
- VGGGPCQERPFHOB-MCIONIFRSA-N Bestatin Chemical compound CC(C)C[C@H](C(O)=O)NC(=O)[C@@H](O)[C@H](N)CC1=CC=CC=C1 VGGGPCQERPFHOB-MCIONIFRSA-N 0.000 description 1
- 229940122361 Bisphosphonate Drugs 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 206010051728 Bone erosion Diseases 0.000 description 1
- 102100027052 Bone morphogenetic protein receptor type-1B Human genes 0.000 description 1
- 101710140080 Brevican core protein Proteins 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-M Bromide Chemical compound [Br-] CPELXLSAUQHCOX-UHFFFAOYSA-M 0.000 description 1
- MBABCNBNDNGODA-LTGLSHGVSA-N Bullatacin Natural products O=C1C(C[C@H](O)CCCCCCCCCC[C@@H](O)[C@@H]2O[C@@H]([C@@H]3O[C@H]([C@@H](O)CCCCCCCCCC)CC3)CC2)=C[C@H](C)O1 MBABCNBNDNGODA-LTGLSHGVSA-N 0.000 description 1
- KGGVWMAPBXIMEM-ZRTAFWODSA-N Bullatacinone Chemical compound O1[C@@H]([C@@H](O)CCCCCCCCCC)CC[C@@H]1[C@@H]1O[C@@H]([C@H](O)CCCCCCCCCC[C@H]2OC(=O)[C@H](CC(C)=O)C2)CC1 KGGVWMAPBXIMEM-ZRTAFWODSA-N 0.000 description 1
- KGGVWMAPBXIMEM-JQFCFGFHSA-N Bullatacinone Natural products O=C(C[C@H]1C(=O)O[C@H](CCCCCCCCCC[C@H](O)[C@@H]2O[C@@H]([C@@H]3O[C@@H]([C@@H](O)CCCCCCCCCC)CC3)CC2)C1)C KGGVWMAPBXIMEM-JQFCFGFHSA-N 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- FERIUCNNQQJTOY-UHFFFAOYSA-N Butyric acid Natural products CCCC(O)=O FERIUCNNQQJTOY-UHFFFAOYSA-N 0.000 description 1
- 108090000342 C-Type Lectins Proteins 0.000 description 1
- 102000003930 C-Type Lectins Human genes 0.000 description 1
- 101150013553 CD40 gene Proteins 0.000 description 1
- 108010021064 CTLA-4 Antigen Proteins 0.000 description 1
- 229940045513 CTLA4 antagonist Drugs 0.000 description 1
- 101100289995 Caenorhabditis elegans mac-1 gene Proteins 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- KLWPJMFMVPTNCC-UHFFFAOYSA-N Camptothecin Natural products CCC1(O)C(=O)OCC2=C1C=C3C4Nc5ccccc5C=C4CN3C2=O KLWPJMFMVPTNCC-UHFFFAOYSA-N 0.000 description 1
- GAGWJHPBXLXJQN-UHFFFAOYSA-N Capecitabine Natural products C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1C1C(O)C(O)C(C)O1 GAGWJHPBXLXJQN-UHFFFAOYSA-N 0.000 description 1
- KXDHJXZQYSOELW-UHFFFAOYSA-M Carbamate Chemical compound NC([O-])=O KXDHJXZQYSOELW-UHFFFAOYSA-M 0.000 description 1
- SHHKQEUPHAENFK-UHFFFAOYSA-N Carboquone Chemical compound O=C1C(C)=C(N2CC2)C(=O)C(C(COC(N)=O)OC)=C1N1CC1 SHHKQEUPHAENFK-UHFFFAOYSA-N 0.000 description 1
- AOCCBINRVIKJHY-UHFFFAOYSA-N Carmofur Chemical compound CCCCCCNC(=O)N1C=C(F)C(=O)NC1=O AOCCBINRVIKJHY-UHFFFAOYSA-N 0.000 description 1
- DLGOEMSEDOSKAD-UHFFFAOYSA-N Carmustine Chemical compound ClCCNC(=O)N(N=O)CCCl DLGOEMSEDOSKAD-UHFFFAOYSA-N 0.000 description 1
- 108010067225 Cell Adhesion Molecules Proteins 0.000 description 1
- 102000016289 Cell Adhesion Molecules Human genes 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- 108010008955 Chemokine CXCL13 Proteins 0.000 description 1
- 102000006574 Chemokine CXCL13 Human genes 0.000 description 1
- JWBOIMRXGHLCPP-UHFFFAOYSA-N Chloditan Chemical compound C=1C=CC=C(Cl)C=1C(C(Cl)Cl)C1=CC=C(Cl)C=C1 JWBOIMRXGHLCPP-UHFFFAOYSA-N 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 1
- XCDXSSFOJZZGQC-UHFFFAOYSA-N Chlornaphazine Chemical compound C1=CC=CC2=CC(N(CCCl)CCCl)=CC=C21 XCDXSSFOJZZGQC-UHFFFAOYSA-N 0.000 description 1
- MKQWTWSXVILIKJ-LXGUWJNJSA-N Chlorozotocin Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](C=O)NC(=O)N(N=O)CCCl MKQWTWSXVILIKJ-LXGUWJNJSA-N 0.000 description 1
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 102000036364 Cullin Ring E3 Ligases Human genes 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 1
- 102100037579 D-3-phosphoglycerate dehydrogenase Human genes 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- DSLZVSRJTYRBFB-LLEIAEIESA-N D-glucaric acid Chemical compound OC(=O)[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(O)=O DSLZVSRJTYRBFB-LLEIAEIESA-N 0.000 description 1
- RGHNJXZEOKUKBD-SQOUGZDYSA-M D-gluconate Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O RGHNJXZEOKUKBD-SQOUGZDYSA-M 0.000 description 1
- AEMOLEFTQBMNLQ-AQKNRBDQSA-N D-glucopyranuronic acid Chemical compound OC1O[C@H](C(O)=O)[C@@H](O)[C@H](O)[C@H]1O AEMOLEFTQBMNLQ-AQKNRBDQSA-N 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 230000004544 DNA amplification Effects 0.000 description 1
- 239000012625 DNA intercalator Substances 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- WEAHRLBPCANXCN-UHFFFAOYSA-N Daunomycin Natural products CCC1(O)CC(OC2CC(N)C(O)C(C)O2)c3cc4C(=O)c5c(OC)cccc5C(=O)c4c(O)c3C1 WEAHRLBPCANXCN-UHFFFAOYSA-N 0.000 description 1
- CYCGRDQQIOGCKX-UHFFFAOYSA-N Dehydro-luciferin Natural products OC(=O)C1=CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 CYCGRDQQIOGCKX-UHFFFAOYSA-N 0.000 description 1
- NNJPGOLRFBJNIW-UHFFFAOYSA-N Demecolcine Natural products C1=C(OC)C(=O)C=C2C(NC)CCC3=CC(OC)=C(OC)C(OC)=C3C2=C1 NNJPGOLRFBJNIW-UHFFFAOYSA-N 0.000 description 1
- 108010002156 Depsipeptides Proteins 0.000 description 1
- AUGQEEXBDZWUJY-ZLJUKNTDSA-N Diacetoxyscirpenol Chemical compound C([C@]12[C@]3(C)[C@H](OC(C)=O)[C@@H](O)[C@H]1O[C@@H]1C=C(C)CC[C@@]13COC(=O)C)O2 AUGQEEXBDZWUJY-ZLJUKNTDSA-N 0.000 description 1
- AUGQEEXBDZWUJY-UHFFFAOYSA-N Diacetoxyscirpenol Natural products CC(=O)OCC12CCC(C)=CC1OC1C(O)C(OC(C)=O)C2(C)C11CO1 AUGQEEXBDZWUJY-UHFFFAOYSA-N 0.000 description 1
- LTMHDMANZUZIPE-AMTYYWEZSA-N Digoxin Natural products O([C@H]1[C@H](C)O[C@H](O[C@@H]2C[C@@H]3[C@@](C)([C@@H]4[C@H]([C@]5(O)[C@](C)([C@H](O)C4)[C@H](C4=CC(=O)OC4)CC5)CC3)CC2)C[C@@H]1O)[C@H]1O[C@H](C)[C@@H](O[C@H]2O[C@@H](C)[C@H](O)[C@@H](O)C2)[C@@H](O)C1 LTMHDMANZUZIPE-AMTYYWEZSA-N 0.000 description 1
- 229930193152 Dynemicin Natural products 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 102220516355 Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial_Y49C_mutation Human genes 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- AFMYMMXSQGUCBK-UHFFFAOYSA-N Endynamicin A Natural products C1#CC=CC#CC2NC(C=3C(=O)C4=C(O)C=CC(O)=C4C(=O)C=3C(O)=C3)=C3C34OC32C(C)C(C(O)=O)=C(OC)C41 AFMYMMXSQGUCBK-UHFFFAOYSA-N 0.000 description 1
- SAMRUMKYXPVKPA-VFKOLLTISA-N Enocitabine Chemical compound O=C1N=C(NC(=O)CCCCCCCCCCCCCCCCCCCCC)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 SAMRUMKYXPVKPA-VFKOLLTISA-N 0.000 description 1
- HTIJFSOGRVMCQR-UHFFFAOYSA-N Epirubicin Natural products COc1cccc2C(=O)c3c(O)c4CC(O)(CC(OC5CC(N)C(=O)C(C)O5)c4c(O)c3C(=O)c12)C(=O)CO HTIJFSOGRVMCQR-UHFFFAOYSA-N 0.000 description 1
- OBMLHUPNRURLOK-XGRAFVIBSA-N Epitiostanol Chemical compound C1[C@@H]2S[C@@H]2C[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CC[C@H]21 OBMLHUPNRURLOK-XGRAFVIBSA-N 0.000 description 1
- 241001524679 Escherichia virus M13 Species 0.000 description 1
- 229930189413 Esperamicin Natural products 0.000 description 1
- JOYRKODLDBILNP-UHFFFAOYSA-N Ethyl urethane Chemical compound CCOC(N)=O JOYRKODLDBILNP-UHFFFAOYSA-N 0.000 description 1
- 229910052693 Europium Inorganic materials 0.000 description 1
- 108010007457 Extracellular Signal-Regulated MAP Kinases Proteins 0.000 description 1
- 108090000331 Firefly luciferases Proteins 0.000 description 1
- BJGNCJDXODQBOB-UHFFFAOYSA-N Fivefly Luciferin Natural products OC(=O)C1CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 BJGNCJDXODQBOB-UHFFFAOYSA-N 0.000 description 1
- MPJKWIXIYCLVCU-UHFFFAOYSA-N Folinic acid Natural products NC1=NC2=C(N(C=O)C(CNc3ccc(cc3)C(=O)NC(CCC(=O)O)CC(=O)O)CN2)C(=O)N1 MPJKWIXIYCLVCU-UHFFFAOYSA-N 0.000 description 1
- 108010014612 Follistatin Proteins 0.000 description 1
- 102000016970 Follistatin Human genes 0.000 description 1
- BDAGIHXWWSANSR-UHFFFAOYSA-M Formate Chemical compound [O-]C=O BDAGIHXWWSANSR-UHFFFAOYSA-M 0.000 description 1
- 108010015133 Galactose oxidase Proteins 0.000 description 1
- 102000002464 Galactosidases Human genes 0.000 description 1
- 108010093031 Galactosidases Proteins 0.000 description 1
- 206010017993 Gastrointestinal neoplasms Diseases 0.000 description 1
- 108010073178 Glucan 1,4-alpha-Glucosidase Proteins 0.000 description 1
- 102100022624 Glucoamylase Human genes 0.000 description 1
- 239000004366 Glucose oxidase Substances 0.000 description 1
- 108010015776 Glucose oxidase Proteins 0.000 description 1
- 108010018962 Glucosephosphate Dehydrogenase Proteins 0.000 description 1
- 108010024636 Glutathione Proteins 0.000 description 1
- 229930186217 Glycolipid Natural products 0.000 description 1
- 208000031886 HIV Infections Diseases 0.000 description 1
- 102100031573 Hematopoietic progenitor cell antigen CD34 Human genes 0.000 description 1
- 102100028999 High mobility group protein HMGI-C Human genes 0.000 description 1
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 1
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 1
- 101000731086 Homo sapiens Brevican core protein Proteins 0.000 description 1
- 101000932213 Homo sapiens Dipeptidase 1 Proteins 0.000 description 1
- 101100118549 Homo sapiens EGFR gene Proteins 0.000 description 1
- 101000777663 Homo sapiens Hematopoietic progenitor cell antigen CD34 Proteins 0.000 description 1
- 101000986379 Homo sapiens High mobility group protein HMGI-C Proteins 0.000 description 1
- 101001046686 Homo sapiens Integrin alpha-M Proteins 0.000 description 1
- 101001044893 Homo sapiens Interleukin-20 receptor subunit alpha Proteins 0.000 description 1
- 101000917826 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-a Proteins 0.000 description 1
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 1
- 101000628547 Homo sapiens Metalloreductase STEAP1 Proteins 0.000 description 1
- 101000946843 Homo sapiens T-cell surface glycoprotein CD8 alpha chain Proteins 0.000 description 1
- VSNHCAURESNICA-UHFFFAOYSA-N Hydroxyurea Chemical compound NC(=O)NO VSNHCAURESNICA-UHFFFAOYSA-N 0.000 description 1
- 206010020853 Hypertonic bladder Diseases 0.000 description 1
- MPBVHIBUJCELCL-UHFFFAOYSA-N Ibandronate Chemical compound CCCCCN(C)CCC(O)(P(O)(O)=O)P(O)(O)=O MPBVHIBUJCELCL-UHFFFAOYSA-N 0.000 description 1
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 1
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 1
- 108010073807 IgG Receptors Proteins 0.000 description 1
- 102000009490 IgG Receptors Human genes 0.000 description 1
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 1
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 102100022338 Integrin alpha-M Human genes 0.000 description 1
- 108010008212 Integrin alpha4beta1 Proteins 0.000 description 1
- 102100025390 Integrin beta-2 Human genes 0.000 description 1
- 102000008607 Integrin beta3 Human genes 0.000 description 1
- 108010020950 Integrin beta3 Proteins 0.000 description 1
- 108010064593 Intercellular Adhesion Molecule-1 Proteins 0.000 description 1
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 description 1
- 108091029795 Intergenic region Proteins 0.000 description 1
- 102100022706 Interleukin-20 receptor subunit alpha Human genes 0.000 description 1
- 102000004310 Ion Channels Human genes 0.000 description 1
- 108090000862 Ion Channels Proteins 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- FEWJPZIEWOKRBE-JCYAYHJZSA-L L-tartrate(2-) Chemical compound [O-]C(=O)[C@H](O)[C@@H](O)C([O-])=O FEWJPZIEWOKRBE-JCYAYHJZSA-L 0.000 description 1
- 125000000510 L-tryptophano group Chemical group [H]C1=C([H])C([H])=C2N([H])C([H])=C(C([H])([H])[C@@]([H])(C(O[H])=O)N([H])[*])C2=C1[H] 0.000 description 1
- 239000005517 L01XE01 - Imatinib Substances 0.000 description 1
- 239000005411 L01XE02 - Gefitinib Substances 0.000 description 1
- 239000003798 L01XE11 - Pazopanib Substances 0.000 description 1
- 239000002118 L01XE12 - Vandetanib Substances 0.000 description 1
- JVTAAEKCZFNVCJ-UHFFFAOYSA-M Lactate Chemical compound CC(O)C([O-])=O JVTAAEKCZFNVCJ-UHFFFAOYSA-M 0.000 description 1
- 102100038609 Lactoperoxidase Human genes 0.000 description 1
- 108010023244 Lactoperoxidase Proteins 0.000 description 1
- 108090001090 Lectins Proteins 0.000 description 1
- 102000004856 Lectins Human genes 0.000 description 1
- 229920001491 Lentinan Polymers 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 206010024305 Leukaemia monocytic Diseases 0.000 description 1
- 206010024612 Lipoma Diseases 0.000 description 1
- GQYIWUVLTXOXAJ-UHFFFAOYSA-N Lomustine Chemical compound ClCCN(N=O)C(=O)NC1CCCCC1 GQYIWUVLTXOXAJ-UHFFFAOYSA-N 0.000 description 1
- 102100029204 Low affinity immunoglobulin gamma Fc region receptor II-a Human genes 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- DDWFXDSYGUXRAY-UHFFFAOYSA-N Luciferin Natural products CCc1c(C)c(CC2NC(=O)C(=C2C=C)C)[nH]c1Cc3[nH]c4C(=C5/NC(CC(=O)O)C(C)C5CC(=O)O)CC(=O)c4c3C DDWFXDSYGUXRAY-UHFFFAOYSA-N 0.000 description 1
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 1
- 108010064548 Lymphocyte Function-Associated Antigen-1 Proteins 0.000 description 1
- 102000008072 Lymphokines Human genes 0.000 description 1
- 108010074338 Lymphokines Proteins 0.000 description 1
- 239000012515 MabSelect SuRe Substances 0.000 description 1
- 108010026217 Malate Dehydrogenase Proteins 0.000 description 1
- OFOBLEOULBTSOW-UHFFFAOYSA-L Malonate Chemical compound [O-]C(=O)CC([O-])=O OFOBLEOULBTSOW-UHFFFAOYSA-L 0.000 description 1
- VJRAUFKOOPNFIQ-UHFFFAOYSA-N Marcellomycin Natural products C12=C(O)C=3C(=O)C4=C(O)C=CC(O)=C4C(=O)C=3C=C2C(C(=O)OC)C(CC)(O)CC1OC(OC1C)CC(N(C)C)C1OC(OC1C)CC(O)C1OC1CC(O)C(O)C(C)O1 VJRAUFKOOPNFIQ-UHFFFAOYSA-N 0.000 description 1
- IVDYZAAPOLNZKG-KWHRADDSSA-N Mepitiostane Chemical compound O([C@@H]1[C@]2(CC[C@@H]3[C@@]4(C)C[C@H]5S[C@H]5C[C@@H]4CC[C@H]3[C@@H]2CC1)C)C1(OC)CCCC1 IVDYZAAPOLNZKG-KWHRADDSSA-N 0.000 description 1
- 102100026712 Metalloreductase STEAP1 Human genes 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 1
- 102000029749 Microtubule Human genes 0.000 description 1
- 108091022875 Microtubule Proteins 0.000 description 1
- VFKZTMPDYBFSTM-KVTDHHQDSA-N Mitobronitol Chemical compound BrC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CBr VFKZTMPDYBFSTM-KVTDHHQDSA-N 0.000 description 1
- 229930192392 Mitomycin Natural products 0.000 description 1
- HRHKSTOGXBBQCB-UHFFFAOYSA-N Mitomycin E Natural products O=C1C(N)=C(C)C(=O)C2=C1C(COC(N)=O)C1(OC)C3N(C)C3CN12 HRHKSTOGXBBQCB-UHFFFAOYSA-N 0.000 description 1
- 102000016943 Muramidase Human genes 0.000 description 1
- 108010014251 Muramidase Proteins 0.000 description 1
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 1
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 1
- OVBPIULPVIDEAO-UHFFFAOYSA-N N-Pteroyl-L-glutaminsaeure Natural products C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-UHFFFAOYSA-N 0.000 description 1
- HDFGOPSGAURCEO-UHFFFAOYSA-N N-ethylmaleimide Chemical group CCN1C(=O)C=CC1=O HDFGOPSGAURCEO-UHFFFAOYSA-N 0.000 description 1
- 229910002651 NO3 Inorganic materials 0.000 description 1
- 102400000058 Neuregulin-1 Human genes 0.000 description 1
- 108090000556 Neuregulin-1 Proteins 0.000 description 1
- NHNBFGGVMKEFGY-UHFFFAOYSA-N Nitrate Chemical compound [O-][N+]([O-])=O NHNBFGGVMKEFGY-UHFFFAOYSA-N 0.000 description 1
- SYNHCENRCUAUNM-UHFFFAOYSA-N Nitrogen mustard N-oxide hydrochloride Chemical compound Cl.ClCC[N+]([O-])(C)CCCl SYNHCENRCUAUNM-UHFFFAOYSA-N 0.000 description 1
- 241000187654 Nocardia Species 0.000 description 1
- KGTDRFCXGRULNK-UHFFFAOYSA-N Nogalamycin Natural products COC1C(OC)(C)C(OC)C(C)OC1OC1C2=C(O)C(C(=O)C3=C(O)C=C4C5(C)OC(C(C(C5O)N(C)C)O)OC4=C3C3=O)=C3C=C2C(C(=O)OC)C(C)(O)C1 KGTDRFCXGRULNK-UHFFFAOYSA-N 0.000 description 1
- 241000238413 Octopus Species 0.000 description 1
- 108020005187 Oligonucleotide Probes Proteins 0.000 description 1
- 229930187135 Olivomycin Natural products 0.000 description 1
- 101100081884 Oryza sativa subsp. japonica OSA15 gene Proteins 0.000 description 1
- 101710160107 Outer membrane protein A Proteins 0.000 description 1
- 206010033128 Ovarian cancer Diseases 0.000 description 1
- 206010061535 Ovarian neoplasm Diseases 0.000 description 1
- MUBZPKHOEPUJKR-UHFFFAOYSA-N Oxalic acid Chemical compound OC(=O)C(O)=O MUBZPKHOEPUJKR-UHFFFAOYSA-N 0.000 description 1
- SUDAHWBOROXANE-SECBINFHSA-N PD 0325901 Chemical compound OC[C@@H](O)CONC(=O)C1=CC=C(F)C(F)=C1NC1=CC=C(I)C=C1F SUDAHWBOROXANE-SECBINFHSA-N 0.000 description 1
- SUDAHWBOROXANE-VIFPVBQESA-N PD 0325901-Cl Chemical compound OC[C@H](O)CONC(=O)C1=CC=C(F)C(F)=C1NC1=CC=C(I)C=C1F SUDAHWBOROXANE-VIFPVBQESA-N 0.000 description 1
- 101150082245 PSAG gene Proteins 0.000 description 1
- VREZDOWOLGNDPW-ALTGWBOUSA-N Pancratistatin Chemical compound C1=C2[C@H]3[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O)[C@@H]3NC(=O)C2=C(O)C2=C1OCO2 VREZDOWOLGNDPW-ALTGWBOUSA-N 0.000 description 1
- VREZDOWOLGNDPW-MYVCAWNPSA-N Pancratistatin Natural products O=C1N[C@H]2[C@H](O)[C@H](O)[C@H](O)[C@H](O)[C@@H]2c2c1c(O)c1OCOc1c2 VREZDOWOLGNDPW-MYVCAWNPSA-N 0.000 description 1
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 108010057150 Peplomycin Proteins 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 108010081690 Pertussis Toxin Proteins 0.000 description 1
- 206010057249 Phagocytosis Diseases 0.000 description 1
- KMSKQZKKOZQFFG-HSUXVGOQSA-N Pirarubicin Chemical compound O([C@H]1[C@@H](N)C[C@@H](O[C@H]1C)O[C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1CCCCO1 KMSKQZKKOZQFFG-HSUXVGOQSA-N 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 239000004793 Polystyrene Substances 0.000 description 1
- HFVNWDWLWUCIHC-GUPDPFMOSA-N Prednimustine Chemical compound O=C([C@@]1(O)CC[C@H]2[C@H]3[C@@H]([C@]4(C=CC(=O)C=C4CC3)C)[C@@H](O)C[C@@]21C)COC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 HFVNWDWLWUCIHC-GUPDPFMOSA-N 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 102100033237 Pro-epidermal growth factor Human genes 0.000 description 1
- 101710098940 Pro-epidermal growth factor Proteins 0.000 description 1
- 101710120463 Prostate stem cell antigen Proteins 0.000 description 1
- 101800004937 Protein C Proteins 0.000 description 1
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 101100501691 Rattus norvegicus Erbb2 gene Proteins 0.000 description 1
- 101100501698 Rattus norvegicus Erbb4 gene Proteins 0.000 description 1
- 101001010820 Rattus norvegicus Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 1
- 102000004278 Receptor Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108090000873 Receptor Protein-Tyrosine Kinases Proteins 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 208000015634 Rectal Neoplasms Diseases 0.000 description 1
- OWPCHSCAPHNHAV-UHFFFAOYSA-N Rhizoxin Natural products C1C(O)C2(C)OC2C=CC(C)C(OC(=O)C2)CC2CC2OC2C(=O)OC1C(C)C(OC)C(C)=CC=CC(C)=CC1=COC(C)=N1 OWPCHSCAPHNHAV-UHFFFAOYSA-N 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- NSFWWJIQIKBZMJ-YKNYLIOZSA-N Roridin A Chemical compound C([C@]12[C@]3(C)[C@H]4C[C@H]1O[C@@H]1C=C(C)CC[C@@]13COC(=O)[C@@H](O)[C@H](C)CCO[C@H](\C=C\C=C/C(=O)O4)[C@H](O)C)O2 NSFWWJIQIKBZMJ-YKNYLIOZSA-N 0.000 description 1
- 108010040181 SF 1126 Proteins 0.000 description 1
- 101100123851 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) HER1 gene Proteins 0.000 description 1
- 206010061934 Salivary gland cancer Diseases 0.000 description 1
- 101800001700 Saposin-D Proteins 0.000 description 1
- 102400000827 Saposin-D Human genes 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- 229920005654 Sephadex Polymers 0.000 description 1
- 239000012507 Sephadex™ Substances 0.000 description 1
- 108010029157 Sialic Acid Binding Ig-like Lectin 2 Proteins 0.000 description 1
- 229920000519 Sizofiran Polymers 0.000 description 1
- 206010041067 Small cell lung cancer Diseases 0.000 description 1
- 238000002105 Southern blotting Methods 0.000 description 1
- 231100000632 Spindle poison Toxicity 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- BXFOFFBJRFZBQZ-QYWOHJEZSA-N T-2 toxin Chemical compound C([C@@]12[C@]3(C)[C@H](OC(C)=O)[C@@H](O)[C@H]1O[C@H]1[C@]3(COC(C)=O)C[C@@H](C(=C1)C)OC(=O)CC(C)C)O2 BXFOFFBJRFZBQZ-QYWOHJEZSA-N 0.000 description 1
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- 108700011582 TER 286 Proteins 0.000 description 1
- 229920002253 Tannate Polymers 0.000 description 1
- CGMTUJFWROPELF-UHFFFAOYSA-N Tenuazonic acid Natural products CCC(C)C1NC(=O)C(=C(C)/O)C1=O CGMTUJFWROPELF-UHFFFAOYSA-N 0.000 description 1
- 108010000499 Thromboplastin Proteins 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- 102100030859 Tissue factor Human genes 0.000 description 1
- UMILHIMHKXVDGH-UHFFFAOYSA-N Triethylene glycol diglycidyl ether Chemical compound C1OC1COCCOCCOCCOCC1CO1 UMILHIMHKXVDGH-UHFFFAOYSA-N 0.000 description 1
- FYAMXEPQQLNQDM-UHFFFAOYSA-N Tris(1-aziridinyl)phosphine oxide Chemical compound C1CN1P(N1CC1)(=O)N1CC1 FYAMXEPQQLNQDM-UHFFFAOYSA-N 0.000 description 1
- 102000004243 Tubulin Human genes 0.000 description 1
- 108090000704 Tubulin Proteins 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 1
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 1
- 108010051765 Type I Bone Morphogenetic Protein Receptors Proteins 0.000 description 1
- 108010092464 Urate Oxidase Proteins 0.000 description 1
- 108010046334 Urease Proteins 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 1
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 1
- 102100029477 Vitamin K-dependent protein C Human genes 0.000 description 1
- 206010047741 Vulval cancer Diseases 0.000 description 1
- 102100033220 Xanthine oxidase Human genes 0.000 description 1
- 108010093894 Xanthine oxidase Proteins 0.000 description 1
- SPJCRMJCFSJKDE-ZWBUGVOYSA-N [(3s,8s,9s,10r,13r,14s,17r)-10,13-dimethyl-17-[(2r)-6-methylheptan-2-yl]-2,3,4,7,8,9,11,12,14,15,16,17-dodecahydro-1h-cyclopenta[a]phenanthren-3-yl] 2-[4-[bis(2-chloroethyl)amino]phenyl]acetate Chemical compound O([C@@H]1CC2=CC[C@H]3[C@@H]4CC[C@@H]([C@]4(CC[C@@H]3[C@@]2(C)CC1)C)[C@H](C)CCCC(C)C)C(=O)CC1=CC=C(N(CCCl)CCCl)C=C1 SPJCRMJCFSJKDE-ZWBUGVOYSA-N 0.000 description 1
- IFJUINDAXYAPTO-UUBSBJJBSA-N [(8r,9s,13s,14s,17s)-17-[2-[4-[4-[bis(2-chloroethyl)amino]phenyl]butanoyloxy]acetyl]oxy-13-methyl-6,7,8,9,11,12,14,15,16,17-decahydrocyclopenta[a]phenanthren-3-yl] benzoate Chemical compound C([C@@H]1[C@@H](C2=CC=3)CC[C@]4([C@H]1CC[C@@H]4OC(=O)COC(=O)CCCC=1C=CC(=CC=1)N(CCCl)CCCl)C)CC2=CC=3OC(=O)C1=CC=CC=C1 IFJUINDAXYAPTO-UUBSBJJBSA-N 0.000 description 1
- XZSRRNFBEIOBDA-CFNBKWCHSA-N [2-[(2s,4s)-4-[(2r,4s,5s,6s)-4-amino-5-hydroxy-6-methyloxan-2-yl]oxy-2,5,12-trihydroxy-7-methoxy-6,11-dioxo-3,4-dihydro-1h-tetracen-2-yl]-2-oxoethyl] 2,2-diethoxyacetate Chemical compound O([C@H]1C[C@](CC2=C(O)C=3C(=O)C4=CC=CC(OC)=C4C(=O)C=3C(O)=C21)(O)C(=O)COC(=O)C(OCC)OCC)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 XZSRRNFBEIOBDA-CFNBKWCHSA-N 0.000 description 1
- 230000035508 accumulation Effects 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- ZOZKYEHVNDEUCO-XUTVFYLZSA-N aceglatone Chemical compound O1C(=O)[C@H](OC(C)=O)[C@@H]2OC(=O)[C@@H](OC(=O)C)[C@@H]21 ZOZKYEHVNDEUCO-XUTVFYLZSA-N 0.000 description 1
- 229950002684 aceglatone Drugs 0.000 description 1
- 229930183665 actinomycin Natural products 0.000 description 1
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000023445 activated T cell autonomous cell death Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000008186 active pharmaceutical agent Substances 0.000 description 1
- 150000001263 acyl chlorides Chemical class 0.000 description 1
- 230000010933 acylation Effects 0.000 description 1
- 238000005917 acylation reaction Methods 0.000 description 1
- 125000004423 acyloxy group Chemical group 0.000 description 1
- 125000005042 acyloxymethyl group Chemical group 0.000 description 1
- 229950004955 adozelesin Drugs 0.000 description 1
- BYRVKDUQDLJUBX-JJCDCTGGSA-N adozelesin Chemical compound C1=CC=C2OC(C(=O)NC=3C=C4C=C(NC4=CC=3)C(=O)N3C[C@H]4C[C@]44C5=C(C(C=C43)=O)NC=C5C)=CC2=C1 BYRVKDUQDLJUBX-JJCDCTGGSA-N 0.000 description 1
- 229940009456 adriamycin Drugs 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 238000001261 affinity purification Methods 0.000 description 1
- 238000013019 agitation Methods 0.000 description 1
- 229930013930 alkaloid Natural products 0.000 description 1
- 125000003545 alkoxy group Chemical group 0.000 description 1
- 125000003282 alkyl amino group Chemical group 0.000 description 1
- 229940045714 alkyl sulfonate alkylating agent Drugs 0.000 description 1
- 150000008052 alkyl sulfonates Chemical class 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- SHGAZHPCJJPHSC-YCNIQYBTSA-N all-trans-retinoic acid Chemical compound OC(=O)\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-YCNIQYBTSA-N 0.000 description 1
- 229960000473 altretamine Drugs 0.000 description 1
- 125000003368 amide group Chemical group 0.000 description 1
- 229960003437 aminoglutethimide Drugs 0.000 description 1
- ROBVIMPUHSLWNV-UHFFFAOYSA-N aminoglutethimide Chemical compound C=1C=C(N)C=CC=1C1(CC)CCC(=O)NC1=O ROBVIMPUHSLWNV-UHFFFAOYSA-N 0.000 description 1
- 229960002749 aminolevulinic acid Drugs 0.000 description 1
- 229960003896 aminopterin Drugs 0.000 description 1
- 229960001220 amsacrine Drugs 0.000 description 1
- XCPGHVQEEXUHNC-UHFFFAOYSA-N amsacrine Chemical compound COC1=CC(NS(C)(=O)=O)=CC=C1NC1=C(C=CC=C2)C2=NC2=CC=CC=C12 XCPGHVQEEXUHNC-UHFFFAOYSA-N 0.000 description 1
- 201000007538 anal carcinoma Diseases 0.000 description 1
- BBDAGFIXKZCXAH-CCXZUQQUSA-N ancitabine Chemical compound N=C1C=CN2[C@@H]3O[C@H](CO)[C@@H](O)[C@@H]3OC2=N1 BBDAGFIXKZCXAH-CCXZUQQUSA-N 0.000 description 1
- 229950000242 ancitabine Drugs 0.000 description 1
- 239000003098 androgen Substances 0.000 description 1
- 229940030486 androgens Drugs 0.000 description 1
- 230000033115 angiogenesis Effects 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 230000009830 antibody antigen interaction Effects 0.000 description 1
- 238000011230 antibody-based therapy Methods 0.000 description 1
- 230000005888 antibody-dependent cellular phagocytosis Effects 0.000 description 1
- 229940045687 antimetabolites folic acid analogs Drugs 0.000 description 1
- 229940045719 antineoplastic alkylating agent nitrosoureas Drugs 0.000 description 1
- 239000012062 aqueous buffer Substances 0.000 description 1
- 150000008209 arabinosides Chemical class 0.000 description 1
- 125000000732 arylene group Chemical group 0.000 description 1
- 229940072107 ascorbate Drugs 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 230000001363 autoimmune Effects 0.000 description 1
- 238000000376 autoradiography Methods 0.000 description 1
- 229960002756 azacitidine Drugs 0.000 description 1
- 229950011321 azaserine Drugs 0.000 description 1
- 150000001541 aziridines Chemical class 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 229940077388 benzenesulfonate Drugs 0.000 description 1
- SRSXLGNVWSONIS-UHFFFAOYSA-M benzenesulfonate Chemical compound [O-]S(=O)(=O)C1=CC=CC=C1 SRSXLGNVWSONIS-UHFFFAOYSA-M 0.000 description 1
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-FPRJBGLDSA-N beta-D-galactose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-FPRJBGLDSA-N 0.000 description 1
- SQVRNKJHWKZAKO-UHFFFAOYSA-N beta-N-Acetyl-D-neuraminic acid Natural products CC(=O)NC1C(O)CC(O)(C(O)=O)OC1C(O)C(O)CO SQVRNKJHWKZAKO-UHFFFAOYSA-N 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 238000013357 binding ELISA Methods 0.000 description 1
- 230000031018 biological processes and functions Effects 0.000 description 1
- 238000005415 bioluminescence Methods 0.000 description 1
- 230000029918 bioluminescence Effects 0.000 description 1
- 229950008548 bisantrene Drugs 0.000 description 1
- 150000004663 bisphosphonates Chemical class 0.000 description 1
- 229950006844 bizelesin Drugs 0.000 description 1
- 201000000053 blastoma Diseases 0.000 description 1
- 238000004061 bleaching Methods 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical class N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 229960001467 bortezomib Drugs 0.000 description 1
- 229960005520 bryostatin Drugs 0.000 description 1
- MJQUEDHRCUIRLF-TVIXENOKSA-N bryostatin 1 Chemical compound C([C@@H]1CC(/[C@@H]([C@@](C(C)(C)/C=C/2)(O)O1)OC(=O)/C=C/C=C/CCC)=C\C(=O)OC)[C@H]([C@@H](C)O)OC(=O)C[C@H](O)C[C@@H](O1)C[C@H](OC(C)=O)C(C)(C)[C@]1(O)C[C@@H]1C\C(=C\C(=O)OC)C[C@H]\2O1 MJQUEDHRCUIRLF-TVIXENOKSA-N 0.000 description 1
- MUIWQCKLQMOUAT-AKUNNTHJSA-N bryostatin 20 Natural products COC(=O)C=C1C[C@@]2(C)C[C@]3(O)O[C@](C)(C[C@@H](O)CC(=O)O[C@](C)(C[C@@]4(C)O[C@](O)(CC5=CC(=O)O[C@]45C)C(C)(C)C=C[C@@](C)(C1)O2)[C@@H](C)O)C[C@H](OC(=O)C(C)(C)C)C3(C)C MUIWQCKLQMOUAT-AKUNNTHJSA-N 0.000 description 1
- MBABCNBNDNGODA-LUVUIASKSA-N bullatacin Chemical compound O1[C@@H]([C@@H](O)CCCCCCCCCC)CC[C@@H]1[C@@H]1O[C@@H]([C@H](O)CCCCCCCCCC[C@@H](O)CC=2C(O[C@@H](C)C=2)=O)CC1 MBABCNBNDNGODA-LUVUIASKSA-N 0.000 description 1
- 229960002092 busulfan Drugs 0.000 description 1
- SNCZNSNPXMPCGN-UHFFFAOYSA-N butanediamide Chemical compound NC(=O)CCC(N)=O SNCZNSNPXMPCGN-UHFFFAOYSA-N 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 102220348226 c.58A>C Human genes 0.000 description 1
- 108700002839 cactinomycin Proteins 0.000 description 1
- 229950009908 cactinomycin Drugs 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- IVFYLRMMHVYGJH-PVPPCFLZSA-N calusterone Chemical compound C1C[C@]2(C)[C@](O)(C)CC[C@H]2[C@@H]2[C@@H](C)CC3=CC(=O)CC[C@]3(C)[C@H]21 IVFYLRMMHVYGJH-PVPPCFLZSA-N 0.000 description 1
- 229950009823 calusterone Drugs 0.000 description 1
- 229940088954 camptosar Drugs 0.000 description 1
- 229940127093 camptothecin Drugs 0.000 description 1
- VSJKWCGYPAHWDS-FQEVSTJZSA-N camptothecin Chemical compound C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-FQEVSTJZSA-N 0.000 description 1
- OJLHWPALWODJPQ-QNWVGRARSA-N canfosfamide Chemical compound ClCCN(CCCl)P(=O)(N(CCCl)CCCl)OCCS(=O)(=O)C[C@H](NC(=O)CC[C@H](N)C(O)=O)C(=O)N[C@@H](C(O)=O)C1=CC=CC=C1 OJLHWPALWODJPQ-QNWVGRARSA-N 0.000 description 1
- 229950000772 canfosfamide Drugs 0.000 description 1
- 229960004117 capecitabine Drugs 0.000 description 1
- CVXBEEMKQHEXEN-UHFFFAOYSA-N carbaryl Chemical group C1=CC=C2C(OC(=O)NC)=CC=CC2=C1 CVXBEEMKQHEXEN-UHFFFAOYSA-N 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 229960002115 carboquone Drugs 0.000 description 1
- XREUEWVEMYWFFA-CSKJXFQVSA-N carminomycin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=C(O)C=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XREUEWVEMYWFFA-CSKJXFQVSA-N 0.000 description 1
- 229930188550 carminomycin Natural products 0.000 description 1
- XREUEWVEMYWFFA-UHFFFAOYSA-N carminomycin I Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=C(O)C=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XREUEWVEMYWFFA-UHFFFAOYSA-N 0.000 description 1
- 229960003261 carmofur Drugs 0.000 description 1
- 229960005243 carmustine Drugs 0.000 description 1
- 229950001725 carubicin Drugs 0.000 description 1
- BBZDXMBRAFTCAA-AREMUKBSSA-N carzelesin Chemical compound C1=2NC=C(C)C=2C([C@H](CCl)CN2C(=O)C=3NC4=CC=C(C=C4C=3)NC(=O)C3=CC4=CC=C(C=C4O3)N(CC)CC)=C2C=C1OC(=O)NC1=CC=CC=C1 BBZDXMBRAFTCAA-AREMUKBSSA-N 0.000 description 1
- 229950007509 carzelesin Drugs 0.000 description 1
- 108010047060 carzinophilin Proteins 0.000 description 1
- 230000021164 cell adhesion Effects 0.000 description 1
- 238000000423 cell based assay Methods 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 230000011712 cell development Effects 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000023549 cell-cell signaling Effects 0.000 description 1
- 230000004700 cellular uptake Effects 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- GPUADMRJQVPIAS-QCVDVZFFSA-M cerivastatin sodium Chemical compound [Na+].COCC1=C(C(C)C)N=C(C(C)C)C(\C=C\[C@@H](O)C[C@@H](O)CC([O-])=O)=C1C1=CC=C(F)C=C1 GPUADMRJQVPIAS-QCVDVZFFSA-M 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 238000012412 chemical coupling Methods 0.000 description 1
- 238000001311 chemical methods and process Methods 0.000 description 1
- 230000000973 chemotherapeutic effect Effects 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 229940044683 chemotherapy drug Drugs 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 229960004630 chlorambucil Drugs 0.000 description 1
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 1
- 229950008249 chlornaphazine Drugs 0.000 description 1
- 229960001480 chlorozotocin Drugs 0.000 description 1
- 229940001468 citrate Drugs 0.000 description 1
- ACSIXWWBWUQEHA-UHFFFAOYSA-N clodronic acid Chemical compound OP(O)(=O)C(Cl)(Cl)P(O)(O)=O ACSIXWWBWUQEHA-UHFFFAOYSA-N 0.000 description 1
- 229960002286 clodronic acid Drugs 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 229960002271 cobimetinib Drugs 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 230000001447 compensatory effect Effects 0.000 description 1
- 238000012875 competitive assay Methods 0.000 description 1
- 230000024203 complement activation Effects 0.000 description 1
- 230000009827 complement-dependent cellular cytotoxicity Effects 0.000 description 1
- 230000000536 complexating effect Effects 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 108010089438 cryptophycin 1 Proteins 0.000 description 1
- 108010090203 cryptophycin 8 Proteins 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- 229960000684 cytarabine Drugs 0.000 description 1
- 239000000824 cytostatic agent Substances 0.000 description 1
- 229960003901 dacarbazine Drugs 0.000 description 1
- 229960000640 dactinomycin Drugs 0.000 description 1
- 229950006418 dactolisib Drugs 0.000 description 1
- JOGKUKXHTYWRGZ-UHFFFAOYSA-N dactolisib Chemical compound O=C1N(C)C2=CN=C3C=CC(C=4C=C5C=CC=CC5=NC=4)=CC3=C2N1C1=CC=C(C(C)(C)C#N)C=C1 JOGKUKXHTYWRGZ-UHFFFAOYSA-N 0.000 description 1
- 229960000975 daunorubicin Drugs 0.000 description 1
- 230000006196 deacetylation Effects 0.000 description 1
- 238000003381 deacetylation reaction Methods 0.000 description 1
- 238000006298 dechlorination reaction Methods 0.000 description 1
- 238000007257 deesterification reaction Methods 0.000 description 1
- 230000007123 defense Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 229960005052 demecolcine Drugs 0.000 description 1
- 230000003831 deregulation Effects 0.000 description 1
- 229950003913 detorubicin Drugs 0.000 description 1
- WVYXNIXAMZOZFK-UHFFFAOYSA-N diaziquone Chemical compound O=C1C(NC(=O)OCC)=C(N2CC2)C(=O)C(NC(=O)OCC)=C1N1CC1 WVYXNIXAMZOZFK-UHFFFAOYSA-N 0.000 description 1
- 229950002389 diaziquone Drugs 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- LTMHDMANZUZIPE-PUGKRICDSA-N digoxin Chemical compound C1[C@H](O)[C@H](O)[C@@H](C)O[C@H]1O[C@@H]1[C@@H](C)O[C@@H](O[C@@H]2[C@H](O[C@@H](O[C@@H]3C[C@@H]4[C@]([C@@H]5[C@H]([C@]6(CC[C@@H]([C@@]6(C)[C@H](O)C5)C=5COC(=O)C=5)O)CC4)(C)CC3)C[C@@H]2O)C)C[C@@H]1O LTMHDMANZUZIPE-PUGKRICDSA-N 0.000 description 1
- LTMHDMANZUZIPE-UHFFFAOYSA-N digoxine Natural products C1C(O)C(O)C(C)OC1OC1C(C)OC(OC2C(OC(OC3CC4C(C5C(C6(CCC(C6(C)C(O)C5)C=5COC(=O)C=5)O)CC4)(C)CC3)CC2O)C)CC1O LTMHDMANZUZIPE-UHFFFAOYSA-N 0.000 description 1
- 230000009266 disease activity Effects 0.000 description 1
- 125000002228 disulfide group Chemical group 0.000 description 1
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 1
- VSJKWCGYPAHWDS-UHFFFAOYSA-N dl-camptothecin Natural products C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-UHFFFAOYSA-N 0.000 description 1
- 229960003668 docetaxel Drugs 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- ZWAOHEXOSAUJHY-ZIYNGMLESA-N doxifluridine Chemical compound O[C@@H]1[C@H](O)[C@@H](C)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ZWAOHEXOSAUJHY-ZIYNGMLESA-N 0.000 description 1
- 229950005454 doxifluridine Drugs 0.000 description 1
- NOTIQUSPUUHHEH-UXOVVSIBSA-N dromostanolone propionate Chemical compound C([C@@H]1CC2)C(=O)[C@H](C)C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H](OC(=O)CC)[C@@]2(C)CC1 NOTIQUSPUUHHEH-UXOVVSIBSA-N 0.000 description 1
- 229950004683 drostanolone propionate Drugs 0.000 description 1
- 229960005501 duocarmycin Drugs 0.000 description 1
- VQNATVDKACXKTF-XELLLNAOSA-N duocarmycin Chemical compound COC1=C(OC)C(OC)=C2NC(C(=O)N3C4=CC(=O)C5=C([C@@]64C[C@@H]6C3)C=C(N5)C(=O)OC)=CC2=C1 VQNATVDKACXKTF-XELLLNAOSA-N 0.000 description 1
- 229930184221 duocarmycin Natural products 0.000 description 1
- AFMYMMXSQGUCBK-AKMKHHNQSA-N dynemicin a Chemical compound C1#C\C=C/C#C[C@@H]2NC(C=3C(=O)C4=C(O)C=CC(O)=C4C(=O)C=3C(O)=C3)=C3[C@@]34O[C@]32[C@@H](C)C(C(O)=O)=C(OC)[C@H]41 AFMYMMXSQGUCBK-AKMKHHNQSA-N 0.000 description 1
- FSIRXIHZBIXHKT-MHTVFEQDSA-N edatrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CC(CC)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FSIRXIHZBIXHKT-MHTVFEQDSA-N 0.000 description 1
- 229950006700 edatrexate Drugs 0.000 description 1
- 229960002759 eflornithine Drugs 0.000 description 1
- XOPYFXBZMVTEJF-PDACKIITSA-N eleutherobin Chemical compound C(/[C@H]1[C@H](C(=CC[C@@H]1C(C)C)C)C[C@@H]([C@@]1(C)O[C@@]2(C=C1)OC)OC(=O)\C=C\C=1N=CN(C)C=1)=C2\CO[C@@H]1OC[C@@H](O)[C@@H](O)[C@@H]1OC(C)=O XOPYFXBZMVTEJF-PDACKIITSA-N 0.000 description 1
- XOPYFXBZMVTEJF-UHFFFAOYSA-N eleutherobin Natural products C1=CC2(OC)OC1(C)C(OC(=O)C=CC=1N=CN(C)C=1)CC(C(=CCC1C(C)C)C)C1C=C2COC1OCC(O)C(O)C1OC(C)=O XOPYFXBZMVTEJF-UHFFFAOYSA-N 0.000 description 1
- 229950000549 elliptinium acetate Drugs 0.000 description 1
- 229940120655 eloxatin Drugs 0.000 description 1
- 239000003480 eluent Substances 0.000 description 1
- 201000008184 embryoma Diseases 0.000 description 1
- 201000003914 endometrial carcinoma Diseases 0.000 description 1
- 230000002357 endometrial effect Effects 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- JOZGNYDSEBIJDH-UHFFFAOYSA-N eniluracil Chemical compound O=C1NC=C(C#C)C(=O)N1 JOZGNYDSEBIJDH-UHFFFAOYSA-N 0.000 description 1
- 229950010213 eniluracil Drugs 0.000 description 1
- 229950011487 enocitabine Drugs 0.000 description 1
- 230000009144 enzymatic modification Effects 0.000 description 1
- 229960001904 epirubicin Drugs 0.000 description 1
- 229950002973 epitiostanol Drugs 0.000 description 1
- 229930013356 epothilone Natural products 0.000 description 1
- 150000003883 epothilone derivatives Chemical class 0.000 description 1
- 239000006167 equilibration buffer Substances 0.000 description 1
- 229960001433 erlotinib Drugs 0.000 description 1
- 210000003013 erythroid precursor cell Anatomy 0.000 description 1
- ITSGNOIFAJAQHJ-BMFNZSJVSA-N esorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)C[C@H](C)O1 ITSGNOIFAJAQHJ-BMFNZSJVSA-N 0.000 description 1
- 229950002017 esorubicin Drugs 0.000 description 1
- LJQQFQHBKUKHIS-WJHRIEJJSA-N esperamicin Chemical compound O1CC(NC(C)C)C(OC)CC1OC1C(O)C(NOC2OC(C)C(SC)C(O)C2)C(C)OC1OC1C(\C2=C/CSSSC)=C(NC(=O)OC)C(=O)C(OC3OC(C)C(O)C(OC(=O)C=4C(=CC(OC)=C(OC)C=4)NC(=O)C(=C)OC)C3)C2(O)C#C\C=C/C#C1 LJQQFQHBKUKHIS-WJHRIEJJSA-N 0.000 description 1
- 229960001842 estramustine Drugs 0.000 description 1
- FRPJXPJMRWBBIH-RBRWEJTLSA-N estramustine Chemical compound ClCCN(CCCl)C(=O)OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 FRPJXPJMRWBBIH-RBRWEJTLSA-N 0.000 description 1
- CCIVGXIOQKPBKL-UHFFFAOYSA-M ethanesulfonate Chemical compound CCS([O-])(=O)=O CCIVGXIOQKPBKL-UHFFFAOYSA-M 0.000 description 1
- QSRLNKCNOLVZIR-KRWDZBQOSA-N ethyl (2s)-2-[[2-[4-[bis(2-chloroethyl)amino]phenyl]acetyl]amino]-4-methylsulfanylbutanoate Chemical compound CCOC(=O)[C@H](CCSC)NC(=O)CC1=CC=C(N(CCCl)CCCl)C=C1 QSRLNKCNOLVZIR-KRWDZBQOSA-N 0.000 description 1
- 125000000816 ethylene group Chemical group [H]C([H])([*:1])C([H])([H])[*:2] 0.000 description 1
- 229960005237 etoglucid Drugs 0.000 description 1
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 1
- OGPBJKLSAFTDLK-UHFFFAOYSA-N europium atom Chemical compound [Eu] OGPBJKLSAFTDLK-UHFFFAOYSA-N 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 229940087861 faslodex Drugs 0.000 description 1
- 229940087476 femara Drugs 0.000 description 1
- 210000003754 fetus Anatomy 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 229960000961 floxuridine Drugs 0.000 description 1
- ODKNJVUHOIMIIZ-RRKCRQDMSA-N floxuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ODKNJVUHOIMIIZ-RRKCRQDMSA-N 0.000 description 1
- 229960000390 fludarabine Drugs 0.000 description 1
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 235000019152 folic acid Nutrition 0.000 description 1
- 239000011724 folic acid Substances 0.000 description 1
- 229960000304 folic acid Drugs 0.000 description 1
- 150000002224 folic acids Chemical class 0.000 description 1
- 229960004783 fotemustine Drugs 0.000 description 1
- YAKWPXVTIGTRJH-UHFFFAOYSA-N fotemustine Chemical compound CCOP(=O)(OCC)C(C)NC(=O)N(CCCl)N=O YAKWPXVTIGTRJH-UHFFFAOYSA-N 0.000 description 1
- 229960002258 fulvestrant Drugs 0.000 description 1
- 229940050411 fumarate Drugs 0.000 description 1
- VZCYOOQTPOCHFL-OWOJBTEDSA-L fumarate(2-) Chemical compound [O-]C(=O)\C=C\C([O-])=O VZCYOOQTPOCHFL-OWOJBTEDSA-L 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 229940044658 gallium nitrate Drugs 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 210000005095 gastrointestinal system Anatomy 0.000 description 1
- 229960002584 gefitinib Drugs 0.000 description 1
- 229960005277 gemcitabine Drugs 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 229940020967 gemzar Drugs 0.000 description 1
- 239000003168 generic drug Substances 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 229940080856 gleevec Drugs 0.000 description 1
- 208000005017 glioblastoma Diseases 0.000 description 1
- 229940050410 gluconate Drugs 0.000 description 1
- 229940116332 glucose oxidase Drugs 0.000 description 1
- 235000019420 glucose oxidase Nutrition 0.000 description 1
- 229940097042 glucuronate Drugs 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- 229960003180 glutathione Drugs 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- 229930182470 glycoside Natural products 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 201000010536 head and neck cancer Diseases 0.000 description 1
- 208000014829 head and neck neoplasm Diseases 0.000 description 1
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 1
- 230000002440 hepatic effect Effects 0.000 description 1
- 125000005549 heteroarylene group Chemical group 0.000 description 1
- 238000005734 heterodimerization reaction Methods 0.000 description 1
- UUVWYPNAQBNQJQ-UHFFFAOYSA-N hexamethylmelamine Chemical compound CN(C)C1=NC(N(C)C)=NC(N(C)C)=N1 UUVWYPNAQBNQJQ-UHFFFAOYSA-N 0.000 description 1
- ALBYIUDWACNRRB-UHFFFAOYSA-N hexanamide Chemical compound CCCCCC(N)=O ALBYIUDWACNRRB-UHFFFAOYSA-N 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 238000009396 hybridization Methods 0.000 description 1
- XMBWDFGMSWQBCA-UHFFFAOYSA-N hydrogen iodide Chemical compound I XMBWDFGMSWQBCA-UHFFFAOYSA-N 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-M hydrogensulfate Chemical compound OS([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-M 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- 229960001330 hydroxycarbamide Drugs 0.000 description 1
- CBOIHMRHGLHBPB-UHFFFAOYSA-N hydroxymethyl Chemical compound O[CH2] CBOIHMRHGLHBPB-UHFFFAOYSA-N 0.000 description 1
- 229940015872 ibandronate Drugs 0.000 description 1
- 229960000908 idarubicin Drugs 0.000 description 1
- 229960003685 imatinib mesylate Drugs 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 238000003312 immunocapture Methods 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 238000003364 immunohistochemistry Methods 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- DBIGHPPNXATHOF-UHFFFAOYSA-N improsulfan Chemical compound CS(=O)(=O)OCCCNCCCOS(C)(=O)=O DBIGHPPNXATHOF-UHFFFAOYSA-N 0.000 description 1
- 229950008097 improsulfan Drugs 0.000 description 1
- 238000000099 in vitro assay Methods 0.000 description 1
- 238000011503 in vivo imaging Methods 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 230000008595 infiltration Effects 0.000 description 1
- 238000001764 infiltration Methods 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 108091008042 inhibitory receptors Proteins 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 229940084651 iressa Drugs 0.000 description 1
- 229960004768 irinotecan Drugs 0.000 description 1
- TWBYWOBDOCUKOW-UHFFFAOYSA-M isonicotinate Chemical compound [O-]C(=O)C1=CC=NC=C1 TWBYWOBDOCUKOW-UHFFFAOYSA-M 0.000 description 1
- 150000002540 isothiocyanates Chemical class 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 229940043355 kinase inhibitor Drugs 0.000 description 1
- 238000011005 laboratory method Methods 0.000 description 1
- 229940057428 lactoperoxidase Drugs 0.000 description 1
- 229960004891 lapatinib Drugs 0.000 description 1
- 239000002523 lectin Substances 0.000 description 1
- 229940115286 lentinan Drugs 0.000 description 1
- 229960003881 letrozole Drugs 0.000 description 1
- 238000001972 liquid chromatography-electrospray ionisation mass spectrometry Methods 0.000 description 1
- 239000007791 liquid phase Substances 0.000 description 1
- 239000012280 lithium aluminium hydride Substances 0.000 description 1
- 201000007270 liver cancer Diseases 0.000 description 1
- 229960002247 lomustine Drugs 0.000 description 1
- 229950001750 lonafarnib Drugs 0.000 description 1
- YROQEQPFUCPDCP-UHFFFAOYSA-N losoxantrone Chemical compound OCCNCCN1N=C2C3=CC=CC(O)=C3C(=O)C3=C2C1=CC=C3NCCNCCO YROQEQPFUCPDCP-UHFFFAOYSA-N 0.000 description 1
- 229950008745 losoxantrone Drugs 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 201000005249 lung adenocarcinoma Diseases 0.000 description 1
- 201000005202 lung cancer Diseases 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 239000004325 lysozyme Substances 0.000 description 1
- 229960000274 lysozyme Drugs 0.000 description 1
- 235000010335 lysozyme Nutrition 0.000 description 1
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- MQXVYODZCMMZEM-ZYUZMQFOSA-N mannomustine Chemical compound ClCCNC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CNCCCl MQXVYODZCMMZEM-ZYUZMQFOSA-N 0.000 description 1
- 229950008612 mannomustine Drugs 0.000 description 1
- 230000008774 maternal effect Effects 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 229960004961 mechlorethamine Drugs 0.000 description 1
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical compound ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 1
- 229960001924 melphalan Drugs 0.000 description 1
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 1
- 210000004379 membrane Anatomy 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 229950009246 mepitiostane Drugs 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 229910021645 metal ion Inorganic materials 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- VJRAUFKOOPNFIQ-TVEKBUMESA-N methyl (1r,2r,4s)-4-[(2r,4s,5s,6s)-5-[(2s,4s,5s,6s)-5-[(2s,4s,5s,6s)-4,5-dihydroxy-6-methyloxan-2-yl]oxy-4-hydroxy-6-methyloxan-2-yl]oxy-4-(dimethylamino)-6-methyloxan-2-yl]oxy-2-ethyl-2,5,7,10-tetrahydroxy-6,11-dioxo-3,4-dihydro-1h-tetracene-1-carboxylat Chemical compound O([C@H]1[C@@H](O)C[C@@H](O[C@H]1C)O[C@H]1[C@H](C[C@@H](O[C@H]1C)O[C@H]1C[C@]([C@@H](C2=CC=3C(=O)C4=C(O)C=CC(O)=C4C(=O)C=3C(O)=C21)C(=O)OC)(O)CC)N(C)C)[C@H]1C[C@H](O)[C@H](O)[C@H](C)O1 VJRAUFKOOPNFIQ-TVEKBUMESA-N 0.000 description 1
- HRHKSTOGXBBQCB-VFWICMBZSA-N methylmitomycin Chemical compound O=C1C(N)=C(C)C(=O)C2=C1[C@@H](COC(N)=O)[C@@]1(OC)[C@H]3N(C)[C@H]3CN12 HRHKSTOGXBBQCB-VFWICMBZSA-N 0.000 description 1
- HPNSFSBZBAHARI-UHFFFAOYSA-N micophenolic acid Natural products OC1=C(CC=C(C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-UHFFFAOYSA-N 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 108010029942 microperoxidase Proteins 0.000 description 1
- 210000004688 microtubule Anatomy 0.000 description 1
- 230000005012 migration Effects 0.000 description 1
- 238000013508 migration Methods 0.000 description 1
- 229960005485 mitobronitol Drugs 0.000 description 1
- MXWHMTNPTTVWDM-NXOFHUPFSA-N mitoguazone Chemical compound NC(N)=N\N=C(/C)\C=N\N=C(N)N MXWHMTNPTTVWDM-NXOFHUPFSA-N 0.000 description 1
- 229960003539 mitoguazone Drugs 0.000 description 1
- VFKZTMPDYBFSTM-GUCUJZIJSA-N mitolactol Chemical compound BrC[C@H](O)[C@@H](O)[C@@H](O)[C@H](O)CBr VFKZTMPDYBFSTM-GUCUJZIJSA-N 0.000 description 1
- 229950010913 mitolactol Drugs 0.000 description 1
- 229960004857 mitomycin Drugs 0.000 description 1
- 229960000350 mitotane Drugs 0.000 description 1
- 239000003607 modifier Substances 0.000 description 1
- 201000006894 monocytic leukemia Diseases 0.000 description 1
- 231100000219 mutagenic Toxicity 0.000 description 1
- 230000003505 mutagenic effect Effects 0.000 description 1
- 229960000951 mycophenolic acid Drugs 0.000 description 1
- HPNSFSBZBAHARI-RUDMXATFSA-N mycophenolic acid Chemical compound OC1=C(C\C=C(/C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-RUDMXATFSA-N 0.000 description 1
- 208000025113 myeloid leukemia Diseases 0.000 description 1
- QAPPRYMOAGJPPE-UHFFFAOYSA-N n-(2,5-dioxopyrrolidin-1-yl)-2-iodoacetamide Chemical compound ICC(=O)NN1C(=O)CCC1=O QAPPRYMOAGJPPE-UHFFFAOYSA-N 0.000 description 1
- UPSFMJHZUCSEHU-JYGUBCOQSA-N n-[(2s,3r,4r,5s,6r)-2-[(2r,3s,4r,5r,6s)-5-acetamido-4-hydroxy-2-(hydroxymethyl)-6-(4-methyl-2-oxochromen-7-yl)oxyoxan-3-yl]oxy-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl]acetamide Chemical compound CC(=O)N[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1O[C@H]1[C@H](O)[C@@H](NC(C)=O)[C@H](OC=2C=C3OC(=O)C=C(C)C3=CC=2)O[C@@H]1CO UPSFMJHZUCSEHU-JYGUBCOQSA-N 0.000 description 1
- NJSMWLQOCQIOPE-OCHFTUDZSA-N n-[(e)-[10-[(e)-(4,5-dihydro-1h-imidazol-2-ylhydrazinylidene)methyl]anthracen-9-yl]methylideneamino]-4,5-dihydro-1h-imidazol-2-amine Chemical compound N1CCN=C1N\N=C\C(C1=CC=CC=C11)=C(C=CC=C2)C2=C1\C=N\NC1=NCCN1 NJSMWLQOCQIOPE-OCHFTUDZSA-N 0.000 description 1
- LBWFXVZLPYTWQI-IPOVEDGCSA-N n-[2-(diethylamino)ethyl]-5-[(z)-(5-fluoro-2-oxo-1h-indol-3-ylidene)methyl]-2,4-dimethyl-1h-pyrrole-3-carboxamide;(2s)-2-hydroxybutanedioic acid Chemical compound OC(=O)[C@@H](O)CC(O)=O.CCN(CC)CCNC(=O)C1=C(C)NC(\C=C/2C3=CC(F)=CC=C3NC\2=O)=C1C LBWFXVZLPYTWQI-IPOVEDGCSA-N 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 210000000822 natural killer cell Anatomy 0.000 description 1
- 229940086322 navelbine Drugs 0.000 description 1
- 238000007857 nested PCR Methods 0.000 description 1
- 230000004766 neurogenesis Effects 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 229940080607 nexavar Drugs 0.000 description 1
- 229960001420 nimustine Drugs 0.000 description 1
- VFEDRRNHLBGPNN-UHFFFAOYSA-N nimustine Chemical compound CC1=NC=C(CNC(=O)N(CCCl)N=O)C(N)=N1 VFEDRRNHLBGPNN-UHFFFAOYSA-N 0.000 description 1
- KGTDRFCXGRULNK-JYOBTZKQSA-N nogalamycin Chemical compound CO[C@@H]1[C@@](OC)(C)[C@@H](OC)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=C(O)C=C4[C@@]5(C)O[C@H]([C@H]([C@@H]([C@H]5O)N(C)C)O)OC4=C3C3=O)=C3C=C2[C@@H](C(=O)OC)[C@@](C)(O)C1 KGTDRFCXGRULNK-JYOBTZKQSA-N 0.000 description 1
- 229950009266 nogalamycin Drugs 0.000 description 1
- 229940085033 nolvadex Drugs 0.000 description 1
- 210000004967 non-hematopoietic stem cell Anatomy 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 238000009206 nuclear medicine Methods 0.000 description 1
- 238000011330 nucleic acid test Methods 0.000 description 1
- 229940049964 oleate Drugs 0.000 description 1
- ZQPPMHVWECSIRJ-KTKRTIGZSA-M oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC([O-])=O ZQPPMHVWECSIRJ-KTKRTIGZSA-M 0.000 description 1
- 239000002751 oligonucleotide probe Substances 0.000 description 1
- CZDBNBLGZNWKMC-MWQNXGTOSA-N olivomycin Chemical class O([C@@H]1C[C@@H](O[C@H](C)[C@@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1)O[C@H]1O[C@@H](C)[C@H](O)[C@@H](OC2O[C@@H](C)[C@H](O)[C@@H](O)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@H](O)[C@H](OC)[C@H](C)O1 CZDBNBLGZNWKMC-MWQNXGTOSA-N 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 229960001756 oxaliplatin Drugs 0.000 description 1
- DWAFYCQODLXJNR-BNTLRKBRSA-L oxaliplatin Chemical compound O1C(=O)C(=O)O[Pt]11N[C@@H]2CCCC[C@H]2N1 DWAFYCQODLXJNR-BNTLRKBRSA-L 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- WLJNZVDCPSBLRP-UHFFFAOYSA-N pamoic acid Chemical class C1=CC=C2C(CC=3C4=CC=CC=C4C=C(C=3O)C(=O)O)=C(O)C(C(O)=O)=CC2=C1 WLJNZVDCPSBLRP-UHFFFAOYSA-N 0.000 description 1
- VREZDOWOLGNDPW-UHFFFAOYSA-N pancratistatine Natural products C1=C2C3C(O)C(O)C(O)C(O)C3NC(=O)C2=C(O)C2=C1OCO2 VREZDOWOLGNDPW-UHFFFAOYSA-N 0.000 description 1
- 201000002528 pancreatic cancer Diseases 0.000 description 1
- 208000008443 pancreatic carcinoma Diseases 0.000 description 1
- 229940014662 pantothenate Drugs 0.000 description 1
- 235000019161 pantothenic acid Nutrition 0.000 description 1
- 239000011713 pantothenic acid Substances 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 230000007310 pathophysiology Effects 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 229960000639 pazopanib Drugs 0.000 description 1
- CUIHSIWYWATEQL-UHFFFAOYSA-N pazopanib Chemical compound C1=CC2=C(C)N(C)N=C2C=C1N(C)C(N=1)=CC=NC=1NC1=CC=C(C)C(S(N)(=O)=O)=C1 CUIHSIWYWATEQL-UHFFFAOYSA-N 0.000 description 1
- 208000030940 penile carcinoma Diseases 0.000 description 1
- 201000008174 penis carcinoma Diseases 0.000 description 1
- 229960002340 pentostatin Drugs 0.000 description 1
- FPVKHBSQESCIEP-JQCXWYLXSA-N pentostatin Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=CNC[C@H]2O)=C2N=C1 FPVKHBSQESCIEP-JQCXWYLXSA-N 0.000 description 1
- QIMGFXOHTOXMQP-GFAGFCTOSA-N peplomycin Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCCN[C@@H](C)C=1C=CC=CC=1)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1NC=NC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C QIMGFXOHTOXMQP-GFAGFCTOSA-N 0.000 description 1
- 229950003180 peplomycin Drugs 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 210000001322 periplasm Anatomy 0.000 description 1
- 201000002628 peritoneum cancer Diseases 0.000 description 1
- 230000003094 perturbing effect Effects 0.000 description 1
- 230000008782 phagocytosis Effects 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- NMHMNPHRMNGLLB-UHFFFAOYSA-N phloretic acid Chemical compound OC(=O)CCC1=CC=C(O)C=C1 NMHMNPHRMNGLLB-UHFFFAOYSA-N 0.000 description 1
- 239000002953 phosphate buffered saline Substances 0.000 description 1
- 239000003757 phosphotransferase inhibitor Substances 0.000 description 1
- 239000003504 photosensitizing agent Substances 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 229960000952 pipobroman Drugs 0.000 description 1
- NJBFOOCLYDNZJN-UHFFFAOYSA-N pipobroman Chemical compound BrCCC(=O)N1CCN(C(=O)CCBr)CC1 NJBFOOCLYDNZJN-UHFFFAOYSA-N 0.000 description 1
- NUKCGLDCWQXYOQ-UHFFFAOYSA-N piposulfan Chemical compound CS(=O)(=O)OCCC(=O)N1CCN(C(=O)CCOS(C)(=O)=O)CC1 NUKCGLDCWQXYOQ-UHFFFAOYSA-N 0.000 description 1
- 229950001100 piposulfan Drugs 0.000 description 1
- 229960001221 pirarubicin Drugs 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 150000003057 platinum Chemical class 0.000 description 1
- CLSUSRZJUQMOHH-UHFFFAOYSA-L platinum dichloride Chemical compound Cl[Pt]Cl CLSUSRZJUQMOHH-UHFFFAOYSA-L 0.000 description 1
- 210000001778 pluripotent stem cell Anatomy 0.000 description 1
- 238000006116 polymerization reaction Methods 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 229920002223 polystyrene Polymers 0.000 description 1
- 229950004406 porfiromycin Drugs 0.000 description 1
- 238000002600 positron emission tomography Methods 0.000 description 1
- 239000001103 potassium chloride Substances 0.000 description 1
- 235000011164 potassium chloride Nutrition 0.000 description 1
- 229910000160 potassium phosphate Inorganic materials 0.000 description 1
- 235000011009 potassium phosphates Nutrition 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 229960004694 prednimustine Drugs 0.000 description 1
- 230000002028 premature Effects 0.000 description 1
- CPTBDICYNRMXFX-UHFFFAOYSA-N procarbazine Chemical compound CNNCC1=CC=C(C(=O)NC(C)C)C=C1 CPTBDICYNRMXFX-UHFFFAOYSA-N 0.000 description 1
- 229960000624 procarbazine Drugs 0.000 description 1
- 230000000750 progressive effect Effects 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 125000001436 propyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 235000019833 protease Nutrition 0.000 description 1
- 235000019419 proteases Nutrition 0.000 description 1
- 229960000856 protein c Drugs 0.000 description 1
- 239000013636 protein dimer Substances 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 231100000654 protein toxin Toxicity 0.000 description 1
- 229940024999 proteolytic enzymes for treatment of wounds and ulcers Drugs 0.000 description 1
- WOLQREOUPKZMEX-UHFFFAOYSA-N pteroyltriglutamic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)NC(CCC(=O)NC(CCC(=O)NC(CCC(O)=O)C(O)=O)C(O)=O)C(O)=O)C=C1 WOLQREOUPKZMEX-UHFFFAOYSA-N 0.000 description 1
- 150000003212 purines Chemical class 0.000 description 1
- 229950010131 puromycin Drugs 0.000 description 1
- 150000003230 pyrimidines Chemical class 0.000 description 1
- UOWVMDUEMSNCAV-WYENRQIDSA-N rachelmycin Chemical compound C1([C@]23C[C@@H]2CN1C(=O)C=1NC=2C(OC)=C(O)C4=C(C=2C=1)CCN4C(=O)C1=CC=2C=4CCN(C=4C(O)=C(C=2N1)OC)C(N)=O)=CC(=O)C1=C3C(C)=CN1 UOWVMDUEMSNCAV-WYENRQIDSA-N 0.000 description 1
- 150000003254 radicals Chemical class 0.000 description 1
- 238000007420 radioactive assay Methods 0.000 description 1
- 239000000941 radioactive substance Substances 0.000 description 1
- 230000003439 radiotherapeutic effect Effects 0.000 description 1
- 229940099538 rapamune Drugs 0.000 description 1
- 229910052761 rare earth metal Inorganic materials 0.000 description 1
- 150000002910 rare earth metals Chemical class 0.000 description 1
- BMKDZUISNHGIBY-UHFFFAOYSA-N razoxane Chemical compound C1C(=O)NC(=O)CN1C(C)CN1CC(=O)NC(=O)C1 BMKDZUISNHGIBY-UHFFFAOYSA-N 0.000 description 1
- 229960000460 razoxane Drugs 0.000 description 1
- 239000000376 reactant Substances 0.000 description 1
- 230000035484 reaction time Effects 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 206010038038 rectal cancer Diseases 0.000 description 1
- 201000001275 rectum cancer Diseases 0.000 description 1
- 230000022983 regulation of cell cycle Effects 0.000 description 1
- 230000026267 regulation of growth Effects 0.000 description 1
- 230000003252 repetitive effect Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 229930002330 retinoic acid Natural products 0.000 description 1
- OWPCHSCAPHNHAV-LMONGJCWSA-N rhizoxin Chemical compound C/C([C@H](OC)[C@@H](C)[C@@H]1C[C@H](O)[C@]2(C)O[C@@H]2/C=C/[C@@H](C)[C@]2([H])OC(=O)C[C@@](C2)(C[C@@H]2O[C@H]2C(=O)O1)[H])=C\C=C\C(\C)=C\C1=COC(C)=N1 OWPCHSCAPHNHAV-LMONGJCWSA-N 0.000 description 1
- 229950004892 rodorubicin Drugs 0.000 description 1
- 238000005096 rolling process Methods 0.000 description 1
- MBABCNBNDNGODA-WPZDJQSSSA-N rolliniastatin 1 Natural products O1[C@@H]([C@@H](O)CCCCCCCCCC)CC[C@H]1[C@H]1O[C@@H]([C@H](O)CCCCCCCCCC[C@@H](O)CC=2C(O[C@@H](C)C=2)=O)CC1 MBABCNBNDNGODA-WPZDJQSSSA-N 0.000 description 1
- IMUQLZLGWJSVMV-UOBFQKKOSA-N roridin A Natural products CC(O)C1OCCC(C)C(O)C(=O)OCC2CC(=CC3OC4CC(OC(=O)C=C/C=C/1)C(C)(C23)C45CO5)C IMUQLZLGWJSVMV-UOBFQKKOSA-N 0.000 description 1
- 102200003959 rs11556986 Human genes 0.000 description 1
- 102220057401 rs141711342 Human genes 0.000 description 1
- 102220135149 rs144300387 Human genes 0.000 description 1
- 102220122073 rs201643277 Human genes 0.000 description 1
- 102220108440 rs2242074 Human genes 0.000 description 1
- 102200058892 rs28929469 Human genes 0.000 description 1
- 102200058471 rs587777041 Human genes 0.000 description 1
- 102200159386 rs60798368 Human genes 0.000 description 1
- 102220196044 rs772620133 Human genes 0.000 description 1
- 102220062183 rs786203418 Human genes 0.000 description 1
- 102220103283 rs878854732 Human genes 0.000 description 1
- 102220179365 rs886052505 Human genes 0.000 description 1
- VHXNKPBCCMUMSW-FQEVSTJZSA-N rubitecan Chemical compound C1=CC([N+]([O-])=O)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VHXNKPBCCMUMSW-FQEVSTJZSA-N 0.000 description 1
- YGSDEFSMJLZEOE-UHFFFAOYSA-M salicylate Chemical compound OC1=CC=CC=C1C([O-])=O YGSDEFSMJLZEOE-UHFFFAOYSA-M 0.000 description 1
- 229960001860 salicylate Drugs 0.000 description 1
- 201000003804 salivary gland carcinoma Diseases 0.000 description 1
- 229930182947 sarcodictyin Natural products 0.000 description 1
- 238000010187 selection method Methods 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 1
- 238000004904 shortening Methods 0.000 description 1
- SQVRNKJHWKZAKO-OQPLDHBCSA-N sialic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)OC1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-OQPLDHBCSA-N 0.000 description 1
- 229950001403 sizofiran Drugs 0.000 description 1
- 239000002002 slurry Substances 0.000 description 1
- 208000000587 small cell lung carcinoma Diseases 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 238000004611 spectroscopical analysis Methods 0.000 description 1
- 238000009987 spinning Methods 0.000 description 1
- 229950006315 spirogermanium Drugs 0.000 description 1
- ICXJVZHDZFXYQC-UHFFFAOYSA-N spongistatin 1 Natural products OC1C(O2)(O)CC(O)C(C)C2CCCC=CC(O2)CC(O)CC2(O2)CC(OC)CC2CC(=O)C(C)C(OC(C)=O)C(C)C(=C)CC(O2)CC(C)(O)CC2(O2)CC(OC(C)=O)CC2CC(=O)OC2C(O)C(CC(=C)CC(O)C=CC(Cl)=C)OC1C2C ICXJVZHDZFXYQC-UHFFFAOYSA-N 0.000 description 1
- 229960001052 streptozocin Drugs 0.000 description 1
- ZSJLQEPLLKMAKR-GKHCUFPYSA-N streptozocin Chemical compound O=NN(C)C(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O ZSJLQEPLLKMAKR-GKHCUFPYSA-N 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- YBBRCQOCSYXUOC-UHFFFAOYSA-N sulfuryl dichloride Chemical compound ClS(Cl)(=O)=O YBBRCQOCSYXUOC-UHFFFAOYSA-N 0.000 description 1
- 229960001796 sunitinib Drugs 0.000 description 1
- 229940034785 sutent Drugs 0.000 description 1
- 230000005062 synaptic transmission Effects 0.000 description 1
- 230000008409 synovial inflammation Effects 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 1
- 229960001603 tamoxifen Drugs 0.000 description 1
- FQZYTYWMLGAPFJ-OQKDUQJOSA-N tamoxifen citrate Chemical compound [H+].[H+].[H+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O.C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 FQZYTYWMLGAPFJ-OQKDUQJOSA-N 0.000 description 1
- 229940120982 tarceva Drugs 0.000 description 1
- 229940095064 tartrate Drugs 0.000 description 1
- RCINICONZNJXQF-XAZOAEDWSA-N taxol® Chemical compound O([C@@H]1[C@@]2(CC(C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3(C21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-XAZOAEDWSA-N 0.000 description 1
- 229940063683 taxotere Drugs 0.000 description 1
- 229940061353 temodar Drugs 0.000 description 1
- 229960000235 temsirolimus Drugs 0.000 description 1
- QFJCIRLUMZQUOT-UHFFFAOYSA-N temsirolimus Natural products C1CC(O)C(OC)CC1CC(C)C1OC(=O)C2CCCCN2C(=O)C(=O)C(O)(O2)C(C)CCC2CC(OC)C(C)=CC=CC=CC(C)CC(C)C(=O)C(OC)C(O)C(C)=CC(C)C(=O)C1 QFJCIRLUMZQUOT-UHFFFAOYSA-N 0.000 description 1
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 1
- 229960001278 teniposide Drugs 0.000 description 1
- BPEWUONYVDABNZ-DZBHQSCQSA-N testolactone Chemical compound O=C1C=C[C@]2(C)[C@H]3CC[C@](C)(OC(=O)CC4)[C@@H]4[C@@H]3CCC2=C1 BPEWUONYVDABNZ-DZBHQSCQSA-N 0.000 description 1
- 229960005353 testolactone Drugs 0.000 description 1
- ABZLKHKQJHEPAX-UHFFFAOYSA-N tetramethylrhodamine Chemical compound C=12C=CC(N(C)C)=CC2=[O+]C2=CC(N(C)C)=CC=C2C=1C1=CC=CC=C1C([O-])=O ABZLKHKQJHEPAX-UHFFFAOYSA-N 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 150000003573 thiols Chemical class 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- YFTWHEBLORWGNI-UHFFFAOYSA-N tiamiprine Chemical compound CN1C=NC([N+]([O-])=O)=C1SC1=NC(N)=NC2=C1NC=N2 YFTWHEBLORWGNI-UHFFFAOYSA-N 0.000 description 1
- 229950011457 tiamiprine Drugs 0.000 description 1
- PLHJCIYEEKOWNM-HHHXNRCGSA-N tipifarnib Chemical compound CN1C=NC=C1[C@](N)(C=1C=C2C(C=3C=C(Cl)C=CC=3)=CC(=O)N(C)C2=CC=1)C1=CC=C(Cl)C=C1 PLHJCIYEEKOWNM-HHHXNRCGSA-N 0.000 description 1
- 229950009158 tipifarnib Drugs 0.000 description 1
- 230000025366 tissue development Effects 0.000 description 1
- YONPGGFAJWQGJC-UHFFFAOYSA-K titanium(iii) chloride Chemical compound Cl[Ti](Cl)Cl YONPGGFAJWQGJC-UHFFFAOYSA-K 0.000 description 1
- JOXIMZWYDAKGHI-UHFFFAOYSA-N toluene-4-sulfonic acid Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-N 0.000 description 1
- 238000003325 tomography Methods 0.000 description 1
- 229960000303 topotecan Drugs 0.000 description 1
- 229940100411 torisel Drugs 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 230000014616 translation Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- IUCJMVBFZDHPDX-UHFFFAOYSA-N tretamine Chemical compound C1CN1C1=NC(N2CC2)=NC(N2CC2)=N1 IUCJMVBFZDHPDX-UHFFFAOYSA-N 0.000 description 1
- 229950001353 tretamine Drugs 0.000 description 1
- 229960001727 tretinoin Drugs 0.000 description 1
- PXSOHRWMIRDKMP-UHFFFAOYSA-N triaziquone Chemical compound O=C1C(N2CC2)=C(N2CC2)C(=O)C=C1N1CC1 PXSOHRWMIRDKMP-UHFFFAOYSA-N 0.000 description 1
- 229960004560 triaziquone Drugs 0.000 description 1
- 229960001670 trilostane Drugs 0.000 description 1
- KVJXBPDAXMEYOA-CXANFOAXSA-N trilostane Chemical compound OC1=C(C#N)C[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CC[C@@]32O[C@@H]31 KVJXBPDAXMEYOA-CXANFOAXSA-N 0.000 description 1
- NOYPYLRCIDNJJB-UHFFFAOYSA-N trimetrexate Chemical compound COC1=C(OC)C(OC)=CC(NCC=2C(=C3C(N)=NC(N)=NC3=CC=2)C)=C1 NOYPYLRCIDNJJB-UHFFFAOYSA-N 0.000 description 1
- 229960001099 trimetrexate Drugs 0.000 description 1
- 229960000875 trofosfamide Drugs 0.000 description 1
- UMKFEPPTGMDVMI-UHFFFAOYSA-N trofosfamide Chemical compound ClCCN(CCCl)P1(=O)OCCCN1CCCl UMKFEPPTGMDVMI-UHFFFAOYSA-N 0.000 description 1
- HDZZVAMISRMYHH-LITAXDCLSA-N tubercidin Chemical compound C1=CC=2C(N)=NC=NC=2N1[C@@H]1O[C@@H](CO)[C@H](O)[C@H]1O HDZZVAMISRMYHH-LITAXDCLSA-N 0.000 description 1
- 230000004614 tumor growth Effects 0.000 description 1
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 1
- 230000007306 turnover Effects 0.000 description 1
- 229940094060 tykerb Drugs 0.000 description 1
- 229950009811 ubenimex Drugs 0.000 description 1
- 238000002604 ultrasonography Methods 0.000 description 1
- 229960001055 uracil mustard Drugs 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
- 208000012991 uterine carcinoma Diseases 0.000 description 1
- 230000004862 vasculogenesis Effects 0.000 description 1
- LLDWLPRYLVPDTG-UHFFFAOYSA-N vatalanib succinate Chemical compound OC(=O)CCC(O)=O.C1=CC(Cl)=CC=C1NC(C1=CC=CC=C11)=NN=C1CC1=CC=NC=C1 LLDWLPRYLVPDTG-UHFFFAOYSA-N 0.000 description 1
- 229940099039 velcade Drugs 0.000 description 1
- HOFQVRTUGATRFI-XQKSVPLYSA-N vinblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1N=C1[C]2C=CC=C1 HOFQVRTUGATRFI-XQKSVPLYSA-N 0.000 description 1
- 229960003048 vinblastine Drugs 0.000 description 1
- 229960004528 vincristine Drugs 0.000 description 1
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 1
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 1
- UGGWPQSBPIFKDZ-KOTLKJBCSA-N vindesine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(N)=O)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1N=C1[C]2C=CC=C1 UGGWPQSBPIFKDZ-KOTLKJBCSA-N 0.000 description 1
- 229960004355 vindesine Drugs 0.000 description 1
- GBABOYUKABKIAF-IELIFDKJSA-N vinorelbine Chemical compound C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC GBABOYUKABKIAF-IELIFDKJSA-N 0.000 description 1
- 229960002066 vinorelbine Drugs 0.000 description 1
- CILBMBUYJCWATM-PYGJLNRPSA-N vinorelbine ditartrate Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O.OC(=O)[C@H](O)[C@@H](O)C(O)=O.C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC CILBMBUYJCWATM-PYGJLNRPSA-N 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 201000005102 vulva cancer Diseases 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 238000002424 x-ray crystallography Methods 0.000 description 1
- 229940053867 xeloda Drugs 0.000 description 1
- 229950009268 zinostatin Drugs 0.000 description 1
- FBTUMDXHSRTGRV-ALTNURHMSA-N zorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(\C)=N\NC(=O)C=1C=CC=CC=1)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 FBTUMDXHSRTGRV-ALTNURHMSA-N 0.000 description 1
- 229960000641 zorubicin Drugs 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/32—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/6807—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug or compound being a sugar, nucleoside, nucleotide, nucleic acid, e.g. RNA antisense
- A61K47/6809—Antibiotics, e.g. antitumor antibiotics anthracyclins, adriamycin, doxorubicin or daunomycin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
- A61K47/6817—Toxins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
- A61K47/6869—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from a cell of the reproductive system: ovaria, uterus, testes, prostate
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K49/00—Preparations for testing in vivo
- A61K49/001—Preparation for luminescence or biological staining
- A61K49/0013—Luminescence
- A61K49/0017—Fluorescence in vivo
- A61K49/005—Fluorescence in vivo characterised by the carrier molecule carrying the fluorescent agent
- A61K49/0058—Antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K51/00—Preparations containing radioactive substances for use in therapy or testing in vivo
- A61K51/02—Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
- A61K51/04—Organic compounds
- A61K51/08—Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
- A61K51/10—Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3069—Reproductive system, e.g. ovaria, uterus, testes, prostate
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3076—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties
- C07K16/3092—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties against tumour-associated mucins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/40—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/58—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving labelled substances
- G01N33/582—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving labelled substances with fluorescent label
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/40—Immunoglobulins specific features characterized by post-translational modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
Definitions
- the invention relates generally to antibodies engineered with reactive cysteine residues and more specifically to antibodies with therapeutic or diagnostic applications.
- the cysteine engineered antibodies may be conjugated with chemotherapeutic drugs, toxins, affinity ligands such as biotin, and detection labels such as fluorophores.
- the invention also relates to methods of using antibodies and antibody-drug conjugate compounds for in vitro, in situ, and in vivo diagnosis or treatment of mammalian cells, or associated pathological conditions.
- ADC Antibody drug conjugates
- Analytical and preparative methods are inadequate to separate and characterize the antibody- drug conjugate species molecules within the heterogeneous mixture resulting from a conjugation reaction.
- Antibodies are large, complex and structurally diverse biomolecules, often with many reactive functional groups. Their reactivities with linker reagents and drug- linker intermediates are dependent on factors such as pH, concentration, salt concentration, and co-solvents. Furthermore, the multistep conjugation process may be nonreproducible due to difficulties in controlling the reaction conditions and characterizing reactants and intermediates.
- Cysteine thiols are reactive at neutral pH, unlike most amines which are protonated and less nucleophilic near pH 7. Since free thiol (RSH, sulfhydryl) groups are relatively reactive, proteins with cysteine residues often exist in their oxidized form as disulfide-linked oligomers or have internally bridged disulfide groups. Antibody cysteine thiol groups are generally more reactive, i.e. more nucleophilic, towards electrophilic conjugation reagents than antibody amine or hydroxyl groups.
- the protein oxidatively forms an intramolecular disulfide bond between the newly engineered Cys and an existing Cys residue, both Cys groups are unavailable for active site participation and interactions.
- the protein may be rendered inactive or non- specific, by misfolding or loss of tertiary structure (Zhang et al (2002) Anal. Biochem.311:1- 9).
- THIOMAB TM antibodies can then be conjugated to cytotoxic drugs through the engineered cysteine thiol groups to obtain THIOMAB TM antibody drug conjugates (TDC) with uniform stoichiometry (e.g., up to 2 drugs per antibody in an antibody that has a single engineered cysteine site).
- TDC antibody drug conjugates
- Studies with multiple antibodies against different antigens have shown that TDCs are as efficacious as conventional ADC in xenograft models and are tolerated at higher doses in relevant preclinical models.
- THIOMAB TM antibodies have been engineered for drug attachment at different locations of the antibody (e.g., specific amino acid positions (i.e., sites) within the light chain-Fab, heavy chain-Fab and heavy chain-Fc).
- the in vitro & in vivo stability, efficacy and PK properties of THIOMAB TM antibodies provide a unique advantage over conventional ADCs due to their homogeneity and site-specific conjugation to cytotoxic drugs.
- This application includes disclosure of novel, isolated cysteine engineered antibodies comprising a free cysteine amino acid in the heavy chain or light chain
- An aspect of the invention is a process to prepare the isolated cysteine engineered antibodies (THIOMAB TM antibodies) by mutagenizing a nucleic acid sequence of a parent antibody by replacing one or more amino acid residues by cysteine to encode the cysteine engineered antibody; expressing the cysteine engineered antibody; and isolating the cysteine engineered antibody.
- THIOMAB TM antibodies isolated cysteine engineered antibodies
- Another aspect of the invention are conjugates of isolated cysteine engineered antibodies (THIOMAB TM antibodies) wherein the antibody is covalently attached to a capture label, a detection label, a drug moiety, or a solid support.
- THIOMAB TM antibodies isolated cysteine engineered antibodies
- the invention is a cysteine engineered antibody comprising a cysteine mutation selected from the cysteine mutations identified in any of Tables 1-4 and preferably in either Table 1 or 2.
- the cysteine mutation is a free cysteine amino acid.
- the cysteine mutation in the heavy chain selected from the cysteine mutations identified in Tables 2 or 3.
- the cysteine mutation in the in the light chain selected from the cysteine mutations identified in Tables 1 or 4.
- the cysteine mutation is selected from the group consisting of HC-I195C, HC-S420C, HC-Y432C, and LC-G64C (according to Kabat numbering).
- the cysteine mutation is selected from the group consisting of HC-Y432C and LC-G64C (according to Kabat numbering). In certain embodiments, the cysteine mutation is a heavy chain mutation and is selected from the group consisting of Y33C, G162C, V184C, I195C, S420C, Y432C, and Q434C
- the cysteine mutation is a heavy chain mutation and is selected from the group consisting of R19C, E46C, T57C, Y59C, A60C, M100cC, W103C, G162C, I195C, V258C, S420C, H425C, and N430C (according to Kabat numbering).
- the cysteine mutation is a heavy chain mutation and is selected from the group consisting of Y33C, G162C, V184C, and I195C (according to Kabat numbering).
- the cysteine mutation is a heavy chain mutation and is selected from the group consisting of R19C, E46C, Y59C, A60C, M100cC, W103C, V258C, H425C, and N430C (according to Kabat numbering).
- the cysteine mutation is a light chain mutation and is selected from the group consisting of Y55C, G64C, T85C, and T180C, and N430C
- the cysteine mutation is a light chain mutation and is selected from the group consisting of T31C, S52C, G64C, R66C, A193C, and N430C (according to Kabat numbering). In certain embodiments, the cysteine mutation is a light chain mutation and is selected from the group consisting of G64C, T85C, and T180C, and N430C (according to Kabat numbering). In certain embodiments, the cysteine mutation is a light chain mutation and is selected from the group consisting of S52C, G64C, R66C, and A193C N430C (according to Kabat numbering).
- the cysteine mutation in the light chain is selected from the group of cysteine mutations comprising LC- I106C, LC-R108C, LC-R142C, and LC-K149C according to Kabat numbering (see Figure 1a; Table 1).
- the cysteine mutation in the in the light chain is LC-K149C according to Kabat numbering (see Figure 1a). Table 1.
- Exemplary light chain cysteine mutations comprising LC- I106C, LC-R108C, LC-R142C, and LC-K149C according to Kabat numbering (see Figure 1a; Table 1).
- the cysteine mutation in the heavy chain is selected from the group of cysteine mutations comprising HC-T114C, HC-A140C, HC-L174C, HC- L179C, HC-T187C, HC-T209C, HC-V262C, HC-G371C, HC-Y373C, HC-E382C, HC- S424C, HC-N434C, and HC-Q438C according to EU numbering (see Figure 1b; Table 2).
- the cysteine mutation in the in the heavy chain is HC-A143C according to Kabat numbering (i.e., HC-A140C according to EU numbering) (see Figures 1b and 21; Table 2).
- the cysteine mutation in the in the heavy chain is HC-A174C according to EU numbering (see Figures 1b and 21; Table 2). Table 2.
- cysteine engineered antibody as described herein is prepared by a process comprising:
- a cysteine engineered antibody as described herein is a fusion protein comprising the albumin-binding peptide (ABP).
- the ABP comprises a sequence selected from:
- CDKTHTGGGSQRLMEDICLPRWGCLWEDDF SEQ ID NO:144
- QRLMEDICLPRWGCLWEDDF SEQ ID NO:145
- DICLPRWGCLW (SEQ ID NO:148).
- a cysteine engineered antibody as described herein is selected from a monoclonal antibody, an antibody fragment, a bispecific antibody, a chimeric antibody, a human antibody, and a humanized antibody.
- the antibody fragment is a Fab fragment.
- a cysteine engineered antibody as described herein is an anti-HER2 antibody. In certain embodiments, a cysteine engineered antibody as described herein is an anti-MUC16 antibody. In certain embodiments, a cysteine engineered antibody as described herein is an anti-STEAP1 antibody. In certain embodiments, a cysteine engineered antibody as described herein is an anti-CD79b antibody. In certain embodiments, a cysteine engineered antibody as described herein is an anti-CD22 antibody. In certain embodiments, a cysteine engineered antibody as described herein is an anti-B7H4 antibody. In certain embodiments, a cysteine engineered antibody as described herein is an anti-Ly6E antibody. In certain embodiments, a cysteine engineered antibody as described herein is an anti-NaPi2b antibody.
- cysteine engineered antibody as described herein binds to one or more of receptors (1)-(53):
- BMPR1B bone morphogenetic protein receptor-type IB
- MPF MPF, MSLN, SMR, megakaryocyte potentiating factor
- Napi3b also known as NaPi2b
- NAPI-3B also known as NaPi2b
- NPTIIb NPTIIb
- SLC34A2 solute carrier family 34 (sodium phosphate), member 2, type II sodium-dependent phosphate transporter 3b);
- Sema 5b (FLJ10372, KIAA1445, Mm.42015, SEMA5B, SEMAG, Semaphorin 5b Hlog, sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5B);
- PSCA hlg (2700050C12Rik, C530008O16Rik, RIKEN cDNA 2700050C12, RIKEN cDNA 2700050C12 gene);
- ETBR Endothelin type B receptor
- STEAP2 (HGNC_8639, IPCA-1, PCANAP1, STAMP1, STEAP2, STMP, prostate cancer associated gene 1, prostate cancer associated protein 1, six transmembrane epithelial antigen of prostate 2, six transmembrane prostate protein);
- TrpM4 (BR22450, FLJ20041, TRPM4, TRPM4B, transient receptor potential cation channel, subfamily M, member 4);
- CRIPTO (CR, CR1, CRGF, CRIPTO, TDGF1, teratocarcinoma-derived growth factor);
- CD21 (CR2 (Complement receptor 2) or C3DR (C3d/Epstein Barr virus receptor) or Hs.73792);
- CD79b CD79B, CD79 ⁇ , IGb (immunoglobulin-associated beta), B29
- FcRH2 IFGP4, IRTA4, SPAP1A (SH2 domain containing phosphatase anchor protein 1a), SPAP1B, SPAP1C);
- BAFF-R B cell -activating factor receptor, BLyS receptor 3, BR3
- CD22 B-cell receptor CD22-B isoform
- CD79a (CD79A, CD79 ⁇ , immunoglobulin-associated alpha, a B cell-specific protein);
- CXCR5 Bokitt's lymphoma receptor 1, a G protein-coupled receptor
- HLA-DOB Beta subunit of MHC class II molecule (Ia antigen)
- P2X5 Purinergic receptor P2X ligand-gated ion channel 5
- CD72 B-cell differentiation antigen CD72, Lyb-2
- LY64 Lymphocyte antigen 64 (RP105), type I membrane protein of the leucine rich repeat (LRR) family
- FcRH1 Fc receptor-like protein 1
- IRTA2 Immunoglobulin superfamily receptor translocation associated 2
- TENB2 (putative transmembrane proteoglycan);
- PMEL17 (silver homolog; SILV; D12S53E; PMEL17; SI; SIL);
- TMEFF1 transmembrane protein with EGF-like and two follistatin-like domains 1; Tomoregulin-1
- GDNF-Ra1 GDNF family receptor alpha 1; GFRA1; GDNFR;
- Ly6E lymphocyte antigen 6 complex, locus E; Ly67,RIG-E,SCA-2,TSA- 1
- Ly6G6D lymphocyte antigen 6 complex, locus G6D; Ly6-D, MEGT1; (43) LGR5 (leucine-rich repeat-containing G protein-coupled receptor 5;
- RET ret proto-oncogene; MEN2A; HSCR1; MEN2B; MTC1; PTC; CDHF12; Hs.168114; RET51; RET-ELE1);
- LY6K lymphocyte antigen 6 complex, locus K; LY6K; HSJ001348; FLJ35226;
- GPR19 G protein-coupled receptor 19; Mm.4787
- GPR54 KISS1 receptor; KISS1R; GPR54; HOT7T175; AXOR12;
- ASPHD1 aspartate beta-hydroxylase domain containing 1; LOC253982
- Tyrosinase TRR; OCAIA; OCA1A; tyrosinase; SHEP3;
- TMEM118 ring finger protein, transmembrane 2; RNFT2; FLJ14627
- GPR172A G protein-coupled receptor 172A; GPCR41; FLJ11856;
- a cysteine engineered antibody as described herein is covalently attached to a capture label, a detection label, a drug moiety, or a solid support.
- the antibody is covalently attached to a biotin capture label.
- the antibody is covalently attached to a fluorescent dye detection label.
- the fluorescent dye is selected from a fluorescein type, a rhodamine type, dansyl, Lissamine, a cyanine, a phycoerythrin, Texas Red, and an analog thereof.
- the antibody is covalently attached to a radionuclide detection label selected from 3 H, 11 C, 14 C, 18 F, 32 P, 35 S, 64 Cu, 68 Ga, 86 Y, 89 Zr, 99 Tc, 111 In, 123 I, 124 I, 125 I, 131 I, 133 Xe, 177 Lu, 211 At, and 213 Bi.
- the antibody is covalently attached to a detection label by a chelating ligand.
- the chelating ligand is selected from DOTA, DOTP, DOTMA, DTPA and TETA.
- a cysteine engineered antibody as described herein is covalently attached to a drug moiety selected from a maytansinoid, an auristatin, a dolastatin, a trichothecene, CC1065, a calicheamicin, enediyne antibiotics, a taxane, and an anthracycline to form an antibody-drug conjugate having Formula I (i.e., Ab ⁇ (L ⁇ D) p ) where Ab is the antibody, L is a linker, D is the drug moiety, and p is 1, 2, 3, or 4.
- the antibody-drug conjugate has the structure:
- the drug (D) of Formula I of that is conjugated to a c steine en ineered antibod as described herein is a ma tansinoid having the structure:
- R is independently selected from H, methyl, ethyl, 1-propyl, 2-propyl, 1- butyl, 2-methyl-1-propyl, 2-butyl, 2-methyl-2-propyl, 1-pentyl, 2-pentyl, 3-pentyl, 2-methyl- 2-butyl, 3-methyl-2-butyl, 3-methyl-1-butyl, 2-methyl-1-butyl, 1-hexyl, 2-hexyl, 3-hexyl, 2- methyl-2-pentyl, 3-methyl-2-pentyl, 4-methyl-2-pentyl, 3-methyl-3-pentyl, 2-methyl-3- pentyl, 2,3-dimethyl-2-butyl, and 3,3-dimethyl-2-butyl; and m is 1, 2, or 3.
- the drug (D) of Formula I of that is conjugated to a cysteine engineered antibody as described herein is selected from the structures:
- the drug (D) of Formula I of that is conjugated to a
- n 0, 1, or 2.
- the drug (D) of Formula I of that is conjugated to a cysteine engineered antibody as described herein is a monomethylauristatin drug moiety MMAE or MMAF having the structures:
- cysteine engineered antibody as described herein has one of the following structures:
- cysteine engineered antibody as described herein has the following structures:
- a cysteine engineered antibody as described herein is conjugated to a drug that falls into one of the following classes, that is described in further detail in a later section of this specification: auristatins, dolastatins, trichothecenes, CC1065, calicheamicins, enediyne antibiotics, taxanes, pyrrolobenzodiazepines (PBDs), 1- (Chloromethyl)-2,3-dihydro-1H-benzo[e]indole (CBI) dimers, CBI-PBD heterodimers, and anthracyclines.
- the linker (L) of a cysteine engineered antibody as described herein comprises a thiol-reactive agent.
- the linker (L) is selected from the group consisting of a maleimide, an iodoacetamide, and a pyridyl disulfide.
- the linker (L) is a pyridyl disulfide.
- the linker (L) is a pyridyl disulfide and the drug (D) is MMAE.
- this invention comprises a method of preparing an antibody-drug conjugate comprising reacting at least one free cysteine of a cysteine engineered antibody (Ab) with a linker-drug (L-D) reagent to form an antibody-drug conjugate having Formula (i.e., Ab ⁇ (L ⁇ D) p ) wherein Ab is the cysteine engineered antibody, L is a linker, D is a drug moiety, and p is 1, 2, 3, or 4; and wherein the cysteine engineered antibody comprises one or more free cysteine amino acids, wherein at least one free cysteine amino acid is selected from the cysteine mutations identified in any of Tables 1 or 2 or alternatively is selected from an alternate stable cysteine mutation identified in
- this invention comprises a method of preparing an antibody-drug conjugate comprising reacting at least one free cysteine of a cysteine engineered antibody (Ab) with a linker-drug (L-D) reagent to form an antibody-drug conjugate having Formula (i.e., Ab ⁇ (L ⁇ D) p ) wherein Ab is the cysteine engineered antibody, L is a linker, D is a drug moiety, and p is 1, 2, 3, or 4; and wherein the cysteine engineered antibody comprises one or more free cysteine amino acids, wherein at least one free cysteine amino acid is preferably selected from the cysteine mutations identified in Tables 1 and 2 or alternatively is selected from an alternate stable cysteine mutation identified in Tables 3 or 4.
- Formula i.e., Ab ⁇ (L ⁇ D) p
- the methods can be used to make a cysteine engineered antibody, wherein the in the cysteine mutation is in the heavy chain and is selected from the cysteine mutations identified in Tables 2 or 3.
- the methods can be used to make a cysteine engineered antibody, wherein the in the cysteine mutation is in the light chain and is selected from the cysteine mutations identified in Tables 1 and 4.
- the methods can be used to make a cysteine engineered antibody, wherein the in the cysteine mutation is selected from the cysteine mutations identified in Figure 21.
- the methods can be used to make a cysteine engineered antibody, wherein the in the cysteine mutation is selected from the cysteine mutations identified in Table 5.
- the methods can be used to make a cysteine engineered antibody, wherein the in the cysteine mutation is selected from the group consisting of HC-I195C, HC-S420C, HC-Y432C, and LC-G64C (according to Kabat numbering).
- the methods can be used to make a cysteine engineered antibody, wherein the in the cysteine mutation is selected from the group consisting of HC- Y432C and LC-G64C (according to Kabat numbering).
- the methods can be used to make a cysteine engineered antibody, wherein the in the cysteine mutation is a heavy chain mutation and is selected from the group consisting of Y33C, G162C, V184C, I195C, S420C, Y432C, and Q434C (according to Kabat numbering).
- the methods can be used to make a cysteine engineered antibody, wherein the in the cysteine mutation is a heavy chain mutation and is selected from the group consisting of R19C, E46C, T57C, Y59C, A60C, M100cC, W103C, G162C, I195C, V258C, S420C, H425C, and N430C (according to Kabat numbering).
- the methods can be used to make a cysteine engineered antibody, wherein the in the cysteine mutation is a heavy chain mutation and is selected from the group consisting of Y33C, G162C, V184C, and I195C (according to Kabat numbering).
- the methods can be used to make a cysteine engineered antibody, wherein the in the cysteine mutation is a heavy chain mutation and is selected from the group consisting of R19C, E46C, Y59C, A60C, M100cC, W103C, V258C, H425C, and N430C (according to Kabat numbering).
- the methods can be used to make a cysteine engineered antibody, wherein the in the cysteine mutation is in the light chain and is selected from the group consisting of Y55C, G64C, T85C, and T180C (according to Kabat numbering).
- the methods can be used to make a cysteine engineered antibody, wherein the in the cysteine mutation is in the light chain and is selected from the group consisting of T31C, S52C, G64C, R66C, A193C (according to Kabat numbering). In certain embodiments, the methods can be used to make a cysteine engineered antibody, wherein the in the cysteine mutation is in the light chain and selected from the group consisting of G64C, T85C, and T180C (according to Kabat numbering).
- the methods can be used to make a cysteine engineered antibody, wherein the in the cysteine mutation is in the light chain and is selected from the group consisting of S52C, G64C, R66C, and A193C (according to Kabat numbering).
- the methods can be used to make a cysteine engineered antibody, wherein the in the cysteine mutation in the light chain is selected from the group of cysteine mutations comprising LC- I106C, LC-R108C, LC-R142C, and LC- K149C according to Kabat numbering (see Figures 1a and 21).
- the methods can be used to make a cysteine engineered antibody, wherein the in the cysteine mutation in the in the light chain is LC-K149C according to Kabat numbering (see Figures 1a and 21 and Table 1).
- the methods can be used to make a cysteine engineered antibody, wherein the in the cysteine mutation in the heavy chain is selected from the group of cysteine mutations comprising HC-T114C, HC-A140C, HC-L174C, HC-L179C, HC-T187C, HC-T209C, HC-V262C, HC-G371C, HC-Y373C, HC-E382C, HC-S424C, HC- N434C, and HC-Q438C according to EU numbering (see Figure 1b and 21 and Table 2).
- the methods can be used to make a cysteine engineered antibody, wherein the in the cysteine mutation in the in the heavy chain is HC-A140C according to EU numbering (i.e., HC-A136C according to Kabat numbering) (see Figure 1b and 21 and Table 2).
- the methods can be used to make a cysteine engineered antibody, wherein the in the cysteine mutation in the in the heavy chain is HC-L174C according to EU numbering (see Figure 1b and 21 and Table 2).
- the methods can be used to make a cysteine engineered antibody as described herein, wherein the in the cysteine engineered antibody is prepared by a process comprising:
- the methods can be used to make a cysteine engineered antibody, wherein the cysteine engineered antibody is a fusion protein
- the ABP comprises a sequence selected from:
- CDKTHTGGGSQRLMEDICLPRWGCLWEDDF SEQ ID NO:144
- QRLMEDICLPRWGCLWEDDF SEQ ID NO:145
- the methods can be used to make a cysteine engineered antibody, wherein the cysteine engineered antibody is selected from a
- the monoclonal antibody an antibody fragment, a bispecific antibody, a chimeric antibody, a human antibody, and a humanized antibody.
- the antibody fragment is a Fab fragment.
- the methods can be used to make a cysteine engineered antibody, wherein the cysteine engineered antibody is an anti-HER2 antibody.
- a cysteine engineered antibody as described herein is an anti-MUC16 antibody.
- a cysteine engineered antibody as described herein is an anti-STEAP1 antibody.
- a cysteine engineered antibody as described herein is an anti-CD79b antibody.
- a cysteine engineered antibody as described herein is an anti-CD22 antibody.
- a cysteine engineered antibody as described herein is an anti-B7H4 antibody.
- a cysteine engineered antibody as described herein is an anti-Ly6E antibody.
- a cysteine engineered antibody as described herein is an anti-NaPi2b antibody.
- the methods can be used to make a cysteine engineered antibody, wherein the cysteine engineered antibody binds to one or more of receptors (1)-(53):
- BMPR1B bone morphogenetic protein receptor-type IB
- MPF MPF, MSLN, SMR, megakaryocyte potentiating factor
- Napi3b also known as NaPi2b
- NAPI-3B also known as NaPi2b
- NPTIIb NPTIIb
- SLC34A2 solute carrier family 34 (sodium phosphate), member 2, type II sodium-dependent phosphate transporter 3b);
- Sema 5b (FLJ10372, KIAA1445, Mm.42015, SEMA5B, SEMAG, Semaphorin 5b Hlog, sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5B);
- PSCA hlg (2700050C12Rik, C530008O16Rik, RIKEN cDNA 2700050C12, RIKEN cDNA 2700050C12 gene);
- ETBR Endothelin type B receptor
- STEAP2 (HGNC_8639, IPCA-1, PCANAP1, STAMP1, STEAP2, STMP, prostate cancer associated gene 1, prostate cancer associated protein 1, six transmembrane epithelial antigen of prostate 2, six transmembrane prostate protein);
- TrpM4 (BR22450, FLJ20041, TRPM4, TRPM4B, transient receptor potential cation channel, subfamily M, member 4);
- CRIPTO (CR, CR1, CRGF, CRIPTO, TDGF1, teratocarcinoma-derived growth factor);
- CD21 (CR2 (Complement receptor 2) or C3DR (C3d/Epstein Barr virus receptor) or Hs.73792);
- CD79b CD79B, CD79 ⁇ , IGb (immunoglobulin-associated beta), B29
- FcRH2 IFGP4, IRTA4, SPAP1A (SH2 domain containing phosphatase anchor protein 1a), SPAP1B, SPAP1C);
- BAFF-R B cell -activating factor receptor, BLyS receptor 3, BR3
- CD22 B-cell receptor CD22-B isoform
- CD79a (CD79A, CD79 ⁇ , immunoglobulin-associated alpha, a B cell-specific protein);
- CXCR5 Bokitt's lymphoma receptor 1, a G protein-coupled receptor
- HLA-DOB Beta subunit of MHC class II molecule (Ia antigen)
- P2X5 Purinergic receptor P2X ligand-gated ion channel 5
- CD72 B-cell differentiation antigen CD72, Lyb-2
- LY64 Lymphocyte antigen 64 (RP105), type I membrane protein of the leucine rich repeat (LRR) family
- FcRH1 Fc receptor-like protein 1
- IRTA2 Immunoglobulin superfamily receptor translocation associated 2
- TENB2 (putative transmembrane proteoglycan);
- PMEL17 (silver homolog; SILV; D12S53E; PMEL17; SI; SIL);
- TMEFF1 transmembrane protein with EGF-like and two follistatin-like domains 1; Tomoregulin-1
- GDNF-Ra1 GDNF family receptor alpha 1; GFRA1; GDNFR;
- Ly6E lymphocyte antigen 6 complex, locus E; Ly67,RIG-E,SCA-2,TSA- 1
- Ly6G6D lymphocyte antigen 6 complex, locus G6D; Ly6-D, MEGT1; (43) LGR5 (leucine-rich repeat-containing G protein-coupled receptor 5;
- RET ret proto-oncogene; MEN2A; HSCR1; MEN2B; MTC1; PTC; CDHF12; Hs.168114; RET51; RET-ELE1);
- LY6K lymphocyte antigen 6 complex, locus K; LY6K; HSJ001348; FLJ35226;
- GPR19 G protein-coupled receptor 19; Mm.4787
- GPR54 KISS1 receptor; KISS1R; GPR54; HOT7T175; AXOR12;
- ASPHD1 aspartate beta-hydroxylase domain containing 1; LOC253982
- Tyrosinase TRR; OCAIA; OCA1A; tyrosinase; SHEP3;
- TMEM118 ring finger protein, transmembrane 2; RNFT2; FLJ14627
- GPR172A G protein-coupled receptor 172A; GPCR41; FLJ11856;
- the methods can be used to make a cysteine engineered antibody, wherein the cysteine engineered antibody is covalently attached to a capture label, a detection label, a drug moiety, or a solid support.
- the antibody is covalently attached to a biotin capture label.
- the antibody is covalently attached to a fluorescent dye detection label.
- the fluorescent dye is selected from a fluorescein type, a rhodamine type, dansyl, Lissamine, a cyanine, a phycoerythrin, Texas Red, and an analog thereof.
- the antibody is covalently attached to a radionuclide detection label selected from 3 H, 11 C, 14 C, 18 F, 32 P, 35 S, 64 Cu, 68 Ga, 86 Y, 89 Zr, 99 Tc, 111 In, 123 I, 124 I, 125 I, 131 I, 133 Xe, 177 Lu, 211 At, and 213 Bi.
- the antibody is covalently attached to a detection label by a chelating ligand.
- the chelating ligand is selected from DOTA, DOTP, DOTMA, DTPA and TETA.
- the methods can be used to make a cysteine engineered antibody, wherein the cysteine engineered antibody is covalently attached to a drug moiety selected from a maytansinoid, an auristatin, a dolastatin, a trichothecene, CC1065, a calicheamicin, enediyne antibiotics, a taxane, and an anthracycline to form an antibody-drug conjugate having Formula I (i.e., Ab ⁇ (L ⁇ D) p ) where Ab is the antibody, L is a linker, D is the drug moiety, and p is 1, 2, 3, or 4.
- a drug moiety selected from a maytansinoid, an auristatin, a dolastatin, a trichothecene, CC1065, a calicheamicin, enediyne antibiotics, a taxane, and an anthracycline
- the methods can be used to make a cysteine engineered antibody, wherein the cysteine engineered antibody has the structure:
- the methods can be used to make a cysteine engineered antibody, wherein the drug (D) of the cysteine engineered antibody is a maytansinoid having the structure:
- R is independently selected from H, methyl, ethyl, 1-propyl, 2-propyl, 1- butyl, 2-methyl-1-propyl, 2-butyl, 2-methyl-2-propyl, 1-pentyl, 2-pentyl, 3-pentyl, 2-methyl- 2-butyl, 3-methyl-2-butyl, 3-methyl-1-butyl, 2-methyl-1-butyl, 1-hexyl, 2-hexyl, 3-hexyl, 2- methyl-2-pentyl, 3-methyl-2-pentyl, 4-methyl-2-pentyl, 3-methyl-3-pentyl, 2-methyl-3- pentyl, 2,3-dimethyl-2-butyl, and 3,3-dimethyl-2-butyl; and m is 1, 2, or 3.
- the methods can be used to make a cysteine en ineered antibod wherein the dru D is selected from the structures:
- the methods can be used to make a cysteine engineered antibody that has the structure:
- n 0, 1, or 2
- the methods can be used to make a cysteine engineered antibody wherein D is a monomethylauristatin drug moiety MMAE or MMAF having the structures:
- the methods can be used to make a cysteine engineered antibody that is selected from the structures:
- the methods can be used to make a cysteine engineered antibody that is conjugated to a drug into one of the following classes and that is described in further detail in later sections of this specification: auristatins, dolastatins, trichothecenes, CC1065, calicheamicins, enediyne antibiotics, taxanes,
- the methods can be used to make a cysteine engineered antibody wherein the linker (L) comprises a thiol-reactive agent.
- the, linker (L) is selected from the group consisting of a maleimide, an iodoacetamide, and a pyridyl disulfide.
- the linker (L) is a pyridyl disulfide.
- the linker (L) is a pyridyl disulfide and the drug (D) is MMAE.
- the methods can be used to make a cysteine engineered antibody wherein the cysteine engineered antibody is an isolated cysteine engineered antibody.
- the methods can be used to make an isolated cysteine engineered antibody, wherein the in the isolated cysteine mutation in the light chain is selected from the group of cysteine mutations comprising LC- I106C, LC-R108C, LC- R142C, and LC-K149C according to Kabat numbering (see Figure 1a and Figure 21).
- the methods can be used to make an isolated cysteine engineered antibody, wherein the in the isolated cysteine mutation in the in the light chain is LC-K149C according to Kabat numbering (see Figures 1a and 21 and Table 1).
- the in the isolated cysteine mutation in the in the light chain is LC-K149C according to Kabat numbering (see Figures 1a and 21 and Table 1).
- the methods can be used to make an isolated cysteine engineered antibody, wherein the in the isolated cysteine mutation in the heavy chain is selected from the group of cysteine mutations comprising HC-T114C, HC-A140C, HC-L174C, HC-L179C, HC-T187C, HC-T209C, HC-V262C, HC-G371C, HC-Y373C, HC-E382C, HC-S424C, HC-N434C, and HC-Q438C according to EU numbering (see Figures 1b and 21 and Table 2).
- the methods can be used to make an isolated cysteine engineered antibody, wherein the in the isolated cysteine mutation in the in the heavy chain is HC-A140C according to EU numbering (i.e., HC-A136C according to Kabat numbering) (see Figures 1b and 21 and Table 2).
- any cysteine engineered antibody as described herein has one of the following cysteine mutations: LC-K149C according to Kabat numbering and HC-A140C according to EU numbering (see Tables 1 and 2 and Figures 1a and 1b).
- any cysteine engineered antibody as described herein has a thiol reactivity value of 0.8-1.0. In certain embodiments of the invention, any cysteine engineered antibody as described herein has a thiol reactivity value of 0.9-1.0. In certain embodiments of the invention, any cysteine engineered antibody as described herein has a thiol reactivity value of 0.6-0.9. In certain embodiments of the invention, any cysteine engineered antibody as described herein has a thiol reactivity value of 0.5-0.7. In certain embodiments of the invention, any cysteine engineered antibody as described herein has a thiol reactivity value of 0.4-0.6.
- any cysteine engineered antibody as described herein has a thiol reactivity value of 0.3-0.5. In certain embodiments of the invention, any cysteine engineered antibody as described herein has a thiol reactivity value of 0.2-0.4.
- the invention is a pharmaceutical composition comprising any cysteine engineered antibody as described herein.
- Figure 1a shows the Kabat numbering scheme for the 4D5 light chain.
- Figure 1b shows a sequential numbering scheme (left row) starting at the N-terminus in comparison with the Kabat numbering scheme (middle row) and EU numbering scheme (right row) for the 4D5 antibody.
- Figure 2 shows exemplary sites for cysteine mutagenesis and drug
- FIG. 1 shows the exemplary and additional exemplary residues for cysteine mutagenesis in the heavy chain.
- Figure 2B shows the exemplary and additional exemplary residues for cysteine mutagenesis in the light chain.
- the preferred sites for cysteine mutagenesis are shaded in grey and include HC-T114C, HC-A140C, HC-L174C, HC-L179C, HC-T187C, HC-T209C, HC-V262C, HC-G371C, HC-Y373C, HC-E382C, HC-S424C, HC- N434C, and HC-Q438C according to EU numbering ( Figure 2A) and LC- I106C, LC-R108C, LC-R142C, and LC-K149C according to Kabat numbering ( Figure 2B).
- the preferred HC- A140C according to EU numbering (HC-A136C according to Kabat numbering) and LC- K149C according to Kabat numbering are boxed and highlighted in a large font.
- Figure 3 shows a representative plot of aggregate and monomer peaks used for the aggregation analysis and calculations.
- the large peak between 8 and 10 minutes is the monomer peak and the small peak at 8 minutes is the aggregate peak.
- Figure 4 shows UV280 LC/MS chromatographs of THIOMAB TM antibodies.
- Figure 4a shows the conjugation peak detected by UV280 LC/MS.
- Figure 4b shows DAR0 (naked antibody), DAR1, and DAR2 conjugation peaks.
- Figure 5 shows the protocol for performing the full antibody cysteine screen. Full antibody screens were performed on PDS-MMAE and MC-vc-MMAE conjugates.
- Figure 6 shows representative stability graphs of MC-vc-MMAE and PDS- MMAE conjugates.
- Figure 6a shows representative stability graphs of the PDS-MMAE LC- R142C THIOMAB TM antibodies using LC/MS analysis at 0hr, 48 hrs, and 96 hrs.
- Figure 6b shows representative stability graphs of the MC-vc-MMAE LC-R142C THIOMAB TM antibodies using LC/MS analysis at 0hr, 48 hrs, and 96 hrs.
- Figure 7 shows a graph of the stabilities of different PDS-MMAE
- THIOMAB TM antibodies as assessed by the percent drug load.
- Figure 8 shows a graph of the stabilities of different MC-vc-MMAE
- THIOMAB TM antibodies as assessed by the percent drug load.
- Figure 9 shows a graph of the Average DAR over time of LC-K149C, LC- V205C, and HC-A114C THIOMAB TM anti-HER2 and anti-CD33 antibodies.
- Figure 10 shows exemplary THIOMAB TM antibody structures.
- Figure 10a shows the structure of thio-Her2-hu7C2-HC-A118C-disulfide-PBD and thio-Her2-hu7C2- LC-K149C-disulfide-PBD THIOMAB TM antibody.
- Figure 10b shows the structure for thio- Her2-hu7C2-LC-K149C-CBI dimer.
- Figure 10c shows the structure for thio-Her2-hu7C2- LC-K149C-disulfide-CBI-PBD.
- Figure 10d shows the structure for thio-Her2-hu7C2-LC- K149C-disulfide-PNU.
- Figure 10e shows the structure for thio-Her2-hu7C2-HC-A118C- maleimide-PNU and thio-Her2-hu7C2-LC-K149C-maleimide-PNU.
- Figure 11 shows a drawing (not to scale) of a MC-vc-MMAE THIOMAB TM antibody.
- Figure 12 shows a drawing (not to scale) of a PDS-MMAE THIOMAB TM antibody.
- FIG. 13 shows diagrams of the enzymatic modifications of certain drugs conjugated to a LC-K149C cysteine engineered antibody.
- the modifications are as follows: cryptophycin was subject to an amide cleavage, Tubulysin was subject to an acetyl loss (i.e., deacetylation), a CBI-PBD heterodimer linker-drug intermediate was subject to a carbamate loss, and Taxoids were unstable and showed multiple enzymatic cleavages
- Figure 14a shows that HC-A140C provides protection of the acetyl group of Tubulysin compared to LC-K149C. Specifically, it was shown using LCMS that there is less degradation of the drug using HC-A140C as the site of attachment than LC-K149C after 24hrs of incubation.
- Figures 14b and 14c show that HC-A140C was more stable than LC- K149C after 24hrs of incubation using a novel whole blood assay.
- Figure 15 shows the acetyl loss was drastically reduced at HC-A140C compared to LC-K149C using multiple rounds of WB assays. It was confirmed that HC- A140C rescues acetyl loss modification
- Figure 16a shows that HC-A140C provides protection of the carbomate group of a CBI-PBD heterodimer linker-drug intermediate. Specifically, it was shown using LCMS that there is less degradation of the drug using HC-A140C as the site of attachment than LC- K149C after 24hrs of incubation ( Figure 16a). Figures 16b and 16c show that HC-A140C was more stable than LC-K149C after 24hrs of incubation using a novel whole blood assay.
- Figure 17 shows that HC-A140C was more stable than LC-K149C using the novel whole blood assay described herein.
- Figure 18a shows that HC-A140C provides protection from modification of taxoids. Specifically, it was shown using LCMS that there is less degradation of the drug using HC-A140C as the site of attachment than LC-K149C after 24hrs of incubation.
- Figures 18b and 18c show that HC-A140C was more stable than LC-K149C after 24hrs of incubation using a novel whole blood assay.
- Figure 19 shows that HC-A140C was more stable (e.g., in terms of protecting taxoid drug loss) than LC-K149C using the novel whole blood assay.
- Figure 20 shows that HC-A140C protects cryptophycin from amide and ester cleavage compared to LC-K149C.
- Figure 21 shows the preferred HC and LC cysteine mutations for PDS and– vc linkers mapped to the diagram of an antibody.
- antibody herein is used in the broadest sense and specifically covers monoclonal antibodies, polyclonal antibodies, dimers, multimers, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments, so long as they exhibit the desired biological activity (Miller et al (2003) Jour. of Immunology 170:4854-4861).
- Antibodies may be murine, human, humanized, chimeric, or derived from other species.
- An antibody is a protein generated by the immune system that is capable of recognizing and binding to a specific antigen. (Janeway, C., Travers, P., Walport, M., Shlomchik (2001) Immuno Biology, 5th Ed., Garland Publishing, New York).
- a target antigen generally has numerous binding sites, also called epitopes, recognized by CDRs on multiple antibodies. Each antibody that specifically binds to a different epitope has a different structure. Thus, one antigen may have more than one corresponding antibody.
- An antibody includes a full- length immunoglobulin molecule or an immunologically active portion of a full-length immunoglobulin molecule, i.e., a molecule that contains an antigen binding site that immunospecifically binds an antigen of a target of interest or part thereof, such targets including but not limited to, cancer cell or cells that produce autoimmune antibodies associated with an autoimmune disease.
- the immunoglobulin disclosed herein can be of any type (e.g., IgG, IgE, IgM, IgD, and IgA), class (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2) or subclass of immunoglobulin molecule.
- the immunoglobulins can be derived from any species. In one aspect, however, the immunoglobulin is of human, murine, or rabbit origin.
- Antibody fragments comprise a portion of a full length antibody, generally the antigen binding or variable region thereof.
- Examples of antibody fragments include Fab, Fab', F(ab') 2 , and Fv fragments; diabodies; linear antibodies; minibodies (Olafsen et al (2004) Protein Eng. Design & Sel.17(4):315-323), fragments produced by a Fab expression library, anti-idiotypic (anti-Id) antibodies, CDR (complementary determining region), and epitope- binding fragments of any of the above which immunospecifically bind to cancer cell antigens, viral antigens or microbial antigens, single-chain antibody molecules; and multispecific antibodies formed from antibody fragments.
- an antibody provided herein is a multispecific antibody, e.g. a bispecific antibody.
- the term“multispecific antibody” as used herein refers to an antibody comprising an antigen-binding domain that has polyepitopic specificity (i.e., is capable of binding to two, or more, different epitopes on one molecule or is capable of binding to epitopes on two, or more, different molecules).
- multispecific antibodies are monoclonal antibodies that have binding specificities for at least two different antigen binding sites (such as a bispecific antibody).
- the first antigen-binding domain and the second antigen- binding domain of the multispecific antibody may bind the two epitopes within one and the same molecule (intramolecular binding).
- the first antigen-binding domain and the second antigen-binding domain of the multispecific antibody may bind to two different epitopes on the same molecule.
- the two different epitopes that a multispecific antibody binds are epitopes that are not normally bound at the same time by one monospecific antibody, such as e.g.
- the first antigen-binding domain and the second antigen-binding domain of the multispecific antibody may bind epitopes located within two distinct molecules (intermolecular binding).
- the first antigen-binding domain of the multispecific antibody may bind to one epitope on one molecule
- the second antigen-binding domain of the multispecific antibody may bind to another epitope on a different molecule, thereby cross-linking the two molecules.
- the antigen-binding domain of a multispecific antibody comprises two VH/VL units, wherein a first VH/VL unit binds to a first epitope and a second VH/VL unit binds to a second epitope, wherein each VH/VL unit comprises a heavy chain variable domain (VH) and a light chain variable domain (VL).
- Such multispecific antibodies include, but are not limited to, full length antibodies, antibodies having two or more VL and VH domains, and antibody fragments (such as Fab, Fv, dsFv, scFv, diabodies, bispecific diabodies and triabodies, antibody fragments that have been linked covalently or non-covalently).
- a VH/VL unit that further comprises at least a portion of a heavy chain variable region and/or at least a portion of a light chain variable region may also be referred to as an“arm” or“hemimer” or“half antibody.”
- a hemimer comprises a sufficient portion of a heavy chain variable region to allow
- a hemimer comprises a knob mutation or a hole mutation, for example, to allow
- heterodimerization with a second hemimer or half antibody that comprises a complementary hole mutation or knob mutation.
- Knob mutations and hole mutations are discussed further below.
- a multispecific antibody provided herein may be a bispecific antibody.
- the term“bispecific antibody” as used herein refers to a multispecific antibody comprising an antigen-binding domain that is capable of binding to two different epitopes on one molecule or is capable of binding to epitopes on two different molecules.
- a bispecific antibody may also be referred to herein as having“dual specificity” or as being “dual specific.”
- Exemplary bispecific antibodies may bind both the molecule and any other antigen.
- one of the binding specificities is for the molecule and the other is for CD3. See, e.g., U.S. Patent No.5,821,337.
- bispecific antibodies may bind to two different epitopes of the same molecule.
- bispecific antibodies may bind to two different epitopes on two different molecules.
- Bispecific antibodies may also be used to localize cytotoxic agents to cells which express the molecule of interest.
- Bispecific antibodies can be prepared as full length antibodies or antibody fragments.
- Techniques for making multispecific antibodies include, but are not limited to, recombinant co-expression of two immunoglobulin heavy chain-light chain pairs having different specificities (see Milstein and Cuello, Nature 305: 537 (1983), WO 93/08829, and Traunecker et al., EMBO J.10: 3655 (1991)), and“knob-in-hole” engineering (see, e.g., U.S. Patent No.5,731,168, WO2009/089004, US2009/0182127, US2011/0287009, Marvin and Zhu, Acta Pharmacol. Sin. (2005) 26(6):649-658, and Kontermann (2005) Acta Pharmacol. Sin., 26:1-9).
- knock-into-hole or“KnH” technology as used herein refers to the technology directing the pairing of two polypeptides together in vitro or in vivo by introducing a protuberance (knob) into one polypeptide and a cavity (hole) into the other polypeptide at an interface in which they interact.
- KnHs have been introduced in the Fc:Fc binding interfaces, CL:CH1 interfaces or VH/VL interfaces of antibodies (see, e.g., US 2011/0287009, US2007/0178552, WO 96/027011, WO 98/050431, Zhu et al., 1997, Protein Science 6:781-788, and WO2012/106587).
- KnHs drive the pairing of two different heavy chains together during the manufacture of multispecific antibodies.
- multispecific antibodies having KnH in their Fc regions can further comprise single variable domains linked to each Fc region, or further comprise different heavy chain variable domains that pair with similar or different light chain variable domains.
- KnH technology can be also be used to pair two different receptor extracellular domains together or any other polypeptide sequences that comprises different target recognition sequences (e.g., including affibodies, peptibodies and other Fc fusions).
- knock mutation refers to a mutation that introduces a protuberance (knob) into a polypeptide at an interface in which the polypeptide interacts with another polypeptide.
- the other polypeptide has a hole mutation.
- hole mutation refers to a mutation that introduces a cavity (hole) into a polypeptide at an interface in which the polypeptide interacts with another polypeptide.
- the other polypeptide has a knob mutation.
- A“protuberance” refers to at least one amino acid side chain which projects from the interface of a first polypeptide and is therefore positionable in a compensatory cavity in the adjacent interface (i.e. the interface of a second polypeptide) so as to stabilize the heteromultimer, and thereby favor heteromultimer formation over homomultimer formation, for example.
- the protuberance may exist in the original interface or may be introduced synthetically (e.g., by altering nucleic acid encoding the interface). In some embodiments, nucleic acid encoding the interface of the first polypeptide is altered to encode the protuberance.
- nucleic acid encoding at least one“original” amino acid residue in the interface of the first polypeptide is replaced with nucleic acid encoding at least one“import” amino acid residue which has a larger side chain volume than the original amino acid residue. It will be appreciated that there can be more than one original and corresponding import residue.
- the side chain volumes of the various amino residues are shown, for example, in Table 1 of US2011/0287009. A mutation to introduce a
- protuberance may be referred to as a“knob mutation.”
- import residues for the formation of a protuberance are naturally occurring amino acid residues selected from arginine (R), phenylalanine (F), tyrosine (Y) and tryptophan (W).
- an import residue is tryptophan or tyrosine.
- the original residue for the formation of the protuberance has a small side chain volume, such as alanine, asparagine, aspartic acid, glycine, serine, threonine or valine.
- A“cavity” refers to at least one amino acid side chain which is recessed from the interface of a second polypeptide and therefore accommodates a corresponding protuberance on the adjacent interface of a first polypeptide.
- the cavity may exist in the original interface or may be introduced synthetically (e.g. by altering nucleic acid encoding the interface).
- nucleic acid encoding the interface of the second polypeptide is altered to encode the cavity. To achieve this, the nucleic acid encoding at least one“original” amino acid residue in the interface of the second polypeptide is replaced with DNA encoding at least one“import” amino acid residue which has a smaller side chain volume than the original amino acid residue.
- import residues for the formation of a cavity are naturally occurring amino acid residues selected from alanine (A), serine (S), threonine (T) and valine (V).
- an import residue is serine, alanine or threonine.
- the original residue for the formation of the cavity has a large side chain volume, such as tyrosine, arginine, phenylalanine or tryptophan.
- a mutation to introduce a“cavity” may be referred to as a“hole mutation.”
- the protuberance is“positionable” in the cavity which means that the spatial location of the protuberance and cavity on the interface of a first polypeptide and second polypeptide respectively and the sizes of the protuberance and cavity are such that the protuberance can be located in the cavity without significantly perturbing the normal association of the first and second polypeptides at the interface.
- protuberances such as Tyr, Phe and Trp do not typically extend perpendicularly from the axis of the interface and have preferred conformations
- the alignment of a protuberance with a corresponding cavity may, in some instances, rely on modeling the protuberance/cavity pair based upon a three- dimensional structure such as that obtained by X-ray crystallography or nuclear magnetic resonance (NMR). This can be achieved using widely accepted techniques in the art.
- a knob mutation in an IgG1 constant region is T366W (EU numbering).
- a hole mutation in an IgG1 constant region comprises one or more mutations selected from T366S, L368A and Y407V (EU numbering).
- a hole mutation in an IgG1 constant region comprises T366S, L368A and Y407V (EU numbering).
- a knob mutation in an IgG4 constant region is T366W (EU numbering).
- a hole mutation in an IgG4 constant region comprises one or more mutations selected from T366S, L368A, and Y407V (EU numbering).
- a hole mutation in an IgG4 constant region comprises T366S, L368A, and Y407V (EU numbering).
- Multispecific antibodies may also be made by engineering electrostatic steering effects for making antibody Fc-heterodimeric molecules (WO 2009/089004A1); cross-linking two or more antibodies or fragments (see, e.g., US Patent No.4,676,980, and Brennan et al., Science, 229: 81 (1985)); using leucine zippers to produce bi-specific antibodies (see, e.g., Kostelny et al., J. Immunol., 148(5):1547-1553 (1992)); using "diabody” technology for making bispecific antibody fragments (see, e.g., Hollinger et al., Proc. Natl. Acad. Sci.
- Engineered antibodies with three or more functional antigen binding sites including “Octopus antibodies” or“dual-variable domain immunoglobulins” (DVDs) are also included herein (see, e.g., US 2006/0025576A1, and Wu et al. Nature Biotechnology (2007)).
- the antibody or fragment herein also includes a“Dual Acting FAb” or“DAF” comprising an antigen binding site that binds to the molecule as well as another, different antigen (see, US 2008/0069820, for example).
- the term“monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to polyclonal antibody preparations which include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen. In addition to their specificity, the monoclonal antibodies are advantageous in that they may be synthesized uncontaminated by other antibodies.
- the modifier“monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
- the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler et al (1975) Nature 256:495, or may be made by recombinant DNA methods (see for example: US 4816567; US 5807715).
- the monoclonal antibodies may also be isolated from phage antibody libraries using the techniques described in Clackson et al (1991) Nature, 352:624-628; Marks et al (1991) J. Mol. Biol., 222:581-597; for example.
- the monoclonal antibodies herein specifically include“chimeric” antibodies in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (US 4816567; and Morrison et al (1984) Proc. Natl. Acad. Sci. USA, 81:6851-6855).
- Chimeric antibodies of interest herein include “primatized” antibodies comprising variable domain antigen-binding sequences derived from a non-human primate (e.g., Old World Monkey, Ape etc) and human constant region sequences.
- An“intact antibody” herein is one comprising a VL and VH domains, as well as a light chain constant domain (CL) and heavy chain constant domains, CH1, CH2 and CH3.
- the constant domains may be native sequence constant domains (e.g., human native sequence constant domains) or amino acid sequence variant thereof.
- the intact antibody may have one or more“effector functions” which refer to those biological activities attributable to the Fc constant region (a native sequence Fc region or amino acid sequence variant Fc region) of an antibody. Examples of antibody effector functions include C1q binding;
- one or more amino acid modifications may be introduced into the Fc region of an antibody provided herein, thereby generating an Fc region variant.
- the Fc region variant may comprise a human Fc region sequence (e.g., a human IgG1, IgG2, IgG3 or IgG4 Fc region) comprising an amino acid modification (e.g. a substitution) at one or more amino acid positions.
- the invention contemplates an antibody variant that possesses some but not all effector functions, which make it a desirable candidate for applications in which the half life of the antibody in vivo is important yet certain effector functions (such as complement and ADCC) are unnecessary or deleterious.
- Fc receptor (FcR) binding assays can be conducted to ensure that the antibody lacks Fc ⁇ R binding (hence likely lacking ADCC activity), but retains FcRn binding ability.
- FcR expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol.9:457-492 (1991).
- Non-limiting examples of in vitro assays to assess ADCC activity of a molecule of interest is described in U.S. Patent No.5,500,362 (see, e.g. Hellstrom, I. et al. Proc. Nat’l Acad. Sci. USA 83:7059-7063 (1986)) and Hellstrom, I et al., Proc. Nat’l Acad. Sci. USA 82:1499-1502 (1985); 5,821,337 (see Bruggemann, M. et al., J. Exp. Med.166:1351-1361 (1987)).
- non-radioactive assays methods may be employed (see, for example, ACTITM non- radioactive cytotoxicity assay for flow cytometry (CellTechnology, Inc. Mountain View, CA; and CytoTox 96 ® non-radioactive cytotoxicity assay (Promega, Madison, WI).
- Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells.
- ADCC activity of the molecule of interest may be assessed in vivo, e.g., in an animal model such as that disclosed in Clynes et al. Proc. Nat’l Acad. Sci. USA 95:652-656 (1998).
- C1q binding assays may also be carried out to confirm that the antibody is unable to bind C1q and hence lacks CDC activity. See, e.g., C1q and C3c binding ELISA in WO 2006/029879 and WO 2005/100402.
- a CDC assay may be performed (see, for example, Gazzano-Santoro et al., J. Immunol.
- FcRn binding and in vivo clearance/half-life determinations can also be performed using methods known in the art (see, e.g., Petkova, S.B. et al., Int’l. Immunol.18(12):1759-1769 (2006)).
- one or more amino acid modifications may be introduced into the Fc portion of the antibody provided herein in order to increase IgG binding to the neonatal Fc receptor.
- the antibody comprises the following three mutations according to EU numbering: M252Y, S254T, and T256E (the“YTE mutation”) (US Patent No.8,697,650; see also Dall’Acqua et al., Journal of Biological Chemistry 281(33):23514-23524 (2006).
- the YTE mutation does not affect the ability of the antibody to bind to its cognate antigen.
- the YTE mutation increases the antibody’s serum half-life compared to the native (i.e., non-YTE mutant) antibody. In some embodiments, the YTE mutation increases the serum half-life of the antibody by 3-fold compared to the native (i.e., non-YTE mutant) antibody. In some embodiments, the YTE mutation increases the serum half-life of the antibody by 2- fold compared to the native (i.e., non-YTE mutant) antibody. In some embodiments, the YTE mutation increases the serum half-life of the antibody by 4-fold compared to the native (i.e., non-YTE mutant) antibody.
- the YTE mutation increases the serum half-life of the antibody by at least 5-fold compared to the native (i.e., non-YTE mutant) antibody. In some embodiments, the YTE mutation increases the serum half-life of the antibody by at least 10-fold compared to the native (i.e., non-YTE mutant) antibody. See, e.g., US Patent No.8,697,650; see also Dall’Acqua et al., Journal of Biological Chemistry 281(33):23514-23524 (2006).
- the YTE mutant provides a means to modulate antibody- dependent cell-mediated cytotoxicity (ADCC) activity of the antibody.
- ADCC antibody- dependent cell-mediated cytotoxicity
- the YTEO mutant provides a means to modulate ADCC activity of a humanized IgG antibody directed against a human antigen. See, e.g., US Patent No.8,697,650; see also Dall’Acqua et al., Journal of Biological Chemistry 281(33):23514-23524 (2006).
- the YTE mutant allows the simultaneous modulation of serum half-life, tissue distribution, and antibody activity (e.g., the ADCC activity of an IgG antibody). See, e.g., US Patent No.8,697,650; see also Dall’Acqua et al., Journal of Biological Chemistry 281(33):23514-23524 (2006).
- Antibodies with reduced effector function include those with substitution of one or more of Fc region residues 238, 265, 269, 270, 297, 327 and 329 according to EU numbering (U.S. Patent No.6,737,056).
- Such Fc mutants include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327 according to EU numbering, including the so-called “DANA” Fc mutant with substitution of residues 265 and 297 to alanine according to EU numbering (i.e., D265A and N297A according to EU numbering) (US Patent No.7,332,581).
- the Fc mutant comprises the following two amino acid substitutions: D265A and N297A.
- the Fc mutant consists of the following two amino acid substitutions: D265A and N297A.
- the proline at position329 (EU numbering ) (P329) of a wild- type human Fc region is substituted with glycine or arginine or an amino acid residue large enough to destroy the proline sandwich within the Fc/Fc ⁇ receptor interface, that is formed between the P329 of the Fc and tryptophan residues W87 and W110 of FcgRIII (Sondermann et al.: Nature 406, 267-273 (20 July 2000)).
- At least one further amino acid substitution in the Fc variant is S228P, E233P, L234A, L235A, L235E, N297A, N297D, or P331S and still in another embodiment said at least one further amino acid substitution is L234A and L235A of the human IgG1 Fc region or S228P and L235E of the human IgG4 Fc region, all according to EU numbering (U.S. Patent No. 8,969,526 which is incorporated by reference in its entirety).
- a polypeptide comprises the Fc variant of a wild-type human IgG Fc region wherein the polypeptide has P329 of the human IgG Fc region substituted with glycine and wherein the Fc variant comprises at least two further amino acid substitutions at L234A and L235A of the human IgG1 Fc region or S228P and L235E of the human IgG4 Fc region, and wherein the residues are numbered according to the EU numbering (U.S. Patent No.8,969,526 which is incorporated by reference in its entirety).
- the polypeptide comprising the P329G, L234A and L235A (EU numbering) substitutions exhibit a reduced affinity to the human Fc ⁇ RIIIA and Fc ⁇ RIIA, for down-modulation of ADCC to at least 20% of the ADCC induced by the polypeptide comprising the wild type human IgG Fc region, and/or for down-modulation of ADCP (U.S. Patent No.8,969,526 which is incorporated by reference in its entirety).
- polypeptide comprising an Fc variant of a wild type human Fc polypeptide comprises a triple mutation: an amino acid substitution at position Pro329, a L234A and a L235A mutation according to EU numbering (P329 / LALA) (U.S. Patent No.8,969,526 which is incorporated by reference in its entirety).
- the polypeptide comprises the following amino acid substitutions: P329G, L234A, and L235A according to EU numbering.
- an antibody variant comprises an Fc region with one or more amino acid substitutions which improve ADCC, e.g., substitutions at positions 298, 333, and/or 334 of the Fc region (EU numbering).
- alterations are made in the Fc region that result in altered (i.e., either improved or diminished) C1q binding and/or Complement Dependent Cytotoxicity (CDC), e.g., as described in US Patent No.6,194,551, WO 99/51642, and Idusogie et al. J. Immunol.164: 4178- 4184 (2000).
- CDC Complement Dependent Cytotoxicity
- Antibodies with increased half-lives and improved binding to the neonatal Fc receptor (FcRn), which is responsible for the transfer of maternal IgGs to the fetus are described in US2005/0014934A1 (Hinton et al.). Those antibodies comprise an Fc region with one or more substitutions therein which improve binding of the Fc region to FcRn.
- Such Fc variants include those with substitutions at one or more of Fc region residues: 238, 256, 265, 272, 286, 303, 305, 307, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 or 434, e.g., substitution of Fc region residue 434 (US Patent No.
- immunoglobulin antibodies can be assigned to different“classes.” There are five major classes of intact immunoglobulin antibodies: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into“subclasses” (isotypes), e.g., IgG1, IgG2, IgG3, IgG4, IgA, and IgA2.
- the heavy-chain constant domains that correspond to the different classes of antibodies are called ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ , respectively.
- the subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.
- Ig forms include hinge-modifications or hingeless forms (Roux et al (1998) J. Immunol.161:4083-4090; Lund et al (2000) Eur. J. Biochem.267:7246-7256; US 2005/0048572; US 2004/0229310).
- A“cysteine engineered antibody” or“cysteine engineered antibody variant” is an antibody in which one or more residues of an antibody are substituted with cysteine residues.
- the thiol group(s) of the cysteine engineered antibodies can be conjugated to a drug moiety (e.g., via a linker) to form a THIOMAB TM antibody (i.e., a THIOMAB TM antibody drug conjugate (TDC)).
- THIOMAB TM antibody i.e., a THIOMAB TM antibody drug conjugate (TDC)
- the substituted residues occur at accessible sites of the antibody.
- reactive thiol groups are thereby positioned at accessible sites of the antibody and may be used to conjugate the antibody to other moieties, such as drug moieties or linker-drug moieties, to create an immunoconjugate, as described further herein.
- a THIOMAB TM antibody may be an antibody with a single mutation of a non-cysteine native residue to a cysteine in the light chain (e.g., G64C, I106C, R108C, K149C or R142C according to Kabat numbering) or in the heavy chain (e.g., HC-D101C, HC-V184C, or HC-T205C according to Kabat numbering, or HC-T114C, HC-A140C, HC-L174C, HC-L179C, HC-T187C, HC-T209C, HC-V262C, HC- G371C, HC-Y373C, HC-E382C, HC-S424C, HC-N434C, and HC-Q438C according to EU numbering (i.e., HC-A136C according to Kabat numbering is HC-A140C according to EU numbering) (see Figure 1b)
- An“ErbB receptor” is a receptor protein tyrosine kinase which belongs to the ErbB receptor family whose members are important mediators of cell growth, differentiation and survival.
- the ErbB receptor family includes four distinct members including epidermal growth factor receptor (EGFR, ErbB1, HER1), HER2 (ErbB2 or p185neu), HER3 (ErbB3) and HER4 (ErbB4 or tyro2).
- EGFR epidermal growth factor receptor
- HER2 ErbB2 or p185neu
- HER3 ErbB3
- HER4 ErbB4 or tyro2
- a panel of anti-ErbB2 antibodies has been characterized using the human breast tumor cell line SKBR3 (Hudziak et al (1989) Mol. Cell. Biol.9(3):1165- 1172. Maximum inhibition was obtained with the antibody called 4D5 which inhibited cellular proliferation by 56%.
- the antibody 4D5 was further found to sensitize ErbB2- overexpressing breast tumor cell lines to the cytotoxic effects of TNF- ⁇ (US 5677171).
- the anti-ErbB2 antibodies discussed in Hudziak et al. are further characterized in Fendly et al (1990) Cancer Research 50:1550-1558; Kotts et al. (1990) In Vitro 26(3):59A; Sarup et al. (1991) Growth Regulation 1:72-82; Shepard et al. J. (1991) Clin. Immunol.11(3):117-127; Kumar et al. (1991) Mol. Cell.
- the ErbB receptor will generally comprise an extracellular domain, which may bind an ErbB ligand; a lipophilic transmembrane domain; a conserved intracellular tyrosine kinase domain; and a carboxyl-terminal signaling domain harboring several tyrosine residues which can be phosphorylated.
- the ErbB receptor may be a“native sequence” ErbB receptor or an“amino acid sequence variant” thereof.
- the ErbB receptor is native sequence human ErbB receptor. Accordingly, a“member of the ErbB receptor family” includes EGFR (ErbB1), ErbB2, ErbB3, ErbB4.
- amino acid sequence variant refers to polypeptides having amino acid sequences that differ to some extent from a native sequence polypeptide.
- the amino acid sequence variants possess substitutions, deletions, and/or insertions at certain positions within the amino acid sequence of the native amino acid sequence.
- Amino acids are designated by the conventional names, one-letter and three-letter codes.
- an amino acid sequence variant will possess at least about 70% sequence identity with at least one receptor binding domain of a native ErbB ligand or with at least one ligand binding domain of a native ErbB receptor, and preferably, it will be at least about 80%, more preferably, at least about 90% homologous by sequence with such receptor or ligand binding domains.
- Sequence identity is defined as the percentage of residues in the amino acid sequence variant that are identical after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity.
- Methods and computer programs for the alignment are well known in the art.
- One such computer program is“Align 2,” authored by Genentech, Inc., which was filed with user documentation in the United States Copyright Office, Washington, DC 20559, on December 10, 1991.
- “Native antibodies” are usually heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light (L) chains and two identical heavy (H) chains. Each light chain is linked to a heavy chain by one covalent disulfide bond, while the number of disulfide linkages varies among the heavy chains of different immunoglobulin isotypes. Each heavy and light chain also has regularly spaced intrachain disulfide bridges. Each heavy chain has at one end a variable domain (V H ) followed by a number of constant domains. Each light chain has a variable domain at one end (V L ) and a constant domain at its other end. The constant domain of the light chain is aligned with the first constant domain of the heavy chain, and the light-chain variable domain is aligned with the variable domain of the heavy chain. Particular amino acid residues are believed to form an interface between the light chain and heavy chain variable domains.
- variable refers to the fact that certain portions of the variable domains differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called hypervariable regions both in the light chain and the heavy chain variable domains. The more highly conserved portions of variable domains are called the framework regions (FRs).
- the variable domains of native heavy and light chains each comprise four FRs, largely adopting a ⁇ -sheet configuration, connected by three
- hypervariable regions which form loops connecting, and in some cases forming part of, the ⁇ -sheet structure.
- the hypervariable regions in each chain are held together in close proximity by the FRs and, with the hypervariable regions from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Kabat et al (1991) Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD).
- the constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody dependent cellular cytotoxicity (ADCC).
- hypervariable region when used herein refers to the amino acid residues of an antibody which are responsible for antigen-binding.
- the hypervariable region generally comprises amino acid residues from a“complementarity determining region” or “CDR” (e.g., residues 24-34 (L1), 50-56 (L2) and 89-97 (L3) in the light chain variable domain and 31-35 (H1), 50-65 (H2) and 95-102 (H3) in the heavy chain variable domain; Kabat et al supra) and/or those residues from a“hypervariable loop” (e.g., residues 26-32 (L1), 50-52 (L2) and 91-96 (L3) in the light chain variable domain and 26-32 (H1), 53-55 (H2) and 96-101 (H3) in the heavy chain variable domain; Chothia and Lesk (1987) J. Mol. Biol., 196:901-917).“Framework Region” or“FR” residues are
- Papain digestion of antibodies produces two identical antigen-binding fragments, called“Fab” fragments, each with a single antigen-binding site, and a residual “Fc” fragment, whose name reflects its ability to crystallize readily.
- Pepsin treatment yields an F(ab’)2 fragment that has two antigen-binding sites and is still capable of cross-linking antigen.
- Fv is the minimum antibody fragment which contains a complete antigen- recognition and antigen-binding site. This region consists of a dimer of one heavy chain and one light chain variable domain in tight, non-covalent association. It is in this configuration that the three hypervariable regions of each variable domain interact to define an antigen- binding site on the surface of the V H -V L dimer. Collectively, the six hypervariable regions confer antigen-binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three hypervariable regions specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
- the Fab fragment also contains the constant domain of the light chain and the first constant domain (CH1) of the heavy chain.
- Fab’ fragments differ from Fab fragments by the addition of a few residues at the carboxy terminus of the heavy chain CH1 domain including one or more cysteines from the antibody hinge region.
- Fab’-SH is the designation herein for Fab’ in which the cysteine residue(s) of the constant domains bear at least one free thiol group.
- F(ab’)2 antibody fragments originally were produced as pairs of Fab’ fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
- The“light chains” of antibodies from any vertebrate species can be assigned to one of two clearly distinct types, called kappa ( ⁇ ) and lambda ( ⁇ ), based on the amino acid sequences of their constant domains.
- Single-chain Fv or“scFv” antibody fragments comprise the V H and V L domains of antibody, wherein these domains are present in a single polypeptide chain.
- the Fv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the scFv to form the desired structure for antigen binding.
- a polypeptide linker between the VH and VL domains which enables the scFv to form the desired structure for antigen binding.
- Anti-ErbB2 antibody scFv fragments are described in WO 93/16185; US Patent Nos.5571894; and 5587458.
- “Humanized” forms of non-human (e.g., rodent) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin.
- Humanization is a method to transfer the murine antigen binding information to a non- immunogenic human antibody acceptor, and has resulted in many therapeutically useful drugs.
- the method of humanization generally begins by transferring all six murine complementarity determining regions (CDRs) onto a human antibody framework (Jones et al, (1986) Nature 321:522-525). These CDR-grafted antibodies generally do not retain their original affinity for antigen binding, and in fact, affinity is often severely impaired. Besides the CDRs, select non-human antibody framework residues must also be incorporated to maintain proper CDR conformation (Chothia et al (1989) Nature 342:877).
- humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
- donor antibody such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
- framework region (FR) residues of the human immunoglobulin are replaced by
- humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance.
- the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non- human immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence.
- the humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human
- A“free cysteine amino acid” refers to a cysteine amino acid residue which has been engineered into a parent antibody, has a thiol functional group (-SH), and is not paired as an intramolecular or intermolecular disulfide bridge.
- the term“thiol reactivity value” is a quantitative characterization of the reactivity of free cysteine amino acids. The thiol reactivity value is the percentage of a free cysteine amino acid in a cysteine engineered antibody which reacts with a thiol-reactive reagent, and converted to a maximum value of 1.
- a free cysteine amino acid on a cysteine engineered antibody which reacts in 100% yield with a thiol-reactive reagent, such as a biotin-maleimide reagent, to form a biotin-labelled antibody has a thiol reactivity value of 1.0.
- a thiol-reactive reagent such as a biotin-maleimide reagent
- Another cysteine amino acid engineered into the same or different parent antibody which reacts in 90% yield with a thiol-reactive reagent has a thiol reactivity value of about 0.9.
- Another cysteine amino acid engineered into the same or different parent antibody which reacts in 80% yield with a thiol-reactive reagent has a thiol reactivity value of about 0.8.
- Another cysteine amino acid engineered into the same or different parent antibody which reacts in 70% yield with a thiol-reactive reagent has a thiol reactivity value of about 0.7.
- Another cysteine amino acid engineered into the same or different parent antibody which reacts in 60% yield with a thiol-reactive reagent has a thiol reactivity value of about 0.6.
- Another cysteine amino acid engineered into the same or different parent antibody which reacts in 50% yield with a thiol-reactive reagent has a thiol reactivity value of about 0.5.
- Another cysteine amino acid engineered into the same or different parent antibody which reacts in 40% yield with a thiol-reactive reagent has a thiol reactivity value of about 0.4.
- Another cysteine amino acid engineered into the same or different parent antibody which reacts in 30% yield with a thiol-reactive reagent has a thiol reactivity value of about 0.3.
- Another cysteine amino acid engineered into the same or different parent antibody which reacts in 20% yield with a thiol-reactive reagent has a thiol reactivity value of about 0.2.
- Another cysteine amino acid engineered into the same or different parent antibody which reacts in 10% yield with a thiol-reactive reagent has a thiol reactivity value of about 0.1.
- Another cysteine amino acid engineered into the same or different parent antibody which fails totally to react with a thiol-reactive reagent has a thiol reactivity value of 0.
- Determination of the thiol reactivity value of a particular cysteine may be conducted by ELISA assay, mass spectroscopy, liquid chromatography, autoradiography, or other quantitative analytical tests.
- a "parent antibody” is an antibody comprising an amino acid sequence from which one or more amino acid residues are replaced by one or more cysteine residues.
- the parent antibody may comprise a native or wild type sequence.
- the parent antibody may have pre-existing amino acid sequence modifications (such as additions, deletions and/or substitutions) relative to other native, wild type, or modified forms of an antibody.
- a parent antibody may be directed against a target antigen of interest, e.g. a biologically important polypeptide.
- Antibodies directed against nonpolypeptide antigens are also contemplated.
- Exemplary parent antibodies include antibodies having affinity and selectivity for cell surface and transmembrane receptors and tumor-associated antigens (TAA).
- TAA tumor-associated antigens
- An“isolated” antibody is one which has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials which would interfere with diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or
- the antibody will be purified (1) to greater than 95% by weight of antibody as determined by the Lowry method, and most preferably more than 99% by weight, (2) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE under reducing or nonreducing conditions using Coomassie blue or, preferably, silver stain.
- Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody’s natural environment will not be present. Ordinarily, however, isolated antibody will be prepared by at least one purification step.
- an antibody“which binds” a molecular target or an antigen of interest is one capable of binding that antigen with sufficient affinity such that the antibody is useful in targeting a cell expressing the antigen.
- the antibody is one which binds ErbB2
- it will usually preferentially bind ErbB2 as opposed to other ErbB receptors, and may be one which does not significantly cross-react with other proteins such as EGFR, ErbB3 or ErbB4.
- the extent of binding of the antibody to these non- ErbB2 proteins e.g., cell surface binding to endogenous receptor
- FACS fluorescence activated cell sorting
- RIA radioimmunoprecipitation
- CD proteins and their ligands such as, but not limited to: (i) CD3, CD4, CD8, CD19, CD20, CD22, CD34, CD40, CD79 ⁇ (CD79a), and CD79 ⁇ (CD79b); (ii) members of the ErbB receptor family such as the EGF receptor, HER2, HER3 or HER4 receptor; (iii) cell adhesion molecules such as LFA-1, Mac1, p150,95, VLA-4, ICAM-1, VCAM and Alpha-v/Beta-3 integrin, including either alpha or beta subunits thereof (e.g.
- anti-CD11a, anti-CD18 or anti- CD11b antibodies include growth factors such as VEGF; IgE; blood group antigens; flk2/flt3 receptor; obesity (OB) receptor; mpl receptor; CTLA-4; protein C, BR3, c-met, tissue factor, etc; and (v) cell surface and transmembrane tumor-associated antigens (TAA).
- growth factors such as VEGF; IgE; blood group antigens; flk2/flt3 receptor; obesity (OB) receptor; mpl receptor; CTLA-4; protein C, BR3, c-met, tissue factor, etc; and TAA).
- anti-Ly6E antibody and“an antibody that binds to Ly6E” refer to an antibody that is capable of binding Ly6E with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting Ly6E.
- the extent of binding of an anti-Ly6E antibody to an unrelated, non-Ly6E protein is less than about 10% of the binding of the antibody to Ly6E as measured, e.g., by a radioimmunoassay (RIA).
- RIA radioimmunoassay
- an antibody that binds to Ly6E has a dissociation constant (Kd) of ⁇ 1 ⁇ M, ⁇ 100 nM, ⁇ 10 nM, ⁇ 5 nm, ⁇ 4 nM, ⁇ 3 nM, ⁇ 2 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g., 10 -8 M or less, e.g. from 10 -8 M to 10 -13 M, e.g., from 10 -9 M to 10 -13 M).
- an anti- Ly6E antibody binds to an epitope of Ly6E that is conserved among Ly6E from different species.
- anti-STEAP1 antibody and“an antibody that binds to STEAP1” refer to an antibody that is capable of binding STEAP1 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting STEAP1.
- the extent of binding of an anti-STEAP1 antibody to an unrelated, non-STEAP1 protein is less than about 10% of the binding of the antibody to STEAP1 as measured, e.g., by a radioimmunoassay (RIA).
- RIA radioimmunoassay
- an antibody that binds to STEAP1 has a dissociation constant (Kd) of ⁇ 1 ⁇ M, ⁇ 100 nM, ⁇ 10 nM, ⁇ 5 nm, ⁇ 4 nM, ⁇ 3 nM, ⁇ 2 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g., 10 -8 M or less, e.g. from 10 -8 M to 10- 13 M, e.g., from 10 -9 M to 10 -13 M).
- an anti- STEAP1 antibody binds to an epitope of STEAP1 that is conserved among STEAP1 from different species.
- anti-CD79b antibody and“an antibody that binds to CD79b” refer to an antibody that is capable of binding CD79b with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting CD79b.
- the extent of binding of an anti-CD79b antibody to an unrelated, non-CD79b protein is less than about 10% of the binding of the antibody to CD79b as measured, e.g., by a radioimmunoassay (RIA).
- RIA radioimmunoassay
- an antibody that binds to CD79b has a dissociation constant (Kd) of ⁇ 1 ⁇ M, ⁇ 100 nM, ⁇ 10 nM, ⁇ 5 nm, ⁇ 4 nM, ⁇ 3 nM, ⁇ 2 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g., 10 -8 M or less, e.g. from 10 -8 M to 10 -13 M, e.g., from 10 -9 M to 10 -13 M).
- an anti- CD79b antibody binds to an epitope of CD79b that is conserved among CD79b from different species.
- anti-MUC16 antibody and“an antibody that binds to MUC16” refer to an antibody that is capable of binding MUC16 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting MUC16.
- the extent of binding of an anti-MUC16 antibody to an unrelated, non-MUC16 protein is less than about 10% of the binding of the antibody to MUC16 as measured, e.g., by a radioimmunoassay (RIA).
- RIA radioimmunoassay
- an antibody that binds to MUC16 has a dissociation constant (Kd) of ⁇ 1 ⁇ M, ⁇ 100 nM, ⁇ 10 nM, ⁇ 5 nm, ⁇ 4 nM, ⁇ 3 nM, ⁇ 2 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g., 10 -8 M or less, e.g. from 10 -8 M to 10 -13 M, e.g., from 10 -9 M to 10 -13 M).
- an anti- MUC16 antibody binds to an epitope of MUC16 that is conserved among MUC16 from different species.
- anti-HER2 antibody and“an antibody that binds to HER2” refer to an antibody that is capable of binding HER2 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting HER2.
- the extent of binding of an anti-HER2 antibody to an unrelated, non-HER2 protein is less than about 10% of the binding of the antibody to HER2 as measured, e.g., by a radioimmunoassay (RIA).
- an antibody that binds to HER2 has a dissociation constant (Kd) of ⁇ 1 ⁇ M, ⁇ 100 nM, ⁇ 10 nM, ⁇ 5 nm, ⁇ 4 nM, ⁇ 3 nM, ⁇ 2 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g., 10 -8 M or less, e.g. from 10 -8 M to 10 -13 M, e.g., from 10 -9 M to 10 -13 M).
- an anti- HER2 antibody binds to an epitope of HER2 that is conserved among HER2 from different species.
- the terms“CD22 antibody” and“an antibody that binds to CD22” refer to an antibody that is capable of binding CD22 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting CD22.
- the extent of binding of an anti-CD22 antibody to an unrelated, non-CD22 protein is less than about 10% of the binding of the antibody to CD22 as measured, e.g., by a radioimmunoassay (RIA).
- an antibody that binds to CD22 has a dissociation constant (Kd) of ⁇ 1 ⁇ M, ⁇ 100 nM, ⁇ 10 nM, ⁇ 5 nm, ⁇ 4 nM, ⁇ 3 nM, ⁇ 2 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g., 10 -8 M or less, e.g. from 10 -8 M to 10 -13 M, e.g., from 10 -9 M to 10 -13 M).
- an anti- CD22 antibody binds to an epitope of CD22 that is conserved among CD22 from different species.
- anti-CD79b antibody and“an antibody that binds to CD79b” refer to an antibody that is capable of binding CD79b with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting CD79b.
- the extent of binding of an anti-CD79b antibody to an unrelated, non-CD79b protein is less than about 10% of the binding of the antibody to CD79b as measured, e.g., by a radioimmunoassay (RIA).
- RIA radioimmunoassay
- an antibody that binds to CD79b has a dissociation constant (Kd) of ⁇ 1 ⁇ M, ⁇ 100 nM, ⁇ 10 nM, ⁇ 5 nm, ⁇ 4 nM, ⁇ 3 nM, ⁇ 2 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g., 10 -8 M or less, e.g. from 10 -8 M to 10 -13 M, e.g., from 10 -9 M to 10 -13 M).
- an anti- CD79b antibody binds to an epitope of CD79b that is conserved among CD79b from different species.
- anti-NaPi2b antibody and“an antibody that binds to NaPi2b” refer to an antibody that is capable of binding NaPi2b with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting NaPi2b.
- the extent of binding of an anti-NaPi2b antibody to an unrelated, non-NaPi2b protein is less than about 10% of the binding of the antibody to NaPi2b as measured, e.g., by a radioimmunoassay (RIA).
- RIA radioimmunoassay
- an antibody that binds to NaPi2b has a dissociation constant (Kd) of ⁇ 1 ⁇ M, ⁇ 100 nM, ⁇ 10 nM, ⁇ 5 nm, ⁇ 4 nM, ⁇ 3 nM, ⁇ 2 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g., 10 -8 M or less, e.g. from 10 -8 M to 10 -13 M, e.g., from 10 -9 M to 10 -13 M).
- an anti- NaPi2b antibody binds to an epitope of NaPi2b that is conserved among NaPi2b from different species.
- the term“monoclonal antibody 4D5” refers to an antibody that has antigen binding residues of, or derived from, the murine 4D5 antibody (ATCC CRL 10463).
- the monoclonal antibody 4D5 may be murine
- monoclonal antibody 4D5 or a variant thereof, such as a humanized 4D5.
- exemplary humanized 4D5 antibodies include huMAb4D5-1, huMAb4D5-2, huMAb4D5-3,
- huMAb4D5-4 huMAb4D5-5, huMAb4D5-6, huMAb4D5-7 and huMAb4D5-8 (trastuzumab, HERCEPTIN®) as in US Patent No.5821337.
- the term“monoclonal antibody 7C2” or“7C2” refers to an antibody that has antigen biding residues of, or derived from the 7C2.v2.2.LA antibody.
- the 7C2 antibody is an anti-HER2 antibody.
- A“hu7C2.v.2.2.LA antibody-drug conjugate” refers to a humanized 7C2 antibody conjugated to a drug.
- the humanized 7C2 antibody conjugated to a drug via an engineered cysteine and linker.
- the humanized 7C2 ADC is co-administered with one or more additional therapeutic agents selected from trastuzumab (Herceptin®), T-DM1 (Kadcyla®) and pertuzumab (Perjeta®).
- a hu7C2 ADC is co-administered with trastuzumab.
- a hu7C2 ADC is co-administered with T-DM1. In some embodiments, a hu7C2 ADC is co-administered with pertuzumab. In some embodiments, a hu7C2 ADC is co-administered with trastuzumab and pertuzumab. In some embodiments, a hu7C2 ADC is co-administered with T-DM1 and pertuzumab.
- beneficial or desired clinical results include, but are not limited to, alleviation of symptoms, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable.
- Treatment can also mean prolonging survival as compared to expected survival if not receiving treatment.
- Those in need of treatment include those already with the condition or disorder as well as those prone to have the condition or disorder or those in which the condition or disorder is to be prevented.
- the term“therapeutically effective amount” refers to an amount of a drug effective to treat a disease or disorder in a mammal.
- the therapeutically effective amount of the drug may reduce the number of cancer cells; reduce the tumor size; inhibit (i.e., slow to some extent and preferably stop) cancer cell infiltration into peripheral organs; inhibit (i.e., slow to some extent and preferably stop) tumor metastasis; inhibit, to some extent, tumor growth; and/or relieve to some extent one or more of the symptoms associated with the cancer.
- the drug may prevent growth and/or kill existing cancer cells, it may be cytostatic and/or cytotoxic.
- efficacy can, for example, be measured by assessing the time to disease progression (TTP) and/or determining the response rate (RR).
- cancer refers to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth.
- A“tumor” comprises one or more cancerous cells. Examples of cancer include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia or lymphoid malignancies.
- squamous cell cancer e.g., epithelial squamous cell cancer
- lung cancer including small- cell lung cancer, non-small cell lung cancer (“NSCLC”), adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, rectal cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, anal carcinoma, penile carcinoma, as well as head and neck cancer.
- NSCLC non-small cell lung cancer
- adenocarcinoma of the lung and squamous carcinoma of the lung cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer
- An“ErbB-expressing cancer” is one comprising cells which have ErbB protein present at their cell surface.
- An“ErbB2-expressing cancer” is one which produces sufficient levels of ErbB2 at the surface of cells thereof, such that an anti-ErbB2 antibody can bind thereto and have a therapeutic effect with respect to the cancer.
- a cancer which“overexpresses” an antigenic receptor is one which has significantly higher levels of the receptor, such as ErbB2, at the cell surface thereof, compared to a noncancerous cell of the same tissue type.
- Such overexpression may be caused by gene amplification or by increased transcription or translation.
- Receptor overexpression may be determined in a diagnostic or prognostic assay by evaluating increased levels of the receptor protein present on the surface of a cell (e.g., via an
- IHC immunohistochemistry assay
- FISH fluorescent in situ hybridization
- PCR polymerase chain reaction
- A“chemotherapy” is use of a chemotherapeutic agent useful in the treatment of cancer.
- A“chemotherapeutic agent” is a chemical compound useful in the treatment of cancer, regardless of mechanism of action.
- the term“drug” or“drug moiety” are examples of chemotherapeutic agents. Accordingly, a wherein the THIOMAB TM antibodies described herein comprise a cysteine engineered antibody, a linker, and a drug, the drug may be any of the chemotherapeutic agents described herein.
- Classes of chemotherapeutic agents include, but are not limited to: alkylating agents, antimetabolites, spindle poison plant alkaloids, cytotoxic/antitumor antibiotics, topoisomerase inhibitors, antibodies, photosensitizers, and kinase inhibitors.
- chemotherapeutic agents include: erlotinib (TARCEVA®, Genentech/OSI Pharm.), docetaxel (TAXOTERE®, Sanofi-Aventis), 5-FU (fluorouracil, 5-fluorouracil, CAS No.51-21-8), gemcitabine (GEMZAR®, Lilly), PD-0325901 (CAS No.391210-10-9, Pfizer), cisplatin (cis-diamine,dichloroplatinum(II), CAS No.15663-27-1), carboplatin (CAS No.41575-94- 4), paclitaxel (TAXOL®, Bristol-Myers Squibb Oncology, Princeton, N.J.), temozolomide (4-methyl-5-oxo- 2,3,4,6,8-pentazabicyclo [4.3.0] nona-2,7,9-triene- 9-carboxamide, CAS No.85622-93-1, TEMODAR®,
- chemotherapeutic agents include: oxaliplatin
- IRESSA® IRESSA®, AstraZeneca
- CAMPTOSAR® CPT-11, Pfizer
- tipifarnib irinotecan
- dynemicin dynemicin A
- bisphosphonates such as clodronate
- an esperamicin as well as neocarzinostatin chromophore and related chromoprotein enediyne antibiotic chromophores
- aclacinomysins actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, carminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, morpholino-doxorubicin,
- cyanomorpholino-doxorubicin 2-pyrrolino-doxorubicin and deoxydoxorubicin
- epirubicin esorubicin, idarubicin, marcellomycin
- mitomycins such as mitomycin C, mycophenolic acid, nogalamycin, olivomycins, peplomycin, porfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin
- anti-metabolites such as methotrexate and 5-fluorouracil (5-FU); folic acid analogs such as denopterin,
- methotrexate, pteropterin, trimetrexate purine analogs such as fludarabine, 6- mercaptopurine, thiamiprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine; androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals such as aminoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; dia
- cyclophosphamide thiotepa; 6-thioguanine; mercaptopurine; methotrexate; platinum analogs such as cisplatin and carboplatin; vinblastine; etoposide (VP-16); ifosfamide; mitoxantrone; vincristine; vinorelbine (NAVELBINE®); novantrone; teniposide; edatrexate; daunomycin; aminopterin; capecitabine (XELODA®, Roche); ibandronate; CPT-11; topoisomerase inhibitor RFS 2000; difluoromethylornithine (DMFO); retinoids such as retinoic acid; and pharmaceutically acceptable salts, acids and derivatives of any of the above.
- platinum analogs such as cisplatin and carboplatin
- vinblastine etoposide (VP-16); ifosfamide; mitoxantrone; vincristine; vinore
- cytotoxic agent refers to a substance that inhibits or prevents the function of cells and/or causes destruction of cells.
- a chemotherapeutic agent i.e., a“drug” or“drug moiety” is can be a cytotoxic agent.
- the drug may be any of the cytotoxic agents described herein
- the term is intended to include radioactive isotopes (e.g., 211 At, 131 I, 125 I, 90 Y, 186 Re, 188 Re, 153 Sm, 212 Bi, 32 P, 60 C, and radioactive isotopes of Lu), chemotherapeutic agents, and toxins such as small molecule toxins or enzymatically active toxins of bacterial, fungal, plant or animal origin, including synthetic analogs and derivatives thereof.
- radioactive isotopes e.g., 211 At, 131 I, 125 I, 90 Y, 186 Re, 188 Re, 153 Sm, 212 Bi, 32 P, 60 C, and radioactive isotopes of Lu
- chemotherapeutic agents e.g., chemotherapeutic agents, and toxins such as small molecule toxins or enzymatically active toxins of bacterial, fungal, plant or animal origin, including synthetic analogs and derivative
- Phage display is a technique by which variant polypeptides are displayed as fusion proteins to a coat protein on the surface of phage, e.g., filamentous phage, particles.
- phage display One utility of phage display lies in the fact that large libraries of randomized protein variants can be rapidly and efficiently sorted for those sequences that bind to a target molecule with high affinity. Display of peptide and protein libraries on phage has been used for screening millions of polypeptides for ones with specific binding properties. Polyvalent phage display methods have been used for displaying small random peptides and small proteins, typically through fusions to either pIII or pVIII of filamentous phage (Wells and Lowman, (1992) Curr. Opin. Struct.
- phagemid vectors are used, which simplify DNA manipulations. Lowman and Wells, Methods: A companion to Methods in Enzymology, 3:205-0216 (1991).
- Phage display includes techniques for producing antibody-like molecules (Janeway, C., Travers, P., Walport, M., Shlomchik (2001) Immunobiology, 5th Ed., Garland Publishing, New York, p627-628; Lee et al ).
- a "phagemid” is a plasmid vector having a bacterial origin of replication, e.g., Co1E1, and a copy of an intergenic region of a bacteriophage.
- the phagemid may be used on any known bacteriophage, including filamentous bacteriophage and lambdoid bacteriophage.
- the plasmid will also generally contain a selectable marker for antibiotic resistance.
- Segments of DNA cloned into these vectors can be propagated as plasmids.
- the mode of replication of the plasmid changes to rolling circle replication to generate copies of one strand of the plasmid DNA and package phage particles.
- the phagemid may form infectious or non-infectious phage particles. This term includes phagemids which contain a phage coat protein gene or fragment thereof linked to a heterologous polypeptide gene as a gene fusion such that the heterologous polypeptide is displayed on the surface of the phage particle.
- Linker means a chemical moiety comprising a covalent bond or a chain of atoms that covalently attaches an antibody to a drug moiety.
- a linker is specified as L.
- Linkers include a divalent radical such as an alkyldiyl, an arylene, a heteroarylene, moieties such as: ⁇ (CR 2 ) n O(CR 2 ) n ⁇ , repeating units of alkyloxy (e.g. polyethylenoxy, PEG, polymethyleneoxy) and alkylamino (e.g.
- label means any moiety which can be covalently attached to an antibody and that functions to: (i) provide a detectable signal; (ii) interact with a second label to modify the detectable signal provided by the first or second label, e.g. FRET (fluorescence resonance energy transfer); (iii) stabilize interactions or increase affinity of binding, with antigen or ligand; (iv) affect mobility, e.g. electrophoretic mobility, or cell-permeability, by charge, hydrophobicity, shape, or other physical parameters, or (v) provide a capture moiety, to modulate ligand affinity, antibody/antigen binding, or ionic complexation.
- FRET fluorescence resonance energy transfer
- stereoisomers are identical except that they are mirror images of one another.
- a specific stereoisomer may also be referred to as an enantiomer, and a mixture of such isomers is often called an enantiomeric mixture.
- a 50:50 mixture of enantiomers is referred to as a racemic mixture or a racemate, which may occur where there has been no stereoselection or stereospecificity in a chemical reaction or process.
- racemic mixture and“racemate” refer to an equimolar mixture of two enantiomeric species, devoid of optical activity.
- pharmaceutically acceptable salt refers to pharmaceutically acceptable organic or inorganic salts of an ADC.
- Exemplary salts include, but are not limited, to sulfate, citrate, acetate, oxalate, chloride, bromide, iodide, nitrate, bisulfate, phosphate, acid phosphate, isonicotinate, lactate, salicylate, acid citrate, tartrate, oleate, tannate, pantothenate, bitartrate, ascorbate, succinate, maleate, gentisinate, fumarate, gluconate, glucuronate, saccharate, formate, benzoate, glutamate, methanesulfonate, ethanesulfonate, benzenesulfonate, p-toluenesulfonate, and pamoate (i.e., 1,1’-methylene-bis -(2-hydroxy-3- naphthoate)) salts.
- pamoate i.e., 1,1’-methylene-bis -(2-hydroxy
- a pharmaceutically acceptable salt may involve the inclusion of another molecule such as an acetate ion, a succinate ion or other counterion.
- the counterion may be any organic or inorganic moiety that stabilizes the charge on the parent compound.
- a pharmaceutically acceptable salt may have more than one charged atom in its structure. Instances where multiple charged atoms are part of the pharmaceutically acceptable salt can have multiple counter ions. Hence, a pharmaceutically acceptable salt can have one or more charged atoms and/or one or more counterion.
- “Pharmaceutically acceptable solvate” refers to an association of one or more solvent molecules and an ADC.
- solvents that form pharmaceutically acceptable solvates include, but are not limited to, water, isopropanol, ethanol, methanol, DMSO, ethyl acetate, acetic acid, and ethanolamine.
- the compounds of the invention include cysteine engineered antibodies where one or more amino acids of a wild-type or parent antibody are replaced (i.e.,“substituted” or “mutated”) with a cysteine amino acid (i.e., and“engineered cysteine”). Any form of antibody may be so engineered, i.e. mutated.
- a parent monoclonal antibody may be engineered to form a“THIOMAB TM antibody.”
- THIOMAB TM antibody is an antibody fragment (i.e., a Fab) that has an engineered cysteine.
- This Fab THIOMAB TM antibody can be referred to as“ThioFab.” It should be noted that a single site mutation yields a single engineered cysteine residue in a ThioFab, while a single site mutation yields two engineered cysteine residues in a THIOMAB TM antibody, due to the dimeric nature of the IgG antibody. Mutants with engineered cysteine (Cys) residues were evaluated for the reactivity of the newly introduced, engineered cysteine thiol groups. The thiol reactivity value is a relative, numerical term in the range of 0 to 1.0 and can be measured for any cysteine engineered antibody.
- Thiol reactivity values of cysteine engineered antibodies of the invention are in the range of 0.0 to 1.0. Specifically, the thiol reactivity values of cysteine engineered antibodies of the invention are in the range of 0.1 to 1.0. In certain embodiments, the thiol reactivity values of cysteine engineered antibodies of the invenention are in the ranges of 0.0 to 0.1, 0.1 to 0.5, 0.1 to 0.6, 0.1 to 0.7, 0.1 to 0.8, 0.1 to 0.9, or 0.1 to 1.0.
- the thiol reactivity values of cysteine engineered antibodies of the invenention are in the ranges of 0.2 to 1.0, 0.3 to 1.0, 0.4 to 1.0, 0.5 to 1.0, 0.6 to 1.0, 0.7 to 1.0, or 0.8 to 1.0. In certain embodiments, the thiol reactivity values of cysteine engineered antibodies of the invenention are in the range of 0.6 to 1.0. In certain embodiments, the thiol reactivity values of cysteine engineered antibodies of the invenention are in the ranges of 0.7 to 1.0. In certain embodiments, the thiol reactivity values of cysteine engineered antibodies of the invention are in the ranges of 0.8 to 10.
- the thiol reactivity values of cysteine engineered antibodies of the invenention are in the ranges of 0.5 to 0.8. In certain embodiments, the thiol reactivity values of cysteine engineered antibodies of the invenention are in the ranges of 0.5 to 0.9. In certain
- the thiol reactivity values of cysteine engineered antibodies of the invenention are in the ranges of 0.5 to 0.7. In certain embodiments, the thiol reactivity values of cysteine engineered antibodies of the invenention are in the ranges of 0.5 to 1.0.
- the design, selection, and preparation methods of the invention enable cysteine engineered antibodies which are reactive with electrophilic functionality. These methods further enable antibody conjugate compounds such as antibody-drug conjugate (ADC) compounds with drug molecules at designated, designed, selective sites. Reactive cysteine residues on an antibody surface allow specifically conjugating a drug moiety through a thiol reactive group such as maleimide or haloacetyl.
- ADC antibody-drug conjugate
- Reactive cysteine residues on an antibody surface allow specifically conjugating a drug moiety through a thiol reactive group such as maleimide or haloacetyl.
- the nucleophilic reactivity of the thiol functionality of a Cys residue to a maleimide group is about 1000 times higher compared to any other amino acid functionality in a protein, such as amino group of lysine residues or the N-terminal amino group.
- Thiol specific functionality in iodoacetyl and maleimide reagents may react with amine groups, but higher pH (>9.0) and longer reaction times are required (Garman, 1997, Non-Radioactive Labelling: A Practical Approach, Academic Press, London).
- cysteine engineered antibodies of the invention preferably retain the antigen binding capability of their wild type, parent antibody counterparts.
- cysteine engineered antibodies are capable of binding, preferably specifically, to antigens.
- antigens include, for example, tumor-associated antigens (TAA), cell surface receptor proteins and other cell surface molecules, transmembrane proteins, signalling proteins, cell survival regulatory factors, cell proliferation regulatory factors, molecules associated with (for e.g., known or suspected to contribute functionally to) tissue development or differentiation, lymphokines, cytokines, molecules involved in cell cycle regulation, molecules involved in vasculogenesis and molecules associated with (for e.g., known or suspected to contribute functionally to) angiogenesis.
- TAA tumor-associated antigens
- cell surface receptor proteins and other cell surface molecules include, for example, tumor-associated antigens (TAA), cell surface receptor proteins and other cell surface molecules, transmembrane proteins, signalling proteins, cell survival regulatory factors, cell proliferation regulatory factors, molecules associated with (for e.g., known or
- the tumor-associated antigen may be a cluster differentiation factor (i.e., a CD protein).
- An antigen to which a cysteine engineered antibody is capable of binding may be a member of a subset of one of the above-mentioned categories, wherein the other subset(s) of said category comprise other molecules/antigens that have a distinct characteristic (with respect to the antigen of interest).
- the parent antibody may also be a humanized antibody selected from huMAb4D5-1, huMAb4D5-2, huMAb4D5-3, huMAb4D5-4, huMAb4D5-5, huMAb4D5-6, huMAb4D5-7 and huMAb4D5-8 (Trastuzumab, HERCEPTIN®) as described in Table 3 of US 5821337, expressly incorporated herein by reference; humanized 520C9 (WO 93/21319) and humanized 2C4 antibodies as described herein.
- Cysteine engineered antibodies of the invention may be site-specifically and efficiently coupled with a thiol-reactive reagent.
- the thiol-reactive reagent may be a multifunctional linker reagent, a capture, i.e. affinity, label reagent (e.g. a biotin-linker reagent), a detection label (e.g. a fluorophore reagent), a solid phase immobilization reagent (e.g. SEPHAROSETM, polystyrene, or glass), or a drug-linker intermediate.
- label reagent e.g. a biotin-linker reagent
- a detection label e.g. a fluorophore reagent
- a solid phase immobilization reagent e.g. SEPHAROSETM, polystyrene, or glass
- a drug-linker intermediate e.g. SEPHAROSETM, polystyrene, or glass
- THIOMAB TM antibody by which the presence and reactivity of the engineered cysteine residue may be detected and measured.
- Reaction of a THIOMAB TM antibody with a multifunctional linker reagent provides a THIOMAB TM antibody with a functionalized linker which may be further reacted with a drug moiety reagent or other label.
- Reaction of a THIOMAB TM antibody with a drug-linker intermediate provides a THIOMAB TM antibody drug conjugate.
- the THIOMAB TM antibody is a ThioFab.
- the exemplary methods described here may be applied generally to the identification and production of antibodies, and more generally, to other proteins through application of the design and screening steps described herein.
- Such an approach may be applied to the conjugation of other thiol-reactive agents in which the reactive group is, for example, a maleimide, an iodoacetamide, a pyridyl disulfide, or other thiol-reactive conjugation partner (Haugland, 2003, Molecular Probes Handbook of Fluorescent Probes and Research Chemicals, Molecular Probes, Inc.; Brinkley, 1992, Bioconjugate Chem.3:2; Garman, 1997, Non-Radioactive Labelling: A Practical Approach, Academic Press, London; Means (1990) Bioconjugate Chem.1:2; Hermanson, G.
- the reactive group is, for example, a maleimide, an iodoacetamide, a pyridyl disulfide, or other thiol-reactive conjugation partner
- the partner may be a cytotoxic agent (e.g. a toxin such as doxorubicin or pertussis toxin), a fluorophore such as a fluorescent dye like fluorescein or rhodamine, a chelating agent for an imaging or radiotherapeutic metal, a peptidyl or non-peptidyl label or detection tag, or a clearance-modifying agent such as various isomers of polyethylene glycol, a peptide that binds to a third component, or another carbohydrate or lipophilic agent.
- a cytotoxic agent e.g. a toxin such as doxorubicin or pertussis toxin
- a fluorophore such as a fluorescent dye like fluorescein or rhodamine
- a chelating agent for an imaging or radiotherapeutic metal e.g. a peptidyl or non-peptidyl label or detection tag
- a clearance-modifying agent such as various isomers of poly
- the sites identified on the exemplary antibody, hu4D5, herein are primarily in the constant domain of an antibody which is well conserved across all species of antibodies. These sites should be broadly applicable to other antibodies, without further need of structural design or knowledge of specific antibody structures, and without interference in the antigen binding properties inherent to the variable domains of the antibody.
- Cysteine engineered antibodies which may be useful in the treatment of cancer include, but are not limited to, antibodies against cell surface receptors and tumor-associated antigens (TAA). Such antibodies may be used as naked antibodies (unconjugated to a drug or label moiety) or as Formula I antibody-drug conjugates (ADC). Tumor-associated antigens are known in the art, and can prepared for use in generating antibodies using methods and information which are well known in the art. In attempts to discover effective cellular targets for cancer diagnosis and therapy, researchers have sought to identify transmembrane or otherwise tumor-associated polypeptides that are specifically expressed on the surface of one or more particular type(s) of cancer cell as compared to on one or more normal non- cancerous cell(s).
- tumor-associated polypeptides are more abundantly expressed on the surface of the cancer cells as compared to on the surface of the non-cancerous cells.
- the identification of such tumor-associated cell surface antigen polypeptides has given rise to the ability to specifically target cancer cells for destruction via antibody-based therapies.
- TAA examples include, but are not limited to, TAA (1)-(53) listed below.
- TAA (1)-(53) listed below.
- information relating to these antigens is listed below and includes names, alternative names, Genbank accession numbers and primary reference(s), following nucleic acid and protein sequence identification conventions of the National Center for Biotechnology Information (NCBI).
- NCBI National Center for Biotechnology Information
- Nucleic acid and protein sequences corresponding to TAA (1)-(53) are available in public databases such as GenBank.
- Tumor- associated antigens targeted by antibodies include all amino acid sequence variants and isoforms possessing at least about 70%, 80%, 85%, 90%, or 95% sequence identity relative to the sequences identified in the cited references, or which exhibit substantially the same biological properties or characteristics as a TAA having a sequence found in the cited references.
- a TAA having a variant sequence generally is able to bind specifically to an antibody that binds specifically to the TAA with the corresponding sequence listed.
- the sequences and disclosure in the reference specifically recited herein are expressly incorporated by reference.
- BMPR1B bone morphogenetic protein receptor-type IB, Genbank accession no. NM_001203
- BMPR1B bone morphogenetic protein receptor-type IB, Genbank accession no. NM_001203
- STEAP1 (six transmembrane epithelial antigen of prostate, Genbank accession no. NM_012449); Cancer Res.61 (15), 5857-5860 (2001), Hubert, R.S., et al (1999) Proc. Natl. Acad. Sci. U.S.A.96 (25):14523-14528); WO2004065577 (Claim 6); WO2004027049 (Fig 1L); EP1394274 (Example 11); WO2004016225 (Claim 2);
- WO2003042661 (Claim 12); US2003157089 (Example 5); US2003185830 (Example 5); US2003064397 (Fig 2); WO200289747 (Example 5; Page 618-619); WO2003022995 (Example 9; Fig 13A, Example 53; Page 173, Example 2; Fig 2A); NP_036581 six transmembrane epithelial antigen of the prostate Cross-references: MIM:604415; NP_036581.1; NM_012449_1
- MPF MPF, MSLN, SMR, megakaryocyte potentiating factor, mesothelin, Genbank accession no. NM_005823
- Yamaguchi N., et al Biol. Chem.269 (2), 805-808 (1994), Proc. Natl. Acad. Sci. U.S.A.96 (20):11531-11536 (1999), Proc. Natl. Acad. Sci. U.S.A.93 (1):136-140 (1996), J. Biol. Chem.270 (37):21984-21990 (1995));
- WO2003101283 (Claim 14); (WO2002102235 (Claim 13; Page 287-288); WO2002101075 (Claim 4; Page 308-309); WO200271928 (Page 320-321); WO9410312 (Page 52-57); Cross- references: MIM:601051; NP_005814.2; NM_005823_1
- Napi3b also known as NaPi2b
- NAPI-3B also known as NaPi2b
- NPTIIb NPTIIb
- SLC34A2 solute carrier family 34 (sodium phosphate), member 2, type II sodium-dependent phosphate transporter 3b, Genbank accession no. NM_006424) J. Biol. Chem.277 (22):19665-19672 (2002), Genomics 62 (2):281-284 (1999), Feild, J.A., et al (1999) Biochem. Biophys. Res. Commun.258 (3):578-582); WO2004022778 (Claim 2); EP1394274 (Example 11);
- WO2002102235 (Claim 13; Page 326); EP875569 (Claim 1; Page 17-19); WO200157188 (Claim 20; Page 329); WO2004032842 (Example IV); WO200175177 (Claim 24; Page 139- 140); Cross-references: MIM:604217; NP_006415.1; NM_006424_1
- Sema 5b (FLJ10372, KIAA1445, Mm.42015, SEMA5B, SEMAG, Semaphorin 5b Hlog, sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5B, Genbank accession no. AB040878); Nagase T., et al (2000) DNA Res.7 (2):143-150);
- WO2004000997 (Claim 1); WO2003003984 (Claim 1); WO200206339 (Claim 1; Page 50); WO200188133 (Claim 1; Page 41-43, 48-58); WO2003054152 (Claim 20); WO2003101400 (Claim 11); Accession: Q9P283; EMBL; AB040878; BAA95969.1. Genew; HGNC:10737
- PSCA hlg (2700050C12Rik, C530008O16Rik, RIKEN cDNA
- ETBR Endothelin type B receptor, Genbank accession no. AY275463
- Nakamuta M. et al Biochem. Biophys. Res. Commun.177, 34-39, 1991
- Ogawa Y. et al Biochem. Biophys. Res. Commun.178, 248-255, 1991
- Arai H. et al Jpn. Circ. J.56, 1303- 1307, 1992
- Arai H. et al J. Biol. Chem.268, 3463-3470, 1993
- Sakamoto A. Yanagisawa M., et al Biochem. Biophys. Res.
- WO2004048938 (Example 2); WO2004040000 (Claim 151); WO2003087768 (Claim 1); WO2003016475 (Claim 1); WO2003016475 (Claim 1); WO200261087 (Fig 1);
- WO2003016494 (Fig 6); WO2003025138 (Claim 12; Page 144); WO200198351 (Claim 1; Page 124-125); EP522868 (Claim 8; Fig 2); WO200177172 (Claim 1; Page 297-299);
- MSG783 (RNF124, hypothetical protein FLJ20315, Genbank accession no. NM_017763); WO2003104275 (Claim 1); WO2004046342 (Example 2);
- WO2003042661 (Claim 12); WO2003083074 (Claim 14; Page 61); WO2003018621 (Claim 1); WO2003024392 (Claim 2; Fig 93); WO200166689 (Example 6); Cross-references:
- STEAP2 (HGNC_8639, IPCA-1, PCANAP1, STAMP1, STEAP2, STMP, prostate cancer associated gene 1, prostate cancer associated protein 1, six transmembrane epithelial antigen of prostate 2, six transmembrane prostate protein, Genbank accession no. AF455138); Lab. Invest.82 (11):1573-1582 (2002)); WO2003087306;
- TrpM4 (BR22450, FLJ20041, TRPM4, TRPM4B, transient receptor potential cation channel, subfamily M, member 4, Genbank accession no. NM_017636); Xu, X.Z., et al Proc. Natl. Acad. Sci. U.S.A.98 (19):10692-10697 (2001), Cell 109 (3):397-407 (2002), J. Biol. Chem.278 (33):30813-30820 (2003)); US2003143557 (Claim 4);
- WO200040614 (Claim 14; Page 100-103); WO200210382 (Claim 1; Fig 9A);
- WO2003042661 (Claim 12); WO200230268 (Claim 27; Page 391); US2003219806 (Claim 4); WO200162794 (Claim 14; Fig 1A-D); Cross-references: MIM:606936; NP_060106.2; NM_017636_1
- CRIPTO (CR, CR1, CRGF, CRIPTO, TDGF1, teratocarcinoma-derived growth factor, Genbank accession no. NP_003203 or NM_003212); Ciccodicola, A., et al EMBO J.8 (7):1987-1991 (1989), Am. J. Hum. Genet.49 (3):555-565 (1991));
- WO200288170 (Claim 2; Page 52-53); WO2003024392 (Claim 2; Fig 58); WO200216413 (Claim 1; Page 94-95, 105); WO200222808 (Claim 2; Fig 1); US5854399 (Example 2; Col 17-18); US5792616 (Fig 2); Cross-references: MIM:187395; NP_003203.1; NM_003212_1
- CD21 CR2 (Complement receptor 2) or C3DR (C3d/Epstein Barr virus receptor) or Hs.73792 Genbank accession no. M26004); Fujisaku et al (1989) J. Biol. Chem. 264 (4):2118-2125); Weis J.J., et al J. Exp. Med.167, 1047-1066, 1988; Moore M., et al Proc. Natl. Acad. Sci. U.S.A.84, 9194-9198, 1987; Barel M., et al Mol. Immunol.35, 1025- 1031, 1998; Weis J.J., et al Proc. Natl. Acad. Sci.
- CD79b (CD79B, CD79 ⁇ , IGb (immunoglobulin-associated beta), B29, Genbank accession no. NM_000626 or 11038674); Proc. Natl. Acad. Sci. U.S.A. (2003) 100 (7):4126-4131, Blood (2002) 100 (9):3068-3076, Muller et al (1992) Eur. J.
- FcRH2 FcRH2 (IFGP4, IRTA4, SPAP1A (SH2 domain containing phosphatase anchor protein 1a), SPAP1B, SPAP1C, Genbank accession no. NM_030764, AY358130); Genome Res.13 (10):2265-2270 (2003), Immunogenetics 54 (2):87-95 (2002), Blood 99 (8):2662-2669 (2002), Proc. Natl. Acad. Sci. U.S.A.98 (17):9772-9777 (2001), Xu, M.J., et al (2001) Biochem. Biophys. Res.
- HER2 ErbB2, Genbank accession no. M11730; Coussens L., et al Science (1985) 230(4730):1132-1139); Yamamoto T., et al Nature 319, 230-234, 1986;
- WO2004048938 (Example 2); WO2004027049 (Fig 1I); WO2004009622; WO2003081210; WO2003089904 (Claim 9); WO2003016475 (Claim 1); US2003118592; WO2003008537 (Claim 1); WO2003055439 (Claim 29; Fig 1A-B); WO2003025228 (Claim 37; Fig 5C); WO200222636 (Example 13; Page 95-107); WO200212341 (Claim 68; Fig 7);
- WO200213847 (Page 71-74); WO200214503 (Page 114-117); WO200153463 (Claim 2; Page 41-46); WO200141787 (Page 15); WO200044899 (Claim 52; Fig 7); WO200020579 (Claim 3; Fig 2); US5869445 (Claim 3; Col 31-38); WO9630514 (Claim 2; Page 56-61); EP1439393 (Claim 7); WO2004043361 (Claim 7); WO2004022709; WO200100244
- NCA NCA (CEACAM6, Genbank accession no. M18728); Barnett T., et al Genomics 3, 59-66, 1988; Tawaragi Y., et al Biochem. Biophys. Res. Commun.150, 89-96, 1988; Strausberg R.L., et al Proc. Natl. Acad. Sci. U.S.A.99:16899-16903, 2002;
- WO2004063709 EP1439393 (Claim 7); WO2004044178 (Example 4); WO2004031238; WO2003042661 (Claim 12); WO200278524 (Example 2); WO200286443 (Claim 27; Page 427); WO200260317 (Claim 2); Accession: P40199; Q14920; EMBL; M29541;
- MDP Genbank accession no. BC017023
- WO2003016475 (Claim 1); WO200264798 (Claim 33; Page 85-87); JP05003790 (Fig 6-8); WO9946284 (Fig 9); Cross-references: MIM:179780; AAH17023.1; BC017023_1
- IL20R ⁇ (IL20Ra, ZCYTOR7, Genbank accession no. AF184971); Clark H.F., et al Genome Res.13, 2265-2270, 2003; Mungall A.J., et al Nature 425, 805-811, 2003; Blumberg H., et al Cell 104, 9-19, 2001; Dumoutier L., et al J. Immunol.167, 3545-3549, 2001; Parrish-Novak J., et al J. Biol. Chem.277, 47517-47523, 2002; Pletnev S., et al (2003) Biochemistry 42:12617-12624; Sheikh F., et al (2004) J. Immunol.172, 2006-2010;
- EP1394274 (Example 11); US2004005320 (Example 5); WO2003029262 (Page 74-75); WO2003002717 (Claim 2; Page 63); WO200222153 (Page 45-47); US2002042366 (Page 20- 21); WO200146261 (Page 57-59); WO200146232 (Page 63-65); WO9837193 (Claim 1; Page 55-59); Accession: Q9UHF4; Q6UWA9; Q96SH8; EMBL; AF184971; AAF01320.1.
- PSCA Prostate stem cell antigen precursor, Genbank accession no.
- BAFF-R B cell -activating factor receptor, BLyS receptor 3, BR3, Genbank accession No. AF116456
- BAFF receptor /pid NP_443177.1 - Homo sapiens: Thompson, J.S., et al Science 293 (5537), 2108-2111 (2001); WO2004058309;
- WO2004011611; WO2003045422 (Example; Page 32-33); WO2003014294 (Claim 35; Fig 6B); WO2003035846 (Claim 70; Page 615-616); WO200294852 (Col 136-137);
- WO200238766 (Claim 3; Page 133); WO200224909 (Example 3; Fig 3); Cross-references: MIM:606269; NP_443177.1; NM_052945_1; AF132600
- CD22 B-cell receptor CD22-B isoform, BL-CAM, Lyb-8, Lyb8, SIGLEC-2, FLJ22814, Genbank accession No. AK026467); Wilson et al (1991) J. Exp. Med. 173:137-146; WO2003072036 (Claim 1; Fig 1); Cross-references: MIM:107266;
- CD79a (CD79A, CD79 ⁇ , immunoglobulin-associated alpha, a B cell-specific protein that covalently interacts with Ig beta (CD79B) and forms a complex on the surface with Ig M molecules, transduces a signal involved in B-cell differentiation), pI: 4.84, MW: 25028 TM: 2 [P] Gene Chromosome: 19q13.2, Genbank accession No.
- CXCR5 Burkitt's lymphoma receptor 1, a G protein-coupled receptor that is activated by the CXCL13 chemokine, functions in lymphocyte migration and humoral defense, plays a role in HIV-2 infection and perhaps development of AIDS, lymphoma, myeloma, and leukemia); 372 aa, pI: 8.54 MW: 41959 TM: 7 [P] Gene Chromosome:
- HLA-DOB Beta subunit of MHC class II molecule (Ia antigen) that binds peptides and presents them to CD4+ T lymphocytes); 273 aa, pI: 6.56, MW:
- P2X5 Purinergic receptor P2X ligand-gated ion channel 5, an ion channel gated by extracellular ATP, may be involved in synaptic transmission and neurogenesis, deficiency may contribute to the pathophysiology of idiopathic detrusor instability
- 422 aa pI: 7.63, MW: 47206 TM: 1
- Gene Chromosome 17p13.3, Genbank accession No. NP_002552.2); Le et al (1997) FEBS Lett.418(1-2):195-199;
- CD72 B-cell differentiation antigen CD72, Lyb-2
- Gene Chromosome 9p13.3, Genbank accession No. NP_001773.1
- WO2004042346 claim 65
- WO2003026493 pages 51-52, 57-58
- WO200075655 pages 105-106
- Von Hoegen et al (1990) J. Immunol.144(12):4870-4877; Strausberg et al (2002) Proc. Natl. Acad. Sci USA 99:16899-16903.
- LY64 Lymphocyte antigen 64 (RP105), type I membrane protein of the leucine rich repeat (LRR) family, regulates B-cell activation and apoptosis, loss of function is associated with increased disease activity in patients with systemic lupus erythematosis); 661 aa, pI: 6.20, MW: 74147 TM: 1 [P] Gene Chromosome: 5q12, Genbank accession No.
- NP_005573.1 US2002193567; WO9707198 (claim 11, pages 39-42); Miura et al (1996) Genomics 38(3):299-304; Miura et al (1998) Blood 92:2815-2822; WO2003083047;
- FcRH1 Fc receptor-like protein 1, a putative receptor for the
- immunoglobulin Fc domain that contains C2 type Ig-like and ITAM domains, may have a role in B-lymphocyte differentiation); 429 aa, pI: 5.28, MW: 46925 TM: 1 [P] Gene
- Chromosome 1q21-1q22, Genbank accession No. NP_443170.1); WO2003077836;
- WO200138490 (claim 6, Fig 18E-1-18-E-2); Davis et al (2001) Proc. Natl. Acad. Sci USA 98(17):9772-9777; WO2003089624 (claim 8); EP1347046 (claim 1); WO2003089624 (claim 7)
- IRTA2 Immunoglobulin superfamily receptor translocation associated 2, a putative immunoreceptor with possible roles in B cell development and lymphomagenesis; deregulation of the gene by translocation occurs in some B cell malignancies
- Gene Chromosome 1q21, Genbank accession No.
- TENB2 (TMEFF2, tomoregulin, TPEF, HPP1, TR, putative transmembrane proteoglycan, related to the EGF/heregulin family of growth factors and follistatin); 374 aa, NCBI Accession: AAD55776, AAF91397, AAG49451, NCBI RefSeq: NP_057276; NCBI Gene: 23671; OMIM: 605734; SwissProt Q9UIK5; Genbank accession No. AF179274;
- TMEFF1 transmembrane protein with EGF-like and two follistatin-like domains 1; Tomoregulin-1); H7365; C9orf2; C9ORF2; U19878; X83961; NM_080655; NM_003692; Harms, P.W. (2003) Genes Dev.17 (21), 2624-2629; Gery, S. et al (2003) Oncogene 22 (18):2723-2727;
- GDNF-Ra1 GDNF family receptor alpha 1; GFRA1; GDNFR; GDNFRA; RETL1; TRNR1; RET1L; GDNFR-alpha1; GFR-ALPHA-1); U95847; BC014962;
- Ly6E lymphocyte antigen 6 complex, locus E; Ly67,RIG-E,SCA-2,TSA-1
- NP_002337.1 NP_002346.2
- de Nooij-van Dalen A.G. et al (2003) Int. J. Cancer 103 (6), 768-774
- TMEM46 shisa homolog 2 (Xenopus laevis); SHISA2
- NP_001007539.1 NM_001007538.1
- Furushima K. et al (2007) Dev. Biol.306 (2), 480-492
- Clark H.F. et al (2003) Genome Res.13 (10):2265-2270;
- Ly6G6D lymphocyte antigen 6 complex, locus G6D; Ly6-D, MEGT1;
- LGR5 leucine-rich repeat-containing G protein-coupled receptor 5; GPR49, GPR67
- NP_003658.1 NP_003667.2
- Salanti G. et al (2009) Am. J. Epidemiol.170 (5):537-545; Yamamoto, Y. et al (2003) Hepatology 37 (3):528-533;
- RET ret proto-oncogene; MEN2A; HSCR1; MEN2B; MTC1; PTC; CDHF12; Hs.168114; RET51; RET-ELE1); NP_066124.1; NM_020975.4; Tsukamoto, H. et al (2009) Cancer Sci.100 (10):1895-1901; Narita, N. et al (2009) Oncogene 28 (34):3058-3068;
- LY6K lymphocyte antigen 6 complex, locus K; LY6K; HSJ001348;
- GPR19 G protein-coupled receptor 19; Mm.4787; NP_006134.1;
- GPR54 KISS1 receptor; KISS1R; GPR54; HOT7T175; AXOR12;
- ASPHD1 aspartate beta-hydroxylase domain containing 1; LOC253982); NP_859069.2; NM_181718.3; Gerhard, D.S. et al (2004) Genome Res.14 (10B):2121-2127;
- Tyrosinase (TYR; OCAIA; OCA1A; tyrosinase; SHEP3); NP_000363.1;
- TMEM118 ring finger protein, transmembrane 2; RNFT2; FLJ14627
- GPR172A G protein-coupled receptor 172A; GPCR41; FLJ11856;
- CD33 a member of the sialic acid binding, immunoglobulin-like lectin family, is a 67-kDa glycosylated transmembrane protein. CD33is expressed on most myeloid and monocytic leukemia cells in addition to committed myelomonocytic and erythroid progenitor cells. It is not seen on the earliest pluripotent stem cells, mature granulocytes, lymphoid cells, or nonhematopoietic cells (Sabbath et al., (1985) J. Clin. Invest.75:756-56; Andrews et al., (1986) Blood 68:1030-5). CD33 contains two tyrosine residues on its cytoplasmic tail, each of which is followed by hydrophobic residues similar to the immunoreceptor tyrosine-based inhibitory motif (ITIM) seen in many inhibitory receptors.
- ITIM immunoreceptor tyrosine-based inhibitory motif
- CLL-1 (CLEC12A, MICL, and DCAL2)
- CTL/CTLD C-type lectin-like domain
- CLL-1 has been shown to be a type II transmembrane receptor comprising a single C-type lectin-like domain (which is not predicted to bind either calcium or sugar), a stalk region, a
- transmembrane domain and a short cytoplasmic tail containing an ITIM motif.
- the parent antibody may also be a fusion protein comprising an albumin- binding peptide (ABP) sequence (Dennis et al. (2002)“Albumin Binding As A General Strategy For Improving The Pharmacokinetics Of Proteins” J Biol Chem.277:35035-35043; WO 01/45746).
- Antibodies of the invention include fusion proteins with ABP sequences taught by: (i) Dennis et al (2002) J Biol Chem.277:35035-35043 at Tables III and IV, page 35038; (ii) US 20040001827 at [0076]; and (iii) WO 01/45746 at pages 12-13, and all of which are incorporated herein by reference.
- ABP albumin- binding peptide
- DNA encoding an amino acid sequence variant of the starting polypeptide is prepared by a variety of methods known in the art. These methods include, but are not limited to, preparation by site-directed (or oligonucleotide-mediated) mutagenesis, PCR mutagenesis, and cassette mutagenesis of an earlier prepared DNA encoding the polypeptide. Variants of recombinant antibodies may be constructed also by restriction fragment manipulation or by overlap extension PCR with synthetic oligonucleotides. Mutagenic primers encode the cysteine codon replacement(s). Standard mutagenesis techniques can be employed to generate DNA encoding such mutant cysteine engineered antibodies.
- Site-directed mutagenesis is one method for preparing substitution variants, i.e. mutant proteins. This technique is well known in the art (see for example, Carter (1985) et al Nucleic Acids Res.13:4431-4443; Ho et al (1989) Gene (Amst.) 77:51-59; and Kunkel et al (1987) Proc. Natl. Acad. Sci. USA 82:488). Briefly, in carrying out site-directed mutagenesis of DNA, the starting DNA is altered by first hybridizing an oligonucleotide encoding the desired mutation to a single strand of such starting DNA.
- a DNA polymerase is used to synthesize an entire second strand, using the hybridized oligonucleotide as a primer, and using the single strand of the starting DNA as a template.
- the oligonucleotide encoding the desired mutation is incorporated in the resulting double-stranded DNA.
- Site-directed mutagenesis may be carried out within the gene expressing the protein to be mutagenized in an expression plasmid and the resulting plasmid may be sequenced to confirm the introduction of the desired cysteine replacement mutations (Liu et al (1998) J. Biol. Chem.273:20252-20260).
- Site-directed of protocols and formats including those commercially available, e.g. QuikChange® Multi Site-Directed Mutagenesis Kit (Stratagene, La Jolla, CA).
- PCR mutagenesis is also suitable for making amino acid sequence variants of the starting polypeptide. See Higuchi, (1990) in PCR Protocols, pp.177-183, Academic Press; Ito et al (1991) Gene 102:67-70; Bernhard et al (1994) Bioconjugate Chem.5:126-132; and Vallette et al (1989) Nuc. Acids Res.17:723-733. Briefly, when small amounts of template DNA are used as starting material in a PCR, primers that differ slightly in sequence from the corresponding region in a template DNA can be used to generate relatively large quantities of a specific DNA fragment that differs from the template sequence only at the positions where the primers differ from the template.
- Another method for preparing variants, cassette mutagenesis is based on the technique described by Wells et al (1985) Gene 34:315-323.
- the starting material is the plasmid (or other vector) comprising the starting polypeptide DNA to be mutated.
- the codon(s) in the starting DNA to be mutated are identified. There must be a unique restriction endonuclease site on each side of the identified mutation site(s). If no such restriction sites exist, they may be generated using the above described oligonucleotide-mediated
- oligonucleotide encoding the sequence of the DNA between the restriction sites but containing the desired mutation(s) is synthesized using standard procedures, wherein the two strands of the oligonucleotide are synthesized separately and then hybridized together using standard techniques.
- Oligonucleotides are prepared by the phosphoramidite synthesis method (US 4415732; US 4458066; Beaucage, S. and Iyer, R. (1992) "Advances in the synthesis of oligonucleotides by the phosphoramidite approach", Tetrahedron 48:2223-2311). This double-stranded oligonucleotide is referred to as the cassette.
- This cassette is designed to have 5' and 3' ends that are compatible with the ends of the linearized plasmid, such that it can be directly ligated to the plasmid.
- This plasmid now contains the mutated DNA sequence. Mutant DNA containing the encoded cysteine replacements can be confirmed by DNA sequencing.
- Single mutations are also generated by oligonucleotide directed mutagenesis using double stranded plasmid DNA as template by PCR based mutagenesis (Sambrook and Russel, (2001) Molecular Cloning: A Laboratory Manual, 3rd edition; Zoller et al (1983) Methods Enzymol.100:468-500; Zoller, M.J. and Smith, M. (1982) Nucl. Acids Res.
- hu4D5 displayed on M13 phage (Gerstner et al (2002)“Sequence Plasticity In The Antigen-Binding Site Of A Therapeutic Anti-HER2 Antibody”, J Mol Biol.321:851-62) was used for experiments as a model system. Cysteine mutations were introduced in hu4D5-phage, hu4D5, and ABP-hu4D5 constructs.
- the hu4D5- THIOMAB TM antibody -Phage preps were carried out using the polyethylene glycol (PEG) precipitation method as described earlier (Lowman, Henry B. (1998) Methods in Molecular Biology (Totowa, New Jersey) 87 (Combinatorial Peptide Library Protocols) 249- 264).
- PEG polyethylene glycol
- the PHESELECTOR (Phage ELISA for Selection of Reactive Thiols) assay allows for detection of reactive cysteine groups in antibodies in an ELISA phage format. See U.S. Pat. No.7,521,541 and U.S. Pat. Pub. No.20110301334 which are incorporated by reference in their entirety.
- the PHESESLECTOR assay includes the process of coating the protein (e.g. antibody) of interest on well surfaces, followed incubation with phage particles and then HRP labeled secondary antibody with absorbance detection. Mutant proteins displayed on phage may be screened in a rapid, robust, and high-throughput manner.
- cysteine engineered antibodies can be produced and subjected to binding selection using the same approach to identify appropriately reactive sites of free Cys incorporation from random protein-phage libraries of antibodies or other proteins.
- This technique includes reacting cysteine mutant proteins displayed on phage with an affinity reagent or reporter group which is also thiol-reactive.
- the PHESELECTOR assay includes the following steps: 1) bovine serum albumin (BSA), a portion or entirety of a target protein (e.g., an erbB2 extracellular domain (HER2)), and streptavidin (100 ⁇ l of 2 ⁇ g/ml) are separately coated on Maxisorp 96 well plates; 2) After blocking with 0.5% Tween-20 (in PBS), biotinylated and non-biotinylated THIOMAB TM antibody-Phage (2x10 10 phage particles) are incubated for 1 hour at room temperature (e.g., if the target protein is an erbB2 extracellular domain (HER2) then the hu4D5- THIOMAB TM antibody-Phage); 3) the incubation with the Phage is followed by incubation with horseradish peroxidase (HRP) labeled secondary antibody (anti-M13 phage coat protein, pVIII protein antibody); 4) standard HR
- HRP horseradish peroxid
- DNA encoding the cysteine engineered antibodies is readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies).
- the hybridoma cells serve as a source of such DNA.
- the DNA may be placed into expression vectors, which are then transfected into host cells such as E. coli cells, simian COS cells, Chinese Hamster Ovary (CHO) cells, HEK293T cells, or other mammalian host cells, such as myeloma cells (US 5807715; US 2005/0048572; US
- cysteine engineered antibodies e.g. THIOMAB TM antibodies, with highly reactive unpaired Cys residues
- THIOMAB TM antibodies may be produced by: (i) expression in a bacterial, e.g. E. coli, system or a mammalian cell culture system (WO 01/00245), e.g. Chinese Hamster Ovary cells (CHO) or HEK293 cells (e.g., HEK293T cells); and (ii) purification using common protein purification techniques (Lowman et al (1991) J. Biol. Chem.266(17):10982-10988).
- the THIOMAB TM antibodies were expressed in a mammalian cell expression system.
- the mammalian cell expression system is HEK293T cells.
- THIOMAB TM antibodies are full length antibodies that include native cysteine residues that form disulfide bonds within the antibody. Accordingly, these native cysteine residues do not have any reactive thiol groups to conjugate with drug-maleimide (unless treated with a reducing agent). Hence, the newly engineered Cys residue, can remain unpaired, and able to react with, i.e. conjugate to, an electrophilic linker reagent or drug- linker intermediate, such as a drug-maleimide.
- the structure positions of the engineered Cys residues of the heavy and light chains are numbered according to a sequential numbering system.
- This sequential numbering system is correlated to the Kabat numbering system (Kabat et al., (1991) Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD) for the 4D5 antibody.
- Kabat numbering system the actual linear amino acid sequence of the may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or CDR of the variable domain.
- the cysteine engineered heavy chain variant sites and light chain variant sites are identified by the sequential numbering and Kabat numbering in Figure 1A and 1B.
- Thiol reactivity may also be generalized to certain domains of an antibody, such as the light chain constant domain (CL) and heavy chain constant domains, CH1, CH2 and CH3. Cysteine replacements resulting in thiol reactivity values of about 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, and 0.95 and higher may be made in the heavy chain constant domains ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ of intact antibodies: IgA, IgD, IgE, IgG, and IgM, respectively, including the IgG subclasses: IgG1, IgG2, IgG3, IgG4, IgA, and IgA2. [00249] LABELLED CYSTEINE ENGINEERED ANTIBODIES
- the cysteine engineered antibodies of the invention may be conjugated with any label moiety which can be covalently attached to the antibody through a reactive cysteine thiol group (Singh et al (2002) Anal. Biochem.304:147-15; Harlow E. and Lane, D. (1999) Using Antibodies: A Laboratory Manual, Cold Springs Harbor Laboratory Press, Cold Spring Harbor, NY; Lundblad R.L. (1991) Chemical Reagents for Protein Modification, 2nd ed. CRC Press, Boca Raton, FL).
- the attached label may function to: (i) provide a detectable signal; (ii) interact with a second label to modify the detectable signal provided by the first or second label, e.g.
- FRET fluorescence resonance energy transfer
- Labelled cysteine engineered antibodies may be useful in diagnostic assays, e.g., for detecting expression of an antigen of interest in specific cells, tissues, or serum.
- the antibody will typically be labeled with a detectable moiety.
- Radioisotopes such as 3 H, 11 C, 14 C, 18 F, 32 P, 35 S, 64 Cu, 68 Ga, 86 Y, 89 Zr, 99 Tc, 111 In, 123 I, 124 I, 125 I, 131 I, 133 Xe, 177 Lu, 211 At, or 213 Bi. Radioisotope labelled antibodies are useful in receptor targeted imaging experiments.
- the antibody can be labeled with ligand reagents that bind, chelate or otherwise complex a radioisotope metal where the reagent is reactive with the engineered cysteine thiol of the antibody, using the techniques described in Current Protocols in Immunology, (1991) Volumes 1 and 2, Coligen et al, Ed. Wiley-Interscience, New York, NY, Pubs..
- Chelating ligands which may complex a metal ion include DOTA, DOTP, DOTMA, DTPA and TETA (Macrocyclics, Dallas, TX).
- Radionuclides can be targetted via complexation with the antibody-drug conjugates of the invention (Wu et al (2005) Nature Biotechnology 23(9):1137-1146).
- DOTA-maleimide reagents react with the free cysteine amino acids of the cysteine engineered antibodies and provide a metal complexing ligand on the antibody (Lewis et al (1998) Bioconj. Chem.9:72- 86).
- Chelating linker labelling reagents such as DOTA-NHS (1,4,7,10- tetraazacyclododecane-1,4,7,10-tetraacetic acid mono (N-hydroxysuccinimide ester) are commercially available (Macrocyclics, Dallas, TX).
- radionuclide labelled antibodies can provide a marker of pathway activation by detection and quantitation of progressive accumulation of antibodies in tumor tissue (Albert et al (1998) Bioorg. Med. Chem. Lett.8:1207-1210).
- Fluorescent labels such as rare earth chelates (europium chelates), fluorescein types including FITC, 5-carboxyfluorescein, 6-carboxy fluorescein; rhodamine types including TAMRA; dansyl; Lissamine; cyanines; phycoerythrins; Texas Red; and analogs thereof.
- the fluorescent labels can be conjugated to antibodies using the techniques disclosed in Current Protocols in Immunology, supra, for example. Fluorescent dyes and fluorescent label reagents include those which are commercially available from
- Detection labels such as fluorescent dyes and chemiluminescent dyes (Briggs et al (1997) "Synthesis of Functionalised Fluorescent Dyes and Their Coupling to Amines and Amino Acids," J. Chem. Soc., Perkin-Trans.1:1051-1058) provide a detectable signal and are generally applicable for labelling antibodies, preferably with the following properties: (i) the labelled antibody should produce a very high signal with low background so that small quantities of antibodies can be sensitively detected in both cell-free and cell-based assays; and (ii) the labelled antibody should be photostable so that the fluorescent signal may be observed, monitored and recorded without significant photo bleaching.
- the labels preferably (iii) have good water-solubility to achieve effective conjugate concentration and detection sensitivity and (iv) are non-toxic to living cells so as not to disrupt the normal metabolic processes of the cells or cause premature cell death.
- the enzyme generally catalyzes a chemical alteration of a chromogenic substrate that can be measured using various techniques. For example, the enzyme may catalyze a color change in a substrate, which can be measured spectrophotometrically. Alternatively, the enzyme may alter the fluorescence or chemiluminescence of the substrate. Techniques for quantifying a change in fluorescence are described above. The chemiluminescent substrate becomes electronically excited by a chemical reaction and may then emit light which can be measured (using a chemiluminometer, for example) or donates energy to a fluorescent acceptor.
- enzymatic labels include luciferases (e.g., firefly luciferase and bacterial luciferase; US Patent No.4,737,456), luciferin, 2,3-dihydrophthalazinediones, malate dehydrogenase, urease, peroxidase such as horseradish peroxidase (HRP), alkaline phosphatase (AP), ⁇ -galactosidase, glucoamylase, lysozyme, saccharide oxidases (e.g., glucose oxidase, galactose oxidase, and glucose-6-phosphate dehydrogenase), heterocyclic oxidases (such as uricase and xanthine oxidase), lactoperoxidase, microperoxidase, and the like.
- luciferases e.g., firefly luciferase and bacterial luciferase
- Examples of enzyme-substrate combinations include, for example:
- HRP Horseradish peroxidase
- OPD orthophenylene diamine
- TMB 3,3',5,5'-tetramethylbenzidine hydrochloride
- ⁇ -D-galactosidase ( ⁇ -D-Gal) with a chromogenic substrate (e.g., p- nitrophenyl- ⁇ -D-galactosidase) or fluorogenic substrate 4-methylumbelliferyl- ⁇ -D- galactosidase.
- a chromogenic substrate e.g., p- nitrophenyl- ⁇ -D-galactosidase
- fluorogenic substrate 4-methylumbelliferyl- ⁇ -D- galactosidase
- a label may be indirectly conjugated with a cysteine engineered antibody.
- the antibody can be conjugated with biotin and any of the three broad categories of labels mentioned above can be conjugated with avidin or streptavidin, or vice versa. Biotin binds selectively to streptavidin and thus, the label can be conjugated with the antibody in this indirect manner.
- the polypeptide variant is conjugated with a small hapten (e.g., digoxin) and one of the different types of labels mentioned above is conjugated with an anti-hapten polypeptide variant (e.g., anti-digoxin antibody).
- a small hapten e.g., digoxin
- an anti-hapten polypeptide variant e.g., anti-digoxin antibody
- polypeptide variant of the present invention may be employed in any known assay method, such as ELISA, competitive binding assays, direct and indirect sandwich assays, and immunoprecipitation assays (Zola, (1987) Monoclonal Antibodies: A Manual of Techniques, pp.147-158, CRC Press, Inc.).
- a detection label may be useful for localizing, visualizing, and quantitating a binding or recognition event.
- the labelled antibodies of the invention can detect cell-surface receptors.
- Another use for detectably labelled antibodies is a method of bead-based immunocapture comprising conjugating a bead with a fluorescent labelled antibody and detecting a fluorescence signal upon binding of a ligand. Similar binding detection methodologies utilize the surface plasmon resonance (SPR) effect to measure and detect antibody-antigen interactions.
- SPR surface plasmon resonance
- Labelled cysteine engineered antibodies of the invention are useful as imaging biomarkers and probes by the various methods and techniques of biomedical and molecular imaging such as: (i) MRI (magnetic resonance imaging); (ii) MicroCT (computerized tomography); (iii) SPECT (single photon emission computed tomography); (iv) PET
- Immunoscintigraphy is an imaging procedure in which antibodies labeled with radioactive substances are administered to an animal or human patient and a picture is taken of sites in the body where the antibody localizes (US 6528624). Imaging biomarkers may be objectively measured and evaluated as an indicator of normal biological processes, pathogenic processes, or pharmacological responses to a therapeutic intervention.
- Biomarkers may be of several types: Type 0 are natural history markers of a disease and correlate longitudinally with known clinical indices, e.g. MRI assessment of synovial inflammation in rheumatoid arthritis; Type I markers capture the effect of an intervention in accordance with a mechanism-of-action, even though the mechanism may not be associated with clinical outcome; Type II markers function as surrogate endpoints where the change in, or signal from, the biomarker predicts a clinical benefit to“validate” the targeted response, such as measured bone erosion in rheumatoid arthritis by CT. Imaging biomarkers thus can provide pharmacodynamic (PD) therapeutic information about: (i) expression of a target protein, (ii) binding of a therapeutic to the target protein, i.e.
- PD pharmacodynamic
- in vivo imaging biomarkers include: non-invasive treatment, quantifiable, whole body assessment, repetitive dosing and assessment, i.e. multiple time points, and potentially transferable effects from preclinical (small animal) to clinical (human) results. For some applications, bioimaging supplants or minimizes the number of animal experiments in preclinical studies.
- FRET fluorescence resonance energy transfer
- Reporter groups are typically fluorescent dyes that are excited by light at a certain wavelength and transfer energy to an acceptor, or quencher, group, with the appropriate Stokes shift for emission at maximal brightness.
- Fluorescent dyes include molecules with extended aromaticity, such as fluorescein and rhodamine, and their derivatives.
- the fluorescent reporter may be partially or significantly quenched by the quencher moiety in an intact peptide. Upon cleavage of the peptide by a peptidase or protease, a detectable increase in fluorescence may be measured (Knight, C. (1995)“Fluorimetric Assays of Proteolytic Enzymes”, Methods in Enzymology, Academic Press, 248:18-34).
- the labelled antibodies of the invention may also be used as an affinity purification agent.
- the labelled antibody is immobilized on a solid phase such a Sephadex resin or filter paper, using methods well known in the art.
- the immobilized antibody is contacted with a sample containing the antigen to be purified, and thereafter the support is washed with a suitable solvent that will remove substantially all the material in the sample except the antigen to be purified, which is bound to the immobilized polypeptide variant. Finally, the support is washed with another suitable solvent, such as glycine buffer at pH 5.0 that will release the antigen from the polypeptide variant.
- Labelling reagents typically bear reactive functionality which may react (i) directly with a cysteine thiol of a cysteine engineered antibody to form the labelled antibody, (ii) with a linker reagent to form a linker-label intermediate, or (iii) with a linker antibody to form the labelled antibody.
- Reactive functionality of labelling reagents include: maleimide, haloacetyl, iodoacetamide succinimidyl ester (e.g. NHS, N-hydroxysuccinimide),
- THIOMAB TM antibodies described herein were conjugated to two different linker drugs to demonstrate the conjugation efficiency of engineered cysteines at every site within the heavy and light chains.
- THIOMAB TM antibodies were produced by a cysteine residue.
- Each THIOMAB TM antibody was separately conjugated to two linker drugs (MC-vc-PAB-MMAE and PDS-MMAE). Conjugations were performed in 96 well filter plates (volume 2 ml, PolyProplyene 0.45um filter from EK Scientific). The plates allow aqueous buffer to flow through only upon centrifugation at 500xg for 2 min. 450 ⁇ l of MabSelect SuRe resin as 50% slurry in 20% ethanol (GE Healthcare) was added to each well. The resin was washed 3 times and equilibrated in 50mM Tris pH 8.0, 150mM NaCl, 2mM EDTA (buffer A).
- Each THIOMAB TM antibody (1.5 mgs) was added to each well and allowed to bind to resin for 30 min on a plate shaker at 600 RPM at RT. After 30 min the plates were centrifuged to remove excess buffer. The THIOMAB TM antibodies were reduced in the presence of 0.9ml of 2mM dithiothreitol in buffer A overnight with agitation at room temperature (RT). The reducing agent and any cysteine or glutathione blocks were purified away by washing with buffer A 2 times. The plates were washed 3 times with 1ml of 1mM dehydroascorbic acid (DHAA) in buffer A to saturate the plates with oxidizing agent. After the last addition of 0.9ml of 1mM DHAA in buffer A the THIOMAB TM antibodies were allow to reoxidize for 3 hrs on a plate shaker at RT.
- DHAA dehydroascorbic acid
- the oxidizing agent was removed by centrifugation.
- a two-fold molar excess (over available thiol groups) of the linker drug (either MC-vc-PAB-MMAE or PDS-MMAE) dissolved in 10% DMA in buffer A was added to each well and incubated for 2 hrs on a plate shaker at RT with the THIOMAB TM antibodies.
- the excess linker drug was purified away by washing the plates 6 times with equilibration buffer.
- the conjugated THIOMAB TM antibodies were eluted with 0.1 M glycine buffer, pH 2.7 for 30 min on a plate shaker at RT.
- THIOMAB TM antibodies were neutralized immediately with 15 % of 0.5M Tris, pH 8.0.
- the number of drugs conjugated per mAb was quantified by LC/MS analysis. Aggregation of the conjugate was assessed by size exclusion chromatography. [00274] MASS SPECTROSCOPY ANALYSIS
- LC/MS analysis was performed on a 6224 Mass Time-of-Flight (TOF) LC/MS (Agilent Technologies). Samples were chromatographed on a PRLP-S column, 1000 ⁇ , 8 ⁇ m (50 mm 2.1 mm, Agilent Technologies) heated to 80 °C. A linear gradient from 34– 42% B in 3 minutes at 0.7 ml/min flow rate (solvent A, 0.05% TFA in water; solvent B, 0.04% TFA in acetonitrile) was used and the eluent was directly ionized using the
- Cysteines were introduced into the full-length monoclonal antibody, trastuzumab (HERCEPTIN®, Genentech Inc.) at every residue in the heavy and light chains (each native, non-cysteine residue of SEQ ID NO.:1 (the 4D5 Heavy Chain) and SEQ ID NO.:2 (the 4D5 Light Chain) was mutated to a cysteine) .
- trastuzumab HERCEPTIN®, Genentech Inc.
- representative 4D5 antibody has 450 amino acids: 12 cysteine residues and 438 non-cysteine residues.
- a light chain of the representative 4D5 antibody has 214 amino acids: 6 cysteine residues and 208 non-cysteine residues.
- a single residue was mutated from its native amino acid to a cysteine, thereby resulting in a full length antibody with two engineered cysteine residues.
- Each cysteine mutation was conjugated to a PDS-MMAE and a MC-vc-MMAE. This resulted in a total of 648 THIOMAB TM antibodies: 648 PDS-MMAE THIOMAB TM antibodies and 648 MC-vc-MMAE THIOMAB TM antibodies.
- These cysteine engineered antibodies (THIOMAB TM antibodies) were expressed in HEK293T cells in media.
- the THIOMAB TM antibodies comprise one or more of the heavy chain mutations according to Kabat numbering in Table 2.
- the THIOMAB TM antibodies comprise an engineered cysteine at the equivalent position as those listed in Table 2 according to the 4D5 sequence.
- the engineered cysteines identified in Table 2, or the positional equivalent engineered cysteine, in the THIOMAB TM antibodies is a free cysteine.
- the THIOMAB TM antibody comprises an engineered cysteine at position HC- A136C according to Kabat numbering (i.e., HC-A140C according to EU numbering) (see Example 11).
- the THIOMAB TM antibodies comprise one or more of the heavy chain mutations according to EU numbering in Figure 21.
- the heavy chain cysteine mutation in the cysteine engineered antibody is selected from the group of sites consisting of HC-T110C, HC-A140C, HC-L174C, HC-L179C, HC-T187C, HC- T209C, HC-V262C, HC-G371C, HC-Y373C, HC-E382C, HC-S242C, HC-N434C, and Q438C according to EU numbering.
- the THIOMAB TM antibodies comprises a cysteine engineered antibody that is conjugated to a drug moiety by a PDS linker at an engineered cysteine selected from the group consisting of HC-A140C, HC-L174C, HC- L179C, HC-G371C, HC-Y373C, HC-S424C, and HC-Q438C according to EU numbering.
- the THIOMAB TM antibodies comprises a cysteine engineered antibody that is conjugated to a drug moiety by a vc- (i.e., maleimide) linker at an engineered cysteine selected from the group consisting of HC-T110C, HC-T187C, HC-T209C, HC- V262C, HC-G371C, HC-E382C, and HC-N434C.
- a vc- i.e., maleimide
- the THIOMAB TM antibodies comprise one or more of the heavy chain mutations according to Kabat numbering in Table 3. In certain embodiments,
- the THIOMAB TM antibodies comprise an engineered cysteine at the equivalent position as those listed in Table 3 according to the 4D5 sequence.
- an antibody comprises a native alanine (A) at position 5 according to Kabat numbering in its heavy chain (as compared to the native valine (V) in 4D5)
- the alanine can be mutated to a cysteine to yield a HC-A5C THIOMAB TM antibody.
- the engineered cysteines identified in Table 3, or the positional equivalent engineered cysteine, in the THIOMAB TM antibodies is a free cysteine. T l H hin in M in A r in K mbering.
- n certa n em o ments, t e ant o es comprise a sequence listed in Table 3.
- the THIOMAB TM antibodies with mutations and/or sequences listed in Table 3 comprise a PDS linker.
- the THIOMAB TM antibodies with mutations and/or sequences listed in Table 3 comprise a maleimide (e.g. -vc) linker.
- a heavy chain site (according to Kabat numbering) is mutated to a cysteine, selected from the following group, to form a cysteine engineered antibody and linked to a drug using a PDS linker: V2C, T29C, Y30C, A37C, E43C, Y77C, W96C, G97C, D105C, T139C, N159C, A162C, G166C, G178C, L179C, V188C, I199C, N203C, S207C, E388C, K414C, Q418C, S242C, Y436C, T437C, Q438C, L443C, and M104C.
- a heavy chain site (according to Kabat numbering) is mutated to a cysteine, selected from the following group, to form a cysteine engineered antibody and linked to a drug using a–vc (i.e., maleimide) linker: V2C, L1C, V2C, L8C, R16C, F24C, I26C, Y30C, Q36C, A37C, K40C, L42C, E43C, T51C, G53C, T55C, R56C, Y57C, A58C, T66C, N74C, Q79C, W107C, T120C, K121C, A140C, G166C, G178C, T187C, I199C, T209C, F243C, M252C, E258C, V262C, N276C, V282C, L309C, T335C, S337C, R344C, Q347C, K360C
- the cysteine engineered antibodies that comprise a heavy chain cysteine mutation selected from the mutations listed in Table 2 have an average DAR between 1.0 and 2.0 using the Affinity-Capture LC-MS Assays for Stability Determination Assay described herein (see Examples 12 and 13) .
- the cysteine engineered antibodies that comprise a heavy chain cysteine mutation selected from the mutations listed in Table 2 have an average DAR between 1.1 and 1.3.
- the cysteine engineered antibodies that comprise a heavy chain cysteine mutation selected from the mutations listed in Table 2 have an average DAR between 1.3 and 1.5.
- the THIOMAB TM antibodies with a cysteine mutation selected from the list in Table 1 has an average DAR between 1.5 and 1.8.
- the cysteine engineered antibodies that comprise a heavy chain cysteine mutation selected from the mutations listed in Table 2 have an average DAR between 1.8 and 2.0.
- the cysteine engineered antibodies comprise one or more of the heavy chain mutations according to Kabat numbering in Table 2.
- the cysteine engineered antibodies comprise an engineered cysteine at the equivalent position as those listed in Table 2 according to the 4D5 sequence. For example, if an antibody comprises a native lysine (K) at position 19 according to Kabat numbering in its heavy chain (as compared to the native arginine (R) in 4D5), the lysine can be mutated to a cysteine to yield a K19C THIOMAB TM antibody.
- K native lysine
- R native arginine
- the engineered cysteines identified in Table 2, or the positional equivalent engineered cysteine, in the THIOMAB TM antibodies is a free cysteine.
- Table 4 Li ht Chain C steine Mutations Accordin to Kabat Numbering.
- the THIOMAB TM antibodies comprise one or more of the light chain mutations according to Kabat numbering in Table 1.
- the THIOMAB TM antibodies comprise an engineered cysteine at the equivalent position as those listed in Table 1 according to the 4D5 sequence.
- the engineered cysteines identified in Table 1, or the positional equivalent engineered cysteine, in the THIOMAB TM antibodies is a free cysteine.
- the THIOMAB TM antibody comprises an engineered cysteine at position LC- K149C according to Kabat numbering (see Examples 2 and 7).
- the LC-K149C antibody is conjugated to a drug moiety via a PDS linker.
- the LC-K149C antibody is conjugated to a drug moiety via a–vc (i.e., maleimide) linker.
- the THIOMAB TM antibodies comprise one or more of the light chain mutations according to Kabat numbering in Figure 21.
- the light chain cysteine mutation in the cysteine engineered antibody is selected from the group of sites consisting of LC-T22C, LC-K39C, LC-Y49C, LC-Y55C, LC-T85C, LC-T97C, LC- I106C, LC-R108C, LC-R142C, LC-K149C, and LC-V205C according to Kabat numbering.
- the THIOMAB TM antibodies comprises a cysteine engineered antibody that is conjugated to a drug moiety by a PDS linker at an engineered cysteine selected from the group consisting of LC-I106C, LC-R108C, and LC-V205C according to Kabat numbering.
- the THIOMAB TM antibodies comprises a cysteine engineered antibody that is conjugated to a drug moiety by a vc- (i.e., maleimide) linker at an engineered cysteine selected from the group consisting of LC-T22C, LC-K39C, LC-Y49C, LC-Y55C, LC-T85C, LC-T97C, LC-R142C, and LC-K149C according to Kabat numbering.
- vc- i.e., maleimide
- cysteine engineered antibodies that comprise a light chain cysteine mutation selected from the mutations listed in Table 1 have an average DAR between 1.0 and 2.0 using the Affinity-Capture LC-MS Assays for Stability
- the cysteine engineered antibodies that comprise a light chain cysteine mutation selected from the mutations listed in Table 1 have an average DAR between 1.1 and 1.3. In specific embodiments, the cysteine engineered antibodies that comprise a light chain cysteine mutation selected from the mutations listed in Table 1 have an average DAR between 1.3 and 1.5. In specific embodiments, the cysteine engineered antibodies with a cysteine mutation selected from the list in Table 1 has an average DAR between 1.5 and 1.8. In specific embodiments, the cysteine engineered antibodies that comprise a heavy chain cysteine mutation selected from the mutations listed in Table 1 have an average DAR between 1.8 and 2.0. In specific embodiments, the cysteine engineered antibodies that comprise a heavy chain cysteine mutation selected from the mutations listed in Table 1 have an average DAR between 0.8 and 1.4.
- the THIOMAB TM antibodies comprise a sequence listed in Table 1.
- the THIOMAB TM antibodies with mutations and/or sequences listed in Table 1 comprise a PDS linker.
- the THIOMAB TM antibodies with mutations and/or sequences listed in Table 1 comprise a -vc linker.
- the THIOMAB TM antibodies comprise a sequence listed in Table 4. In certain embodiments, the THIOMAB TM antibodies with mutations and/or sequences listed in Table 4 comprise a PDS linker. In certain embodiments, the THIOMAB TM antibodies with mutations and/or sequences listed in Table 4 comprise a -vc linker.
- cysteine engineered antibodies that comprise a light chain cysteine mutation selected from the mutations listed in Table 4 have an average DAR between 1.0 and 2.0 using the Affinity-Capture LC-MS Assays for Stability
- the THIOMAB TM antibodies with a cysteine mutation selected from the list in Table 4 has an average DAR between 1.3 and 1.9.
- the THIOMAB TM antibodies with a cysteine mutation selected from the list in Table 4 has an average DAR between 1.3 and 1.9.
- THIOMAB TM antibodies with a cysteine mutation selected from the list in Table 4 has an average DAR between 1.3 and 1.8. In specific embodiments, the THIOMAB TM antibodies with a cysteine mutation selected from the list in Table 4 has an average DAR between 1.5 and 1.9. In specific embodiments, the THIOMAB TM antibodies with a cysteine mutation selected from the list in Table 4 has an average DAR between 0.8 and 1.0.
- the THIOMAB TM antibodies comprise one or more of the light chain mutations according to EU numbering in Figure 21.
- the light chain cysteine mutation in the cysteine engineered antibody is selected from the group of sites consisting of LC-T22C, LC-K39C, LC-Y49C, LC-Y55C, LC-T85C, LC-T97C, LC- I106C, LC-R108C, LC-R142C, LC-K149C, and LC-V205C according to EU numbering.
- the THIOMAB TM antibodies comprises a cysteine engineered antibody that is conjugated to a drug moiety by a PDS linker at an engineered cysteine selected from the group consisting of LC-T22C, LC-K39C, LC-Y49C, LC-Y55C, LC-T85C, LC-T97C, LC-R142C, and LC-K149C according to EU numbering.
- a cysteine engineered antibody that is conjugated to a drug moiety by a PDS linker at an engineered cysteine selected from the group consisting of LC-T22C, LC-K39C, LC-Y49C, LC-Y55C, LC-T85C, LC-T97C, LC-R142C, and LC-K149C according to EU numbering.
- the THIOMAB TM antibodies comprises a cysteine engineered antibody that is conjugated to a drug moiety by a vc- (i.e., maleimide) linker at an engineered cysteine selected from the group consisting of LC-I106C, LC-R108C, and LC-V205C.
- a vc- linker i.e., maleimide
- the THIOMAB TM antibodies comprise a sequence listed in Table 5.
- the THIOMAB TM antibodies comprise an engineered cysteine at the equivalent position as those listed in Table 5 according to the 4D5 sequence.
- an antibody comprises a native serine (S) at position 40 according to Kabat numbering in its heavy chain (as compared to the native Alanine (A) in 4D5)
- the serine can be mutated to a cysteine to yield a S40C THIOMAB TM antibody.
- the engineered cysteines identified in Table 5, or the positional equivalent engineered cysteine, in the THIOMAB TM antibodies are free cysteines. Table 5. Heavy Chain and Light Chain Cysteine Mutations According to Kabat Numberin .
- the THIOMAB TM antibodies comprise a sequence listed in Table 5. In certain embodiments, the THIOMAB TM antibodies with mutations and/or sequences listed in Table 5 comprise a -vc or PDS linker.
- the THIOMAB TM antibodies with a cysteine mutation selected from the list in Table 5 has an average DAR between 1.0 and 2.0. In specific embodiments, the THIOMAB TM antibodies with a cysteine mutation selected from the list in Table 5 has an average DAR between 1.3 and 1.9. In specific embodiments, the THIOMAB TM antibodies with a cysteine mutation selected from the list in Table 5 has an average DAR between 1.3 and 1.8. In specific embodiments, the THIOMAB TM antibodies with a cysteine mutation selected from the list in Table 5 has an average DAR between 1.5 and 1.9.
- the THIOMAB TM antibodies comprise an engineered cysteine identified in any one of Tables 1-5.
- the THIOMAB TM antibodies comprise an engineered cysteine identified in any one of Tables 1 and 2.
- the THIOMAB TM antibodies can be designed for any target antigen. [00298] THIOMAB TM ANTIBODY DESIGN AND ENGINEERING
- Single cysteine substitutions were introduced into each position of the heavy chain and light chain of the anti-HER2 hu4D5 antibody (i.e., a total of 648 antibodies with PDS linkers and a total of 648 antibodies with–vc linkers were made) (Example 1).
- Single cysteine substitutions were also introduced into select positions of anti-CD33 antibodies, anti- STEAP1 antibodies, anti-MUC16 antibodies, anti-NaPi2b antibodies, anti-Ly6E antibodies, anti-CD22 antibodies, anti-CD79b antibodies, anti-B7H4 antibodies, and additional anti- HER2 antibodies. All of the heavy chain mutants and light chain mutants were prepared according to the methods described herein.
- Heavy chain and light chain sequences are numbered according to the Kabat numbering system.
- the positional equivalent according to sequential numbering and EU numbering of each Kabat position is provided in Figures 1A and 1B.
- Kabat, Sequential, and EU numbering denotes same numbers.
- the heavy and light chain 4D5 THIOMAB TM antibodies were conjugated to a drug via a PDS or a vc linker (i.e., a total of 648 antibodies with PDS linkers and a total of 648 antibodies with–vc linkers were made).
- Each THIOMAB TM antibody was screened for average drug-antibody ratio (DAR), concentration (mg/mL), aggregation (% total), and stability (Example 2). Accordingly, each THIOMAB TM antibody had DAR, concentration, aggregation, and stability measurements for the PDS and vc conjugates.
- the PDS conjugates and measurements are provided in the tables provided herein and the vc conjugates and measurements are provided in the tables provided herein. Table 6. Average DAR, concentration, aggregation, and stability (ELISA Rat Plasma Stability) of the cysteine engineered antibodies of Tables 3 and 4 conjugated with a PDS-linker
- the PDS-MMAE THIOMAB TM antibodies identified in Tables 6 and 7 were analyzed with a starting concentration of ⁇ 1mg/mL of source material (i.e., the PDS-MMAE THIOMAB TM antibody).
- the DAR calculations for the PDS-MMAE THIOMAB TM antibodies identified in Tables 6 and 7 were all ⁇ DAR1. All of the PDS-MMAE
- THIOMAB TM antibodies identified in Tables 6 and 7 had ⁇ 50% aggregation, reoxidized.
- the PDS-MMAE THIOMAB TM antibodies identified in Table 6 exhibited at least ⁇ 77 % stability in rat matrix over time for ELISA replicates.
- the same samples analyzed in Table 6 were used in the experiments performed for Table 7.
- Table 7 shows the LCSM confirmation of the ELISA stability results of Table 6.
- THIOMAB TM antibodies identified in Tables 8 and 9 were all ⁇ DAR1. All of the MC-VC- MMAE THIOMAB TM antibodies identified in Tables 8 and 9 had ⁇ 50% aggregation, reoxidized. The MC-VC-MMAE THIOMAB TM antibodies identified in Table 8 exhibited at least ⁇ 77 % stability in rat matrix over time for ELISA replicates. Table 9 shows the LCSM confirmation of the ELISA stability results of Table 8.
- Table 10 Average DAR, concentration, and aggregation of the preferred cysteine engineered antibodies of Tables 1 and 2 (Same samples as those shown in Tables 11 and 12)
- the DAR, concentration, aggregation, and stability were not the same for the vc- and PDS- conjugated cysteine engineered antibodies (i.e., THIOMAB TM antibodies).
- the preferred cysteine engineered antibodies of Tables 6 and 7 (PDS linker) and Tables 8 and 9 (vc linker) were not identical.
- the top stable sites preferred for PDS linker conjugation to a drug moiety are LC-T22C, LC-K39C, LC- Y49C, LC-Y55C, LC-T85C, LC-T97C, LC-R142C, LC-K149C, HC-A140C, HC-L174C, HC-L179C, HC-G371C, HC-Y373C, and HC-S424C while the top stable sites preferred for– vc linker conjugation to a drug moiety are LC-I106C, LC-R108C, LC-V205C, HC-T110C (Kabat numbering), HC-T187C, HC-T209C, HC-V262C, HC-G371C, HC-E382C, HC- N434C according to EU numbering (see Figure 21).
- thiol reactivity of full length, IgG cysteine engineered antibodies can be measured by biotinylation and streptavidin binding as described in US Pat. No.7,521,541 which is incorporated by reference in its entirety.
- a western blot assay was can be set up to screen the THIOMAB TM antibody that is specifically conjugated with biotin-maleimide.
- the antibodies can be analyzed on reducing SDS-PAGE and the presence of biotin is specifically probed by incubating with streptavidin-HRP.
- streptavidin-HRP interaction can either be observed in heavy chain or light chain depending on which engineered cys variant is being used and the binding can be compared to the biotin- streptavidin interaction of a wild type IgG without an engineered cysteine, thereby indicating which THIOMAB TM antibodies specifically conjugate the biotin as compared to any background binding of the wild type antibody.
- the cysteine engineered antibodies of the invention may be conjugated with any therapeutic agent, i.e. drug moiety, which can be covalently attached to the antibody through a reactive cysteine thiol group.
- any therapeutic agent i.e. drug moiety
- the cysteine engineered antibodies disclosed in the tables provided herein were conjugated to a maytansinoid drug, specifically MMAE.
- An exemplary embodiment of an antibody-drug conjugate (ADC) compound comprises a cysteine engineered antibody (Ab), and a drug moiety (D) wherein the antibody has one or more free cysteine amino acids, and the antibody is attached through the one or more free cysteine amino acids by a linker moiety (L) to D; the composition having Formula I:
- p is 1, 2, 3, or 4.
- the number of drug moieties which may be conjugated via a thiol reactive linker moiety to an antibody molecule is limited by the number of cysteine residues which are introduced by the methods described herein.
- Exemplary ADC of Formula I therefore comprise antibodies which have 1, 2, 3, or 4 engineered cysteine amino acids.
- an antibody-drug conjugate compound comprises a cysteine engineered antibody (Ab), an albumin-binding peptide (ABP) and a drug moiety (D) wherein the antibody is attached to the drug moiety by a linker moiety (L) and the antibody is attached to the albumin-binding peptide by an amide bond or a second linker moiety; the composition having Formula Ia:
- the ADC compounds of the invention include those with utility for anticancer activity.
- the compounds include a cysteine-engineered antibody conjugated, i.e. covalently attached by a linker, to a drug moiety, i.e. toxin.
- a drug moiety i.e. toxin.
- the antibody-drug conjugates (ADC) of the invention selectively deliver an effective dose of a cytotoxic agent to tumor tissue whereby greater selectivity, i.e. a lower efficacious dose, may be achieved.
- the drug moiety (D) of the antibody-drug conjugates (ADC) includes any compound, moiety or group which has a cytotoxic or cytostatic effect.
- Drug moieties include: (i) chemotherapeutic agents, which may function as microtubulin inhibitors, mitosis inhibitors, topoisomerase inhibitors, or DNA intercalators; (ii) protein toxins, which may function enzymatically; and (iii) radioisotopes.
- Exemplary drug moieties include, but are not limited to, a maytansinoid, an auristatin, a dolastatin, a trichothecene, CC1065, a calicheamicin and other enediyne antibiotics, a taxane, a pyrrolobenzodiazepine (PBD), a 1-(Chloromethyl)-2,3-dihydro-1H- benzo[e]indole (CBI) dimer, a CBI-PBD heterodimer, an anthracycline, and stereoisomers, isosteres, analogs or derivatives thereof.
- a maytansinoid an auristatin, a dolastatin, a trichothecene, CC1065, a calicheamicin and other enediyne antibiotics, a taxane, a pyrrolobenzodiazepine (PBD), a 1-(Chloromethyl)-2,3-d
- Maytansine compounds suitable for use as maytansinoid drug moieties are well known in the art, and can be isolated from natural sources according to known methods, produced using genetic engineering techniques (see Yu et al (2002) PROC. NAT. ACAD. SCI. (USA) 99:7968-7973), or maytansinol and maytansinol analogues prepared
- Exemplary maytansinoid drug moieties include those having a modified aromatic ring, such as: C-19-dechloro (US 4256746) (prepared by lithium aluminum hydride reduction of ansamytocin P2); C-20-hydroxy (or C-20-demethyl) +/-C-19-dechloro (US Pat. Nos.4361650 and 4307016) (prepared by demethylation using Streptomyces or Actinomyces or dechlorination using LAH); and C-20-demethoxy, C-20-acyloxy (-OCOR), +/-dechloro (U.S. Pat. No.4,294,757) (prepared by acylation using acyl chlorides). and those having modifications at other positions
- Exemplary maytansinoid drug moieties also include those having
- C-9-SH (US 4424219) (prepared by the reaction of maytansinol with H 2 S or P 2 S 5 ); C-14-alkoxymethyl(demethoxy/CH 2 OR)(US 4331598); C-14-hydroxymethyl or acyloxymethyl (CH 2 OH or CH 2 OAc) (US 4450254) (prepared from Nocardia); C-15- hydroxy/acyloxy (US 4364866) (prepared by the conversion of maytansinol by
- the drug moiety (D) of the antibody-drug conjugates (ADC) of Formula I include maytansinoids havin the structure:
- R may independently be H or a C 1 ⁇ C 6 alkyl selected from methyl, ethyl, 1-propyl, 2-propyl, 1-butyl, 2-methyl-1-propyl, 2-butyl, 2- methyl-2-propyl, 1-pentyl, 2-pentyl, 3-pentyl, 2-methyl-2-butyl, 3-methyl-2-butyl, 3-methyl- 1-butyl, 2-methyl-1-butyl, 1-hexyl, 2-hexyl, 3-hexyl, 2-methyl-2-pentyl, 3-methyl-2-pentyl, 4-methyl-2-pentyl, 3-methyl-3-pentyl, 2-methyl-3-pentyl, 2,3-dimethyl-2-butyl, and 3,3- dimethyl-2-butyl.
- Maytansine compounds inhibit cell proliferation by inhibiting the formation of microtubules during mitosis through inhibition of polymerization of the microtubulin protein, tubulin (Remillard et al (1975) Science 189:1002-1005). Maytansine and maytansinoids are highly cytotoxic but their clinical use in cancer therapy has been greatly limited by their severe systemic side-effects primarily attributed to their poor selectivity for tumors. Clinical trials with maytansine had been discontinued due to serious adverse effects on the central nervous system and gastrointestinal system (Issel et al (1978) Can. Treatment. Rev.5:199- 207).
- Maytansinoid drug moieties are attractive drug moieties in antibody-drug conjugates because they are: (i) relatively accessible to prepare by fermentation or chemical modification, derivatization of fermentation products, (ii) amenable to derivatization with functional groups suitable for conjugation through the non-disulfide linkers to antibodies, (iii) stable in plasma, and (iv) effective against a variety of tumor cell lines (US 2005/0169933; WO 2005/037992; US 5208020).
- the maytansinoid drug moiety (D) will have the following stereochemistry:
- the linker may be attached to the maytansinoid molecule at various positions, depending on the type of the link.
- an ester linkage may be formed by reaction with a hydroxyl group using conventional coupling techniques. The reaction may occur at the C-3 position having a hydroxyl group, the C-14 position modified with hydroxymethyl, the C-15 position modified with a hydroxyl group, and the C-20 position having a hydroxyl group.
- the linkage is formed at the C-3 position of maytansinol or a maytansinol analogue.
- the drug moiety (D) of the antibody-drug conjugates (ADC) of Formula I also include dolastatins and their peptidic analogs and derivatives, the auristatins (US Patent Nos. 5635483; 5780588). Dolastatins and auristatins have been shown to interfere with
- Drug moieties include dolastatins, auristatins (US 5635483; US 5780588; US 5767237; US 6124431), and analogs and derivatives thereof. Dolastatins and auristatins have been shown to interfere with microtubule dynamics, GTP hydrolysis, and nuclear and cellular division (Woyke et al (2001) Antimicrob. Agents and Chemother.45(12):3580-3584) and have anticancer (US 5663149) and antifungal activity (Pettit et al (1998) Antimicrob. Agents Chemother.42:2961-2965).
- the dolastatin or auristatin drug moiety may be attached to the antibody through the N (amino) terminus or the C (carboxyl) terminus of the peptidic drug moiety (WO 02/088172).
- Exemplary auristatin embodiments include the N-terminus linked
- the drug moiety (D) of the antibody-drug conjugates (ADC) of Formula I include the monomethylauristatin drug moieties MMAE and MMAF linked through the N- terminus to the antibody, and having the structures:
- peptide-based drug moieties can be prepared by forming a peptide bond between two or more amino acids and/or peptide fragments.
- Such peptide bonds can be prepared, for example, according to the liquid phase synthesis method (see E. Schröder and K. Lübke, “The Peptides”, volume 1, pp 76-136, 1965, Academic Press) that is well known in the field of peptide chemistry.
- the drug moiety includes calicheamicin, and analogs and derivatives thereof.
- the calicheamicin family of antibiotics are capable of producing double-stranded DNA breaks at sub-picomolar concentrations.
- Structural analogues of calicheamicin which may be used include, but are not limited to, ⁇ I 11 ⁇ I2 , ⁇ 3 , N-acetyl- ⁇ 1 , PSAG and ⁇ I
- an ADC comprises a pyrrolobenzodiazepine (PBD).
- PDB dimers recognize and bind to specific DNA sequences.
- the natural product anthramycin, a PBD was first reported in 1965 (Leimgruber, et al., (1965) J. Am. Chem. Soc., 87:5793-5795; Leimgruber, et al., (1965) J. Am. Chem. Soc., 87:5791-5793). Since then, a number of PBDs, both naturally-occurring and analogues, have been reported (Thurston, et al., (1994) Chem.
- PBD compounds can be employed as prodrugs by protecting them at the N10 position with a nitrogen protecting group which is removable in vivo (WO 00/12507; WO 2005/023814).
- the immunoconjugate comprises an antibody conjugated to one or more calicheamicin molecules.
- the calicheamicin family of antibiotics, and analogues thereof, are capable of producing double-stranded DNA breaks at sub- picomolar concentrations (Hinman et al., (1993) Cancer Research 53:3336-3342; Lode et al., (1998) Cancer Research 58:2925-2928).
- Calicheamicin has intracellular sites of action but, in certain instances, does not readily cross the plasma membrane. Therefore, cellular uptake of these agents through antibody-mediated internalization may, in some embodiments, greatly enhances their cytotoxic effects.
- Nonlimiting exemplary methods of preparing antibody-drug conjugates with a calicheamicin drug moiety are described, for example, in US 5712374; US 5714586; US 5739116; and US 5767285.
- the calicheamicin drug moiety conjugated to the antibod is a com ound havin the formula:
- X is Br
- R a is hydrogen
- R is isopropyl
- X is Br
- R a is hydrogen
- R is ethyl
- X is I
- R a is hydrogen
- R is isopropyl
- X is I
- R a is hydrogen
- R is ethyl
- X is Br
- R a is hydrogen
- X is I
- R a is hydrogen
- X is I
- X is Br
- R a is ethyl
- PBD dimers have been conjugated to antibodies and the resulting ADC shown to have anti-cancer properties (US 2010/0203007).
- Nonlimiting exemplary linkage sites on the PBD dimer include the five-membered pyrrolo ring, the tether between the PBD units, and the N10-C11 imine group (WO 2009/016516; US 2009/304710; US 2010/047257; US 2009/036431; US 2011/0256157; WO 2011/130598).
- an ADC comprises a pyrrolobenzodiazepine (PBD).
- PDB dimers recognize and bind to specific DNA sequences.
- the natural product anthramycin, a PBD was first reported in 1965 (Leimgruber, et al., (1965) J. Am. Chem. Soc., 87:5793-5795; Leimgruber, et al., (1965) J. Am. Chem. Soc., 87:5791-5793). Since then, a number of PBDs, both naturally-occurring and analogues, have been reported (Thurston, et al., (1994) Chem.
- PBD compounds can be employed as prodrugs by protecting them at the N10 position with a nitrogen protecting group which is removable in vivo (WO 00/12507; WO 2005/023814).
- PBD dimers have been conjugated to antibodies and the resulting ADC shown to have anti-cancer properties (US 2010/0203007).
- Nonlimiting exemplary linkage sites on the PBD dimer include the five-membered pyrrolo ring, the tether between the PBD units, and the N10-C11 imine group (WO 2009/016516; US 2009/304710; US 2010/047257; US 2009/036431; US 2011/0256157; WO 2011/130598).
- Nonlimitin exem lar PBD dimer com onents of ADCs are of Formula A:
- the wavy line indicates the covalent attachment site to the linker; the dotted lines indicate the optional presence of a double bond between C1 and C2 or C2 and C3;
- R 6 and R 9 are independently selected from H, R, OH, OR, SH, SR, NH 2 , NHR, NRR’, NO 2 , Me 3 Sn and halo;
- R 7 is independently selected from H, R, OH, OR, SH, SR, NH 2 , NHR, NRR’, NO 2 , Me 3 Sn and halo;
- Q is independently selected from O, S and NH;
- R 11 is either H, or R or, where Q is O, SO 3 M, where M is a metal cation;
- R and R’ are each independently selected from optionally substituted C 1-8 alkyl, C 1-12 alkyl, C 3-8 heterocyclyl, C 3-20 heterocycle, and C 5-20 aryl groups, and optionally in relation to the group NRR’, R and R’ together with the nitrogen atom to which they are attached form an optionally substituted 4-, 5-, 6- or 7-membered heterocyclic ring;
- R 12 , R 16 , R 19 and R 17 are as defined for R 2 , R 6 , R 9 and R 7 respectively;
- R′′ is a C 3-12 alkylene group, which chain may be interrupted by one or more heteroatoms, e.g. O, S, N(H), NMe and/or aromatic rings, e.g. benzene or pyridine, which rings are optionally substituted; and
- X and X’ are independently selected from O, S and N(H).
- R and R’ are each independently selected from optionally substituted C 1-12 alkyl, C 3-20 heterocycle, and C 5-20 aryl groups, and optionally in relation to the group NRR’, R and R’ together with the nitrogen atom to which they are attached form an optionally substituted 4-, 5-, 6- or 7-membered heterocyclic ring.
- R 9 and R 19 are H.
- R 6 and R 16 are H.
- R 7 are R 17 are both OR 7A , where R 7A is optionally substituted C 1-4 alkyl.
- R 7A is Me.
- R 7A is is Ch 2 Ph, where Ph is a phenyl group.
- X is O.
- R 11 is H.
- each group may independently have either configuration shown below:
- R′′ is a C 3 alkylene group or a C 5 alkylene group.
- an exemplary PBD dimer component of an ADC has the structure of Formula A(I):
- n 0 or 1.
- an exemplary PBD dimer component of an ADC has the structure of Formula A(II):
- n 0 or 1.
- an exemplary PBD dimer component of an ADC has the structure of Formula A III :
- R E and R E are each independently selected from H or R D , wherein R D is defined as above;
- n 0 or 1.
- n is 0. In some embodiments, n is 1. In some embodiments, R E and/or R E” is H. In some embodiments, R E and R E” are H. In some embodiments, R E and/or R E” is R D , wherein R D is optionally substituted C 1-12 alkyl. In some embodiments, R E and/or R E” is R D , wherein R D is methyl.
- an exemplary PBD dimer component of an ADC has the structure of Formula A IV :
- Ar 1 and Ar 2 are each independently optionally substituted C 5-20 aryl; wherein Ar 1 and Ar 2 may be the same or different; and
- n 0 or 1.
- an exemplary PBD dimer component of an ADC has the structure of Formula A V :
- Ar 1 and Ar 2 are each independently optionally substituted C 5-20 aryl; wherein Ar 1 and Ar 2 may be the same or different; and
- Ar 1 and Ar 2 are each independently selected from optionally substituted phenyl, furanyl, thiophenyl and pyridyl. In some embodiments, Ar 1 and Ar 2 are each independently optionally substituted phenyl. In some embodiments, Ar 1 and Ar 2 are each independently optionally substituted thien-2-yl or thien-3-yl. In some embodiments, Ar 1 and Ar 2 are each independently optionally substituted quinolinyl or isoquinolinyl. The quinolinyl or isoquinolinyl group may be bound to the PBD core through any available ring position.
- the quinolinyl may be quinolin-2-yl, quinolin-3-yl, quinolin-4yl, quinolin-5-yl, quinolin-6-yl, quinolin-7-yl and quinolin-8-yl.
- the quinolinyl is selected from quinolin-3-yl and quinolin-6-yl.
- the isoquinolinyl may be isoquinolin-1-yl, isoquinolin-3-yl, isoquinolin-4yl, isoquinolin-5-yl, isoquinolin-6-yl, isoquinolin-7-yl and isoquinolin-8-yl.
- the isoquinolinyl is selected from isoquinolin-3-yl and isoquinolin-6-yl.
- the wavy line indicates the covalent attachment site to the linker
- R V1 and R V2 are independently selected from H, methyl, ethyl and phenyl (which phenyl may be optionally substituted with fluoro, particularly in the 4 position) and C 5-6 heterocyclyl; wherein R V1 and R V2 may be the same or different; and
- n 0 or 1.
- R V1 and R V2 are independently selected from H, phenyl, and 4-fluorophenyl.
- a linker may be attached at one of various sites of the PBD dimer drug moiety, including the N10 imine of the B ring, the C-2 endo/exo position of the C ring, or the tether unit linking the A rings (see structures C(I) and C(II) below).
- Nonlimiting exemplary PBD dimer components of ADCs include Formulas C(I) and C(II):
- Formulas C(I) and C(II) are shown in their N10-C11 imine form.
- Exemplary PBD drug moieties also include the carbinolamine and protected carbinolamine forms as well, as shown in the table below:
- Z and Z’ are independently selected from OR and NR 2 , where R is a primary, secondary or tertiary alkyl chain containing 1 to 5 carbon atoms;
- R 1 , R’ 1 , R 2 and R’ 2 are each independently selected from H, C 1 -C 8 alkyl, C 2 -C 8 alkenyl, C 2 -C 8 alkynyl, C 5-20 aryl (including substituted aryls), C 5-20 heteroaryl groups,–NH 2 , -NHMe, -OH, and -SH, where, in some embodiments, alkyl, alkenyl and alkynyl chains comprise up to 5 carbon atoms;
- R 3 and R’ 3 are independently selected from H, OR, NHR, and NR 2 , where R is a primary, secondary or tertiary alkyl chain containing 1 to 5 carbon atoms;
- R 4 and R’ 4 are independently selected from H, Me, and OMe;
- R 5 is selected from C 1 -C 8 alkyl, C 2 -C 8 alkenyl, C 2 -C 8 alkynyl, C 5-20 aryl (including aryls substituted by halo, nitro, cyano, alkoxy, alkyl, heterocyclyl) and C 5-20 heteroaryl groups, where, in some embodiments, alkyl, alkenyl and alkynyl chains comprise up to 5 carbon atoms;
- R 11 is H, C 1 -C 8 alkyl, or a protecting group (such as acetyl, trifluoroacetyl, t-butoxycarbonyl (BOC), benzyloxycarbonyl (CBZ), 9-fluorenylmethylenoxycarbonyl (Fmoc), or a moiety comprising a self-immolating unit such as valine-citrulline-PAB);
- R 12 is is H, C 1 -C 8 alkyl, or a protecting group;
- Exemplary PDB dimer portions of ADC include, but are not limited to (the wav line indicates the site of covalent attachment to the linker :
- Nonlimiting exemplary embodiments of ADCs comprising PBD dimers have the following structures:
- PBD dimer-Phe-Lys-PAB-Ab wherein:
- n is 0 to 12. In some embodiments, n is 2 to 10. In some embodiments, n is 4 to 8. In some embodiments, n is selected from 4, 5, 6, 7, and 8.
- an ADC comprising a PBD dimer described herein may be made by conjugating a linker-drug intermediate including a pyridine leaving group via a sulfur atom with a cysteine thiol of an antibody to form a disulfide linkage. Further, in some embodiments, an ADC comprising a PBD dimer described herein may be made by conjugating a linker-drug intermediate including a thiopyridyl leaving group, wherein the pyridine ring is substituted with one or more nitro groups. In some embodiments, the pyridyl ring is monosubstituted with–NO 2 .
- the PBD dimer is connected through the N10 position.
- non-limiting exemplary ADC comprising a PBD dimer may be made by conjugating a monomethylethyl pyridyl disulfide, N10-linked PBD linker intermediate shown below to an antibod :
- linkers of PBD dimer-val-cit-PAB-Ab and the PBD dimer-Phe-Lys-PAB- Ab are protease cleavable, while the linker of PBD dimer-maleimide-acetal is acid-labile.
- PBD dimers and ADC comprising PBD dimers may be prepared according to methods known in the art. See, e.g., WO 2009/016516; US 2009/304710; US 2010/047257; US 2009/036431; US 2011/0256157; WO 2011/130598; WO 2013/055987.
- an ADC comprising anthracycline.
- Anthracyclines are antibiotic compounds that exhibit cytotoxic activity. While not intending to be bound by any particular theory, studies have indicated that anthracyclines may operate to kill cells by a number of different mechanisms, including: 1) intercalation of the drug molecules into the DNA of the cell thereby inhibiting DNA-dependent nucleic acid synthesis; 2) production by the drug of free radicals which then react with cellular macromolecules to cause damage to the cells, and/or 3) interactions of the drug molecules with the cell membrane (see, e.g., C.
- Nonlimiting exemplary anthracyclines include doxorubicin, epirubicin, idarubicin, daunomycin, nemorubicin, and derivatives thereof. Immunoconjugates and prodrugs of daunorubicin and doxorubicin have been prepared and studied (Kratz et al (2006) Current Med. Chem.13:477-523; Jeffrey et al (2006) Bioorganic & Med. Chem. Letters 16:358-362; Torgov et al (2005) Bioconj. Chem.16:717-721; Nagy et al (2000) Proc. Natl. Acad. Sci. USA 97:829-834; Dubowchik et al (2002) Bioorg.
- PNU-159682 is a potent metabolite (or derivative) of nemorubicin (Quintieri, et al. (2005) Clinical Cancer Research 11(4):1608-1617).
- Nemorubicin is a semisynthetic analog of doxorubicin with a 2-methoxymorpholino group on the glycoside amino of doxorubicin and has been under clinical evaluation (Grandi et al (1990) Cancer Treat. Rev. 17:133; Ripamonti et al (1992) Brit. J.
- a nonlimiting exemplary ADC comprising nemorubicin or nemorubicin derivatives is shown in Formula Ia:
- R 1 is hydrogen atom, hydroxy or methoxy group and R 2 is a C 1 -C 5 alkoxy group, or a pharmaceutically acceptable salt thereof;
- L 1 and Z together are a linker (L) as described herein;
- T is an antibody (Ab) as described herein;
- n is 1 to about 20. In some embodiments, m is 1 to 10, 1 to 7, 1 to 5, or 1 to 4.
- R 1 and R 2 are both methoxy (-OMe).
- a further nonlimiting exemplary ADC comprising nemorubicin or nemorubicin derivatives is shown in Formula Ib:
- R 1 is hydrogen atom, hydroxy or methoxy group and R 2 is a C 1 -C 5 alkoxy group, or a pharmaceutically acceptable salt thereof;
- L 2 and Z together are a linker (L) as described herein;
- T is an antibody (Ab) as described herein; and m is 1 to about 20. In some embodiments, m is 1 to 10, 1 to 7, 1 to 5, or 1 to 4.
- R 1 and R 2 are both methoxy (-OMe).
- the nemorubicin component of a nemorubicin- containing ADC is PNU-159682.
- the drug portion of the ADC ma have one of the followin structures:
- Anthracyclines including PNU-159682, may be conjugated to antibodies through several linkage sites and a variety of linkers (US 2011/0076287; WO2009/099741; US 2010/0034837; WO 2010/009124) , including the linkers described herein.
- Exemplary ADCs comprising a nemorubicin and linker include, but are not limited to:
- R 1 and R 2 are independently selected from H and C 1 -C 6 alkyl
- linker of PNU-159682 maleimide acetal-Ab is acid-labile, while the linkers of PNU-159682-val-cit-PAB-Ab, PNU-159682-val-cit-PAB-spacer-Ab, and PNU- 159682-val-cit-PAB-spacer(R 1 R 2 )-Ab are protease cleavable.
- Exemplary PNU ADC are shown in Figs.10D and 10E.
- an ADC comprises 1-(chloromethyl)-2,3-dihydro-1H- benzo[e]indole (CBI).
- CBI The 5-amino-1-(chloromethyl)-1,2-dihydro-3H-benz[e]indole
- amino CBI The 5-amino-1-(chloromethyl)-1,2-dihydro-3H-benz[e]indole
- DNA minor groove alkylators are potent cytotoxins (Atwell, et al (1999) J. Med. Chem., 42:3400), and have been utilized as effector units in a number of classes of prodrugs designed for cancer therapy. These have included antibody conjugates, (Jeffrey, et al. (2005) J. Med.
- an ADC comprises a 1-(chloromethyl)-2,3-dihydro- 1H-benzo[e]indole (CBI) dimer (WO 2015/023355).
- FIG.10B An exemplary CBI dimer ADC is shown in Fig.10B.
- the dimer is a heterodimer wherein one half of the dimer is a CBI moiety and the other half of the dimer is a PBD moiety.
- FIG.10C An exemplary CBI-PBD heterodimer ADC is shown in Fig.10C.
- R 1 is selected from H, P(O) 3 H 2 , C(O)NR a R b , or a bond to a linker (L);
- R 2 is selected from H, P(O) 3 H 2 , C(O)NR a R b , or a bond to a linker (L);
- R a and R b are independently selected from H and C 1 ⁇ C 6 alkyl optionally substituted with one or more F, or R a and R b form a five or six membered heterocyclyl group;
- T is a tether group selected from C 3 ⁇ C 12 alkylene, Y, (C 1 ⁇ C 6 alkylene) ⁇ Y ⁇ (C 1 ⁇ C 6 alkylene), (C 1 ⁇ C 6 alkylene) ⁇ Y ⁇ (C 1 ⁇ C 6 alkylene) ⁇ Y ⁇ (C 1 ⁇ C 6 alkylene), (C 2 ⁇ C 6 alkenylene) ⁇ Y ⁇ (C 2 ⁇ C 6 alkenylene), and (C 2 ⁇ C 6 alkynylene) ⁇ Y ⁇ (C 2 ⁇ C 6 alkynylene);
- Y is independently selected from O, S, NR 1 , aryl, and heteroaryl;
- alkylene, alkenylene, aryl, and heteroaryl are independently and optionally substituted with F, OH, O(C 1 ⁇ C 6 alkyl), NH 2 , NHCH 3 , N(CH 3 ) 2 , OP(O) 3 H 2 , and C 1 ⁇ C 6 alkyl, where alkyl is optionally substituted with one or more F;
- alkylene, alkenylene, aryl, and heteroaryl are independently and optionally substituted with a bond to L;
- D' is a drug moiety selected from:
- the immunoconjugate comprises an antibody conjugated to one or more amatoxin molecules.
- Amatoxins are cyclic peptides composed of 8 amino acids. They can be isolated from Amanita phalloides mushrooms or prepared synthetically.
- Amatoxins specifically inhibit the DNA-dependent RNA polymerase II of mammalian cells, and thereby also the transcription and protein biosynthesis of the affected cells. Inhibition of transcription in a cell causes stop of growth and proliferation. See e.g., Moldenhauer et al. JNCI 104:1-13 (2012), WO2010115629, WO2012041504, WO2012119787, WO2014043403, WO2014135282, and WO2012119787, which are hereby incorporated by reference in its entirety.
- the one or more amatoxin molecules are one or more ⁇ -amanitin molecules.
- Other drug moieties include, protein toxins such as: diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain (Vitetta et al (1987) Science, 238:1098), abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes (WO 93/21232).
- protein toxins such as: diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas
- the resulting product is a mixture of ADC compounds with a distribution of one or more drug moieties attached to an antibody.
- the average number of drugs per antibody (DAR) may be calculated from the mixture by a dual ELISA antibody assay, which is specific for antibody and specific for the drug.
- Individual ADC molecules may be identified in the mixture by mass spectroscopy and separated by HPLC, e.g. hydrophobic interaction chromatography (see, e.g., McDonagh et al (2006) Prot. Engr. Design & Selection 19(7):299-307; Hamblett et al (2004) Clin.
- a homogeneous ADC with a single loading value may be isolated from the conjugation mixture by electrophoresis or chromatography.
- Antibody drug conjugates 51-58 of Table 18 may be prepared by coupling a drug moiety with a linker reagent, and according to the procedures of WO 2013/055987; WO 2015/023355; WO 2010/009124; WO 2015/095227, and conjugated with any of the antibodies, including cysteine engineered antibodies, described herein.
- Drug moieties also include compounds with nucleolytic activity (e.g., a ribonuclease or a DNA endonuclease).
- nucleolytic activity e.g., a ribonuclease or a DNA endonuclease.
- Therapeutic radioisotopes include: 32 P, 33 P, 90 Y, 125 I, 131 I, 131 In, 153 Sm, 186 Re, 188 Re, 211 At, 212 Bi, 212 Pb, and radioactive isotopes of Lu.
- radioisotope or other labels may be incorporated in the conjugate in known ways (Fraker et al (1978) Biochem. Biophys. Res. Commun.80: 49-57; "Monoclonal Antibodies in Immunoscintigraphy” Chatal, CRC Press 1989).
- Carbon-14-labeled 1- isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of a radionuclide to the antibody (WO 94/11026).
- A“Linker” is a bifunctional or multifunctional moiety that can be used to link one or more drug moieties (D) to an antibody (Ab) to form an antibody-drug conjugate (ADC) of Formula I.
- antibody-drug conjugates (ADC) can be prepared using a Linker having reactive functionalities for covalently attaching to the drug and to the antibody.
- a cysteine thiol of an antibody (Ab) can form a bond with a reactive functional group of a linker or a drug-linker intermediate to make an ADC.
- a linker has a functionality that is capable of reacting with a free cysteine present on an antibody to form a covalent bond.
- reactive functionalities include maleimide, haloacetamides, ⁇ -haloacetyl, activated esters such as succinimide esters, 4-nitrophenyl esters, pentafluorophenyl esters, tetrafluorophenyl esters, anhydrides, acid chlorides, sulfonyl chlorides, isocyanates, and isothiocyanates.
- a linker has a functionality that is capable of reacting with an electrophilic group present on an antibody.
- electrophilic groups include, but are not limited to, aldehyde and ketone carbonyl groups.
- a heteroatom of the reactive functionality of the linker can react with an electrophilic group on an antibody and form a covalent bond to an antibody unit.
- Nonlimiting exemplary such reactive functionalities include, but are not limited to, hydrazide, oxime, amino, hydrazine, thiosemicarbazone, hydrazine carboxylate, and arylhydrazide.
- a linker may comprise one or more linker components.
- exemplary linker components include 6-maleimidocaproyl (“MC”), maleimidopropanoyl (“MP”), valine- citrulline (“val-cit” or“vc”), alanine-phenylalanine (“ala-phe”), p-aminobenzyloxycarbonyl (a“PAB”), N-Succinimidyl 4-(2-pyridylthio) pentanoate (“SPP”), and 4-(N- maleimidomethyl) cyclohexane-1 carboxylate (“MCC”).
- MC 6-maleimidocaproyl
- MP maleimidopropanoyl
- val-cit valine- citrulline
- alanine-phenylalanine ala-phe
- a“PAB” p-aminobenzyloxycarbonyl
- SPP N-Succinimidyl 4-(2-pyridylthi
- a linker may be a“cleavable linker,” facilitating release of a drug.
- Nonlimiting exemplary cleavable linkers include acid-labile linkers (e.g., comprising hydrazone), protease-sensitive (e.g., peptidase-sensitive) linkers, photolabile linkers, or disulfide-containing linkers (Chari et al., Cancer Research 52:127-131 (1992); US 5208020).
- acid-labile linkers e.g., comprising hydrazone
- protease-sensitive linkers e.g., peptidase-sensitive linkers
- photolabile linkers e.g., or disulfide-containing linkers
- a linker has the following Formula II:
- A is a“stretcher unit”, and a is an integer from 0 to 1; W is an“amino acid unit”, and w is an integer from 0 to 12; Y is a“spacer unit”, and y is 0, 1, or 2; and Ab, D, and p are defined as above for Formula I.
- a linker component comprises a“stretcher unit” that links an antibody to another linker component or to a drug moiety.
- Nonlimiting exemplary stretcher units are shown below (wherein the wavy line indicates sites of covalent attachment to an antibody, drug, or additional linker components):
- the linker may be a peptidomimetic linker such as those described in WO2015/095227, WO2015/095124 or WO2015/095223, which documents are hereby incorporated by reference in their entirety.
- a Linker has a reactive site which has an electrophilic group that is reactive to a nucleophilic cysteine present on an antibody.
- the cysteine thiol of the antibody is reactive with an electrophilic group on a Linker and forms a covalent bond to a Linker.
- Useful electrophilic groups include, but are not limited to, maleimide and
- Cysteine engineered antibodies react with linker reagents or drug-linker intermediates, with electrophilic functional groups such as maleimide or ⁇ -halo carbonyl, according to the conjugation method at page 766 of Klussman, et al (2004), Bioconjugate Chemistry 15(4):765-773, and according to the protocol of Example 4.
- the reactive group of a linker reagent or drug- linker intermediate contains a thiol-reactive functional group that can form a bond with a free cysteine thiol of an antibody.
- thiol-reaction functional groups include, but are not limited to, maleimide, ⁇ -haloacetyl, activated esters such as succinimide esters,
- the linker may be a dendritic type linker for covalent attachment of more than one drug moiety through a branching, multifunctional linker moiety to an antibody
- Dendritic linkers can increase the molar ratio of drug to antibody, i.e. loading, which is related to the potency of the ADC.
- a cysteine engineered antibody bears only one reactive cysteine thiol group, a multitude of drug moieties may be attached through a dendritic linker.
- the linker may comprise amino acid residues which links the antibody (Ab) to the drug moiety (D) of the cysteine engineered antibody-drug conjugate (ADC) of the invention.
- the amino acid residues may form a dipeptide, tripeptide, tetrapeptide, pentapeptide, hexapeptide, heptapeptide, octapeptide, nonapeptide, decapeptide,
- Amino acid residues include those occurring naturally, as well as minor amino acids and non-naturally occurring amino acid analogs, such as citrulline.
- Useful amino acid residue units can be designed and optimized in their selectivity for enzymatic cleavage by a particular enzymes, for example, a tumor-associated protease to liberate an active drug moiety.
- an amino acid residue unit such as valine-citrulline (vc or val-cit) is that whose cleavage is catalyzed by cathepsin B, C and D, or a plasmin protease.
- a linker unit may be of the self-immolative type such as a p- aminobenzylcarbamoyl (PAB) unit where the ADC has the exemplary structure:
- Q is -C 1 -C 8 alkyl, -O-(C 1 -C 8 alkyl), -halogen, -nitro or -cyano;
- m is an integer ranging from 0-4; and
- p ranges from 1 to 4.
- self-immolative spacers include, but are not limited to, aromatic compounds that are electronically similar to the PAB group such as 2- aminoimidazol-5-methanol derivatives (US 7375078; Hay et al. (1999) Bioorg. Med. Chem. Lett.9:2237) and ortho or para-aminobenzylacetals.
- Spacers can be used that undergo cyclization upon amide bond hydrolysis, such as substituted and unsubstituted 4- aminobutyric acid amides (Rodrigues et al (1995) Chemistry Biology 2:223), appropriately substituted bicyclo[2.2.1] and bicyclo[2.2.2] ring systems (Storm et al (1972) J. Amer.
- linker L may be a dendritic type linker for covalent attachment of more than one drug moiety through a branching, multifunctional linker moiety to an antibody (Sun et al (2002) Bioorganic & Medicinal Chemistry Letters 12:2213-2215; Sun et al (2003) Bioorganic & Medicinal Chemistry 11:1761-1768).
- Dendritic linkers can increase the molar ratio of drug to antibody, i.e. loading, which is related to the potency of the ADC.
- a cysteine engineered antibody bears only one reactive cysteine thiol group, a multitude of drug moieties may be attached through a dendritic linker (WO
- Embodiments of the Formula Ia antibody-drug conjugate compounds include (val-cit), (MC-val-cit), and (MC-val-cit-PAB):
- R is independently H or C 1 ⁇ C 6 alkyl; and n is 1 to 12.
- a Linker has a reactive functional group which has a nucleophilic group that is reactive to an electrophilic group present on an antibody.
- Useful electrophilic groups on an antibody include, but are not limited to, aldehyde and ketone carbonyl groups.
- the heteroatom of a nucleophilic group of a Linker can react with an electrophilic group on an antibody and form a covalent bond to an antibody unit.
- Useful nucleophilic groups on a Linker include, but are not limited to, hydrazide, oxime, amino, hydrazine, thiosemicarbazone, hydrazine carboxylate, and arylhydrazide.
- the electrophilic group on an antibody provides a convenient site for attachment to a Linker.
- peptide-type Linkers can be prepared by forming a peptide bond between two or more amino acids and/or peptide fragments.
- Such peptide bonds can be prepared, for example, according to the liquid phase synthesis method (E. Schröder and K. Lübke (1965)“The Peptides”, volume 1, pp 76-136, Academic Press) which is well known in the field of peptide chemistry.
- the Linker may be substituted with groups which modulated solubility or reactivity.
- a charged substituent such as sulfonate (- SO - 3 ) or ammonium, may increase water solubility of the reagent and facilitate the coupling reaction of the linker reagent with the antibody or the drug moiety, or facilitate the coupling reaction of Ab-L (antibody-linker intermediate) with D, or D-L (drug-linker intermediate) with Ab, depending on the synthetic route employed to prepare the ADC.
- the compounds of the invention expressly contemplate, but are not limited to, ADC prepared with linker reagents: BMPEO, BMPS, EMCS, GMBS, HBVS, LC-SMCC, MBS, MPBH, SBAP, SIA, SIAB, SMCC, SMPB, SMPH, sulfo-EMCS, sulfo-GMBS, sulfo- KMUS, sulfo-MBS, sulfo-SIAB, sulfo-SMCC, and sulfo-SMPB, and SVSB (succinimidyl- (4-vinylsulfone)benzoate), and including bis-maleimide reagents: DTME, BMB, BMDB, BMH, BMOE, BM(PEO) 3 , and BM(PEO) 4 , which are commercially available from Pierce Biotechnology, Inc., Customer Service Department, P.O.
- Bis-maleimide reagents allow the attachment of the thiol group of a cysteine engineered antibody to a thiol-containing drug moiety, label, or linker intermediate, in a sequential or concurrent fashion.
- Useful linker reagents can also be obtained via other commercial sources, such as Molecular Biosciences Inc.(Boulder, CO), or synthesized in accordance with procedures described in Toki et al (2002) J. Org. Chem.67:1866-1872; Walker, M.A. (1995) J. Org. Chem.60:5352-5355; Frisch et al (1996) Bioconjugate Chem.7:180-186; US 6214345; WO 02/088172; US 2003130189; US2003096743; WO 03/026577; WO 03/043583; and WO 04/032828.
- valine-citrulline (val-cit or vc) dipeptide linker reagent having a maleimide Stretcher and a para-aminobenzylcarbamoyl (PAB) self-immolative Spacer has the structure:
- Q is -C 1 -C 8 alkyl, -O-(C 1 -C 8 alkyl), -halogen, -nitro or -cyano; and m is an integer ranging from 0-4.
- An exemplary phe-lys(Mtr) dipeptide linker reagent having a maleimide Stretcher unit and a p-aminobenzyl self-immolative Spacer unit can be prepared according to Dubowchik, et al. (1997) Tetrahedron Letters, 38:5257-60, and has the structure:
- Mtr is mono-4-methoxytrityl
- Q is -C 1 -C 8 alkyl, -O-(C 1 -C 8 alkyl), - halogen, -nitro or -cyano
- m is an integer ranging from 0-4.
- Exemplary antibody-drug conjugate compounds of the invention include:
- Val valine
- Cit citrulline
- p 1, 2, 3, or 4
- Ab is a cysteine engineered antibody.
- Other exemplary antibody drug conjugates where maytansinoid drug moiety DM1 is linked through a BMPEO linker to a thiol group of trastuzumab have the structure:
- Ab is a cysteine engineered antibody
- n is 0, 1, or 2
- p is 1, 2, 3, or 4.
- the ADC of Formula I may be prepared by several routes, employing organic chemistry reactions, conditions, and reagents known to those skilled in the art, including: (1) reaction of a cysteine group of a cysteine engineered antibody with a linker reagent, to form antibody-linker intermediate Ab-L, via a covalent bond, followed by reaction with an activated drug moiety D; and (2) reaction of a nucleophilic group of a drug moiety with a linker reagent, to form drug-linker intermediate D-L, via a covalent bond, followed by reaction with a cysteine group of a cysteine engineered antibody. Conjugation methods (1) and (2) may be employed with a variety of cysteine engineered antibodies, drug moieties, and linkers to prepare the antibody-drug conjugates of Formula I.
- Antibody cysteine thiol groups are nucleophilic and capable of reacting to form covalent bonds with electrophilic groups on linker reagents and drug-linker
- intermediates including: (i) active esters such as NHS esters, HOBt esters, haloformates, and acid halides; (ii) alkyl and benzyl halides, such as haloacetamides; (iii) aldehydes, ketones, carboxyl, and maleimide groups; and (iv) disulfides, including pyridyl disulfides, via sulfide exchange.
- active esters such as NHS esters, HOBt esters, haloformates, and acid halides
- alkyl and benzyl halides such as haloacetamides
- aldehydes ketones
- carboxyl and maleimide groups
- disulfides including pyridyl disulfides, via sulfide exchange.
- Nucleophilic groups on a drug moiety include, but are not limited to: amine, thiol, hydroxyl, hydrazide, oxime, hydrazine, thiosemicarbazone, hydrazine carboxylate, and arylhydrazide groups capable of reacting to form covalent bonds with electrophilic groups on linker moieties and linker reagents.
- Maytansine may, for example, be converted to May-SSCH 3 , which can be reduced to the free thiol, May-SH, and reacted with a modified antibody (Chari et al (1992) Cancer Research 52:127-131) to generate a maytansinoid-antibody immunoconjugate with a disulfide linker.
- Antibody-maytansinoid conjugates with disulfide linkers have been reported (WO 04/016801; US 6884874; US 2004/039176 A1; WO 03/068144; US 2004/001838 A1; US Patent Nos.6441163, 5208020, 5416064; WO 01/024763).
- the disulfide linker SPP is constructed with linker reagent N-succinimidyl 4-(2-pyridylthio) pentanoate.
- cysteine engineered antibodies may be made reactive for conjugation with linker reagents by treatment with a reducing agent such as DTT (Cleland's reagent, dithiothreitol) or TCEP (tris(2-carboxyethyl)phosphine hydrochloride; Getz et al (1999) Anal. Biochem. Vol 273:73-80; Soltec Ventures, Beverly, MA).
- a reducing agent such as DTT (Cleland's reagent, dithiothreitol) or TCEP (tris(2-carboxyethyl)phosphine hydrochloride; Getz et al (1999) Anal. Biochem. Vol 273:73-80; Soltec Ventures, Beverly, MA).
- THIOMAB TM antibodies Full length, cysteine engineered monoclonal antibodies (THIOMAB TM antibodies) expressed in CHO cells were reduced with about a 50 fold excess of TCEP for 3 hrs at 37 oC to reduce disulfide bonds which may form between the newly introduced cysteine residues and the cysteine present in the culture media.
- the reduced THIOMAB TM antibodies werediluted and loaded onto HiTrap S column in 10 mM sodium acetate, pH 5, and eluted with PBS containing 0.3M sodium chloride. Disulfide bonds were reestablished between cysteine residues present in the parent Mab with dilute (200 nM) aqueous copper sulfate (CuSO 4 ) at room temperature, overnight.
- Other oxidants i.e.
- oxidizing agents and oxidizing conditions, which are known in the art may be used. Ambient air oxidation is also effective. This mild, partial reoxidation step forms intrachain disulfides efficiently with high fidelity.
- An approximate 10 fold excess of drug-linker intermediate, e.g. BM(PEO) 4 -DM1 was added, mixed, and let stand for about an hour at room temperature to effect conjugation and form the antibody-drug conjugate (i.e., a conjugated THIOMAB TM antibodies).
- the conjugation mixture was gel filtered and loaded and eluted through a HiTrap S column to remove excess drug-linker intermediate and other impurities.
- THIOMAB TM antibodies expressed in mammalian cell lines result in externally conjugated Cys adduct to an engineered Cys through–S-S- bond formation.
- purified THIOMAB TM antibodies have to be treated with reduction and oxidation procedures to produce reactive THIOMAB TM antibodies.
- These THIOMAB TM antibodies are used to conjugate with maleimide containing cytotoxic drugs, fluorophores, and other labels.
- THIOMAB TM antibodies conjugates were prepared and can be found in the tables provided herein. [00436] IN VITRO CELL PROLIFERATION ASSAYS
- the cytotoxic or cytostatic activity of an antibody-drug conjugate is measured by: exposing mammalian cells having receptor proteins, e.g. HER2, to the antibody of the ADC in a cell culture medium; culturing the cells for a period from about 6 hours to about 5 days; and measuring cell viability.
- Cell-based in vitro assays were used to measure viability (proliferation), cytotoxicity, and induction of apoptosis (caspase activation) of the ADC of the invention.
- the in vitro potency of antibody-drug conjugates can be measured by a cell proliferation assay.
- a cell proliferation assay For example, the CellTiter-Glo ® Luminescent Cell Viability Assay is a commercially available (Promega Corp., Madison, WI), homogeneous assay method based on the recombinant expression of Coleoptera luciferase (US Patent Nos.5583024; 5674713 and 5700670).
- This cell proliferation assay determines the number of viable cells in culture based on quantitation of the ATP present, an indicator of metabolically active cells (Crouch et al (1993) J. Immunol. Meth.160:81-88; US 6602677).
- the CellTiter-Glo ® Assay is conducted in 96 well format, making it amenable to automated high-throughput screening (HTS) (Cree et al (1995) AntiCancer Drugs 6:398-404).
- the homogeneous assay procedure involves adding the single reagent (CellTiter-Glo ® Reagent) directly to cells cultured in serum- supplemented medium. Cell washing, removal of medium and multiple pipetting steps are not required.
- the system detects as few as 15 cells/well in a 384-well format in 10 minutes after adding reagent and mixing.
- the cells may be treated continuously with ADC, or they may be treated and separated from ADC. Generally, cells treated briefly, i.e.3 hours, showed the same potency effects as continuously treated cells.
- the homogeneous“add-mix-measure” format results in cell lysis and generation of a luminescent signal proportional to the amount of ATP present.
- the amount of ATP is directly proportional to the number of cells present in culture.
- the CellTiter-Glo ® Assay generates a“glow-type” luminescent signal, produced by the luciferase reaction, which has a half-life generally greater than five hours, depending on cell type and medium used. Viable cells are reflected in relative luminescence units (RLU).
- the substrate, Beetle Luciferin is oxidatively decarboxylated by recombinant firefly luciferase with concomitant conversion of ATP to AMP and generation of photons.
- the in vivo efficacy of the THIOMAB TM antibodies described herein can be measured by a high expressing transgenic explant mouse model (e.g., the THIOMAB TM antibodies of the tables provided herein made from the anti-HER24D5 antibody can be measured by a high expressing HER2 transgenic explant mouse model).
- An allograft can be propagated, for example, from the Fo5 mmtv transgenic mouse which does not respond to, or responds poorly to, HERCEPTIN ⁇ therapy.
- Subjects can be treated once with a anti-HER2 4D5 THIOMAB TM antibody and a placebo PBS buffer control (Vehicle) and can be monitored over 3 weeks to measure the time to tumor doubling, log cell kill, and tumor shrinkage.
- the antibody-drug conjugates (ADC) of the invention may be administered by any route appropriate to the condition to be treated.
- the ADC will typically be administered parenterally, i.e. infusion, subcutaneous, intramuscular, intravenous, intradermal, intrathecal and epidural.
- PHARMACEUTICAL FORMULATIONS are typically administered parenterally, i.e. infusion, subcutaneous, intramuscular, intravenous, intradermal, intrathecal and epidural.
- compositions of therapeutic antibody-drug conjugates (ADC) of the invention are typically prepared for parenteral administration, i.e. bolus, intravenous, intratumor injection with a pharmaceutically acceptable parenteral vehicle and in a unit dosage injectable form.
- An antibody-drug conjugate (ADC) having the desired degree of purity is optionally mixed with pharmaceutically acceptable diluents, carriers, excipients or stabilizers (Remington's Pharmaceutical Sciences (1980) 16th edition, Osol, A. Ed.), in the form of a lyophilized formulation or an aqueous solution.
- compositions of the cysteine engineered antibodies described herein can be prepared by mixing such antibody (i.e. a THIOMAB TM antibody) having the desired degree of purity with one or more optional pharmaceutically acceptable carriers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of lyophilized formulations or aqueous solutions.
- antibody i.e. a THIOMAB TM antibody
- optional pharmaceutically acceptable carriers Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)
- Pharmaceutically acceptable carriers are generally nontoxic to recipients at the dosages and concentrations employed, and include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or
- immunoglobulins include hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants such as polyethylene glycol (PEG).
- PEG polyethylene glycol
- Exemplary pharmaceutically acceptable carriers herein further include insterstitial drug dispersion agents such as soluble neutral-active hyaluronidase glycoproteins (sHASEGP), for example, human soluble PH-20 hyaluronidase glycoproteins, such as rHuPH20 (HYLENEX ® , Baxter International, Inc.).
- HASEGP soluble neutral-active hyaluronidase glycoproteins
- rHuPH20 HYLENEX ® , Baxter International, Inc.
- Certain exemplary sHASEGPs and methods of use, including rHuPH20 are described in US Patent Publication Nos.
- a sHASEGP is combined with one or more additional glycosaminoglycanases such as chondroitinases.
- Exemplary lyophilized antibody and immunoconjugate formulations are described in US Patent No.6,267,958 which is incorporated herein in its entirity.
- Aqueous antibody or immunoconjugate formulations include those described in US Patent No.
- the formulation herein may also contain more than one active ingredient as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other.
- Active ingredients may be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example,
- microcapsules respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in
- Sustained-release preparations may be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody or immunoconjugate, which matrices are in the form of shaped articles, e.g. films, or microcapsules.
- the formulations to be used for in vivo administration are generally sterile. Sterility may be readily accomplished, e.g., by filtration through sterile filtration membranes. [00452] ANTIBODY-DRUG CONJUGATE THERAPEUTIC METHODS AND COMPOSITIONS
- the antibody-drug conjugates (ADC) of the present invention may be used to treat various diseases or disorders, e.g. characterized by the overexpression of a tumor antigen.
- exemplary conditions are hyperproliferative disorders which include benign or malignant tumors and leukemia and lymphoid malignancies. Others include neuronal, glial, astrocytal, hypothalamic, glandular, macrophagal, epithelial, stromal, blastocoelic, inflammatory, angiogenic and immunologic, including autoimmune, disorders.
- the disease or disorder to be treated is a hyperproliferative disease such as cancer.
- cancers to be treated herein include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia or lymphoid malignancies. More particular examples of such cancers include squamous cell cancer (e.g.
- lung cancer including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, rectal cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, anal carcinoma, penile carcinoma, as well as head and neck cancer.
- lung cancer including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer,
- Autoimmune diseases for which the ADC compounds may be used in treatment include rheumatologic disorders (such as, for example, rheumatoid arthritis, Sjögren's syndrome, scleroderma, lupus such as SLE and lupus nephritis,
- More preferred such diseases include, for example, rheumatoid arthritis, ulcerative colitis, ANCA-associated vasculitis, lupus, multiple sclerosis, Sjögren's syndrome, Graves’ disease, IDDM, pernicious anemia, thyroiditis, and
- the appropriate dosage of an ADC will depend on the type of disease to be treated, as defined above, the severity and course of the disease, whether the molecule is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the antibody, and the discretion of the attending physician.
- the molecule is suitably administered to the patient at one time or over a series of treatments.
- about 1 ⁇ g/kg to 15 mg/kg (e.g.0.1-20 mg/kg) of molecule is an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion.
- a typical daily dosage might range from about 1 ⁇ g/kg to 100 mg/kg or more, depending on the factors mentioned above.
- An exemplary dosage of ADC to be administered to a patient is in the range of about 0.1 to about 10 mg/kg of patient weight.
- An exemplary dosing regimen comprises administering an initial loading dose of about 4 mg/kg, followed by a weekly maintenance dose of about 2 mg/kg of an anti-ErbB2 antibody. Other dosage regimens may be useful. The progress of this therapy is easily monitored by conventional techniques and assays.
- a THIOMAB TM antibody provided herein can be used in a method of inhibiting cellular proliferation.
- an anti-HER2 THIOMAB TM antibody can be used to inhibit the cellular proliferation of a HER2-positive cell.
- an anti-CD33 THIOMAB TM antibody can be used to inhibit the cellular proliferation of a CD33-positive cell.
- an antibody can be made against any polypeptide expressed on a tumor cell and that antibody can be engineered to include a non- native cysteine for drug conjugation (i.e., the antibody can be engineered into a THIOMAB TM antibody).
- the method of inhibiting cellular proliferation comprises exposing the cell to the THIOMAB TM antibody (e.g., an anti-HER2 THIOMAB TM antibody) under conditions permissive for binding of the THIOMAB TM antibody to the target (e.g., HER2) on the surface of the cell, thereby inhibiting the proliferation of the cell.
- the method is an in vitro or an in vivo method.
- Inhibition of cell proliferation in vitro may be assayed using the CellTiter- Glo TM Luminescent Cell Viability Assay, which is commercially available from Promega (Madison, WI).
- That assay determines the number of viable cells in culture based on quantitation of ATP present, which is an indication of metabolically active cells. See Crouch et al. (1993) J. Immunol. Meth.160:81-88, US Pat. No.6602677.
- the assay may be conducted in 96- or 384-well format, making it amenable to automated high-throughput screening (HTS). See Cree et al. (1995) AntiCancer Drugs 6:398-404.
- the assay procedure involves adding a single reagent (CellTiter-Glo ® Reagent) directly to cultured cells. This results in cell lysis and generation of a luminescent signal produced by a luciferase reaction. The luminescent signal is proportional to the amount of ATP present, which is directly proportional to the number of viable cells present in culture. Data can be recorded by luminometer or CCD camera imaging device. The luminescence output is expressed as relative light units (RLU).
- a THIOMAB TM antibody for use as a medicament is provided (e.g., an anti-HER2 THIOMAB TM antibody).
- THIOMAB TM antibody for use in a method of treatment is provided.
- an anti- HER2 THIOMAB TM antibody for use in treating HER2-positive cancer is provided.
- the invention provides an anti-HER2 THIOMAB TM antibody for use in a method of treating an individual having a HER2-positive cancer, the method comprising administering to the individual an effective amount of the anti- THIOMAB TM antibody.
- the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent, e.g., as described below.
- an anti-CD33 THIOMAB TM antibody for use in treating CD33- positive cancer is provided.
- the invention provides an anti-CD33 THIOMAB TM antibody for use in a method of treating an individual having a CD33-positive cancer, the method comprising administering to the individual an effective amount of the anti- THIOMAB TM antibody.
- the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent, e.g., as described below.
- the invention provides for the use of a THIOMAB TM antibody in the manufacture or preparation of a medicament (e.g., an anti-HER2
- an anti-HER2 THIOMAB TM antibody medicament is for use in a method of treating HER2-positive cancer, the method comprising administering to an individual having HER2-positive cancer an effective amount of the medicament. In one such embodiment, the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent, e.g., as described below.
- the invention provides for the use of a THIOMAB TM antibody in the manufacture or preparation of a medicament (e.g., an anti-MUC16
- an anti-MUC16 THIOMAB TM antibody medicament is for use in a method of treating MUC16-positive cancer, the method comprising administering to an individual having MUC16-positive cancer an effective amount of the medicament. In one such embodiment, the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent, e.g., as described below.
- the invention provides for the use of a THIOMAB TM antibody in the manufacture or preparation of a medicament (e.g., an anti-STEAP1
- an anti-STEAP1 THIOMAB TM antibody medicament is for use in a method of treating STEAP1-positive cancer, the method comprising administering to an individual having STEAP1-positive cancer an effective amount of the medicament. In one such embodiment, the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent, e.g., as described below.
- the invention provides for the use of a THIOMAB TM antibody in the manufacture or preparation of a medicament (e.g., an anti-NAPI2B
- an anti-NAPI2B THIOMAB TM antibody medicament is for use in a method of treating NAPI2B-positive cancer, the method comprising administering to an individual having NAPI2B-positive cancer an effective amount of the medicament. In one such embodiment, the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent, e.g., as described below.
- the invention provides for the use of a THIOMAB TM antibody in the manufacture or preparation of a medicament (e.g., an anti-LY6E
- an anti-LY6E THIOMAB TM antibody medicament is for use in a method of treating LY6E-positive cancer, the method comprising administering to an individual having LY6E-positive cancer an effective amount of the medicament. In one such embodiment, the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent, e.g., as described below.
- the invention provides for the use of a THIOMAB TM antibody in the manufacture or preparation of a medicament (e.g., an anti-B7H4 THIOMAB TM antibody).
- a THIOMAB TM antibody e.g., an anti-B7H4 THIOMAB TM antibody.
- an anti-B7H4 THIOMAB TM antibody medicament is for use in a method of treating B7H4-positive cancer, the method comprising administering to an individual having B7H4-positive cancer an effective amount of the medicament.
- the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent, e.g., as described below.
- the invention provides for the use of a THIOMAB TM antibody in the manufacture or preparation of a medicament (e.g., an anti-CD79B
- an anti-CD79B THIOMAB TM antibody medicament is for use in a method of treating CD79B-positive cancer, the method comprising administering to an individual having CD79B-positive cancer an effective amount of the medicament. In one such embodiment, the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent, e.g., as described below.
- the invention provides for the use of a THIOMAB TM antibody in the manufacture or preparation of a medicament (e.g., an anti-CD22
- an anti-CD22 THIOMAB TM antibody medicament is for use in a method of treating CD22-positive cancer, the method comprising administering to an individual having CD22-positive cancer an effective amount of the medicament. In one such embodiment, the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent, e.g., as described below.
- the invention provides a method for cancer by
- the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent, e.g., as described below.
- the THIOMAB TM antibodies of the invention can be used either alone or in combination with other agents in a therapy.
- an antibody or immunoconjugate of the invention may be co-administered with at least one additional therapeutic agent.
- the additional therapeutic agent can be a second the THIOMAB TM antibody or a chemotherapeutic agent as defined herein.
- Such combination therapies noted above encompass combined administration (where two or more therapeutic agents are included in the same or separate formulations), and separate administration, in which case, administration of the antibody or
- immunoconjugate of the invention can occur prior to, simultaneously, and/or following, administration of the additional therapeutic agent and/or adjuvant.
- Antibodies or antibodies to the invention can occur prior to, simultaneously, and/or following, administration of the additional therapeutic agent and/or adjuvant.
- immunoconjugates of the invention can also be used in combination with radiation therapy.
- the THIOMAB TM antibodies of the invention can be administered by any suitable means, including parenteral, intrapulmonary, and intranasal, and, if desired for local treatment, intralesional administration.
- Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration. Dosing can be by any suitable route, e.g. by injections, such as intravenous or subcutaneous injections, depending in part on whether the administration is brief or chronic.
- Various dosing schedules including but not limited to single or multiple administrations over various time-points, bolus administration, and pulse infusion are contemplated herein.
- THIOMAB TM antibodies of the invention would be formulated, dosed, and administered in a fashion consistent with good medical practice.
- THIOMAB TM antibodies need not be, but are optionally formulated with one or more agents currently used to prevent or treat the disorder in question.
- the effective amount of such other agents depends on the amount of antibody or immunoconjugate present in the formulation, the type of disorder or treatment, and other factors discussed above.
- the appropriate dosage of a THIOMAB TM antibody of the invention (when used alone or in combination with one or more other additional therapeutic agents) will depend on the type of disease to be treated, the type of antibody or immunoconjugate, the severity and course of the disease, whether the THIOMAB TM antibody is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the THIOMAB TM antibody, and the discretion of the attending physician.
- the THIOMAB TM antibody is suitably administered to the patient at one time or over a series of treatments.
- about 1 ⁇ g/kg to 15 mg/kg (e.g.0.1mg/kg-10mg/kg) of the THIOMAB TM antibody can be an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion.
- One typical daily dosage might range from about 1 ⁇ g/kg to 100 mg/kg or more, depending on the factors mentioned above.
- the treatment would generally be sustained until a desired suppression of disease symptoms occurs.
- One exemplary dosage of the THIOMAB TM antibody would be in the range from about 0.05 mg/kg to about 10 mg/kg.
- one or more doses of about 0.5 mg/kg, 2.0 mg/kg, 4.0 mg/kg or 10 mg/kg (or any combination thereof) may be administered to the patient.
- Such doses may be administered intermittently, e.g. every week or every three weeks (e.g. such that the patient receives from about two to about twenty, or e.g. about six doses of the antibody).
- An initial higher loading dose, followed by one or more lower doses may be administered.
- other dosage regimens may be useful. The progress of this therapy is easily monitored by conventional techniques and assays.
- cysteine engineered antibodies may be labelled through the cysteine thiol with radionuclides, fluorescent dyes, bioluminescence- triggering substrate moieties, chemiluminescence-triggering substrate moieties, enzymes, and other detection labels for imaging experiments with diagnostic, pharmacodynamic, and therapeutic applications.
- the labelled cysteine engineered antibody i.e.
- biomarker or“probe”, is administered by injection, perfusion, or oral ingestion to a living organism, e.g. human, rodent, or other small animal, a perfused organ, or tissue sample. The distribution of the probe is detected over a time course and represented by an image.
- a living organism e.g. human, rodent, or other small animal, a perfused organ, or tissue sample.
- the distribution of the probe is detected over a time course and represented by an image.
- an article of manufacture containing materials useful for the treatment of the disorders described above.
- the article of manufacture comprises a container and a label or package insert on or associated with the container.
- Suitable containers include, for example, bottles, vials, syringes, blister pack, etc.
- the containers may be formed from a variety of materials such as glass or plastic.
- the container holds a THIOMAB TM antibody of this invention which is effective for treating the condition and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
- At least one active agent in the composition is a THIOMAB TM antibody.
- the label or package insert indicates that the composition is used for treating the condition of choice, such as cancer.
- the article of manufacture may further comprise a second (or third) container comprising a pharmaceutically-acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
- THIOMAB TM antibodies were generated using hu4D5 plasmid as double stranded DNA template. PCR based site-directed mutagenesis was performed using Quick Change II XL kit from Agilent Technologies.
- the cysteine engineered hu4D5 plasmids were stably transfected into a mammalian cell line for protein production.
- the 293T cell line used for this study was a suspension adapted HEK293 cell line that was stably transfected with the SV40 large T- antigen.
- Cells were cultivated as a seed train in shake flasks under conditions of 37°C, 5% CO 2 , and 150 rpm agitation speed at a 25 mm throw diameter in an 80% humidified incubator before transient transfection.
- Gibco Freestyle 293 expression medium (Life Sciences, Carlsbad CA) supplemented with 1% ultra-low IgG serum (Sigma, St.
Abstract
Description
Claims
Priority Applications (14)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020177008038A KR20170052600A (en) | 2014-09-12 | 2015-09-11 | Cysteine engineered antibodies and conjugates |
EP15771364.5A EP3191521A2 (en) | 2014-09-12 | 2015-09-11 | Cysteine engineered antibodies and conjugates |
CA2957354A CA2957354A1 (en) | 2014-09-12 | 2015-09-11 | Cysteine engineered antibodies and conjugates |
BR112017003236A BR112017003236A2 (en) | 2014-09-12 | 2015-09-11 | cysteine engineered antibodies, drug conjugates and antibodies, drug and antibody conjugate preparation method and pharmaceutical composition |
SG11201701128YA SG11201701128YA (en) | 2014-09-12 | 2015-09-11 | Cysteine engineered antibodies and conjugates |
RU2017107502A RU2017107502A (en) | 2014-09-12 | 2015-09-11 | ANTIBODIES AND CONJUGATES DESIGNED BY THE INTRODUCTION OF CYSTEINE |
AU2015314826A AU2015314826A1 (en) | 2014-09-12 | 2015-09-11 | Cysteine engineered antibodies and conjugates |
MX2017003123A MX2017003123A (en) | 2014-09-12 | 2015-09-11 | Cysteine engineered antibodies and conjugates. |
JP2017513087A JP2017531620A (en) | 2014-09-12 | 2015-09-11 | Cysteine engineered antibodies and conjugates |
CN201580054050.0A CN107108724A (en) | 2014-09-12 | 2015-09-11 | Cysteine engineered antibody and conjugate |
EP17198468.5A EP3388449A3 (en) | 2014-09-12 | 2015-09-11 | Cysteine engineered antibodies and conjugates |
IL250449A IL250449A0 (en) | 2014-09-12 | 2017-02-05 | Cysteine engineered antibodies and conjugates |
ZA2017/00944A ZA201700944B (en) | 2014-09-12 | 2017-02-07 | Cysteine engineered antibodies and conjugates |
HK18102603.5A HK1243103A1 (en) | 2014-09-12 | 2018-02-23 | Cysteine engineered antibodies and conjugates |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201462050022P | 2014-09-12 | 2014-09-12 | |
US62/050,022 | 2014-09-12 |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
EP17198468.5A Previously-Filed-Application EP3388449A3 (en) | 2014-09-12 | 2015-09-11 | Cysteine engineered antibodies and conjugates |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2016040856A2 true WO2016040856A2 (en) | 2016-03-17 |
WO2016040856A3 WO2016040856A3 (en) | 2016-05-06 |
Family
ID=54200088
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2015/049771 WO2016040856A2 (en) | 2014-09-12 | 2015-09-11 | Cysteine engineered antibodies and conjugates |
Country Status (17)
Country | Link |
---|---|
US (3) | US10077318B2 (en) |
EP (2) | EP3191521A2 (en) |
JP (4) | JP2017531620A (en) |
KR (1) | KR20170052600A (en) |
CN (1) | CN107108724A (en) |
AR (1) | AR101844A1 (en) |
AU (1) | AU2015314826A1 (en) |
BR (1) | BR112017003236A2 (en) |
CA (1) | CA2957354A1 (en) |
HK (1) | HK1243103A1 (en) |
IL (1) | IL250449A0 (en) |
MX (1) | MX2017003123A (en) |
RU (1) | RU2017107502A (en) |
SG (1) | SG11201701128YA (en) |
TW (1) | TW201625688A (en) |
WO (1) | WO2016040856A2 (en) |
ZA (1) | ZA201700944B (en) |
Cited By (68)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20170002086A1 (en) * | 2015-06-15 | 2017-01-05 | Genentech, Inc. | Antibodies and immunoconjugates |
WO2018045090A1 (en) * | 2016-09-01 | 2018-03-08 | Immunomab, Inc. | Bispecific antibodies |
US10058613B2 (en) | 2015-10-02 | 2018-08-28 | Genentech, Inc. | Pyrrolobenzodiazepine antibody drug conjugates and methods of use |
WO2018175752A1 (en) | 2017-03-22 | 2018-09-27 | Genentech, Inc. | Optimized antibody compositions for treatment of ocular disorders |
WO2018184966A1 (en) | 2017-04-03 | 2018-10-11 | F. Hoffmann-La Roche Ag | Antibodies binding to steap-1 |
US10124069B2 (en) | 2013-12-16 | 2018-11-13 | Genentech, Inc. | Peptidomimetic compounds and antibody-drug conjugates thereof |
US10179820B2 (en) | 2014-09-12 | 2019-01-15 | Genentech, Inc. | Anti-HER2 antibodies and immunoconjugates |
EP3437657A1 (en) * | 2017-08-04 | 2019-02-06 | Sysmex Corporation | Antibody modified by substituting cysteine at amino acid positions 80 and 171 of kabat numbering |
WO2019122052A2 (en) | 2017-12-21 | 2019-06-27 | F. Hoffmann-La Roche Ag | Antibodies binding to hla-a2/wt1 |
WO2019129677A1 (en) | 2017-12-29 | 2019-07-04 | F. Hoffmann-La Roche Ag | Anti-vegf antibodies and methods of use |
WO2019143636A1 (en) | 2018-01-16 | 2019-07-25 | Lakepharma, Inc. | Bispecific antibody that binds cd3 and another target |
WO2019154890A1 (en) | 2018-02-09 | 2019-08-15 | F. Hoffmann-La Roche Ag | Antibodies binding to gprc5d |
WO2019191552A1 (en) | 2018-03-29 | 2019-10-03 | Genentech, Inc. | Modulating lactogenic activity in mammalian cells |
US10533058B2 (en) | 2013-12-16 | 2020-01-14 | Genentech Inc. | Peptidomimetic compounds and antibody-drug conjugates thereof |
JP2020503243A (en) * | 2017-08-11 | 2020-01-30 | バイオ − テラ ソリューションズ、リミテッド | Compounds and methods for the treatment of trop2 positive disease |
WO2020027330A1 (en) | 2018-08-03 | 2020-02-06 | 中外製薬株式会社 | Antigen-binding molecule containing two antigen-binding domains that are linked to each other |
WO2020092385A1 (en) * | 2018-10-29 | 2020-05-07 | Mersana Therapeutics, Inc. | Cysteine engineered antibody-drug conjugates with peptide-containing linkers |
WO2020127619A1 (en) | 2018-12-21 | 2020-06-25 | F. Hoffmann-La Roche Ag | Antibodies binding to cd3 |
WO2020127873A1 (en) | 2018-12-21 | 2020-06-25 | F. Hoffmann-La Roche Ag | Antibody that binds to vegf and il-1beta and methods of use |
WO2020156439A1 (en) | 2019-01-28 | 2020-08-06 | 上海拓界生物医药科技有限公司 | Anti-cd79b antibody, antigen-binding fragment thereof, and pharmaceutical use thereof |
CN111670051A (en) * | 2017-11-08 | 2020-09-15 | 亚飞(上海)生物医药科技有限公司 | Biomolecular conjugates and uses thereof |
WO2020191306A1 (en) | 2019-03-21 | 2020-09-24 | Immunogen, Inc. | Methods of preparing cell-binding agent-drug conjugates |
WO2021009146A1 (en) | 2019-07-15 | 2021-01-21 | F. Hoffmann-La Roche Ag | Antibodies binding to nkg2d |
WO2021018859A2 (en) | 2019-07-31 | 2021-02-04 | F. Hoffmann-La Roche Ag | Antibodies binding to gprc5d |
WO2021018925A1 (en) | 2019-07-31 | 2021-02-04 | F. Hoffmann-La Roche Ag | Antibodies binding to gprc5d |
US10953106B2 (en) | 2015-02-16 | 2021-03-23 | Lonza Ltd | Antibodies |
WO2021055577A2 (en) | 2019-09-18 | 2021-03-25 | Genentech, Inc. | Anti-klk7 antibodies, anti-klk5 antibodies, multispecific anti-klk5/klk7 antibodies, and methods of use |
WO2021122875A1 (en) | 2019-12-18 | 2021-06-24 | F. Hoffmann-La Roche Ag | Antibodies binding to hla-a2/mage-a4 |
WO2021157679A1 (en) * | 2020-02-05 | 2021-08-12 | Chugai Seiyaku Kabushiki Kaisha | Methods for producing and/or enriching recombinant antigen-binding molecules |
WO2021195464A2 (en) | 2020-03-26 | 2021-09-30 | Genentech, Inc. | Modified mammalian cells |
WO2021198034A1 (en) | 2020-03-30 | 2021-10-07 | F. Hoffmann-La Roche Ag | Antibody that binds to vegf and pdgf-b and methods of use |
US20210347910A1 (en) * | 2020-02-25 | 2021-11-11 | Sysmex Corporation | Method for improving thermal stability of antibody and method for producing modified antibody |
US11179473B2 (en) | 2020-02-21 | 2021-11-23 | Silverback Therapeutics, Inc. | Nectin-4 antibody conjugates and uses thereof |
WO2021249990A2 (en) | 2020-06-08 | 2021-12-16 | Hoffmann-La Roche Inc. | Anti-hbv antibodies and methods of use |
WO2021255146A1 (en) | 2020-06-19 | 2021-12-23 | F. Hoffmann-La Roche Ag | Antibodies binding to cd3 and cea |
WO2021255142A1 (en) | 2020-06-19 | 2021-12-23 | F. Hoffmann-La Roche Ag | Antibodies binding to cd3 |
WO2021255155A1 (en) | 2020-06-19 | 2021-12-23 | F. Hoffmann-La Roche Ag | Antibodies binding to cd3 and cd19 |
US20210393794A1 (en) * | 2017-06-20 | 2021-12-23 | Sichuan Baili Pharm Co.Ltd | Screening of fixed-point coupling sites of cysteine-modified antibody-toxin conjugate (tdc) |
WO2021255143A1 (en) | 2020-06-19 | 2021-12-23 | F. Hoffmann-La Roche Ag | Antibodies binding to cd3 and folr1 |
WO2021262783A1 (en) | 2020-06-24 | 2021-12-30 | Genentech, Inc. | Apoptosis resistant cell lines |
WO2022016037A1 (en) | 2020-07-17 | 2022-01-20 | Genentech, Inc. | Anti-notch2 antibodies and methods of use |
US11229708B2 (en) | 2015-12-04 | 2022-01-25 | Seagen Inc. | Conjugates of quaternized tubulysin compounds |
WO2022047222A2 (en) | 2020-08-28 | 2022-03-03 | Genentech, Inc. | Crispr/cas9 multiplex knockout of host cell proteins |
WO2022049165A1 (en) | 2020-09-04 | 2022-03-10 | F. Hoffmann-La Roche Ag | Antibody that binds to vegf-a and ang2 and methods of use |
US11274151B2 (en) | 2020-03-31 | 2022-03-15 | Chugai Seiyaku Kabushiki Kaisha | CD3-targeting and DLL3-targeting multispecific antigen-binding molecules and uses thereof |
WO2022086957A1 (en) | 2020-10-20 | 2022-04-28 | Genentech, Inc. | Peg-conjugated anti-mertk antibodies and methods of use |
WO2022169872A1 (en) | 2021-02-03 | 2022-08-11 | Genentech, Inc. | Multispecific binding protein degrader platform and methods of use |
WO2022192647A1 (en) | 2021-03-12 | 2022-09-15 | Genentech, Inc. | Anti-klk7 antibodies, anti-klk5 antibodies, multispecific anti-klk5/klk7 antibodies, and methods of use |
WO2022217022A1 (en) | 2021-04-10 | 2022-10-13 | Profoundbio Us Co. | Folr1 binding agents, conjugates thereof and methods of using the same |
WO2022225880A1 (en) | 2021-04-19 | 2022-10-27 | Genentech, Inc. | Modified mammalian cells |
WO2022226317A1 (en) | 2021-04-23 | 2022-10-27 | Profoundbio Us Co. | Anti-cd70 antibodies, conjugates thereof and methods of using the same |
WO2022246259A1 (en) | 2021-05-21 | 2022-11-24 | Genentech, Inc. | Modified cells for the production of a recombinant product of interest |
US11530274B2 (en) | 2018-07-02 | 2022-12-20 | Amgen Inc. | Anti-STEAP1 antigen-binding protein |
US11541126B1 (en) | 2020-07-01 | 2023-01-03 | Silverback Therapeutics, Inc. | Anti-ASGR1 antibody TLR8 agonist comprising conjugates and uses thereof |
WO2023288182A1 (en) | 2021-07-12 | 2023-01-19 | Genentech, Inc. | Structures for reducing antibody-lipase binding |
WO2023288241A1 (en) | 2021-07-14 | 2023-01-19 | Genentech, Inc. | Anti-c-c motif chemokine receptor 8 (ccr8) antibodies and methods of use |
WO2023001884A1 (en) | 2021-07-22 | 2023-01-26 | F. Hoffmann-La Roche Ag | Heterodimeric fc domain antibodies |
WO2023007481A1 (en) * | 2021-07-28 | 2023-02-02 | Ramot At Tel-Aviv University Ltd. | Water soluble prodrug, conjugates and uses thereof |
WO2023012147A1 (en) | 2021-08-03 | 2023-02-09 | F. Hoffmann-La Roche Ag | Bispecific antibodies and methods of use |
WO2023092099A1 (en) | 2021-11-19 | 2023-05-25 | Ardeagen Corporation | Gpc3 binding agents, conjugates thereof and methods of using the same |
WO2023104938A1 (en) | 2021-12-10 | 2023-06-15 | F. Hoffmann-La Roche Ag | Antibodies binding to cd3 and plap |
WO2023141445A1 (en) | 2022-01-19 | 2023-07-27 | Genentech, Inc. | Anti-notch2 antibodies and conjugates and methods of use |
EP4019544A4 (en) * | 2019-08-19 | 2023-10-18 | Shenyang Pharmaceutical University | Antibody mutant and application thereof |
US11793880B2 (en) | 2015-12-04 | 2023-10-24 | Seagen Inc. | Conjugates of quaternized tubulysin compounds |
WO2023215737A1 (en) * | 2022-05-03 | 2023-11-09 | Genentech, Inc. | Anti-ly6e antibodies, immunoconjugates, and uses thereof |
WO2023217933A1 (en) | 2022-05-11 | 2023-11-16 | F. Hoffmann-La Roche Ag | Antibody that binds to vegf-a and il6 and methods of use |
US11932673B2 (en) | 2017-07-12 | 2024-03-19 | Maxion Therapeutics Limited | Sodium channel inhibitors |
WO2024077239A1 (en) | 2022-10-07 | 2024-04-11 | Genentech, Inc. | Methods of treating cancer with anti-c-c motif chemokine receptor 8 (ccr8) antibodies |
Families Citing this family (20)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
AU2014340378A1 (en) | 2013-10-21 | 2016-04-21 | Genentech, Inc. | Anti-Ly6E antibodies and methods of use |
HUE049175T2 (en) * | 2014-09-23 | 2020-09-28 | Hoffmann La Roche | Method of using anti-cd79b immunoconjugates |
WO2017112624A1 (en) | 2015-12-21 | 2017-06-29 | Bristol-Myers Squibb Company | Variant antibodies for site-specific conjugation |
AU2017239038A1 (en) | 2016-03-22 | 2018-10-04 | Bionomics Inc | Administration of an anti-LGR5 monoclonal antibody |
WO2018027204A1 (en) | 2016-08-05 | 2018-02-08 | Genentech, Inc. | Multivalent and multiepitopic anitibodies having agonistic activity and methods of use |
WO2018085769A1 (en) * | 2016-11-07 | 2018-05-11 | Seattle Genetics, Inc. | Distribution of engineered-cysteine caps |
CN110248962A (en) * | 2016-12-06 | 2019-09-17 | 希望之城 | Cysteine peptide enables antibody |
AU2017380871A1 (en) * | 2016-12-21 | 2019-07-11 | Bayer Aktiengesellschaft | Antibody drug conjugates (ADCs) having enzymatically cleavable groups |
SG11201907288RA (en) * | 2017-02-28 | 2019-09-27 | Seattle Genetics Inc | Cysteine mutated antibodies for conjugation |
TW201836647A (en) * | 2017-04-06 | 2018-10-16 | 美商艾伯維有限公司 | Anti-prlr antibody-drug conjugates (adc) and uses thereof |
US20200114017A1 (en) * | 2017-06-16 | 2020-04-16 | Bionomics Limited | Antibody drug conjugates that bind lgr5 |
US11623965B2 (en) | 2017-08-16 | 2023-04-11 | Bristol-Myers Squibb Company | Prodruggable antibodies, prodrugs thereof, and methods of use and making |
WO2019142147A2 (en) * | 2018-01-18 | 2019-07-25 | Magenta Therapeutics, Inc. | Compositions and methods for the depletion of cd134+ cells |
CA3113645A1 (en) * | 2018-09-20 | 2020-03-26 | Arizona Board Of Regents On Behalf Of The University Of Arizona | Targeting moiety-drug grafted immune cell compositions and methods of use |
CN117843795A (en) * | 2019-03-11 | 2024-04-09 | 凯惠科技发展(上海)有限公司 | Cysteine-containing antibody, drug conjugate and application thereof |
US20220348686A1 (en) * | 2019-09-05 | 2022-11-03 | Memorial Sloan Kettering Cancer Center | Anti-steap1 antibodies and uses thereof |
WO2023240067A2 (en) * | 2022-06-07 | 2023-12-14 | Ngb Biopharmaceuticals, Inc. | Multimerization of binding molecules having an antibody constant region variant and mutations that reduce effector functions |
WO2024028282A1 (en) | 2022-08-01 | 2024-02-08 | Gate2Brain, S.L. | Site-specific modification by a bbb-shuttle of antibody-based entities for crossing the blood-brain barrier |
CN115850449A (en) * | 2022-09-29 | 2023-03-28 | 苏州智核生物医药科技有限公司 | Antibodies and conjugates |
CN116650660B (en) * | 2023-07-27 | 2023-11-03 | 上海偌妥生物科技有限公司 | Method for preparing antibody-coupled small molecule drug and application thereof |
Citations (359)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4256746A (en) | 1978-11-14 | 1981-03-17 | Takeda Chemical Industries | Dechloromaytansinoids, their pharmaceutical compositions and method of use |
US4275149A (en) | 1978-11-24 | 1981-06-23 | Syva Company | Macromolecular environment control in specific receptor assays |
US4294757A (en) | 1979-01-31 | 1981-10-13 | Takeda Chemical Industries, Ltd | 20-O-Acylmaytansinoids |
US4307016A (en) | 1978-03-24 | 1981-12-22 | Takeda Chemical Industries, Ltd. | Demethyl maytansinoids |
US4313946A (en) | 1981-01-27 | 1982-02-02 | The United States Of America As Represented By The Secretary Of Agriculture | Chemotherapeutically active maytansinoids from Trewia nudiflora |
US4315929A (en) | 1981-01-27 | 1982-02-16 | The United States Of America As Represented By The Secretary Of Agriculture | Method of controlling the European corn borer with trewiasine |
US4318980A (en) | 1978-04-10 | 1982-03-09 | Miles Laboratories, Inc. | Heterogenous specific binding assay employing a cycling reactant as label |
US4322348A (en) | 1979-06-05 | 1982-03-30 | Takeda Chemical Industries, Ltd. | Maytansinoids |
US4331598A (en) | 1979-09-19 | 1982-05-25 | Takeda Chemical Industries, Ltd. | Maytansinoids |
US4362663A (en) | 1979-09-21 | 1982-12-07 | Takeda Chemical Industries, Ltd. | Maytansinoid compound |
US4364866A (en) | 1979-09-21 | 1982-12-21 | Takeda Chemical Industries, Ltd. | Maytansinoids |
US4371533A (en) | 1980-10-08 | 1983-02-01 | Takeda Chemical Industries, Ltd. | 4,5-Deoxymaytansinoids, their use and pharmaceutical compositions thereof |
US4415732A (en) | 1981-03-27 | 1983-11-15 | University Patents, Inc. | Phosphoramidite compounds and processes |
US4424219A (en) | 1981-05-20 | 1984-01-03 | Takeda Chemical Industries, Ltd. | 9-Thiomaytansinoids and their pharmaceutical compositions and use |
US4450254A (en) | 1980-11-03 | 1984-05-22 | Standard Oil Company | Impact improvement of high nitrile resins |
US4458066A (en) | 1980-02-29 | 1984-07-03 | University Patents, Inc. | Process for preparing polynucleotides |
US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
US4737456A (en) | 1985-05-09 | 1988-04-12 | Syntex (U.S.A.) Inc. | Reducing interference in ligand-receptor binding assays |
US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
EP0328147A2 (en) | 1988-02-11 | 1989-08-16 | Bristol-Myers Squibb Company | Anthracycline immunoconjugates having a novel linker and methods for their production |
WO1991002536A1 (en) | 1989-08-23 | 1991-03-07 | Scripps Clinic And Research Foundation | Compositions and methods for detection and treatment of epstein-barr virus infection and immune disorders |
US5091178A (en) | 1986-02-21 | 1992-02-25 | Oncogen | Tumor therapy with biologically active anti-tumor antibodies |
WO1992007574A1 (en) | 1990-10-25 | 1992-05-14 | Tanox Biosystems, Inc. | Glycoproteins associated with membrane-bound immunoglobulins as antibody targets on b cells |
WO1992017497A1 (en) | 1991-03-29 | 1992-10-15 | Genentech, Inc. | Human pf4a receptors and their use |
EP0522868A1 (en) | 1991-07-12 | 1993-01-13 | SHIONOGI SEIYAKU KABUSHIKI KAISHA trading under the name of SHIONOGI & CO. LTD. | A human endothelin receptor |
JPH053790B2 (en) | 1983-11-02 | 1993-01-18 | Canon Kk | |
US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
WO1993008829A1 (en) | 1991-11-04 | 1993-05-13 | The Regents Of The University Of California | Compositions that mediate killing of hiv-infected cells |
WO1993016185A2 (en) | 1992-02-06 | 1993-08-19 | Creative Biomolecules, Inc. | Biosynthetic binding protein for cancer marker |
WO1993021232A1 (en) | 1992-04-10 | 1993-10-28 | Research Development Foundation | IMMUNOTOXINS DIRECTED AGAINST c-erbB-2 (HER-2/neu) RELATED SURFACE ANTIGENS |
WO1993021319A1 (en) | 1992-04-08 | 1993-10-28 | Cetus Oncology Corporation | HUMANIZED C-erbB-2 SPECIFIC ANTIBODIES |
WO1994010312A1 (en) | 1992-10-23 | 1994-05-11 | Chugai Seiyaku Kabushiki Kaisha | Gene coding for megakaryocyte potentiator |
WO1994011026A2 (en) | 1992-11-13 | 1994-05-26 | Idec Pharmaceuticals Corporation | Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma |
US5316757A (en) | 1984-10-18 | 1994-05-31 | Board Of Regents, The University Of Texas System | Synthesis of polyazamacrocycles with more than one type of side-chain chelating groups |
US5342606A (en) | 1984-10-18 | 1994-08-30 | Board Of Regents, The University Of Texas System | Polyazamacrocyclic compounds for complexation of metal ions |
WO1994028931A1 (en) | 1993-06-11 | 1994-12-22 | Genentech, Inc. | Methods for treating inflammatory disorders |
WO1994029351A2 (en) | 1993-06-16 | 1994-12-22 | Celltech Limited | Antibodies |
US5385893A (en) | 1993-05-06 | 1995-01-31 | The Dow Chemical Company | Tricyclopolyazamacrocyclophosphonic acids, complexes and derivatives thereof, for use as contrast agents |
US5428139A (en) | 1991-12-10 | 1995-06-27 | The Dow Chemical Company | Bicyclopolyazamacrocyclophosphonic acid complexes for use as radiopharmaceuticals |
US5440021A (en) | 1991-03-29 | 1995-08-08 | Chuntharapai; Anan | Antibodies to human IL-8 type B receptor |
US5462725A (en) | 1993-05-06 | 1995-10-31 | The Dow Chemical Company | 2-pyridylmethylenepolyazamacrocyclophosphonic acids, complexes and derivatives thereof, for use as contrast agents |
US5480990A (en) | 1991-12-10 | 1996-01-02 | The Dow Chemical Company | Bicyclopolyazamacrocyclocarboxylic acid complexes for use as contrast agents |
US5500362A (en) | 1987-01-08 | 1996-03-19 | Xoma Corporation | Chimeric antibody with specificity to human B cell surface antigen |
WO1996027011A1 (en) | 1995-03-01 | 1996-09-06 | Genentech, Inc. | A method for making heteromultimeric polypeptides |
WO1996030514A1 (en) | 1995-03-31 | 1996-10-03 | University Of Washington | Intracellular domain of the her-2/neu protein for prevention or treatment of malignancies |
US5571894A (en) | 1991-02-05 | 1996-11-05 | Ciba-Geigy Corporation | Recombinant antibodies specific for a growth factor receptor |
US5583024A (en) | 1985-12-02 | 1996-12-10 | The Regents Of The University Of California | Recombinant expression of Coleoptera luciferase |
US5587458A (en) | 1991-10-07 | 1996-12-24 | Aronex Pharmaceuticals, Inc. | Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof |
WO1997007198A2 (en) | 1995-08-11 | 1997-02-27 | Genetics Institute, Inc. | Dna sequences and secreted proteins encoded thereby |
US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
US5635483A (en) | 1992-12-03 | 1997-06-03 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Tumor inhibiting tetrapeptide bearing modified phenethyl amides |
US5644033A (en) | 1992-12-22 | 1997-07-01 | Health Research, Inc. | Monoclonal antibodies that define a unique antigen of human B cell antigen receptor complex and methods of using same for diagnosis and treatment |
US5663149A (en) | 1994-12-13 | 1997-09-02 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide heterocyclic and halophenyl amides |
US5677171A (en) | 1988-01-12 | 1997-10-14 | Genentech, Inc. | Monoclonal antibodies directed to the HER2 receptor |
WO1997044452A1 (en) | 1996-05-17 | 1997-11-27 | Schering Corporation | Human b-cell antigens, related reagents |
US5700670A (en) | 1995-04-13 | 1997-12-23 | Mitsubishi Chemical Corporation | Method for producing optically active ester of γ-substituted-β-hydroxybutyric acid |
US5712374A (en) | 1995-06-07 | 1998-01-27 | American Cyanamid Company | Method for the preparation of substantiallly monomeric calicheamicin derivative/carrier conjugates |
US5714586A (en) | 1995-06-07 | 1998-02-03 | American Cyanamid Company | Methods for the preparation of monomeric calicheamicin derivative/carrier conjugates |
US5739294A (en) | 1991-12-10 | 1998-04-14 | The Dow Chemical Company | Bicyclopol yazamacrocyclophosphonic acid complexes for use as contrast agents |
US5739116A (en) | 1994-06-03 | 1998-04-14 | American Cyanamid Company | Enediyne derivatives useful for the synthesis of conjugates of methyltrithio antitumor agents |
US5767237A (en) | 1993-10-01 | 1998-06-16 | Teikoku Hormone Mfg. Co., Ltd. | Peptide derivatives |
US5770710A (en) | 1987-10-30 | 1998-06-23 | American Cyanamid Company | Antitumor and antibacterial substituted disulfide derivatives prepared from compounds possessing a methlytrithio group |
US5770701A (en) | 1987-10-30 | 1998-06-23 | American Cyanamid Company | Process for preparing targeted forms of methyltrithio antitumor agents |
US5773223A (en) | 1993-09-02 | 1998-06-30 | Chiron Corporation | Endothelin B1, (ETB1) receptor polypeptide and its encoding nucleic acid methods, and uses thereof |
US5780588A (en) | 1993-01-26 | 1998-07-14 | Arizona Board Of Regents | Elucidation and synthesis of selected pentapeptides |
US5792616A (en) | 1990-05-29 | 1998-08-11 | The United States Of America | Antibodies to human cripto protein |
WO1998037193A1 (en) | 1997-02-20 | 1998-08-27 | Zymogenetics, Inc. | Zcytor7 cytokine receptor |
US5807715A (en) | 1984-08-27 | 1998-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin |
WO1998040403A1 (en) | 1997-03-10 | 1998-09-17 | The Regents Of The University Of California | Psca: prostate stem cell antigen |
US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
WO1998045479A1 (en) | 1997-04-04 | 1998-10-15 | Albany Medical College | Method for assessing prostate cancer |
EP0875569A1 (en) | 1997-04-28 | 1998-11-04 | Smithkline Beecham Corporation | A human sodium dependent phosphate transporter (IPT-1) |
US5834456A (en) | 1996-02-23 | 1998-11-10 | The Dow Chemical Company | Polyazamacrocyclofluoromonoalkylphosphonic acids, and their complexes, for use as contrast agents |
WO1998050431A2 (en) | 1997-05-02 | 1998-11-12 | Genentech, Inc. | A method for making multispecific antibodies having heteromultimeric and common components |
WO1998051805A1 (en) | 1997-05-15 | 1998-11-19 | Abbott Laboratories | Reagents and methods useful for detecting diseases of the prostate |
WO1998051824A1 (en) | 1997-05-15 | 1998-11-19 | Abbott Laboratories | Reagents and methods useful for detecting disease of the urinary tract |
US5854399A (en) | 1991-08-23 | 1998-12-29 | The United States Of America As Represented By The Department Of Health And Human Services | Antibodies specific for human cripto-related polypeptide CR-3 |
US5869445A (en) | 1993-03-17 | 1999-02-09 | University Of Washington | Methods for eliciting or enhancing reactivity to HER-2/neu protein |
WO1999028468A1 (en) | 1997-12-02 | 1999-06-10 | The Regents Of The University Of California | Modulating b lymphocyte chemokine/receptor interactions |
WO1999046284A2 (en) | 1998-03-13 | 1999-09-16 | The Burnham Institute | Molecules that home to various selected organs or tissues |
WO1999051642A1 (en) | 1998-04-02 | 1999-10-14 | Genentech, Inc. | Antibody variants and fragments thereof |
US5976551A (en) | 1991-11-15 | 1999-11-02 | Institut Pasteur And Institut Nationale De La Sante Et De La Recherche Medicale | Altered major histocompatibility complex (MHC) determinant and method of using the determinant |
WO1999058658A2 (en) | 1998-05-13 | 1999-11-18 | Epimmune, Inc. | Expression vectors for stimulating an immune response and methods of using the same |
WO2000012130A1 (en) | 1998-08-27 | 2000-03-09 | Smithkline Beecham Corporation | Rp105 agonists and antagonists |
WO2000012507A2 (en) | 1998-08-27 | 2000-03-09 | Spirogen Limited | Pyrrolobenzodiazepines |
WO2000014228A1 (en) | 1998-09-03 | 2000-03-16 | Japan Science And Technology Corporation | Neutral amino acid transporter and gene thereof |
WO2000020579A1 (en) | 1998-10-02 | 2000-04-13 | Mcmaster University | Spliced form of erbb-2/neu oncogene |
WO2000022129A1 (en) | 1998-10-13 | 2000-04-20 | Arena Pharmaceuticals, Inc. | Non-endogenous, constitutively activated human g protein-coupled receptors |
WO2000032752A1 (en) | 1998-12-02 | 2000-06-08 | The Regents Of The University Of California | Psca: prostate stem cell antigen and uses thereof |
WO2000036107A2 (en) | 1998-12-17 | 2000-06-22 | Corixa Corporation | Compositions and methods for therapy and diagnosis of ovarian cancer |
WO2000040614A2 (en) | 1998-12-30 | 2000-07-13 | Beth Israel Deaconess Medical Center, Inc. | Characterization of the soc/crac calcium channel protein family |
WO2000044899A1 (en) | 1999-01-29 | 2000-08-03 | Corixa Corporation | Her-2/neu fusion proteins |
WO2000053216A2 (en) | 1999-03-05 | 2000-09-14 | Smithkline Beecham Biologicals S.A. | Use of casb616 polypeptides and polynucleotides for cancer treatment |
WO2000055351A1 (en) | 1999-03-12 | 2000-09-21 | Human Genome Sciences, Inc. | Human colon cancer associated gene sequences and polypeptides |
US6153408A (en) | 1991-11-15 | 2000-11-28 | Institut Pasteur And Institut National De La Sante Et De La Recherche Medicale | Altered major histocompatibility complex (MHC) determinant and methods of using the determinant |
WO2000075655A1 (en) | 1999-06-03 | 2000-12-14 | Takeda Chemical Industries, Ltd. | Screening method with the use of cd100 |
WO2001000245A2 (en) | 1999-06-25 | 2001-01-04 | Genentech, Inc. | HUMANIZED ANTI-ErbB2 ANTIBODIES AND TREATMENT WITH ANTI-ErbB2 ANTIBODIES |
WO2001000244A2 (en) | 1999-06-25 | 2001-01-04 | Genentech, Inc. | METHODS OF TREATMENT USING ANTI-ErbB ANTIBODY-MAYTANSINOID CONJUGATES |
US6171586B1 (en) | 1997-06-13 | 2001-01-09 | Genentech, Inc. | Antibody formulation |
US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
WO2001016318A2 (en) | 1999-09-01 | 2001-03-08 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US6214345B1 (en) | 1993-05-14 | 2001-04-10 | Bristol-Myers Squibb Co. | Lysosomal enzyme-cleavable antitumor drug conjugates |
WO2001024763A2 (en) | 1999-10-01 | 2001-04-12 | Immunogen, Inc. | Compositions and methods for treating cancer using immunoconjugates and chemotherapeutic agents |
WO2001038490A2 (en) | 1999-11-29 | 2001-05-31 | The Trustees Of Columbia University In The City Of New York | ISOLATION OF FIVE NOVEL GENES CODING FOR NEW Fc RECEPTORS-TYPE MELANOMA INVOLVED IN THE PATHOGENESIS OF LYMPHOMA/MELANOMA |
WO2001040309A2 (en) | 1999-10-29 | 2001-06-07 | Genentech, Inc. | Anti-prostate stem cell antigen (psca) antibody compositions and methods of use |
WO2001040269A2 (en) | 1999-11-30 | 2001-06-07 | Corixa Corporation | Compositions and methods for therapy and diagnosis of breast cancer |
WO2001041787A1 (en) | 1999-12-10 | 2001-06-14 | Epimmune Inc. | INDUCING CELLULAR IMMUNE RESPONSES TO HER2/neu USING PEPTIDE AND NUCLEIC ACID COMPOSITIONS |
WO2001045746A2 (en) | 1999-12-24 | 2001-06-28 | Genentech, Inc. | Methods and compositions for prolonging elimination half-times of bioactive compounds |
WO2001046261A1 (en) | 1999-12-23 | 2001-06-28 | Zymogenetics, Inc. | Method for treating inflammation |
WO2001046232A2 (en) | 1999-12-23 | 2001-06-28 | Zymogenetics, Inc. | Soluble interleukin-20 receptor |
WO2001048204A1 (en) | 1999-12-23 | 2001-07-05 | Agresearch Limited | Mutated bmp1b receptor as regulator of ovulation rate |
WO2001053463A2 (en) | 2000-01-21 | 2001-07-26 | Corixa Corporation | COMPOUNDS AND METHODS FOR PREVENTION AND TREATMENT OF HER-2/neu ASSOCIATED MALIGNANCIES |
US6267958B1 (en) | 1995-07-27 | 2001-07-31 | Genentech, Inc. | Protein formulation |
WO2001057188A2 (en) | 2000-02-03 | 2001-08-09 | Hyseq, Inc. | Novel nucleic acids and polypeptides |
WO2001062794A2 (en) | 2000-02-22 | 2001-08-30 | Millennium Pharmaceuticals, Inc. | 18607, a human calcium channel |
WO2001066689A2 (en) | 2000-03-07 | 2001-09-13 | Hyseq, Inc. | Novel nucleic acids and polypeptides |
WO2001072962A2 (en) | 2000-03-24 | 2001-10-04 | Fahri Saatcioglu | Novel prostate-specific or testis-specific nucleic acid molecules, polypeptides, and diagnostic and therapeutic methods |
WO2001072830A2 (en) | 2000-03-31 | 2001-10-04 | Ipf Pharmaceuticals Gmbh | Diagnostic and medicament for analysing the cell surface proteome of tumour and inflammatory cells and for treating tumorous and inflammatory diseases, preferably using a specific chemokine receptor analysis and the chemokine receptor-ligand interaction |
WO2001075177A2 (en) | 2000-04-03 | 2001-10-11 | The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Tumor markers in ovarian cancer |
WO2001077172A2 (en) | 2000-04-07 | 2001-10-18 | Arena Pharmaceuticals, Inc. | Non-endogenous, constitutively activated known g protein-coupled receptors |
WO2001088133A2 (en) | 2000-05-18 | 2001-11-22 | Lexicon Genetics Incorporated | Human semaphorin homologs and polynucleotides encoding the same |
WO2001090304A2 (en) | 2000-05-19 | 2001-11-29 | Human Genome Sciences, Inc. | Nucleic acids, proteins, and antibodies |
WO2001094641A2 (en) | 2000-06-09 | 2001-12-13 | Idec Pharmaceuticals Corporation | Gene targets and ligands that bind thereto for treatment and diagnosis of ovarian carcinomas |
US20010055751A1 (en) | 1997-03-10 | 2001-12-27 | Reiter Robert E | PSCA: Prostate stem cell antigen and uses thereof |
WO2001098351A2 (en) | 2000-06-16 | 2001-12-27 | Incyte Genomics, Inc. | G-protein coupled receptors |
WO2002002587A1 (en) | 2000-06-30 | 2002-01-10 | Human Genome Sciences, Inc. | B7-like polynucleotides, polypeptides, and antibodies |
WO2002002624A2 (en) | 2000-06-30 | 2002-01-10 | Amgen, Inc. | B7-like molecules and uses thereof |
WO2002002634A2 (en) | 2000-06-30 | 2002-01-10 | Incyte Genomics, Inc. | Human extracellular matrix and cell adhesion polypeptides |
WO2002006339A2 (en) | 2000-07-03 | 2002-01-24 | Curagen Corporation | Proteins and nucleic acids encoding same |
WO2002006317A2 (en) | 2000-07-17 | 2002-01-24 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of ovarian cancer |
WO2002010382A2 (en) | 2000-07-28 | 2002-02-07 | Ulrich Wissenbach | Trp8, trp9 and trp10, markers for cancer |
WO2002010187A1 (en) | 2000-07-27 | 2002-02-07 | Mayo Foundation For Medical Education And Research | B7-h3 and b7-h4, novel immunoregulatory molecules |
WO2002012341A2 (en) | 2000-08-03 | 2002-02-14 | Corixa Corporation | Her-2/neu fusion proteins |
WO2002014503A2 (en) | 2000-08-14 | 2002-02-21 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of her-2/neu-associated malignancies |
WO2002013847A2 (en) | 2000-08-14 | 2002-02-21 | Corixa Corporation | Methods for diagnosis and therapy of hematological and virus-associated malignancies |
WO2002016413A2 (en) | 2000-08-24 | 2002-02-28 | Glaxosmithkline Biologicals S.A. | Cripto tumour polypeptide |
WO2002016429A2 (en) | 2000-08-24 | 2002-02-28 | Genentech, Inc. | Compositions and methods for the diagnosis and treatment of tumor |
WO2002022153A2 (en) | 2000-09-15 | 2002-03-21 | Zymogenetics, Inc. | Use of a polypeptide comprising the extracellular domains of il-20rb for the treatment of inflammation |
WO2002022636A1 (en) | 2000-09-15 | 2002-03-21 | Isis Pharmaceuticals, Inc. | Antisense modulation of her-2 expression |
WO2002022660A2 (en) | 2000-09-11 | 2002-03-21 | Hyseq, Inc. | Novel nucleic acids and polypeptides |
WO2002022808A2 (en) | 2000-09-18 | 2002-03-21 | Biogen, Inc. | Cripto mutant and uses thereof |
US20020034749A1 (en) | 1997-11-18 | 2002-03-21 | Billing-Medel Patricia A. | Reagents and methods useful for detecting diseases of the breast |
WO2002024909A2 (en) | 2000-09-18 | 2002-03-28 | Biogen, Inc. | Receptor nucleic acids and polypeptides |
US20020042366A1 (en) | 1999-12-23 | 2002-04-11 | Penny Thompson | Method for treating inflammation |
WO2002030268A2 (en) | 2000-10-13 | 2002-04-18 | Eos Biotechnology, Inc. | Methods of diagnosis of prostate cancer, compositions and methods of screening for modulators of prostate cancer |
WO2002038766A2 (en) | 2000-11-07 | 2002-05-16 | Zymogenetics, Inc. | Human tumor necrosis factor receptor |
WO2002054940A2 (en) | 2001-01-12 | 2002-07-18 | University Of Medicine & Dentistry Of New Jersey | Bone morphogenetic protein-2 in the treatment and diagnosis of cancer |
WO2002059377A2 (en) | 2001-01-24 | 2002-08-01 | Protein Design Labs | Methods of diagnosis of breast cancer, compositions and methods of screening for modulators of breast cancer |
WO2002061087A2 (en) | 2000-12-19 | 2002-08-08 | Lifespan Biosciences, Inc. | Antigenic peptides, such as for g protein-coupled receptors (gpcrs), antibodies thereto, and systems for identifying such antigenic peptides |
WO2002060317A2 (en) | 2001-01-30 | 2002-08-08 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of pancreatic cancer |
WO2002064798A1 (en) | 2001-02-12 | 2002-08-22 | Bionomics Limited | Dna sequences differentially expressed in tumour cell lines |
US6441163B1 (en) | 2001-05-31 | 2002-08-27 | Immunogen, Inc. | Methods for preparation of cytotoxic conjugates of maytansinoids and cell binding agents |
WO2002071928A2 (en) | 2001-03-14 | 2002-09-19 | Millennium Pharmaceuticals, Inc. | Nucleic acid molecules and proteins for the identification, assessment, prevention, and therapy of ovarian cancer |
WO2002072596A1 (en) | 2001-03-09 | 2002-09-19 | Incyte Genomics, Inc. | Steap-related protein |
WO2002078524A2 (en) | 2001-03-28 | 2002-10-10 | Zycos Inc. | Translational profiling |
WO2002081646A2 (en) | 2001-04-06 | 2002-10-17 | Mannkind Corporation | Epitope sequences |
US20020150573A1 (en) | 2000-11-10 | 2002-10-17 | The Rockefeller University | Anti-Igalpha-Igbeta antibody for lymphoma therapy |
WO2002083866A2 (en) | 2001-04-17 | 2002-10-24 | The Board Of Trustees Of The University Of Arkansas | Repeat sequences of the ca125 gene and their use for diagnostic and therapeutic interventions |
WO2002086443A2 (en) | 2001-04-18 | 2002-10-31 | Protein Design Labs, Inc | Methods of diagnosis of lung cancer, compositions and methods of screening for modulators of lung cancer |
WO2002088172A2 (en) | 2001-04-30 | 2002-11-07 | Seattle Genetics, Inc. | Pentapeptide compounds and uses related thereto |
WO2002088170A2 (en) | 2001-04-26 | 2002-11-07 | Biogen, Inc. | Cripto blocking antibodies and uses thereof |
WO2002089747A2 (en) | 2001-05-09 | 2002-11-14 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of prostate cancer |
WO2002092836A2 (en) | 2001-05-11 | 2002-11-21 | Sloan-Kettering Institute For Cancer Research | Nucleic acid sequence encoding ovarian antigen, ca125, and uses thereof |
WO2002094852A2 (en) | 2001-05-24 | 2002-11-28 | Zymogenetics, Inc. | Taci-immunoglobulin fusion proteins |
WO2002098358A2 (en) | 2001-06-04 | 2002-12-12 | Eos Biotechnology, Inc. | Methods of diagnosis and treatment of androgen-dependent prostate cancer, prostate cancer undergoing androgen-withdrawal, and androgen-independent prostate cancer |
WO2002099074A2 (en) | 2001-06-05 | 2002-12-12 | Exelixis, Inc. | Slc7s as modifiers of the p53 pathway and methods of use |
WO2002099122A1 (en) | 2001-06-05 | 2002-12-12 | Exelixis, Inc. | Modifiers of the p53 pathway and methods of use |
US20020193567A1 (en) | 1995-08-11 | 2002-12-19 | Genetics Institute, Inc. | Secreted proteins and polynucleotides encoding them |
WO2002101075A2 (en) | 2001-06-13 | 2002-12-19 | Millennium Pharmaceuticals, Inc. | Novel genes, compositions, kits, and methods for identification, assessment, prevention, and therapy of cervical cancer |
WO2002102235A2 (en) | 2001-06-18 | 2002-12-27 | Eos Biotechnology Inc. | Methods of diagnosis of ovarian cancer, compositions and methods of screening for modulators of ovarian cancer |
WO2003000842A2 (en) | 2001-06-04 | 2003-01-03 | Curagen Corporation | Novel proteins and nucleic acids encoding same |
WO2003002717A2 (en) | 2001-06-28 | 2003-01-09 | Schering Corporation | Biological activity of ak155 |
WO2003003906A2 (en) | 2001-07-03 | 2003-01-16 | Eos Biotechnology, Inc. | Diagnostic and screening methods for bladder cancer |
WO2003004529A2 (en) | 2001-07-02 | 2003-01-16 | Licentia Ltd. | Ephrin-tie receptor materials and methods |
WO2003004989A2 (en) | 2001-06-21 | 2003-01-16 | Millennium Pharmaceuticals, Inc. | Compositions, kits, and methods for identification, assessment, prevention, and therapy of breast cancer |
WO2003003984A2 (en) | 2001-07-05 | 2003-01-16 | Curagen Corporation | Novel proteins and nucleic acids encoding same |
WO2003009814A2 (en) | 2001-07-25 | 2003-02-06 | Millennium Pharmaceuticals, Inc. | Novel genes, compositions, kits, and methods for identification, assessment, prevention, and therapy of prostate cancer |
US6518404B1 (en) | 1994-10-17 | 2003-02-11 | Human Genome Sciences, Inc. | Human endothelin-bombesin receptor antibodies |
WO2003014294A2 (en) | 2001-08-03 | 2003-02-20 | Genentech, Inc. | Tacis and br3 polypeptides and uses thereof |
WO2003016494A2 (en) | 2001-08-16 | 2003-02-27 | Vitivity, Inc. | Diagnosis and treatment of vascular disease |
WO2003016475A2 (en) | 2001-08-14 | 2003-02-27 | The General Hospital Corporation | Nucleic acid and amino acid sequences involved in pain |
US6528624B1 (en) | 1998-04-02 | 2003-03-04 | Genentech, Inc. | Polypeptide variants |
WO2003018621A2 (en) | 2001-08-23 | 2003-03-06 | Oxford Biomedica (Uk) Limited | Genes |
WO2003023013A2 (en) | 2001-09-13 | 2003-03-20 | Nuvelo, Inc. | Novel nucleic acids and polypeptides |
WO2003022995A2 (en) | 2001-09-06 | 2003-03-20 | Agensys, Inc. | Nucleic acid and corresponding protein entitled steap-1 useful in treatment and detection of cancer |
EP1295944A2 (en) | 1996-03-19 | 2003-03-26 | Otsuka Pharmaceutical Co., Ltd. | GDP dissociation stimulating protein, brain-specific nucleosome assembly protein, skeletal muscle specific ubiquitin-conjugating enzyme, cell proliferation protein, phosphatidylinositolkinase, nel related proteins |
WO2003025228A1 (en) | 2001-09-18 | 2003-03-27 | Proteologics, Inc. | Methods and compositions for treating hcap associated diseases |
WO2003024392A2 (en) | 2001-09-18 | 2003-03-27 | Genentech, Inc. | Compositions and methods for the diagnosis and treatment of tumor |
WO2003025138A2 (en) | 2001-09-17 | 2003-03-27 | Protein Design Labs, Inc. | Methods of diagnosis of cancer compositions and methods of screening for modulators of cancer |
WO2003025148A2 (en) | 2001-09-19 | 2003-03-27 | Nuvelo, Inc. | Novel nucleic acids and polypeptides |
US20030060612A1 (en) | 1997-10-28 | 2003-03-27 | Genentech, Inc. | Compositions and methods for the diagnosis and treatment of tumor |
US20030064397A1 (en) | 1998-05-22 | 2003-04-03 | Incyte Genomics, Inc. | Transmembrane protein differentially expressed in prostate and lung tumors |
US20030065143A1 (en) | 1998-12-30 | 2003-04-03 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
WO2003026577A2 (en) | 2001-09-24 | 2003-04-03 | Seattle Genetics, Inc. | P-amidobenzylethers in drug delivery agents |
WO2003026493A2 (en) | 2001-09-28 | 2003-04-03 | Bing Yang | Diagnosis and treatment of diseases caused by mutations in cd72 |
WO2003029421A2 (en) | 2001-10-03 | 2003-04-10 | Origene Technologies, Inc. | Regulated breast cancer genes |
WO2003029277A2 (en) | 2001-10-03 | 2003-04-10 | Rigel Pharmaceuticals, Inc. | Modulators of lymphocyte activation and migration |
WO2003029262A2 (en) | 2001-08-29 | 2003-04-10 | Vanderbilt University | The human mob-5 (il-24) receptors and uses thereof |
WO2003034984A2 (en) | 2001-10-19 | 2003-05-01 | Genentech, Inc. | Compositions and methods for the diagnosis and treatment of inflammatory bowel disorders |
WO2003035846A2 (en) | 2001-10-24 | 2003-05-01 | National Jewish Medical And Research Center | Structure of tall-1 and its cognate receptor |
US20030091580A1 (en) | 2001-06-18 | 2003-05-15 | Mitcham Jennifer L. | Compositions and methods for the therapy and diagnosis of ovarian cancer |
US20030096961A1 (en) | 2001-06-01 | 2003-05-22 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US20030096743A1 (en) | 2001-09-24 | 2003-05-22 | Seattle Genetics, Inc. | p-Amidobenzylethers in drug delivery agents |
WO2003042661A2 (en) | 2001-11-13 | 2003-05-22 | Protein Design Labs, Inc. | Methods of diagnosis of cancer, compositions and methods of screening for modulators of cancer |
WO2003043583A2 (en) | 2001-11-20 | 2003-05-30 | Seattle Genetics, Inc. | Treatment of immunological disorders using anti-cd30 antibodies |
WO2003045422A1 (en) | 2001-11-29 | 2003-06-05 | Genset S.A. | Agonists and antagonists of prolixin for the treatment of metabolic disorders |
WO2003048202A2 (en) | 2001-12-03 | 2003-06-12 | Asahi Kasei Pharma Corporation | Nf-kappab activating genes |
US20030119126A1 (en) | 2001-01-16 | 2003-06-26 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US20030119125A1 (en) | 2001-01-16 | 2003-06-26 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US20030119121A1 (en) | 2000-09-15 | 2003-06-26 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US20030119129A1 (en) | 1999-08-10 | 2003-06-26 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US20030119122A1 (en) | 1999-05-11 | 2003-06-26 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US20030119130A1 (en) | 1999-08-17 | 2003-06-26 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US20030119131A1 (en) | 2000-01-20 | 2003-06-26 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US20030118592A1 (en) | 2001-01-17 | 2003-06-26 | Genecraft, Inc. | Binding domain-immunoglobulin fusion proteins |
US20030119128A1 (en) | 1999-07-20 | 2003-06-26 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
WO2003054152A2 (en) | 2001-12-10 | 2003-07-03 | Nuvelo, Inc. | Novel nucleic acids and polypeptides |
US20030124579A1 (en) | 2001-09-05 | 2003-07-03 | Eos Biotechnology, Inc. | Methods of diagnosis of ovarian cancer, compositions and methods of screening for modulators of ovarian cancer |
US20030124140A1 (en) | 1998-12-17 | 2003-07-03 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of ovarian cancer |
US20030129192A1 (en) | 1999-09-10 | 2003-07-10 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of ovarian cancer |
WO2003055439A2 (en) | 2001-07-18 | 2003-07-10 | The Regents Of The University Of California | Her2/neu target antigen and use of same to stimulate an immune response |
WO2003055443A2 (en) | 2001-10-31 | 2003-07-10 | Alcon, Inc. | Bone morphogenic proteins (bmp), bmp receptors and bmp binding proteins and their use in the diagnosis and treatment of glaucoma |
US20030134790A1 (en) | 2002-01-11 | 2003-07-17 | University Of Medicine And Dentistry Of New Jersey | Bone Morphogenetic Protein-2 And Bone Morphogenetic Protein-4 In The Treatment And Diagnosis Of Cancer |
WO2003062401A2 (en) | 2002-01-22 | 2003-07-31 | Corixa Corporation | Compositions and methods for the detection, diagnosis and therapy of hematological malignancies |
US20030143557A1 (en) | 2002-01-25 | 2003-07-31 | Reinhold Penner | Methods of screening for TRPM4b modulators |
US6602677B1 (en) | 1997-09-19 | 2003-08-05 | Promega Corporation | Thermostable luciferases and methods of production |
US20030157089A1 (en) | 1997-02-25 | 2003-08-21 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of prostate cancer |
WO2003068144A2 (en) | 2001-12-21 | 2003-08-21 | Immunogen, Inc. | Cytotoxic agents |
WO2003072036A2 (en) | 2002-02-21 | 2003-09-04 | Duke University | Treatment methods using anti-cd22 antibodies |
WO2003072035A2 (en) | 2002-02-22 | 2003-09-04 | Genentech, Inc. | Compositions and methods for the treatment of immune related diseases |
US20030165504A1 (en) | 1999-09-24 | 2003-09-04 | Retter Marc W. | Compositions and methods for the therapy and diagnosis of ovarian cancer |
EP1347046A1 (en) | 2002-03-22 | 2003-09-24 | Research Association for Biotechnology | Full-length cDNA sequences |
WO2003077836A2 (en) | 2001-11-06 | 2003-09-25 | Corixa Corporation | Compositions and methods for the detection, diagnosis and therapy of hematological malignancies |
US20030185830A1 (en) | 1997-02-25 | 2003-10-02 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of prostate cancer |
US20030186372A1 (en) | 2000-02-11 | 2003-10-02 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
WO2003081210A2 (en) | 2002-03-21 | 2003-10-02 | Sunesis Pharmaceuticals, Inc. | Identification of kinase inhibitors |
US6630579B2 (en) | 1999-12-29 | 2003-10-07 | Immunogen Inc. | Cytotoxic agents comprising modified doxorubicins and daunorubicins and their therapeutic use |
WO2003083074A2 (en) | 2002-03-28 | 2003-10-09 | Idec Pharmaceuticals Corporation | Novel gene targets and ligands that bind thereto for treatment and diagnosis of colon carcinomas |
WO2003083041A2 (en) | 2002-03-22 | 2003-10-09 | Biogen, Inc. | Cripto-specific antibodies |
WO2003083047A2 (en) | 2002-03-01 | 2003-10-09 | Exelixis, Inc. | MP53s AS MODIFIERS OF THE p53 PATHWAY AND METHODS OF USE |
US20030194704A1 (en) | 2002-04-03 | 2003-10-16 | Penn Sharron Gaynor | Human genome-derived single exon nucleic acid probes useful for gene expression analysis two |
WO2003087306A2 (en) | 2002-04-05 | 2003-10-23 | Agensys, Inc. | Nucleic acid and corresponding protein entitled 98p4b6 useful in treatment and detection of cancer |
WO2003087768A2 (en) | 2002-04-12 | 2003-10-23 | Mitokor | Targets for therapeutic intervention identified in the mitochondrial proteome |
WO2003089904A2 (en) | 2002-04-17 | 2003-10-30 | Baylor College Of Medicine | Aib1 as a prognostic marker and predictor of resistance to encocrine therapy |
WO2003088808A2 (en) | 2002-04-16 | 2003-10-30 | Genentech, Inc. | Compositions and methods for the diagnosis and treatment of tumor |
WO2003089624A2 (en) | 2002-03-25 | 2003-10-30 | Uab Research Foundation | Fc receptor homolog, reagents, and uses thereof |
US20030206918A1 (en) | 1999-09-10 | 2003-11-06 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of ovarian cancer |
WO2003093444A2 (en) | 2002-05-03 | 2003-11-13 | Incyte Corporation | Transporters and ion channels |
US20030219806A1 (en) | 2000-02-22 | 2003-11-27 | Millennium Pharmaceuticals, Inc. | Novel 18607, 15603, 69318, 12303, 48000, 52920, 5433, 38554, 57301, 58324, 55063, 52991, 59914, 59921 and 33751 molecules and uses therefor |
WO2003097803A2 (en) | 2002-05-15 | 2003-11-27 | Avalon Pharmaceuticals | Cancer-linked gene as target for chemotherapy |
US20030224454A1 (en) | 2002-05-30 | 2003-12-04 | Ryseck Rolf Peter | Human solute carrier family 7, member 11 (hSLC7A11) |
US20030224411A1 (en) | 2003-03-13 | 2003-12-04 | Stanton Lawrence W. | Genes that are up- or down-regulated during differentiation of human embryonic stem cells |
WO2003101283A2 (en) | 2002-06-04 | 2003-12-11 | Incyte Corporation | Diagnostics markers for lung cancer |
WO2003101400A2 (en) | 2002-06-04 | 2003-12-11 | Avalon Pharmaceuticals, Inc. | Cancer-linked gene as target for chemotherapy |
US20030232350A1 (en) | 2001-11-13 | 2003-12-18 | Eos Biotechnology, Inc. | Methods of diagnosis of cancer, compositions and methods of screening for modulators of cancer |
WO2003104275A2 (en) | 2002-06-06 | 2003-12-18 | Oncotherapy Science, Inc. | Genes and polypeptides relating to human colon cancers |
US20030232056A1 (en) | 1999-09-10 | 2003-12-18 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of ovarian cancer |
WO2003104399A2 (en) | 2002-06-07 | 2003-12-18 | Avalon Pharmaceuticals, Inc | Cancer-linked gene as target for chemotherapy |
WO2003104270A2 (en) | 2002-06-06 | 2003-12-18 | Ingenium Pharmaceuticals Ag | Dudulin 2 genes, expression products, non-human animal model: uses in human hematological disease |
WO2003105758A2 (en) | 2002-06-12 | 2003-12-24 | Avalon Pharmaceuticals, Inc. | Cancer-linked gene as target for chemotherapy |
WO2004001004A2 (en) | 2002-06-21 | 2003-12-31 | Johns Hopkins University School Of Medicine | Membrane associated tumor endothelium markers |
WO2004001993A1 (en) | 2002-06-20 | 2003-12-31 | Snaptrack Incorporated | Reducing cross-interference in a combined gps receiver and communication system |
WO2004000221A2 (en) | 2002-06-20 | 2003-12-31 | The Regents Of The University Of California | Compositions and methods for modulating lymphocyte activity |
WO2004000997A2 (en) | 2002-03-19 | 2003-12-31 | Curagen Corporation | Therapeutic polypeptides, nucleic acids encoding same, and methods of use |
US20040001827A1 (en) | 2002-06-28 | 2004-01-01 | Dennis Mark S. | Serum albumin binding peptides for tumor targeting |
US20040005538A1 (en) | 2001-04-11 | 2004-01-08 | Xiaojiang Chen | Three-dimensional structure of complement receptor type 2 and uses thereof |
US20040005563A1 (en) | 2001-06-18 | 2004-01-08 | Eos Biotechnology, Inc. | Methods of diagnosis of ovarian cancer, compositions and methods of screening for modulators of ovarian cancer |
WO2004009622A2 (en) | 2002-07-19 | 2004-01-29 | Cellzome Ag | Protein complexes of cellular networks underlying the development of cancer and other diseases |
US20040022727A1 (en) | 2002-06-18 | 2004-02-05 | Martin Stanton | Aptamer-toxin molecules and methods for using same |
WO2004011611A2 (en) | 2002-07-25 | 2004-02-05 | Genentech, Inc. | Taci antibodies and uses thereof |
WO2004015426A1 (en) | 2002-08-06 | 2004-02-19 | Bayer Healthcare Ag | Diagnostics and therapeutics for diseases associated with human cxc chemokine receptor 5(cxcr5) |
US20040039176A1 (en) | 2002-08-16 | 2004-02-26 | Immunogen, Inc. | Cross-linkers with high reactivity and solubility and their use in the preparation of conjugates for targeted delivery of small molecule drugs |
WO2004016225A2 (en) | 2002-08-19 | 2004-02-26 | Genentech, Inc. | Compositions and methods for the diagnosis and treatment of tumor |
EP1394274A2 (en) | 2002-08-06 | 2004-03-03 | Genox Research, Inc. | Methods of testing for bronchial asthma or chronic obstructive pulmonary disease |
US20040044179A1 (en) | 2000-07-25 | 2004-03-04 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
WO2004020583A2 (en) | 2002-08-27 | 2004-03-11 | Bristol-Myers Squibb Company | Polynucleotide predictor set for identifying protein tyrosine kinase modulators |
WO2004020595A2 (en) | 2002-08-29 | 2004-03-11 | Five Prime Therapeutics, Inc. | Novel human polypeptides encoded by polynucleotides |
WO2004022709A2 (en) | 2002-09-06 | 2004-03-18 | Mannkind Corporation | Epitope sequences |
WO2004022778A1 (en) | 2002-09-05 | 2004-03-18 | Garvan Institute Of Medical Research | Methods of diagnosis and prognosis of ovarian cancer |
WO2004027049A2 (en) | 2002-09-20 | 2004-04-01 | Astral, Inc. | Methods and compositions to generate and control the effector profile of t cells by simultaneous loading and activation of selected subsets of antigen presenting cells |
JP2004113151A (en) | 2002-09-27 | 2004-04-15 | Sankyo Co Ltd | Oncogene and its application |
WO2004031238A2 (en) | 2002-10-03 | 2004-04-15 | Mcgill Univeristy | Antibodies and cyclic peptides which bind cea (carcinoembryonic antigen) and their use as cancer therapeutics |
WO2004032828A2 (en) | 2002-07-31 | 2004-04-22 | Seattle Genetics, Inc. | Anti-cd20 antibody-drug conjugates for the treatment of cancer and immune disorders |
WO2004032842A2 (en) | 2002-10-04 | 2004-04-22 | Van Andel Research Institute | Molecular sub-classification of kidney tumors and the discovery of new diagnostic markers |
WO2004040000A2 (en) | 2002-09-09 | 2004-05-13 | Nura, Inc | G protein coupled receptors and uses thereof |
US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
WO2004042346A2 (en) | 2002-04-24 | 2004-05-21 | Expression Diagnostics, Inc. | Methods and compositions for diagnosing and monitoring transplant rejection |
WO2004044178A2 (en) | 2002-11-13 | 2004-05-27 | Genentech, Inc. | Methods and compositions for diagnosing dysplasia |
WO2004043361A2 (en) | 2002-11-08 | 2004-05-27 | Genentech, Inc. | Compositions and methods for the treatment of natural killer cell related diseases |
WO2004045520A2 (en) | 2002-11-15 | 2004-06-03 | Musc Foundation For Research Development | Complement receptor 2 targeted complement modulators |
WO2004045516A2 (en) | 2002-11-15 | 2004-06-03 | Genentech, Inc. | Compositions and methods for the diagnosis and treatment of tumor |
WO2004045553A2 (en) | 2002-11-15 | 2004-06-03 | The Board Of Trustees Of The University Of Arkansas | Ca125 gene and its use for diagnostic and therapeutic interventions |
WO2004046342A2 (en) | 2002-11-20 | 2004-06-03 | Biogen Idec Inc. | Novel gene targets and ligands that bind thereto for treatment and diagnosis of carcinomas |
WO2004048938A2 (en) | 2002-11-26 | 2004-06-10 | Protein Design Labs, Inc. | Methods of detecting soft tissue sarcoma, compositions and methods of screening for soft tissue sarcoma modulators |
WO2004047749A2 (en) | 2002-11-21 | 2004-06-10 | University Of Utah Research Foundation | Purinergic modulation of smell |
WO2004053079A2 (en) | 2002-12-06 | 2004-06-24 | Diadexus, Inc. | Compositions, splice variants and methods relating to ovarian specific genes and proteins |
WO2004056312A2 (en) | 2002-12-16 | 2004-07-08 | Genentech, Inc. | Immunoglobulin variants and uses thereof |
WO2004058309A1 (en) | 2002-12-23 | 2004-07-15 | Human Genome Sciences, Inc. | Neutrokine-alpha conjugate, neutrokine-alpha complex, and uses thereof |
EP1439393A2 (en) | 2002-12-13 | 2004-07-21 | Bayer Healthcare LLC | Detection methods using TIMP 1 for colon cancer diagnosis |
WO2004063355A2 (en) | 2003-01-10 | 2004-07-29 | Protein Design Labs, Inc. | Novel methods of diagnosis of metastatic cancer, compositions and methods of screening for modulators of matastatic cancer |
WO2004063709A2 (en) | 2003-01-08 | 2004-07-29 | Bristol-Myers Squibb Company | Biomarkers and methods for determining sensitivity to epidermal growth factor receptor modulators |
WO2004063362A2 (en) | 2003-01-10 | 2004-07-29 | Cyclacel Limited | Cell cycle progression proteins |
WO2004065577A2 (en) | 2003-01-14 | 2004-08-05 | Bristol-Myers Squibb Company | Polynucleotides and polypeptides associated with the nf-kb pathway |
WO2004065576A2 (en) | 2003-01-15 | 2004-08-05 | Millennium Pharmaceuticals, Inc. | Methods and compositions for the treatment of urological disorder using differential expressed polypeptides |
WO2004074320A2 (en) | 2003-02-14 | 2004-09-02 | Sagres Discovery, Inc. | Therapeutic targets in cancer |
US20040197325A1 (en) | 2002-12-20 | 2004-10-07 | Debbie Law | Antibodies against GPR64 and uses thereof |
US20040229310A1 (en) | 2003-01-23 | 2004-11-18 | Genentech, Inc. | Methods for producing humanized antibodies and improving yield of antibodies or antigen binding fragments in cell culture |
US20040249130A1 (en) | 2002-06-18 | 2004-12-09 | Martin Stanton | Aptamer-toxin molecules and methods for using same |
US20050014934A1 (en) | 2002-10-15 | 2005-01-20 | Hinton Paul R. | Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis |
US20050048572A1 (en) | 2002-10-31 | 2005-03-03 | Genentech, Inc. | Methods and compositions for increasing antibody production |
WO2005023814A1 (en) | 2003-09-11 | 2005-03-17 | Spirogen Limited | Synthesis of protected pyrrolobenzodiazepines |
US6884874B2 (en) | 2000-09-12 | 2005-04-26 | Smithkline Beecham Corporation | Process and intermediates |
US6884799B2 (en) | 2003-03-31 | 2005-04-26 | Council Of Scientific And Industrial Research | Non-cross-linking pyrrolo[2,1-c][1,4]benzodiazepines and process thereof |
WO2005037992A2 (en) | 2003-10-10 | 2005-04-28 | Immunogen, Inc. | Method of targeting specific cell populations using cell-binding agent maytansinoid conjugates linked via a non-cleavable linker, said conjugates, and methods of making said conjugates |
WO2005100402A1 (en) | 2004-04-13 | 2005-10-27 | F.Hoffmann-La Roche Ag | Anti-p-selectin antibodies |
US20050260186A1 (en) | 2003-03-05 | 2005-11-24 | Halozyme, Inc. | Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminoglycanases |
US20060025576A1 (en) | 2000-04-11 | 2006-02-02 | Genentech, Inc. | Multivalent antibodies and uses therefor |
WO2006029879A2 (en) | 2004-09-17 | 2006-03-23 | F.Hoffmann-La Roche Ag | Anti-ox40l antibodies |
WO2006044908A2 (en) | 2004-10-20 | 2006-04-27 | Genentech, Inc. | Antibody formulation in histidine-acetate buffer |
US20060104968A1 (en) | 2003-03-05 | 2006-05-18 | Halozyme, Inc. | Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminogly ycanases |
US7049311B1 (en) | 1998-08-27 | 2006-05-23 | Spirogen Limited | Pyrrolbenzodiazepines |
WO2007044515A1 (en) | 2005-10-07 | 2007-04-19 | Exelixis, Inc. | Azetidines as mek inhibitors for the treatment of proliferative diseases |
US20080069820A1 (en) | 2006-08-30 | 2008-03-20 | Genentech, Inc. | Multispecific antibodies |
US7371826B2 (en) | 1999-01-15 | 2008-05-13 | Genentech, Inc. | Polypeptide variants with altered effector function |
US7375078B2 (en) | 2004-02-23 | 2008-05-20 | Genentech, Inc. | Heterocyclic self-immolative linkers and conjugates |
WO2009016516A2 (en) | 2007-07-19 | 2009-02-05 | Sanofi-Aventis | Cytotoxic agents comprising new tomaymycin derivatives and their therapeutic use |
US20090036431A1 (en) | 2006-01-25 | 2009-02-05 | Sanofi-Aventis | Cytotoxic Agents Comprising New Tomaymycin Derivatives |
US7498298B2 (en) | 2003-11-06 | 2009-03-03 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
US7511032B2 (en) | 2003-10-22 | 2009-03-31 | The United States Of America As Represented By The Secretary, Department Of Health And Human Services | Pyrrolobenzodiazepine derivatives, compositions comprising the same and methods related thereto |
US7521541B2 (en) | 2004-09-23 | 2009-04-21 | Genetech Inc. | Cysteine engineered antibodies and conjugates |
WO2009052249A1 (en) | 2007-10-19 | 2009-04-23 | Genentech, Inc. | Cysteine engineered anti-tenb2 antibodies and antibody drug conjugates |
US7528126B2 (en) | 2004-03-09 | 2009-05-05 | Spirogen Limited | Pyrrolobenzodiazepines |
US7557099B2 (en) | 2004-03-01 | 2009-07-07 | Spirogen Limited | Pyrrolobenzodiazepines as key intermediates in the synthesis of dimeric cytotoxic pyrrolobenzodiazepines |
US20090182127A1 (en) | 2006-06-22 | 2009-07-16 | Novo Nordisk A/S | Production of Bispecific Antibodies |
WO2009089004A1 (en) | 2008-01-07 | 2009-07-16 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
WO2009099741A1 (en) | 2008-02-01 | 2009-08-13 | Genentech, Inc. | Nemorubicin metabolite and analog reagents, antibody-drug conjugates and methods |
US20090304710A1 (en) | 2006-10-19 | 2009-12-10 | Sanofi-Aventis | Novel anti-cd38 antibodies for the treatment of cancer |
WO2010009124A2 (en) | 2008-07-15 | 2010-01-21 | Genentech, Inc. | Anthracycline derivative conjugates, process for their preparation and their use as antitumor compounds |
US7659241B2 (en) | 2002-07-31 | 2010-02-09 | Seattle Genetics, Inc. | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
US20100047257A1 (en) | 2006-07-18 | 2010-02-25 | Sanofi-Aventis | Antagonist antibody for the treatment of cancer |
US20100111856A1 (en) | 2004-09-23 | 2010-05-06 | Herman Gill | Zirconium-radiolabeled, cysteine engineered antibody conjugates |
US7723485B2 (en) | 2007-05-08 | 2010-05-25 | Genentech, Inc. | Cysteine engineered anti-MUC16 antibodies and antibody drug conjugates |
US20100203007A1 (en) | 2009-02-05 | 2010-08-12 | Immunogen Inc. | Novel benzodiazepine derivatives |
WO2010115629A2 (en) | 2009-04-08 | 2010-10-14 | Deutsches Krebsforschungszentrum | Amatoxin-armed therapeutic cell surface binding components designed for tumour therapy |
US20110256157A1 (en) | 2010-04-15 | 2011-10-20 | Spirogen Limited | Pyrrolobenzodiazepines and conjugates thereof |
US20110287009A1 (en) | 2010-04-23 | 2011-11-24 | Genentech, Inc. | Production of Heteromultimeric Proteins |
US20110301334A1 (en) | 2010-06-08 | 2011-12-08 | Sunil Bhakta | Cysteine engineered antibodies and conjugates |
WO2012041504A1 (en) | 2010-09-30 | 2012-04-05 | Heidelberg Pharma Gmbh | Amatoxin-conjugates with improved linkers |
WO2012106587A1 (en) | 2011-02-04 | 2012-08-09 | Genentech, Inc. | Fc VARIANTS AND METHODS FOR THEIR PRODUCTION |
WO2012119787A1 (en) | 2011-03-10 | 2012-09-13 | Heidelberg Pharma Gmbh | Amatoxin-conjugates with improved linkages |
WO2013055987A1 (en) | 2011-10-14 | 2013-04-18 | Spirogen Sàrl | Pyrrolobenzodiazepines and conjugates thereof |
WO2014043403A1 (en) | 2012-09-12 | 2014-03-20 | Agensys, Inc. | Amatoxin derivatives and cell-permeable conjugates thereof as inhibitors of rna polymerase |
US8697650B2 (en) | 2010-02-16 | 2014-04-15 | Medimmune, Llc | HSA-related compositions and methods of use |
WO2014135282A1 (en) | 2013-03-04 | 2014-09-12 | Heidelberg Pharma Gmbh | Amatoxin derivatives |
WO2015023355A1 (en) | 2013-08-12 | 2015-02-19 | Genentech, Inc. | 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment |
US8969526B2 (en) | 2011-03-29 | 2015-03-03 | Roche Glycart Ag | Antibody Fc variants |
WO2015095227A2 (en) | 2013-12-16 | 2015-06-25 | Genentech, Inc. | Peptidomimetic compounds and antibody-drug conjugates thereof |
WO2015095223A2 (en) | 2013-12-16 | 2015-06-25 | Genentech, Inc. | Peptidomimetic compounds and antibody-drug conjugates thereof |
WO2015095124A1 (en) | 2013-12-16 | 2015-06-25 | Genentech Inc. | Peptidomimetic compounds and antibody-drug conjugates thereof |
Family Cites Families (46)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
GB8720833D0 (en) | 1987-09-04 | 1987-10-14 | Celltech Ltd | Recombinant dna product |
AU4924893A (en) | 1992-09-16 | 1994-04-12 | Galagen, Inc. | Antibody treatment of (helicobacter pylori) |
EP0851924A1 (en) | 1995-09-18 | 1998-07-08 | Intracel Corporation | Neutralizing monoclonal antibodies to respiratory syncytial virus |
US6753165B1 (en) | 1999-01-14 | 2004-06-22 | Bolder Biotechnology, Inc. | Methods for making proteins containing free cysteine residues |
US6248564B1 (en) | 1997-08-29 | 2001-06-19 | Harvard University | Mutant MHC class I molecules |
US7005504B2 (en) | 1998-01-22 | 2006-02-28 | Genentech, Inc. | Antibody fragment-peg conjugates |
US7097840B2 (en) | 2000-03-16 | 2006-08-29 | Genentech, Inc. | Methods of treatment using anti-ErbB antibody-maytansinoid conjugates |
US20040235068A1 (en) | 2001-09-05 | 2004-11-25 | Levinson Arthur D. | Methods for the identification of polypeptide antigens associated with disorders involving aberrant cell proliferation and compositions useful for the treatment of such disorders |
WO2003049704A2 (en) | 2001-12-11 | 2003-06-19 | University Of Massachusetts | Antibodies to treat cancer |
WO2003060080A2 (en) | 2001-12-21 | 2003-07-24 | Idexx Laboratories, Inc. | Canine immunoglobulin variable domains, caninized antibodies, and methods for making and using them |
AU2003253048A1 (en) | 2002-07-09 | 2004-01-23 | Morphochem Aktiengellschaft Fur Kombinatorische Chemie | Tubulysin conjugates |
CA2508519A1 (en) | 2002-12-02 | 2004-06-17 | The Government Of The United States Of America, As Represented By The Se Cretary Of The Department Of Health And Human Services | Recombinant immunotoxin and use in treating tumors |
WO2005092925A2 (en) | 2004-03-24 | 2005-10-06 | Xencor, Inc. | Immunoglobulin variants outside the fc region |
US7662936B2 (en) * | 2004-04-07 | 2010-02-16 | Genentech, Inc. | Mass spectrometry of antibody conjugates |
CN114053429A (en) | 2004-06-01 | 2022-02-18 | 健泰科生物技术公司 | Antibody-drug conjugates and methods |
EA011879B1 (en) | 2004-09-24 | 2009-06-30 | Эмджин Инк. | MODIFIED Fc MOLECULES |
JP2008521828A (en) | 2004-11-29 | 2008-06-26 | シアトル ジェネティックス, インコーポレイテッド | Engineered antibodies and immunoconjugates |
WO2008020827A2 (en) | 2005-08-01 | 2008-02-21 | Biogen Idec Ma Inc. | Altered polypeptides, immunoconjugates thereof, and methods related thereto |
US8008453B2 (en) | 2005-08-12 | 2011-08-30 | Amgen Inc. | Modified Fc molecules |
CN101037475B (en) | 2006-03-15 | 2012-08-15 | 上海中信国健药业股份有限公司 | Chimerical receptor and preparation method and usage |
KR101328756B1 (en) | 2006-05-30 | 2013-11-18 | 제넨테크, 인크. | Antibodies and immunoconjugates and uses therefor |
GB0619291D0 (en) | 2006-09-29 | 2006-11-08 | Ucb Sa | Altered antibodies |
DK2099823T4 (en) | 2006-12-01 | 2022-05-09 | Seagen Inc | Target binding agent variants and uses thereof |
CL2008000420A1 (en) | 2007-02-09 | 2008-06-27 | Genentech Inc | ANTI-BODY ANTIBODY4; AND ITS USE TO MODULATE ANGIOGENESIS. |
PE20090943A1 (en) | 2007-07-16 | 2009-08-05 | Genentech Inc | ANTI-CD79B ANTIBODIES AND IMMUNOCONJUGATES |
CN101802013B (en) | 2007-07-16 | 2014-07-02 | 健泰科生物技术公司 | Humanized anti-CD79b antibodies and immunoconjugates and methods of use |
JP2011509675A (en) | 2008-01-18 | 2011-03-31 | メディミューン,エルエルシー | Cysteine engineered antibodies for site-specific conjugation |
PT2700651T (en) | 2008-07-18 | 2019-06-19 | Bristol Myers Squibb Co | Compositions monovalent for cd28 binding and methods of use |
JP2012521971A (en) | 2009-03-27 | 2012-09-20 | グラクソ グループ リミテッド | Drug fusions and conjugates |
EP2437785B1 (en) | 2009-06-04 | 2015-02-25 | Novartis AG | METHODS FOR IDENTIFICATION OF SITES FOR IgG CONJUGATION |
JP5918129B2 (en) | 2009-06-22 | 2016-05-18 | メディミューン,エルエルシー | Engineered Fc region for site-specific conjugation |
DE102009035875A1 (en) | 2009-08-03 | 2011-02-24 | Dge Dr.-Ing. Günther Engineering Gmbh | Process for the production of biogas or sewage gas |
US8394922B2 (en) | 2009-08-03 | 2013-03-12 | Medarex, Inc. | Antiproliferative compounds, conjugates thereof, methods therefor, and uses thereof |
GB0920127D0 (en) | 2009-11-17 | 2009-12-30 | Ucb Pharma Sa | Antibodies |
EP2554669B1 (en) * | 2010-03-26 | 2018-09-19 | Kyowa Hakko Kirin Co., Ltd. | Novel antibody having modification site introduced therein, and antibody fragment |
US8979373B2 (en) | 2010-07-15 | 2015-03-17 | Thomson Industries, Inc. | Linear motion bearing with interlock structure |
CA2816426A1 (en) * | 2010-11-17 | 2012-06-07 | Genentech, Inc. | Alaninyl maytansinol antibody conjugates |
US11147852B2 (en) * | 2011-12-23 | 2021-10-19 | Pfizer Inc. | Engineered antibody constant regions for site-specific conjugation and methods and uses therefor |
NZ702195A (en) | 2012-05-21 | 2016-09-30 | Genentech Inc | Anti-ly6e antibodies and immunoconjugates and methods of use |
TW201406785A (en) | 2012-07-09 | 2014-02-16 | Genentech Inc | Anti-CD22 antibodies and immunoconjugates |
AR091961A1 (en) | 2012-08-02 | 2015-03-11 | Genentech Inc | IMMUNOCONJUGADOS AND ANTI-ETBR ANTIBODIES (ENDOTHELINE B RECEIVER) |
SG11201506025RA (en) * | 2013-02-08 | 2015-08-28 | Irm Llc | Specific sites for modifying antibodies to make immunoconjugates |
JP6980384B2 (en) | 2013-12-16 | 2021-12-15 | ジェネンテック, インコーポレイテッド | 1- (Chloromethyl) -2,3-dihydro-1H-benzo [E] indole dimer antibody-drug conjugate compound, and methods of use and treatment |
JP6236540B2 (en) | 2014-01-27 | 2017-11-22 | ファイザー・インク | Bifunctional cytotoxic agent |
SG11201701311YA (en) | 2014-09-11 | 2017-03-30 | Seattle Genetics Inc | Targeted delivery of tertiary amine-containing drug substances |
US9518118B2 (en) * | 2014-09-12 | 2016-12-13 | Genentech, Inc. | Anti-HER2 antibodies and immunoconjugates |
-
2015
- 2015-09-11 RU RU2017107502A patent/RU2017107502A/en not_active Application Discontinuation
- 2015-09-11 AR ARP150102905A patent/AR101844A1/en unknown
- 2015-09-11 AU AU2015314826A patent/AU2015314826A1/en not_active Abandoned
- 2015-09-11 TW TW104130168A patent/TW201625688A/en unknown
- 2015-09-11 EP EP15771364.5A patent/EP3191521A2/en not_active Withdrawn
- 2015-09-11 BR BR112017003236A patent/BR112017003236A2/en not_active IP Right Cessation
- 2015-09-11 MX MX2017003123A patent/MX2017003123A/en unknown
- 2015-09-11 KR KR1020177008038A patent/KR20170052600A/en unknown
- 2015-09-11 SG SG11201701128YA patent/SG11201701128YA/en unknown
- 2015-09-11 EP EP17198468.5A patent/EP3388449A3/en not_active Withdrawn
- 2015-09-11 US US14/851,348 patent/US10077318B2/en active Active
- 2015-09-11 CA CA2957354A patent/CA2957354A1/en not_active Abandoned
- 2015-09-11 WO PCT/US2015/049771 patent/WO2016040856A2/en active Application Filing
- 2015-09-11 CN CN201580054050.0A patent/CN107108724A/en active Pending
- 2015-09-11 JP JP2017513087A patent/JP2017531620A/en active Pending
-
2017
- 2017-02-05 IL IL250449A patent/IL250449A0/en unknown
- 2017-02-07 ZA ZA2017/00944A patent/ZA201700944B/en unknown
-
2018
- 2018-02-23 HK HK18102603.5A patent/HK1243103A1/en unknown
-
2019
- 2019-03-14 US US16/353,207 patent/US20200017601A1/en not_active Abandoned
-
2020
- 2020-04-22 JP JP2020076110A patent/JP2020143067A/en active Pending
- 2020-12-18 JP JP2020209885A patent/JP2021073176A/en active Pending
-
2022
- 2022-05-13 US US17/743,727 patent/US20230130874A1/en active Pending
- 2022-06-14 JP JP2022095359A patent/JP2022137034A/en active Pending
Patent Citations (397)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4307016A (en) | 1978-03-24 | 1981-12-22 | Takeda Chemical Industries, Ltd. | Demethyl maytansinoids |
US4361650A (en) | 1978-03-24 | 1982-11-30 | Takeda Chemical Industries, Ltd. | Fermentation process of preparing demethyl maytansinoids |
US4318980A (en) | 1978-04-10 | 1982-03-09 | Miles Laboratories, Inc. | Heterogenous specific binding assay employing a cycling reactant as label |
US4256746A (en) | 1978-11-14 | 1981-03-17 | Takeda Chemical Industries | Dechloromaytansinoids, their pharmaceutical compositions and method of use |
US4275149A (en) | 1978-11-24 | 1981-06-23 | Syva Company | Macromolecular environment control in specific receptor assays |
US4294757A (en) | 1979-01-31 | 1981-10-13 | Takeda Chemical Industries, Ltd | 20-O-Acylmaytansinoids |
US4322348A (en) | 1979-06-05 | 1982-03-30 | Takeda Chemical Industries, Ltd. | Maytansinoids |
US4331598A (en) | 1979-09-19 | 1982-05-25 | Takeda Chemical Industries, Ltd. | Maytansinoids |
US4362663A (en) | 1979-09-21 | 1982-12-07 | Takeda Chemical Industries, Ltd. | Maytansinoid compound |
US4364866A (en) | 1979-09-21 | 1982-12-21 | Takeda Chemical Industries, Ltd. | Maytansinoids |
US4458066A (en) | 1980-02-29 | 1984-07-03 | University Patents, Inc. | Process for preparing polynucleotides |
US4371533A (en) | 1980-10-08 | 1983-02-01 | Takeda Chemical Industries, Ltd. | 4,5-Deoxymaytansinoids, their use and pharmaceutical compositions thereof |
US4450254A (en) | 1980-11-03 | 1984-05-22 | Standard Oil Company | Impact improvement of high nitrile resins |
US4315929A (en) | 1981-01-27 | 1982-02-16 | The United States Of America As Represented By The Secretary Of Agriculture | Method of controlling the European corn borer with trewiasine |
US4313946A (en) | 1981-01-27 | 1982-02-02 | The United States Of America As Represented By The Secretary Of Agriculture | Chemotherapeutically active maytansinoids from Trewia nudiflora |
US4415732A (en) | 1981-03-27 | 1983-11-15 | University Patents, Inc. | Phosphoramidite compounds and processes |
US4424219A (en) | 1981-05-20 | 1984-01-03 | Takeda Chemical Industries, Ltd. | 9-Thiomaytansinoids and their pharmaceutical compositions and use |
US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
JPH053790B2 (en) | 1983-11-02 | 1993-01-18 | Canon Kk | |
US5807715A (en) | 1984-08-27 | 1998-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin |
US5428155A (en) | 1984-10-18 | 1995-06-27 | Board Of Regents, The University Of Texas System | Synthesis of polyazamacrocycles with more than one type of side-chain chelating groups |
US5342606A (en) | 1984-10-18 | 1994-08-30 | Board Of Regents, The University Of Texas System | Polyazamacrocyclic compounds for complexation of metal ions |
US5316757A (en) | 1984-10-18 | 1994-05-31 | Board Of Regents, The University Of Texas System | Synthesis of polyazamacrocycles with more than one type of side-chain chelating groups |
US4737456A (en) | 1985-05-09 | 1988-04-12 | Syntex (U.S.A.) Inc. | Reducing interference in ligand-receptor binding assays |
US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
US5583024A (en) | 1985-12-02 | 1996-12-10 | The Regents Of The University Of California | Recombinant expression of Coleoptera luciferase |
US5674713A (en) | 1985-12-02 | 1997-10-07 | The Regents Of The University Of California | DNA sequences encoding coleoptera luciferase activity |
US5091178A (en) | 1986-02-21 | 1992-02-25 | Oncogen | Tumor therapy with biologically active anti-tumor antibodies |
US5500362A (en) | 1987-01-08 | 1996-03-19 | Xoma Corporation | Chimeric antibody with specificity to human B cell surface antigen |
US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
US5648260A (en) | 1987-03-18 | 1997-07-15 | Scotgen Biopharmaceuticals Incorporated | DNA encoding antibodies with altered effector functions |
US5770701A (en) | 1987-10-30 | 1998-06-23 | American Cyanamid Company | Process for preparing targeted forms of methyltrithio antitumor agents |
US5770710A (en) | 1987-10-30 | 1998-06-23 | American Cyanamid Company | Antitumor and antibacterial substituted disulfide derivatives prepared from compounds possessing a methlytrithio group |
US5677171A (en) | 1988-01-12 | 1997-10-14 | Genentech, Inc. | Monoclonal antibodies directed to the HER2 receptor |
EP0328147A2 (en) | 1988-02-11 | 1989-08-16 | Bristol-Myers Squibb Company | Anthracycline immunoconjugates having a novel linker and methods for their production |
WO1991002536A1 (en) | 1989-08-23 | 1991-03-07 | Scripps Clinic And Research Foundation | Compositions and methods for detection and treatment of epstein-barr virus infection and immune disorders |
US5416064A (en) | 1989-10-25 | 1995-05-16 | Immunogen, Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
US5792616A (en) | 1990-05-29 | 1998-08-11 | The United States Of America | Antibodies to human cripto protein |
WO1992007574A1 (en) | 1990-10-25 | 1992-05-14 | Tanox Biosystems, Inc. | Glycoproteins associated with membrane-bound immunoglobulins as antibody targets on b cells |
US5571894A (en) | 1991-02-05 | 1996-11-05 | Ciba-Geigy Corporation | Recombinant antibodies specific for a growth factor receptor |
US5440021A (en) | 1991-03-29 | 1995-08-08 | Chuntharapai; Anan | Antibodies to human IL-8 type B receptor |
WO1992017497A1 (en) | 1991-03-29 | 1992-10-15 | Genentech, Inc. | Human pf4a receptors and their use |
US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
US6407213B1 (en) | 1991-06-14 | 2002-06-18 | Genentech, Inc. | Method for making humanized antibodies |
EP0522868A1 (en) | 1991-07-12 | 1993-01-13 | SHIONOGI SEIYAKU KABUSHIKI KAISHA trading under the name of SHIONOGI & CO. LTD. | A human endothelin receptor |
US5854399A (en) | 1991-08-23 | 1998-12-29 | The United States Of America As Represented By The Department Of Health And Human Services | Antibodies specific for human cripto-related polypeptide CR-3 |
US5587458A (en) | 1991-10-07 | 1996-12-24 | Aronex Pharmaceuticals, Inc. | Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof |
WO1993008829A1 (en) | 1991-11-04 | 1993-05-13 | The Regents Of The University Of California | Compositions that mediate killing of hiv-infected cells |
US5976551A (en) | 1991-11-15 | 1999-11-02 | Institut Pasteur And Institut Nationale De La Sante Et De La Recherche Medicale | Altered major histocompatibility complex (MHC) determinant and method of using the determinant |
US6153408A (en) | 1991-11-15 | 2000-11-28 | Institut Pasteur And Institut National De La Sante Et De La Recherche Medicale | Altered major histocompatibility complex (MHC) determinant and methods of using the determinant |
US6011146A (en) | 1991-11-15 | 2000-01-04 | Institut Pasteur | Altered major histocompatibility complex (MHC) determinant and methods of using the determinant |
US5739294A (en) | 1991-12-10 | 1998-04-14 | The Dow Chemical Company | Bicyclopol yazamacrocyclophosphonic acid complexes for use as contrast agents |
US5428139A (en) | 1991-12-10 | 1995-06-27 | The Dow Chemical Company | Bicyclopolyazamacrocyclophosphonic acid complexes for use as radiopharmaceuticals |
US5480990A (en) | 1991-12-10 | 1996-01-02 | The Dow Chemical Company | Bicyclopolyazamacrocyclocarboxylic acid complexes for use as contrast agents |
US5750660A (en) | 1991-12-10 | 1998-05-12 | The Dow Chemical Company | Bicyclopolyazamacrocyclophosphonic acid half esters |
WO1993016185A2 (en) | 1992-02-06 | 1993-08-19 | Creative Biomolecules, Inc. | Biosynthetic binding protein for cancer marker |
WO1993021319A1 (en) | 1992-04-08 | 1993-10-28 | Cetus Oncology Corporation | HUMANIZED C-erbB-2 SPECIFIC ANTIBODIES |
WO1993021232A1 (en) | 1992-04-10 | 1993-10-28 | Research Development Foundation | IMMUNOTOXINS DIRECTED AGAINST c-erbB-2 (HER-2/neu) RELATED SURFACE ANTIGENS |
WO1994010312A1 (en) | 1992-10-23 | 1994-05-11 | Chugai Seiyaku Kabushiki Kaisha | Gene coding for megakaryocyte potentiator |
WO1994011026A2 (en) | 1992-11-13 | 1994-05-26 | Idec Pharmaceuticals Corporation | Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma |
US5635483A (en) | 1992-12-03 | 1997-06-03 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Tumor inhibiting tetrapeptide bearing modified phenethyl amides |
US5644033A (en) | 1992-12-22 | 1997-07-01 | Health Research, Inc. | Monoclonal antibodies that define a unique antigen of human B cell antigen receptor complex and methods of using same for diagnosis and treatment |
US5780588A (en) | 1993-01-26 | 1998-07-14 | Arizona Board Of Regents | Elucidation and synthesis of selected pentapeptides |
US5869445A (en) | 1993-03-17 | 1999-02-09 | University Of Washington | Methods for eliciting or enhancing reactivity to HER-2/neu protein |
US5385893A (en) | 1993-05-06 | 1995-01-31 | The Dow Chemical Company | Tricyclopolyazamacrocyclophosphonic acids, complexes and derivatives thereof, for use as contrast agents |
US5462725A (en) | 1993-05-06 | 1995-10-31 | The Dow Chemical Company | 2-pyridylmethylenepolyazamacrocyclophosphonic acids, complexes and derivatives thereof, for use as contrast agents |
US6214345B1 (en) | 1993-05-14 | 2001-04-10 | Bristol-Myers Squibb Co. | Lysosomal enzyme-cleavable antitumor drug conjugates |
WO1994028931A1 (en) | 1993-06-11 | 1994-12-22 | Genentech, Inc. | Methods for treating inflammatory disorders |
WO1994029351A2 (en) | 1993-06-16 | 1994-12-22 | Celltech Limited | Antibodies |
US5773223A (en) | 1993-09-02 | 1998-06-30 | Chiron Corporation | Endothelin B1, (ETB1) receptor polypeptide and its encoding nucleic acid methods, and uses thereof |
US6124431A (en) | 1993-10-01 | 2000-09-26 | Teikoku Hormone Mfg. Co., Ltd. | Peptide derivatives |
US5767237A (en) | 1993-10-01 | 1998-06-16 | Teikoku Hormone Mfg. Co., Ltd. | Peptide derivatives |
US5739116A (en) | 1994-06-03 | 1998-04-14 | American Cyanamid Company | Enediyne derivatives useful for the synthesis of conjugates of methyltrithio antitumor agents |
US5773001A (en) | 1994-06-03 | 1998-06-30 | American Cyanamid Company | Conjugates of methyltrithio antitumor agents and intermediates for their synthesis |
US5877296A (en) | 1994-06-03 | 1999-03-02 | American Cyanamid Company | Process for preparing conjugates of methyltrithio antitumor agents |
US5767285A (en) | 1994-06-03 | 1998-06-16 | American Cyanamid Company | Linkers useful for the synthesis of conjugates of methyltrithio antitumor agents |
US20030109676A1 (en) | 1994-10-17 | 2003-06-12 | Human Genome Sciences, Inc. | Human endothelin-bombesin receptor |
US6518404B1 (en) | 1994-10-17 | 2003-02-11 | Human Genome Sciences, Inc. | Human endothelin-bombesin receptor antibodies |
US5663149A (en) | 1994-12-13 | 1997-09-02 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide heterocyclic and halophenyl amides |
WO1996027011A1 (en) | 1995-03-01 | 1996-09-06 | Genentech, Inc. | A method for making heteromultimeric polypeptides |
US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
WO1996030514A1 (en) | 1995-03-31 | 1996-10-03 | University Of Washington | Intracellular domain of the her-2/neu protein for prevention or treatment of malignancies |
US5700670A (en) | 1995-04-13 | 1997-12-23 | Mitsubishi Chemical Corporation | Method for producing optically active ester of γ-substituted-β-hydroxybutyric acid |
US5712374A (en) | 1995-06-07 | 1998-01-27 | American Cyanamid Company | Method for the preparation of substantiallly monomeric calicheamicin derivative/carrier conjugates |
US5714586A (en) | 1995-06-07 | 1998-02-03 | American Cyanamid Company | Methods for the preparation of monomeric calicheamicin derivative/carrier conjugates |
US6267958B1 (en) | 1995-07-27 | 2001-07-31 | Genentech, Inc. | Protein formulation |
WO1997007198A2 (en) | 1995-08-11 | 1997-02-27 | Genetics Institute, Inc. | Dna sequences and secreted proteins encoded thereby |
US20020193567A1 (en) | 1995-08-11 | 2002-12-19 | Genetics Institute, Inc. | Secreted proteins and polynucleotides encoding them |
US5834456A (en) | 1996-02-23 | 1998-11-10 | The Dow Chemical Company | Polyazamacrocyclofluoromonoalkylphosphonic acids, and their complexes, for use as contrast agents |
EP1295944A2 (en) | 1996-03-19 | 2003-03-26 | Otsuka Pharmaceutical Co., Ltd. | GDP dissociation stimulating protein, brain-specific nucleosome assembly protein, skeletal muscle specific ubiquitin-conjugating enzyme, cell proliferation protein, phosphatidylinositolkinase, nel related proteins |
WO1997044452A1 (en) | 1996-05-17 | 1997-11-27 | Schering Corporation | Human b-cell antigens, related reagents |
WO1998037193A1 (en) | 1997-02-20 | 1998-08-27 | Zymogenetics, Inc. | Zcytor7 cytokine receptor |
US20030157089A1 (en) | 1997-02-25 | 2003-08-21 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of prostate cancer |
US20030185830A1 (en) | 1997-02-25 | 2003-10-02 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of prostate cancer |
US20010055751A1 (en) | 1997-03-10 | 2001-12-27 | Reiter Robert E | PSCA: Prostate stem cell antigen and uses thereof |
WO1998040403A1 (en) | 1997-03-10 | 1998-09-17 | The Regents Of The University Of California | Psca: prostate stem cell antigen |
WO1998045479A1 (en) | 1997-04-04 | 1998-10-15 | Albany Medical College | Method for assessing prostate cancer |
US6555339B1 (en) | 1997-04-14 | 2003-04-29 | Arena Pharmaceuticals, Inc. | Non-endogenous, constitutively activated human protein-coupled receptors |
US20030105292A1 (en) | 1997-04-14 | 2003-06-05 | Liaw Chen W. | Non-endogenous, constitutively activated human G protein-coupled receptors |
EP0875569A1 (en) | 1997-04-28 | 1998-11-04 | Smithkline Beecham Corporation | A human sodium dependent phosphate transporter (IPT-1) |
US20070178552A1 (en) | 1997-05-02 | 2007-08-02 | Genentech, Inc. | Method for Making Multispecific Antibodies Having Heteromultimeric and Common Components |
WO1998050431A2 (en) | 1997-05-02 | 1998-11-12 | Genentech, Inc. | A method for making multispecific antibodies having heteromultimeric and common components |
WO1998051824A1 (en) | 1997-05-15 | 1998-11-19 | Abbott Laboratories | Reagents and methods useful for detecting disease of the urinary tract |
US20040018553A1 (en) | 1997-05-15 | 2004-01-29 | Patricia A. Billing-Medel | Reagents and methods useful for detecting diseases of the prostate |
WO1998051805A1 (en) | 1997-05-15 | 1998-11-19 | Abbott Laboratories | Reagents and methods useful for detecting diseases of the prostate |
US6171586B1 (en) | 1997-06-13 | 2001-01-09 | Genentech, Inc. | Antibody formulation |
US6602677B1 (en) | 1997-09-19 | 2003-08-05 | Promega Corporation | Thermostable luciferases and methods of production |
US20030060612A1 (en) | 1997-10-28 | 2003-03-27 | Genentech, Inc. | Compositions and methods for the diagnosis and treatment of tumor |
US20020034749A1 (en) | 1997-11-18 | 2002-03-21 | Billing-Medel Patricia A. | Reagents and methods useful for detecting diseases of the breast |
WO1999028468A1 (en) | 1997-12-02 | 1999-06-10 | The Regents Of The University Of California | Modulating b lymphocyte chemokine/receptor interactions |
WO1999046284A2 (en) | 1998-03-13 | 1999-09-16 | The Burnham Institute | Molecules that home to various selected organs or tissues |
US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
WO1999051642A1 (en) | 1998-04-02 | 1999-10-14 | Genentech, Inc. | Antibody variants and fragments thereof |
US6528624B1 (en) | 1998-04-02 | 2003-03-04 | Genentech, Inc. | Polypeptide variants |
WO1999058658A2 (en) | 1998-05-13 | 1999-11-18 | Epimmune, Inc. | Expression vectors for stimulating an immune response and methods of using the same |
US6534482B1 (en) | 1998-05-13 | 2003-03-18 | Epimmune, Inc. | Expression vectors for stimulating an immune response and methods of using the same |
US20030064397A1 (en) | 1998-05-22 | 2003-04-03 | Incyte Genomics, Inc. | Transmembrane protein differentially expressed in prostate and lung tumors |
WO2000012130A1 (en) | 1998-08-27 | 2000-03-09 | Smithkline Beecham Corporation | Rp105 agonists and antagonists |
US7049311B1 (en) | 1998-08-27 | 2006-05-23 | Spirogen Limited | Pyrrolbenzodiazepines |
US7067511B2 (en) | 1998-08-27 | 2006-06-27 | Spirogen Limited | Pyrrolobenzodiazepines |
WO2000012507A2 (en) | 1998-08-27 | 2000-03-09 | Spirogen Limited | Pyrrolobenzodiazepines |
US7265105B2 (en) | 1998-08-27 | 2007-09-04 | Spirogen Limited | Pyrrolobenzodiazepines |
WO2000014228A1 (en) | 1998-09-03 | 2000-03-16 | Japan Science And Technology Corporation | Neutral amino acid transporter and gene thereof |
WO2000020579A1 (en) | 1998-10-02 | 2000-04-13 | Mcmaster University | Spliced form of erbb-2/neu oncogene |
WO2000022129A1 (en) | 1998-10-13 | 2000-04-20 | Arena Pharmaceuticals, Inc. | Non-endogenous, constitutively activated human g protein-coupled receptors |
WO2000032752A1 (en) | 1998-12-02 | 2000-06-08 | The Regents Of The University Of California | Psca: prostate stem cell antigen and uses thereof |
WO2000036107A2 (en) | 1998-12-17 | 2000-06-22 | Corixa Corporation | Compositions and methods for therapy and diagnosis of ovarian cancer |
US20030124140A1 (en) | 1998-12-17 | 2003-07-03 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of ovarian cancer |
US20030065143A1 (en) | 1998-12-30 | 2003-04-03 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
WO2000040614A2 (en) | 1998-12-30 | 2000-07-13 | Beth Israel Deaconess Medical Center, Inc. | Characterization of the soc/crac calcium channel protein family |
US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
US7332581B2 (en) | 1999-01-15 | 2008-02-19 | Genentech, Inc. | Polypeptide variants with altered effector function |
US7371826B2 (en) | 1999-01-15 | 2008-05-13 | Genentech, Inc. | Polypeptide variants with altered effector function |
WO2000044899A1 (en) | 1999-01-29 | 2000-08-03 | Corixa Corporation | Her-2/neu fusion proteins |
WO2000053216A2 (en) | 1999-03-05 | 2000-09-14 | Smithkline Beecham Biologicals S.A. | Use of casb616 polypeptides and polynucleotides for cancer treatment |
WO2000055351A1 (en) | 1999-03-12 | 2000-09-21 | Human Genome Sciences, Inc. | Human colon cancer associated gene sequences and polypeptides |
US20030119122A1 (en) | 1999-05-11 | 2003-06-26 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
WO2000075655A1 (en) | 1999-06-03 | 2000-12-14 | Takeda Chemical Industries, Ltd. | Screening method with the use of cd100 |
WO2001000245A2 (en) | 1999-06-25 | 2001-01-04 | Genentech, Inc. | HUMANIZED ANTI-ErbB2 ANTIBODIES AND TREATMENT WITH ANTI-ErbB2 ANTIBODIES |
WO2001000244A2 (en) | 1999-06-25 | 2001-01-04 | Genentech, Inc. | METHODS OF TREATMENT USING ANTI-ErbB ANTIBODY-MAYTANSINOID CONJUGATES |
US20030119128A1 (en) | 1999-07-20 | 2003-06-26 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US20030119129A1 (en) | 1999-08-10 | 2003-06-26 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US20030119130A1 (en) | 1999-08-17 | 2003-06-26 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
WO2001016318A2 (en) | 1999-09-01 | 2001-03-08 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US20030206918A1 (en) | 1999-09-10 | 2003-11-06 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of ovarian cancer |
US20030129192A1 (en) | 1999-09-10 | 2003-07-10 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of ovarian cancer |
US20030232056A1 (en) | 1999-09-10 | 2003-12-18 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of ovarian cancer |
US20030165504A1 (en) | 1999-09-24 | 2003-09-04 | Retter Marc W. | Compositions and methods for the therapy and diagnosis of ovarian cancer |
WO2001024763A2 (en) | 1999-10-01 | 2001-04-12 | Immunogen, Inc. | Compositions and methods for treating cancer using immunoconjugates and chemotherapeutic agents |
WO2001040309A2 (en) | 1999-10-29 | 2001-06-07 | Genentech, Inc. | Anti-prostate stem cell antigen (psca) antibody compositions and methods of use |
WO2001038490A2 (en) | 1999-11-29 | 2001-05-31 | The Trustees Of Columbia University In The City Of New York | ISOLATION OF FIVE NOVEL GENES CODING FOR NEW Fc RECEPTORS-TYPE MELANOMA INVOLVED IN THE PATHOGENESIS OF LYMPHOMA/MELANOMA |
WO2001040269A2 (en) | 1999-11-30 | 2001-06-07 | Corixa Corporation | Compositions and methods for therapy and diagnosis of breast cancer |
US20040101899A1 (en) | 1999-11-30 | 2004-05-27 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of breast cancer |
WO2001041787A1 (en) | 1999-12-10 | 2001-06-14 | Epimmune Inc. | INDUCING CELLULAR IMMUNE RESPONSES TO HER2/neu USING PEPTIDE AND NUCLEIC ACID COMPOSITIONS |
WO2001048204A1 (en) | 1999-12-23 | 2001-07-05 | Agresearch Limited | Mutated bmp1b receptor as regulator of ovulation rate |
WO2001046261A1 (en) | 1999-12-23 | 2001-06-28 | Zymogenetics, Inc. | Method for treating inflammation |
WO2001046232A2 (en) | 1999-12-23 | 2001-06-28 | Zymogenetics, Inc. | Soluble interleukin-20 receptor |
US20040005320A1 (en) | 1999-12-23 | 2004-01-08 | Penny Thompson | Method for treating inflammation |
US20020042366A1 (en) | 1999-12-23 | 2002-04-11 | Penny Thompson | Method for treating inflammation |
WO2001045746A2 (en) | 1999-12-24 | 2001-06-28 | Genentech, Inc. | Methods and compositions for prolonging elimination half-times of bioactive compounds |
US6630579B2 (en) | 1999-12-29 | 2003-10-07 | Immunogen Inc. | Cytotoxic agents comprising modified doxorubicins and daunorubicins and their therapeutic use |
US20030119131A1 (en) | 2000-01-20 | 2003-06-26 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
WO2001053463A2 (en) | 2000-01-21 | 2001-07-26 | Corixa Corporation | COMPOUNDS AND METHODS FOR PREVENTION AND TREATMENT OF HER-2/neu ASSOCIATED MALIGNANCIES |
WO2001057188A2 (en) | 2000-02-03 | 2001-08-09 | Hyseq, Inc. | Novel nucleic acids and polypeptides |
US20030186372A1 (en) | 2000-02-11 | 2003-10-02 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
WO2001062794A2 (en) | 2000-02-22 | 2001-08-30 | Millennium Pharmaceuticals, Inc. | 18607, a human calcium channel |
US20030219806A1 (en) | 2000-02-22 | 2003-11-27 | Millennium Pharmaceuticals, Inc. | Novel 18607, 15603, 69318, 12303, 48000, 52920, 5433, 38554, 57301, 58324, 55063, 52991, 59914, 59921 and 33751 molecules and uses therefor |
WO2001066689A2 (en) | 2000-03-07 | 2001-09-13 | Hyseq, Inc. | Novel nucleic acids and polypeptides |
WO2001072962A2 (en) | 2000-03-24 | 2001-10-04 | Fahri Saatcioglu | Novel prostate-specific or testis-specific nucleic acid molecules, polypeptides, and diagnostic and therapeutic methods |
WO2001072830A2 (en) | 2000-03-31 | 2001-10-04 | Ipf Pharmaceuticals Gmbh | Diagnostic and medicament for analysing the cell surface proteome of tumour and inflammatory cells and for treating tumorous and inflammatory diseases, preferably using a specific chemokine receptor analysis and the chemokine receptor-ligand interaction |
WO2001075177A2 (en) | 2000-04-03 | 2001-10-11 | The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Tumor markers in ovarian cancer |
WO2001077172A2 (en) | 2000-04-07 | 2001-10-18 | Arena Pharmaceuticals, Inc. | Non-endogenous, constitutively activated known g protein-coupled receptors |
US20060025576A1 (en) | 2000-04-11 | 2006-02-02 | Genentech, Inc. | Multivalent antibodies and uses therefor |
WO2001088133A2 (en) | 2000-05-18 | 2001-11-22 | Lexicon Genetics Incorporated | Human semaphorin homologs and polynucleotides encoding the same |
WO2001090304A2 (en) | 2000-05-19 | 2001-11-29 | Human Genome Sciences, Inc. | Nucleic acids, proteins, and antibodies |
WO2001094641A2 (en) | 2000-06-09 | 2001-12-13 | Idec Pharmaceuticals Corporation | Gene targets and ligands that bind thereto for treatment and diagnosis of ovarian carcinomas |
WO2001098351A2 (en) | 2000-06-16 | 2001-12-27 | Incyte Genomics, Inc. | G-protein coupled receptors |
WO2002002587A1 (en) | 2000-06-30 | 2002-01-10 | Human Genome Sciences, Inc. | B7-like polynucleotides, polypeptides, and antibodies |
WO2002002624A2 (en) | 2000-06-30 | 2002-01-10 | Amgen, Inc. | B7-like molecules and uses thereof |
WO2002002634A2 (en) | 2000-06-30 | 2002-01-10 | Incyte Genomics, Inc. | Human extracellular matrix and cell adhesion polypeptides |
WO2002006339A2 (en) | 2000-07-03 | 2002-01-24 | Curagen Corporation | Proteins and nucleic acids encoding same |
WO2002006317A2 (en) | 2000-07-17 | 2002-01-24 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of ovarian cancer |
US20040044179A1 (en) | 2000-07-25 | 2004-03-04 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
WO2002010187A1 (en) | 2000-07-27 | 2002-02-07 | Mayo Foundation For Medical Education And Research | B7-h3 and b7-h4, novel immunoregulatory molecules |
WO2002010382A2 (en) | 2000-07-28 | 2002-02-07 | Ulrich Wissenbach | Trp8, trp9 and trp10, markers for cancer |
WO2002012341A2 (en) | 2000-08-03 | 2002-02-14 | Corixa Corporation | Her-2/neu fusion proteins |
WO2002014503A2 (en) | 2000-08-14 | 2002-02-21 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of her-2/neu-associated malignancies |
WO2002013847A2 (en) | 2000-08-14 | 2002-02-21 | Corixa Corporation | Methods for diagnosis and therapy of hematological and virus-associated malignancies |
WO2002016429A2 (en) | 2000-08-24 | 2002-02-28 | Genentech, Inc. | Compositions and methods for the diagnosis and treatment of tumor |
WO2002016413A2 (en) | 2000-08-24 | 2002-02-28 | Glaxosmithkline Biologicals S.A. | Cripto tumour polypeptide |
WO2002022660A2 (en) | 2000-09-11 | 2002-03-21 | Hyseq, Inc. | Novel nucleic acids and polypeptides |
US6884874B2 (en) | 2000-09-12 | 2005-04-26 | Smithkline Beecham Corporation | Process and intermediates |
WO2002022636A1 (en) | 2000-09-15 | 2002-03-21 | Isis Pharmaceuticals, Inc. | Antisense modulation of her-2 expression |
US20030186373A1 (en) | 2000-09-15 | 2003-10-02 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US20030119121A1 (en) | 2000-09-15 | 2003-06-26 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
WO2002022153A2 (en) | 2000-09-15 | 2002-03-21 | Zymogenetics, Inc. | Use of a polypeptide comprising the extracellular domains of il-20rb for the treatment of inflammation |
WO2002024909A2 (en) | 2000-09-18 | 2002-03-28 | Biogen, Inc. | Receptor nucleic acids and polypeptides |
WO2002022808A2 (en) | 2000-09-18 | 2002-03-21 | Biogen, Inc. | Cripto mutant and uses thereof |
US20040005598A1 (en) | 2000-09-26 | 2004-01-08 | Genentech, Inc. | PUMPCn compositions and uses thereof |
WO2002026822A2 (en) | 2000-09-26 | 2002-04-04 | Genentech, Inc. | Pumpcn compositions and uses thereof |
WO2002030268A2 (en) | 2000-10-13 | 2002-04-18 | Eos Biotechnology, Inc. | Methods of diagnosis of prostate cancer, compositions and methods of screening for modulators of prostate cancer |
WO2002038766A2 (en) | 2000-11-07 | 2002-05-16 | Zymogenetics, Inc. | Human tumor necrosis factor receptor |
US20020150573A1 (en) | 2000-11-10 | 2002-10-17 | The Rockefeller University | Anti-Igalpha-Igbeta antibody for lymphoma therapy |
WO2002061087A2 (en) | 2000-12-19 | 2002-08-08 | Lifespan Biosciences, Inc. | Antigenic peptides, such as for g protein-coupled receptors (gpcrs), antibodies thereto, and systems for identifying such antigenic peptides |
WO2002054940A2 (en) | 2001-01-12 | 2002-07-18 | University Of Medicine & Dentistry Of New Jersey | Bone morphogenetic protein-2 in the treatment and diagnosis of cancer |
US20030119126A1 (en) | 2001-01-16 | 2003-06-26 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US20030119125A1 (en) | 2001-01-16 | 2003-06-26 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US20030118592A1 (en) | 2001-01-17 | 2003-06-26 | Genecraft, Inc. | Binding domain-immunoglobulin fusion proteins |
WO2002059377A2 (en) | 2001-01-24 | 2002-08-01 | Protein Design Labs | Methods of diagnosis of breast cancer, compositions and methods of screening for modulators of breast cancer |
WO2002060317A2 (en) | 2001-01-30 | 2002-08-08 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of pancreatic cancer |
WO2002064798A1 (en) | 2001-02-12 | 2002-08-22 | Bionomics Limited | Dna sequences differentially expressed in tumour cell lines |
WO2002072596A1 (en) | 2001-03-09 | 2002-09-19 | Incyte Genomics, Inc. | Steap-related protein |
WO2002071928A2 (en) | 2001-03-14 | 2002-09-19 | Millennium Pharmaceuticals, Inc. | Nucleic acid molecules and proteins for the identification, assessment, prevention, and therapy of ovarian cancer |
WO2002078524A2 (en) | 2001-03-28 | 2002-10-10 | Zycos Inc. | Translational profiling |
WO2002081646A2 (en) | 2001-04-06 | 2002-10-17 | Mannkind Corporation | Epitope sequences |
WO2003008537A2 (en) | 2001-04-06 | 2003-01-30 | Mannkind Corporation | Epitope sequences |
US20040005538A1 (en) | 2001-04-11 | 2004-01-08 | Xiaojiang Chen | Three-dimensional structure of complement receptor type 2 and uses thereof |
WO2002083866A2 (en) | 2001-04-17 | 2002-10-24 | The Board Of Trustees Of The University Of Arkansas | Repeat sequences of the ca125 gene and their use for diagnostic and therapeutic interventions |
WO2002086443A2 (en) | 2001-04-18 | 2002-10-31 | Protein Design Labs, Inc | Methods of diagnosis of lung cancer, compositions and methods of screening for modulators of lung cancer |
WO2002088170A2 (en) | 2001-04-26 | 2002-11-07 | Biogen, Inc. | Cripto blocking antibodies and uses thereof |
WO2002088172A2 (en) | 2001-04-30 | 2002-11-07 | Seattle Genetics, Inc. | Pentapeptide compounds and uses related thereto |
WO2002089747A2 (en) | 2001-05-09 | 2002-11-14 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of prostate cancer |
WO2002092836A2 (en) | 2001-05-11 | 2002-11-21 | Sloan-Kettering Institute For Cancer Research | Nucleic acid sequence encoding ovarian antigen, ca125, and uses thereof |
WO2002094852A2 (en) | 2001-05-24 | 2002-11-28 | Zymogenetics, Inc. | Taci-immunoglobulin fusion proteins |
US6441163B1 (en) | 2001-05-31 | 2002-08-27 | Immunogen, Inc. | Methods for preparation of cytotoxic conjugates of maytansinoids and cell binding agents |
US20030096961A1 (en) | 2001-06-01 | 2003-05-22 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US20040044180A1 (en) | 2001-06-01 | 2004-03-04 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
WO2003000842A2 (en) | 2001-06-04 | 2003-01-03 | Curagen Corporation | Novel proteins and nucleic acids encoding same |
WO2002098358A2 (en) | 2001-06-04 | 2002-12-12 | Eos Biotechnology, Inc. | Methods of diagnosis and treatment of androgen-dependent prostate cancer, prostate cancer undergoing androgen-withdrawal, and androgen-independent prostate cancer |
WO2002099074A2 (en) | 2001-06-05 | 2002-12-12 | Exelixis, Inc. | Slc7s as modifiers of the p53 pathway and methods of use |
WO2002099122A1 (en) | 2001-06-05 | 2002-12-12 | Exelixis, Inc. | Modifiers of the p53 pathway and methods of use |
WO2002101075A2 (en) | 2001-06-13 | 2002-12-19 | Millennium Pharmaceuticals, Inc. | Novel genes, compositions, kits, and methods for identification, assessment, prevention, and therapy of cervical cancer |
US20030091580A1 (en) | 2001-06-18 | 2003-05-15 | Mitcham Jennifer L. | Compositions and methods for the therapy and diagnosis of ovarian cancer |
US20040005563A1 (en) | 2001-06-18 | 2004-01-08 | Eos Biotechnology, Inc. | Methods of diagnosis of ovarian cancer, compositions and methods of screening for modulators of ovarian cancer |
WO2002102235A2 (en) | 2001-06-18 | 2002-12-27 | Eos Biotechnology Inc. | Methods of diagnosis of ovarian cancer, compositions and methods of screening for modulators of ovarian cancer |
WO2003004989A2 (en) | 2001-06-21 | 2003-01-16 | Millennium Pharmaceuticals, Inc. | Compositions, kits, and methods for identification, assessment, prevention, and therapy of breast cancer |
WO2003002717A2 (en) | 2001-06-28 | 2003-01-09 | Schering Corporation | Biological activity of ak155 |
WO2003004529A2 (en) | 2001-07-02 | 2003-01-16 | Licentia Ltd. | Ephrin-tie receptor materials and methods |
WO2003003906A2 (en) | 2001-07-03 | 2003-01-16 | Eos Biotechnology, Inc. | Diagnostic and screening methods for bladder cancer |
WO2003003984A2 (en) | 2001-07-05 | 2003-01-16 | Curagen Corporation | Novel proteins and nucleic acids encoding same |
WO2003055439A2 (en) | 2001-07-18 | 2003-07-10 | The Regents Of The University Of California | Her2/neu target antigen and use of same to stimulate an immune response |
WO2003009814A2 (en) | 2001-07-25 | 2003-02-06 | Millennium Pharmaceuticals, Inc. | Novel genes, compositions, kits, and methods for identification, assessment, prevention, and therapy of prostate cancer |
WO2003014294A2 (en) | 2001-08-03 | 2003-02-20 | Genentech, Inc. | Tacis and br3 polypeptides and uses thereof |
WO2003016475A2 (en) | 2001-08-14 | 2003-02-27 | The General Hospital Corporation | Nucleic acid and amino acid sequences involved in pain |
WO2003016494A2 (en) | 2001-08-16 | 2003-02-27 | Vitivity, Inc. | Diagnosis and treatment of vascular disease |
WO2003018621A2 (en) | 2001-08-23 | 2003-03-06 | Oxford Biomedica (Uk) Limited | Genes |
WO2003029262A2 (en) | 2001-08-29 | 2003-04-10 | Vanderbilt University | The human mob-5 (il-24) receptors and uses thereof |
US20030124579A1 (en) | 2001-09-05 | 2003-07-03 | Eos Biotechnology, Inc. | Methods of diagnosis of ovarian cancer, compositions and methods of screening for modulators of ovarian cancer |
WO2003022995A2 (en) | 2001-09-06 | 2003-03-20 | Agensys, Inc. | Nucleic acid and corresponding protein entitled steap-1 useful in treatment and detection of cancer |
WO2003023013A2 (en) | 2001-09-13 | 2003-03-20 | Nuvelo, Inc. | Novel nucleic acids and polypeptides |
WO2003025138A2 (en) | 2001-09-17 | 2003-03-27 | Protein Design Labs, Inc. | Methods of diagnosis of cancer compositions and methods of screening for modulators of cancer |
WO2003025228A1 (en) | 2001-09-18 | 2003-03-27 | Proteologics, Inc. | Methods and compositions for treating hcap associated diseases |
WO2003024392A2 (en) | 2001-09-18 | 2003-03-27 | Genentech, Inc. | Compositions and methods for the diagnosis and treatment of tumor |
WO2003025148A2 (en) | 2001-09-19 | 2003-03-27 | Nuvelo, Inc. | Novel nucleic acids and polypeptides |
US20030130189A1 (en) | 2001-09-24 | 2003-07-10 | Senter Peter D. | P-amidobenzylethers in drug delivery agents |
WO2003026577A2 (en) | 2001-09-24 | 2003-04-03 | Seattle Genetics, Inc. | P-amidobenzylethers in drug delivery agents |
US20030096743A1 (en) | 2001-09-24 | 2003-05-22 | Seattle Genetics, Inc. | p-Amidobenzylethers in drug delivery agents |
WO2003026493A2 (en) | 2001-09-28 | 2003-04-03 | Bing Yang | Diagnosis and treatment of diseases caused by mutations in cd72 |
WO2003029421A2 (en) | 2001-10-03 | 2003-04-10 | Origene Technologies, Inc. | Regulated breast cancer genes |
WO2003029277A2 (en) | 2001-10-03 | 2003-04-10 | Rigel Pharmaceuticals, Inc. | Modulators of lymphocyte activation and migration |
WO2003034984A2 (en) | 2001-10-19 | 2003-05-01 | Genentech, Inc. | Compositions and methods for the diagnosis and treatment of inflammatory bowel disorders |
WO2003035846A2 (en) | 2001-10-24 | 2003-05-01 | National Jewish Medical And Research Center | Structure of tall-1 and its cognate receptor |
WO2003055443A2 (en) | 2001-10-31 | 2003-07-10 | Alcon, Inc. | Bone morphogenic proteins (bmp), bmp receptors and bmp binding proteins and their use in the diagnosis and treatment of glaucoma |
WO2003077836A2 (en) | 2001-11-06 | 2003-09-25 | Corixa Corporation | Compositions and methods for the detection, diagnosis and therapy of hematological malignancies |
US20030232350A1 (en) | 2001-11-13 | 2003-12-18 | Eos Biotechnology, Inc. | Methods of diagnosis of cancer, compositions and methods of screening for modulators of cancer |
WO2003042661A2 (en) | 2001-11-13 | 2003-05-22 | Protein Design Labs, Inc. | Methods of diagnosis of cancer, compositions and methods of screening for modulators of cancer |
WO2003043583A2 (en) | 2001-11-20 | 2003-05-30 | Seattle Genetics, Inc. | Treatment of immunological disorders using anti-cd30 antibodies |
WO2003045422A1 (en) | 2001-11-29 | 2003-06-05 | Genset S.A. | Agonists and antagonists of prolixin for the treatment of metabolic disorders |
WO2003048202A2 (en) | 2001-12-03 | 2003-06-12 | Asahi Kasei Pharma Corporation | Nf-kappab activating genes |
WO2003054152A2 (en) | 2001-12-10 | 2003-07-03 | Nuvelo, Inc. | Novel nucleic acids and polypeptides |
WO2003068144A2 (en) | 2001-12-21 | 2003-08-21 | Immunogen, Inc. | Cytotoxic agents |
US20040001838A1 (en) | 2001-12-21 | 2004-01-01 | Immunogen, Inc. | Cytotoxic agents bearing a reactive polyethylene glycol moiety, cytotoxic conjugates comprising polyethylene glycol linking groups, and methods of making and using the same |
US20030134790A1 (en) | 2002-01-11 | 2003-07-17 | University Of Medicine And Dentistry Of New Jersey | Bone Morphogenetic Protein-2 And Bone Morphogenetic Protein-4 In The Treatment And Diagnosis Of Cancer |
WO2003062401A2 (en) | 2002-01-22 | 2003-07-31 | Corixa Corporation | Compositions and methods for the detection, diagnosis and therapy of hematological malignancies |
US20030143557A1 (en) | 2002-01-25 | 2003-07-31 | Reinhold Penner | Methods of screening for TRPM4b modulators |
WO2003072036A2 (en) | 2002-02-21 | 2003-09-04 | Duke University | Treatment methods using anti-cd22 antibodies |
WO2003072035A2 (en) | 2002-02-22 | 2003-09-04 | Genentech, Inc. | Compositions and methods for the treatment of immune related diseases |
WO2003083047A2 (en) | 2002-03-01 | 2003-10-09 | Exelixis, Inc. | MP53s AS MODIFIERS OF THE p53 PATHWAY AND METHODS OF USE |
WO2004000997A2 (en) | 2002-03-19 | 2003-12-31 | Curagen Corporation | Therapeutic polypeptides, nucleic acids encoding same, and methods of use |
WO2003081210A2 (en) | 2002-03-21 | 2003-10-02 | Sunesis Pharmaceuticals, Inc. | Identification of kinase inhibitors |
EP1347046A1 (en) | 2002-03-22 | 2003-09-24 | Research Association for Biotechnology | Full-length cDNA sequences |
WO2003083041A2 (en) | 2002-03-22 | 2003-10-09 | Biogen, Inc. | Cripto-specific antibodies |
WO2003089624A2 (en) | 2002-03-25 | 2003-10-30 | Uab Research Foundation | Fc receptor homolog, reagents, and uses thereof |
WO2003083074A2 (en) | 2002-03-28 | 2003-10-09 | Idec Pharmaceuticals Corporation | Novel gene targets and ligands that bind thereto for treatment and diagnosis of colon carcinomas |
US20030194704A1 (en) | 2002-04-03 | 2003-10-16 | Penn Sharron Gaynor | Human genome-derived single exon nucleic acid probes useful for gene expression analysis two |
WO2003087306A2 (en) | 2002-04-05 | 2003-10-23 | Agensys, Inc. | Nucleic acid and corresponding protein entitled 98p4b6 useful in treatment and detection of cancer |
WO2003087768A2 (en) | 2002-04-12 | 2003-10-23 | Mitokor | Targets for therapeutic intervention identified in the mitochondrial proteome |
US20040101874A1 (en) | 2002-04-12 | 2004-05-27 | Mitokor Inc. | Targets for therapeutic intervention identified in the mitochondrial proteome |
WO2003088808A2 (en) | 2002-04-16 | 2003-10-30 | Genentech, Inc. | Compositions and methods for the diagnosis and treatment of tumor |
US20030228319A1 (en) | 2002-04-16 | 2003-12-11 | Genentech, Inc. | Compositions and methods for the diagnosis and treatment of tumor |
WO2003089904A2 (en) | 2002-04-17 | 2003-10-30 | Baylor College Of Medicine | Aib1 as a prognostic marker and predictor of resistance to encocrine therapy |
WO2004042346A2 (en) | 2002-04-24 | 2004-05-21 | Expression Diagnostics, Inc. | Methods and compositions for diagnosing and monitoring transplant rejection |
WO2003093444A2 (en) | 2002-05-03 | 2003-11-13 | Incyte Corporation | Transporters and ion channels |
WO2003097803A2 (en) | 2002-05-15 | 2003-11-27 | Avalon Pharmaceuticals | Cancer-linked gene as target for chemotherapy |
US20030224454A1 (en) | 2002-05-30 | 2003-12-04 | Ryseck Rolf Peter | Human solute carrier family 7, member 11 (hSLC7A11) |
WO2003101283A2 (en) | 2002-06-04 | 2003-12-11 | Incyte Corporation | Diagnostics markers for lung cancer |
WO2003101400A2 (en) | 2002-06-04 | 2003-12-11 | Avalon Pharmaceuticals, Inc. | Cancer-linked gene as target for chemotherapy |
WO2003104275A2 (en) | 2002-06-06 | 2003-12-18 | Oncotherapy Science, Inc. | Genes and polypeptides relating to human colon cancers |
WO2003104270A2 (en) | 2002-06-06 | 2003-12-18 | Ingenium Pharmaceuticals Ag | Dudulin 2 genes, expression products, non-human animal model: uses in human hematological disease |
WO2003104399A2 (en) | 2002-06-07 | 2003-12-18 | Avalon Pharmaceuticals, Inc | Cancer-linked gene as target for chemotherapy |
WO2003105758A2 (en) | 2002-06-12 | 2003-12-24 | Avalon Pharmaceuticals, Inc. | Cancer-linked gene as target for chemotherapy |
US20040249130A1 (en) | 2002-06-18 | 2004-12-09 | Martin Stanton | Aptamer-toxin molecules and methods for using same |
US20040022727A1 (en) | 2002-06-18 | 2004-02-05 | Martin Stanton | Aptamer-toxin molecules and methods for using same |
WO2004000221A2 (en) | 2002-06-20 | 2003-12-31 | The Regents Of The University Of California | Compositions and methods for modulating lymphocyte activity |
WO2004001993A1 (en) | 2002-06-20 | 2003-12-31 | Snaptrack Incorporated | Reducing cross-interference in a combined gps receiver and communication system |
WO2004001004A2 (en) | 2002-06-21 | 2003-12-31 | Johns Hopkins University School Of Medicine | Membrane associated tumor endothelium markers |
US20040001827A1 (en) | 2002-06-28 | 2004-01-01 | Dennis Mark S. | Serum albumin binding peptides for tumor targeting |
WO2004009622A2 (en) | 2002-07-19 | 2004-01-29 | Cellzome Ag | Protein complexes of cellular networks underlying the development of cancer and other diseases |
WO2004011611A2 (en) | 2002-07-25 | 2004-02-05 | Genentech, Inc. | Taci antibodies and uses thereof |
WO2004032828A2 (en) | 2002-07-31 | 2004-04-22 | Seattle Genetics, Inc. | Anti-cd20 antibody-drug conjugates for the treatment of cancer and immune disorders |
US7659241B2 (en) | 2002-07-31 | 2010-02-09 | Seattle Genetics, Inc. | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
EP1394274A2 (en) | 2002-08-06 | 2004-03-03 | Genox Research, Inc. | Methods of testing for bronchial asthma or chronic obstructive pulmonary disease |
WO2004015426A1 (en) | 2002-08-06 | 2004-02-19 | Bayer Healthcare Ag | Diagnostics and therapeutics for diseases associated with human cxc chemokine receptor 5(cxcr5) |
WO2004016801A2 (en) | 2002-08-16 | 2004-02-26 | Immunogen, Inc. | Cross-linkers with high reactivity and solubility and their use in the preparation of conjugates for targeted delivery of small molecule drugs |
US20040039176A1 (en) | 2002-08-16 | 2004-02-26 | Immunogen, Inc. | Cross-linkers with high reactivity and solubility and their use in the preparation of conjugates for targeted delivery of small molecule drugs |
WO2004016225A2 (en) | 2002-08-19 | 2004-02-26 | Genentech, Inc. | Compositions and methods for the diagnosis and treatment of tumor |
WO2004020583A2 (en) | 2002-08-27 | 2004-03-11 | Bristol-Myers Squibb Company | Polynucleotide predictor set for identifying protein tyrosine kinase modulators |
WO2004020595A2 (en) | 2002-08-29 | 2004-03-11 | Five Prime Therapeutics, Inc. | Novel human polypeptides encoded by polynucleotides |
WO2004022778A1 (en) | 2002-09-05 | 2004-03-18 | Garvan Institute Of Medical Research | Methods of diagnosis and prognosis of ovarian cancer |
WO2004022709A2 (en) | 2002-09-06 | 2004-03-18 | Mannkind Corporation | Epitope sequences |
WO2004040000A2 (en) | 2002-09-09 | 2004-05-13 | Nura, Inc | G protein coupled receptors and uses thereof |
WO2004027049A2 (en) | 2002-09-20 | 2004-04-01 | Astral, Inc. | Methods and compositions to generate and control the effector profile of t cells by simultaneous loading and activation of selected subsets of antigen presenting cells |
JP2004113151A (en) | 2002-09-27 | 2004-04-15 | Sankyo Co Ltd | Oncogene and its application |
WO2004031238A2 (en) | 2002-10-03 | 2004-04-15 | Mcgill Univeristy | Antibodies and cyclic peptides which bind cea (carcinoembryonic antigen) and their use as cancer therapeutics |
WO2004032842A2 (en) | 2002-10-04 | 2004-04-22 | Van Andel Research Institute | Molecular sub-classification of kidney tumors and the discovery of new diagnostic markers |
US20050014934A1 (en) | 2002-10-15 | 2005-01-20 | Hinton Paul R. | Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis |
US20050048572A1 (en) | 2002-10-31 | 2005-03-03 | Genentech, Inc. | Methods and compositions for increasing antibody production |
WO2004043361A2 (en) | 2002-11-08 | 2004-05-27 | Genentech, Inc. | Compositions and methods for the treatment of natural killer cell related diseases |
WO2004044178A2 (en) | 2002-11-13 | 2004-05-27 | Genentech, Inc. | Methods and compositions for diagnosing dysplasia |
WO2004045553A2 (en) | 2002-11-15 | 2004-06-03 | The Board Of Trustees Of The University Of Arkansas | Ca125 gene and its use for diagnostic and therapeutic interventions |
WO2004045520A2 (en) | 2002-11-15 | 2004-06-03 | Musc Foundation For Research Development | Complement receptor 2 targeted complement modulators |
WO2004045516A2 (en) | 2002-11-15 | 2004-06-03 | Genentech, Inc. | Compositions and methods for the diagnosis and treatment of tumor |
WO2004046342A2 (en) | 2002-11-20 | 2004-06-03 | Biogen Idec Inc. | Novel gene targets and ligands that bind thereto for treatment and diagnosis of carcinomas |
WO2004047749A2 (en) | 2002-11-21 | 2004-06-10 | University Of Utah Research Foundation | Purinergic modulation of smell |
WO2004048938A2 (en) | 2002-11-26 | 2004-06-10 | Protein Design Labs, Inc. | Methods of detecting soft tissue sarcoma, compositions and methods of screening for soft tissue sarcoma modulators |
WO2004053079A2 (en) | 2002-12-06 | 2004-06-24 | Diadexus, Inc. | Compositions, splice variants and methods relating to ovarian specific genes and proteins |
EP1439393A2 (en) | 2002-12-13 | 2004-07-21 | Bayer Healthcare LLC | Detection methods using TIMP 1 for colon cancer diagnosis |
WO2004056312A2 (en) | 2002-12-16 | 2004-07-08 | Genentech, Inc. | Immunoglobulin variants and uses thereof |
US20040197325A1 (en) | 2002-12-20 | 2004-10-07 | Debbie Law | Antibodies against GPR64 and uses thereof |
WO2004058309A1 (en) | 2002-12-23 | 2004-07-15 | Human Genome Sciences, Inc. | Neutrokine-alpha conjugate, neutrokine-alpha complex, and uses thereof |
WO2004063709A2 (en) | 2003-01-08 | 2004-07-29 | Bristol-Myers Squibb Company | Biomarkers and methods for determining sensitivity to epidermal growth factor receptor modulators |
WO2004063362A2 (en) | 2003-01-10 | 2004-07-29 | Cyclacel Limited | Cell cycle progression proteins |
WO2004063355A2 (en) | 2003-01-10 | 2004-07-29 | Protein Design Labs, Inc. | Novel methods of diagnosis of metastatic cancer, compositions and methods of screening for modulators of matastatic cancer |
WO2004065577A2 (en) | 2003-01-14 | 2004-08-05 | Bristol-Myers Squibb Company | Polynucleotides and polypeptides associated with the nf-kb pathway |
WO2004065576A2 (en) | 2003-01-15 | 2004-08-05 | Millennium Pharmaceuticals, Inc. | Methods and compositions for the treatment of urological disorder using differential expressed polypeptides |
US20040229310A1 (en) | 2003-01-23 | 2004-11-18 | Genentech, Inc. | Methods for producing humanized antibodies and improving yield of antibodies or antigen binding fragments in cell culture |
WO2004074320A2 (en) | 2003-02-14 | 2004-09-02 | Sagres Discovery, Inc. | Therapeutic targets in cancer |
US20050260186A1 (en) | 2003-03-05 | 2005-11-24 | Halozyme, Inc. | Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminoglycanases |
US20060104968A1 (en) | 2003-03-05 | 2006-05-18 | Halozyme, Inc. | Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminogly ycanases |
US20030224411A1 (en) | 2003-03-13 | 2003-12-04 | Stanton Lawrence W. | Genes that are up- or down-regulated during differentiation of human embryonic stem cells |
US6884799B2 (en) | 2003-03-31 | 2005-04-26 | Council Of Scientific And Industrial Research | Non-cross-linking pyrrolo[2,1-c][1,4]benzodiazepines and process thereof |
WO2005023814A1 (en) | 2003-09-11 | 2005-03-17 | Spirogen Limited | Synthesis of protected pyrrolobenzodiazepines |
WO2005037992A2 (en) | 2003-10-10 | 2005-04-28 | Immunogen, Inc. | Method of targeting specific cell populations using cell-binding agent maytansinoid conjugates linked via a non-cleavable linker, said conjugates, and methods of making said conjugates |
US20050169933A1 (en) | 2003-10-10 | 2005-08-04 | Immunogen, Inc. | Method of targeting specific cell populations using cell-binding agent maytansinoid conjugates linked via a non-cleavable linker, said conjugates, and methods of making said conjugates |
US7511032B2 (en) | 2003-10-22 | 2009-03-31 | The United States Of America As Represented By The Secretary, Department Of Health And Human Services | Pyrrolobenzodiazepine derivatives, compositions comprising the same and methods related thereto |
US7498298B2 (en) | 2003-11-06 | 2009-03-03 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
US7375078B2 (en) | 2004-02-23 | 2008-05-20 | Genentech, Inc. | Heterocyclic self-immolative linkers and conjugates |
US7557099B2 (en) | 2004-03-01 | 2009-07-07 | Spirogen Limited | Pyrrolobenzodiazepines as key intermediates in the synthesis of dimeric cytotoxic pyrrolobenzodiazepines |
US7528126B2 (en) | 2004-03-09 | 2009-05-05 | Spirogen Limited | Pyrrolobenzodiazepines |
WO2005100402A1 (en) | 2004-04-13 | 2005-10-27 | F.Hoffmann-La Roche Ag | Anti-p-selectin antibodies |
WO2006029879A2 (en) | 2004-09-17 | 2006-03-23 | F.Hoffmann-La Roche Ag | Anti-ox40l antibodies |
US7521541B2 (en) | 2004-09-23 | 2009-04-21 | Genetech Inc. | Cysteine engineered antibodies and conjugates |
US20100111856A1 (en) | 2004-09-23 | 2010-05-06 | Herman Gill | Zirconium-radiolabeled, cysteine engineered antibody conjugates |
WO2006044908A2 (en) | 2004-10-20 | 2006-04-27 | Genentech, Inc. | Antibody formulation in histidine-acetate buffer |
WO2007044515A1 (en) | 2005-10-07 | 2007-04-19 | Exelixis, Inc. | Azetidines as mek inhibitors for the treatment of proliferative diseases |
US20090036431A1 (en) | 2006-01-25 | 2009-02-05 | Sanofi-Aventis | Cytotoxic Agents Comprising New Tomaymycin Derivatives |
US20090182127A1 (en) | 2006-06-22 | 2009-07-16 | Novo Nordisk A/S | Production of Bispecific Antibodies |
US20100047257A1 (en) | 2006-07-18 | 2010-02-25 | Sanofi-Aventis | Antagonist antibody for the treatment of cancer |
US20080069820A1 (en) | 2006-08-30 | 2008-03-20 | Genentech, Inc. | Multispecific antibodies |
US20090304710A1 (en) | 2006-10-19 | 2009-12-10 | Sanofi-Aventis | Novel anti-cd38 antibodies for the treatment of cancer |
US7723485B2 (en) | 2007-05-08 | 2010-05-25 | Genentech, Inc. | Cysteine engineered anti-MUC16 antibodies and antibody drug conjugates |
WO2009016516A2 (en) | 2007-07-19 | 2009-02-05 | Sanofi-Aventis | Cytotoxic agents comprising new tomaymycin derivatives and their therapeutic use |
WO2009052249A1 (en) | 2007-10-19 | 2009-04-23 | Genentech, Inc. | Cysteine engineered anti-tenb2 antibodies and antibody drug conjugates |
WO2009089004A1 (en) | 2008-01-07 | 2009-07-16 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
WO2009099741A1 (en) | 2008-02-01 | 2009-08-13 | Genentech, Inc. | Nemorubicin metabolite and analog reagents, antibody-drug conjugates and methods |
US20110076287A1 (en) | 2008-02-01 | 2011-03-31 | Robert L Cohen | Nemorubicin metabolite and analog reagents, antibody-drug conjugates and methods |
WO2010009124A2 (en) | 2008-07-15 | 2010-01-21 | Genentech, Inc. | Anthracycline derivative conjugates, process for their preparation and their use as antitumor compounds |
US20100034837A1 (en) | 2008-07-15 | 2010-02-11 | Italo Beria | Anthracycline derivative conjugates, process for their preparation and their use as antitumor compounds |
US20100203007A1 (en) | 2009-02-05 | 2010-08-12 | Immunogen Inc. | Novel benzodiazepine derivatives |
WO2010115629A2 (en) | 2009-04-08 | 2010-10-14 | Deutsches Krebsforschungszentrum | Amatoxin-armed therapeutic cell surface binding components designed for tumour therapy |
US8697650B2 (en) | 2010-02-16 | 2014-04-15 | Medimmune, Llc | HSA-related compositions and methods of use |
US20110256157A1 (en) | 2010-04-15 | 2011-10-20 | Spirogen Limited | Pyrrolobenzodiazepines and conjugates thereof |
WO2011130598A1 (en) | 2010-04-15 | 2011-10-20 | Spirogen Limited | Pyrrolobenzodiazepines and conjugates thereof |
US20110287009A1 (en) | 2010-04-23 | 2011-11-24 | Genentech, Inc. | Production of Heteromultimeric Proteins |
US20110301334A1 (en) | 2010-06-08 | 2011-12-08 | Sunil Bhakta | Cysteine engineered antibodies and conjugates |
WO2012041504A1 (en) | 2010-09-30 | 2012-04-05 | Heidelberg Pharma Gmbh | Amatoxin-conjugates with improved linkers |
WO2012106587A1 (en) | 2011-02-04 | 2012-08-09 | Genentech, Inc. | Fc VARIANTS AND METHODS FOR THEIR PRODUCTION |
WO2012119787A1 (en) | 2011-03-10 | 2012-09-13 | Heidelberg Pharma Gmbh | Amatoxin-conjugates with improved linkages |
US8969526B2 (en) | 2011-03-29 | 2015-03-03 | Roche Glycart Ag | Antibody Fc variants |
WO2013055987A1 (en) | 2011-10-14 | 2013-04-18 | Spirogen Sàrl | Pyrrolobenzodiazepines and conjugates thereof |
WO2014043403A1 (en) | 2012-09-12 | 2014-03-20 | Agensys, Inc. | Amatoxin derivatives and cell-permeable conjugates thereof as inhibitors of rna polymerase |
WO2014135282A1 (en) | 2013-03-04 | 2014-09-12 | Heidelberg Pharma Gmbh | Amatoxin derivatives |
WO2015023355A1 (en) | 2013-08-12 | 2015-02-19 | Genentech, Inc. | 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment |
WO2015095227A2 (en) | 2013-12-16 | 2015-06-25 | Genentech, Inc. | Peptidomimetic compounds and antibody-drug conjugates thereof |
WO2015095223A2 (en) | 2013-12-16 | 2015-06-25 | Genentech, Inc. | Peptidomimetic compounds and antibody-drug conjugates thereof |
WO2015095124A1 (en) | 2013-12-16 | 2015-06-25 | Genentech Inc. | Peptidomimetic compounds and antibody-drug conjugates thereof |
Non-Patent Citations (376)
Title |
---|
"Current Protocols in Immunology", vol. 1, 2, 1991, WILEY-INTERSCIENCE |
"McGraw-Hill Dictionary of Chemical Terms", 1984, MCGRAW-HILL BOOK COMPANY |
"Monoclonal Antibodies in Immunoscintigraphy", 1989, CRC PRESS |
"Remington's Pharmaceutical Sciences", 1980 |
AJANI ET AL., CANCER JOUR., vol. 6, 2000, pages 78 - 81 |
ALBERT ET AL., BIOORG. MED. CHEM. LETT., vol. 8, 1998, pages 1207 - 1210 |
ALLEY, S.C. ET AL.: "Controlling the location of drug attachment in antibody-drug conjugates", AMERICAN ASSOCIATION FOR CANCER RESEARCH, 2004 ANNUAL MEETING, MARCH 27-31, 2004, PROCEEDINGS OF THE AACR, vol. 45, 27 March 2004 (2004-03-27) |
AM. J. HUM. GENET., vol. 49, no. 3, 1991, pages 555 - 565 |
AMIEL J. ET AL., HUM. MOL. GENET., vol. 5, 1996, pages 355 - 357 |
AMIR ET AL., ANGEW. CHEM. INT. ED., vol. 42, 2003, pages 4494 - 4499 |
AMSBERRY ET AL., J. ORG. CHEM., vol. 55, 1990, pages 5867 |
ANDREWS, BLOOD, vol. 68, 1986, pages 1030 - 5 |
ANGEW CHEM. INTL. ED. ENGL., vol. 33, 1994, pages 183 - 186 |
ANNU. REV. NEUROSCI., vol. 21, 1998, pages 309 - 345 |
ANTONOW, J. MED. CHEM., vol. 53, no. 7, 2010, pages 2927 - 2941 |
ARAI H. ET AL., J. BIOL. CHEM., vol. 268, 1993, pages 3463 - 3470 |
ARAI H. ET AL., JPN. CIRC. J., vol. 56, 1992, pages 1303 - 1307 |
ATTIE T ET AL., HUM. MOL. GENET., vol. 4, 1995, pages 2407 - 2409 |
ATWELL ET AL., J. MED. CHEM., vol. 42, 1999, pages 3400 |
AURICCHIO A. ET AL., HUM. MOL. GENET., vol. 5, 1996, pages 351 - 354 |
AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1993, GREENE PUBLISHING AND WILEY-INTERSCIENCE |
BAKKER AB ET AL., CANCER RES., vol. 64, no. 22, 2005, pages 8443 - 50 |
BAREL M. ET AL., MOL. IMMUNOL., vol. 35, 1998, pages 1025 - 1031 |
BARELLA ET AL., BIOCHEM. J., vol. 309, 1995, pages 773 - 779 |
BARNETT T. ET AL., GENOMICS, vol. 3, 1988, pages 59 - 66 |
BEAUCAGE, S.; IYER, R.: "Advances in the synthesis of oligonucleotides by the phosphoramidite approach", TETRAHEDRON, vol. 48, 1992, pages 2223 - 2311 |
BECK ET AL., J. MOL. BIOL., vol. 228, 1992, pages 433 - 441 |
BECK ET AL., J. MOL. BIOL., vol. 255, 1996, pages 1 - 13 |
BERNHARD ET AL., BIOCONJUGATE CHEM., vol. 5, 1994, pages 126 - 132 |
BIOCHEM. BIOPHYS. RES. COMMUN., vol. 255, no. 2, 1999, pages 283 - 288 |
BIOCHEM. BIOPHYS. RES. COMMUN., vol. 275, no. 3, 2000, pages 783 - 788 |
BISHOP, D.T. ET AL., NAT. GENET., vol. 41, no. 8, 2009, pages 920 - 925 |
BLEND ET AL., CANCER BIOTHERAPY & RADIOPHARMACEUTICALS, vol. 18, 2003, pages 355 - 363 |
BLOOD, vol. 100, no. 9, 2002, pages 3068 - 3076 |
BLOOD, vol. 99, no. 8, 2002, pages 2662 - 2669 |
BLUMBERG H. ET AL., CELL, vol. 104, 2001, pages 9 - 19 |
BOURGEOIS C. ET AL., J. CLIN. ENDOCRINOL. METAB., vol. 82, 1997, pages 3116 - 3123 |
BRENNAN ET AL., SCIENCE, vol. 229, 1985, pages 81 |
BRIGGS ET AL.: "Synthesis of Functionalised Fluorescent Dyes and Their Coupling to Amines and Amino Acids", J. CHEM. SOC., PERKIN-TRANS., vol. 1, 1997, pages 1051 - 1058 |
BRINKLEY, BIOCONJUGATE CHEM., vol. 3, 1992, pages 2 |
BRINSTER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 836 |
BRUGGEMANN, M. ET AL., J. EXP. MED., vol. 166, 1987, pages 1351 - 1361 |
BUCHMAN; BERG, MOL. CELL. BIOL., vol. 8, 1988, pages 4395 |
C. PETERSON ET AL.: "Transport And Storage Of Anthracycline In Experimental Systems And Human Leukemia", ANTHRACYCLINE ANTIBIOTICS IN CANCER THERAPY |
CAMERA ET AL., J. NUCL. MED., vol. 21, 1994, pages 640 - 646 |
CAMERA ET AL., NUCL. MED. BIOL., vol. 20, 1993, pages 955 - 62 |
CANCER RES., vol. 61, no. 15, 2001, pages 5857 - 5860 |
CARTER ET AL., NUCLEIC ACIDS RES., vol. 13, 1985, pages 4431 - 4443 |
CELL, vol. 109, no. 3, 2002, pages 397 - 407 |
CHAN,J.; WATT, V.M., ONCOGENE, vol. 6, no. 6, 1991, pages 1057 - 1061 |
CHARI ET AL., CANCER RESEARCH, vol. 52, 1992, pages 127 - 131 |
CHEN CH ET AL., BLOOD, vol. 107, no. 4, 2006, pages 1459 - 67 |
CHEN ET AL., BIOCONJUGATE CHEM., vol. 15, 2004, pages 41 - 49 |
CHILD ET AL., J. BIOL. CHEM., vol. 274, 1999, pages 24335 - 24341 |
CHO H.-S. ET AL., NATURE, vol. 421, 2003, pages 756 - 760 |
CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 877 |
CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
CICCODICOLA, A. ET AL., EMBO J., vol. 8, no. 7, 1989, pages 1987 - 1991 |
CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628 |
CLARK H.F. ET AL., GENOME RES., vol. 13, 2003, pages 2265 - 2270 |
CLARK, H.F. ET AL., GENOME RES., vol. 13, no. 10, 2003, pages 2265 - 2270 |
CLYNES ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 95, 1998, pages 652 - 656 |
COLE, R.B.: "Electro Spray Ionization Mass Spectrometry: Fundamentals, Instrumentation And Applications", 1997, WILEY |
COUSSENS L. ET AL., SCIENCE, vol. 230, no. 4730, 1985, pages 1132 - 1139 |
CRAGG, M.S. ET AL., BLOOD, vol. 101, 2003, pages 1045 - 1052 |
CRAGG, M.S.; M.J. GLENNIE, BLOOD, vol. 103, 2004, pages 2738 - 2743 |
CREE ET AL., ANTICANCER DRUGS, vol. 6, 1995, pages 398 - 404 |
CROUCH ET AL., J. IMMUNOL. METH., vol. 160, 1993, pages 81 - 88 |
CROUCH, J. IMMUNOL. METH., vol. 160, 1993, pages 81 - 88 |
DALL'ACQUA ET AL., JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 281, no. 33, 2006, pages 23514 - 23524 |
DAVIS ET AL., PROC. NATL. ACAD. SCI USA, vol. 98, no. 17, 2001, pages 9772 - 9777 |
DE LEON-RODRIGUEZ ET AL., CHEM.EUR. J., vol. 10, 2004, pages 1149 - 1155 |
DE NOOIJ-VAN DALEN, A.G. ET AL., INT. J. CANCER, vol. 103, no. 6, 2003, pages 768 - 774 |
DENARDO ET AL., CLINICAL CANCER RESEARCH, vol. 4, 1998, pages 2483 - 90 |
DENNIS ET AL., J BIOL CHEM., vol. 277, 2002, pages 35035 - 35043 |
DENNIS ET AL.: "Albumin Binding As A General Strategy For Improving The Pharmacokinetics Of Proteins", J BIOL CHEM., vol. 277, pages 35035 - 35043 |
DOBNER ET AL., EUR. J. IMMUNOL., vol. 22, 1992, pages 2795 - 2799 |
DORNAN ET AL., BLOOD, vol. 114, no. 13, 2009, pages 2721 - 2729 |
DORONINA ET AL., NATURE BIOTECHNOLOGY, vol. 21, no. 7, 2003, pages 778 - 784 |
DREBIN ET AL., NATURE, vol. 312, 1984, pages 545 - 548 |
DRICKAMER K, CURR. OPIN. STRUCT. BIOL., vol. 9, no. 5, 1999, pages 585 - 90 |
D'SOUZA ET AL., PROC. NATL. ACAD. SCI., vol. 91, 1994, pages 7202 - 7206 |
DUBOWCHIK ET AL., BIOORG. & MED. CHEM. LETTERS, vol. 12, 2002, pages 1529 - 1532 |
DUBOWCHIK ET AL., TETRAHEDRON LETTERS, vol. 38, 1997, pages 5257 - 60 |
DUMOUTIER L. ET AL., J. IMMUNOL., vol. 167, 2001, pages 3545 - 3549 |
DUNCAN; WINTER, NATURE, vol. 322, 1988, pages 738 - 40 |
E. SCHRODER; K. LUBKE: "The Peptide", vol. 1, 1965, ACADEMIC PRESS, pages: 76 - 136 |
E. SCHRODER; K. LUBKE: "The Peptides", vol. 1, 1965, ACADEMIC PRESS, pages: 76 - 136 |
EHSANI A. ET AL., GENOMICS, vol. 15, 1993, pages 426 - 429 |
ELIEL, E.; WILEN, S.: "Stereochemistry of Organic Compounds", 1994, JOHN WILEY & SONS, INC. |
ELSHOURBAGY N.A. ET AL., J. BIOL. CHEM., vol. 268, 1993, pages 3873 - 3879 |
ERICSSON, T.A. ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 100, no. 11, 2003, pages 6759 - 6764 |
FEILD, J.A. ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 258, no. 3, 1999, pages 578 - 582 |
FENDLY ET AL., CANCER RESEARCH, vol. 50, 1990, pages 1550 - 1558 |
FOOTE; WINTER, J. MOL. BIOL., vol. 224, 1992, pages 487 - 499 |
FRAKER ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 80, 1978, pages 49 - 57 |
FRANCISCO ET AL., BLOOD, vol. 102, no. 4, 2003, pages 1458 - 1465 |
FRISCH ET AL., BIOCONJUGATE CHEM., vol. 7, 1996, pages 180 - 186 |
FUCHS S. ET AL., MOL. MED., vol. 7, 2001, pages 115 - 124 |
FUJISAKU ET AL., J. BIOL. CHEM., vol. 264, no. 4, 1989, pages 2118 - 2125 |
FURUSHIMA, K. ET AL., DEV. BIOL., vol. 306, no. 2, 2007, pages 480 - 492 |
GARMAN: "Non-Radioactive Labelling: A Practical Approach", 1997, ACADEMIC PRESS |
GARY S.C. ET AL., GENE, vol. 256, 2000, pages 139 - 147 |
GAUGITSCH, H.W. ET AL., J. BIOL. CHEM., vol. 267, no. 16, 1992, pages 11267 - 11273 |
GAZZANO-SANTORO ET AL., J. IMMUNOL. METHODS, vol. 202, 1996, pages 163 |
GENE CHROMOSOME, vol. 17, pages 13.3 |
GENOME RES., vol. 13, no. 10, 2003, pages 2265 - 2270 |
GENOMICS, vol. 62, no. 2, 1999, pages 281 - 284 |
GERHARD, D.S. ET AL., GENOME RES., vol. 14, no. 10B, 2004, pages 2121 - 2127 |
GERSTNER ET AL.: "Sequence Plasticity In The Antigen-Binding Site Of A Therapeutic Anti-HER2 Antibody", J MOL BIOL., vol. 321, 2002, pages 851 - 62 |
GERY, S. ET AL., ONCOGENE, vol. 22, no. 18, 2003, pages 2723 - 2727 |
GETZ ET AL., ANAL. BIOCHEM., vol. 273, 1999, pages 73 - 80 |
GLAZER ET AL.: "Chemical Modification of Proteins. Laboratory Techniques in Biochemistry and Molecular Biology", 1975, AMERICAN ELSEVIER PUBLISHING CO. |
GLYNNE-JONES ET AL., INT J CANCER., vol. 94, no. 2, 15 October 2001 (2001-10-15), pages 178 - 84 |
GRANDI ET AL., CANCER TREAT. REV., vol. 17, 1990, pages 133 |
GRUBER ET AL., J. IMMUNOL., vol. 152, 1994, pages 5368 |
GU Z. ET AL., ONCOGENE, vol. 19, 2000, pages 1288 - 1296 |
GUYER ET AL., J. IMMUNOL., vol. 117, 1976, pages 587 |
HA ET AL., J. IMMUNOL., vol. 148, no. 5, 1992, pages 1526 - 1531 |
HAENDLER B. ET AL., J. CARDIOVASC. PHARMACOL., vol. 20, 1992, pages S1 - S4 |
HAMBLETT ET AL., CLIN. CANCER RES., vol. 10, 2004, pages 7063 - 7070 |
HAMBLETT, K.J. ET AL.: "Effect of drug loading on the pharmacology, pharmacokinetics, and toxicity of an anti-CD30 antibody-drug conjugate", AMERICAN ASSOCIATION FOR CANCER RESEARCH, 2004 ANNUAL MEETING, MARCH 27-31, 2004, PROCEEDINGS OF THE AACR, vol. 45, 27 March 2004 (2004-03-27) |
HARLOW E.; LANE, D.: "Using Antibodies: A Laboratory Manual", 1999, COLD SPRINGS HARBOR LABORATORY PRESS |
HARMS, P.W., GENES DEV., vol. 17, no. 21, 2003, pages 2624 - 2629 |
HARTLEY ET AL., CANCER RES., vol. 70, no. 17, 2010, pages 6849 - 6858 |
HASHIMOTO ET AL., IMMUNOGENETICS, vol. 40, no. 4, 1994, pages 287 - 295 |
HATA, K. ET AL., ANTICANCER RES., vol. 29, no. 2, 2009, pages 617 - 623 |
HAUGLAND: "Molecular Probes Handbook of Fluorescent Probes and Research Chemicals", 2003, MOLECULAR PROBES, INC. |
HAY ET AL., BIOORG. MED. CHEM. LETT., vol. 9, 1999, pages 2237 |
HAY ET AL., J. MED. CHEM., vol. 46, 2003, pages 2456 |
HELLSTROM, I ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 82, 1985, pages 1499 - 1502 |
HELLSTROM, I. ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 83, 1986, pages 7059 - 7063 |
HERMANSON, G.: "Bioconjugate Techniques", 1996, ACADEMIC PRESS |
HERMANSON, G.: "Bioconjugate Techniques", 1996, ACADEMIC PRESS, pages: 40 - 55,643-6 |
HIGUCHI: "PCR Protocols", 1990, ACADEMIC PRESS, pages: 177 - 183 |
HINMAN ET AL., CANCER RESEARCH, vol. 53, 1993, pages 3336 - 3342 |
HNATOWICH ET AL., J. IMMUNOL. METHODS, vol. 65, 1983, pages 147 - 157 |
HO ET AL., GENE, vol. 77, 1989, pages 51 - 59 |
HOFSTRA R.M.W. ET AL., EUR. J. HUM. GENET., vol. 5, 1997, pages 180 - 185 |
HOFSTRA R.M.W. ET AL., NAT. GENET., vol. 12, 1996, pages 445 - 447 |
HOLLINGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448 |
HORIE ET AL., GENOMICS, vol. 67, 2000, pages 146 - 152 |
HOWARD ET AL., BIOORGANIC AND MED. CHEM. LETTERS, vol. 19, no. 22, 2009, pages 6463 - 6466 |
HUBERT, R.S. ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 96, no. 25, 1999, pages 14523 - 14528 |
HUDZIAK ET AL., MOL. CELL. BIOL., vol. 9, no. 3, 1989, pages 1 165 - 1172 |
HURLEY; NEEDHAM-VANDEVANTER, ACC. CHEM. RES., vol. 19, 1986, pages 230 - 237 |
IMMUNOGENETICS, vol. 54, no. 2, 2002, pages 87 - 95 |
INT. REV. CYTOL., vol. 196, 2000, pages 177 - 244 |
ISHIKAWA, N. ET AL., CANCER RES., vol. 67, no. 24, 2007, pages 11601 - 11611 |
ISSEL ET AL., CAN. TREATMENT. REV., vol. 5, 1978, pages 199 - 207 |
ITO ET AL., GENE, vol. 102, 1991, pages 67 - 70 |
IZARD ET AL., BIOCONJUGATE CHEM., vol. 3, 1992, pages 346 - 350 |
J. BIOL. CHEM., vol. 270, no. 37, 1995, pages 21984 - 21990 |
J. BIOL. CHEM., vol. 276, no. 29, 2001, pages 27371 - 27375 |
J. BIOL. CHEM., vol. 277, no. 22, 2002, pages 19665 - 19672 |
J. BIOL. CHEM., vol. 278, no. 33, 2003, pages 30813 - 30820 |
JANEWAY, C.; TRAVERS, P.; WALPORT, M.; SHLOMCHIK: "Immuno Biology", 2001, GARLAND PUBLISHING |
JANEWAY, C.; TRAVERS, P.; WALPORT, M.; SHLOMCHIK: "Immunobiology", 2001, GARLAND PUBLISHING |
JANEWAY, C.; TRAVERS, P.; WALPORT, M.; SHLOMCHIK: "Immunobiology", 2001, GARLAND PUBLISHING, pages: 627 - 628 |
JEFFREY ET AL., BIOORGANIC & MED. CHEM. LETTERS, vol. 16, 2006, pages 358 - 362 |
JEFFREY ET AL., J. MED. CHEM., vol. 48, 2005, pages 1344 |
JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525 |
JONSSON ET AL., IMMUNOGENETICS, vol. 29, no. 6, 1989, pages 411 - 413 |
JUNUTULA ET AL., NATURE BIOTECH., vol. 26, no. 8, 2008, pages 925 - 932 |
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NATIONAL INSTITUTES OF HEALTH |
KASAHARA ET AL., IMMUNOGENETICS, vol. 30, no. 1, 1989, pages 66 - 68 |
KIM ET AL., J. IMMUNOL., vol. 24, 1994, pages 249 |
KIM, M.H. ET AL., MOL. CELL. BIOL., vol. 29, no. 8, 2009, pages 2264 - 2277 |
KING ET AL., J. MED. CHEM., vol. 45, 2002, pages 4336 - 4343 |
KING, TETRAHEDRON LETTERS, vol. 43, 2002, pages 1987 - 1990 |
KINGSBURY ET AL., J. MED. CHEM., vol. 27, 1984, pages 1447 |
KLUSSMAN ET AL., BIOCONJUGATE CHEMISTRY, vol. 15, no. 4, 2004, pages 765 - 773 |
KNIGHT, C.: "Methods in Enzymology", vol. 248, 1995, ACADEMIC PRESS, article "Fluorimetric Assays of Proteolytic Enzymes", pages: 18 - 34 |
KOBAYASHI ET AL., BIOCONJUGATE CHEM., vol. 10, 1999, pages 103 - 111 |
KOBAYASHI ET AL., J. NUCL. MED., vol. 39, 1998, pages 829 - 36 |
KOHLER ET AL., NATURE, vol. 256, 1975, pages 495 |
KOHN: "Antibiotics III", 1975, SPRINGER-VERLAG, pages: 3 - 11 |
KONTERMANN, ACTA PHARMACOL. SIN., vol. 26, 2005, pages 1 - 9 |
KOSTELNY ET AL., J. IMMUNOL., vol. 148, no. 5, 1992, pages 1547 - 1553 |
KOTTS ET AL., IN VITRO, vol. 26, no. 3, 1990, pages 59A |
KRATZ ET AL., CURRENT MED. CHEM., vol. 13, 2006, pages 477 - 523 |
KUHNS J.J. ET AL., J. BIOL. CHEM., vol. 274, 1999, pages 36422 - 36427 |
KUKIS ET AL., J. NUCL. MED., vol. 39, 1998, pages 2105 - 2110 |
KUMAR ET AL., MOL. CELL. BIOL., vol. 11, no. 2, 1991, pages 979 - 986 |
KUMMER, M.P. ET AL., J. BIOL. CHEM., vol. 284, no. 4, 2009, pages 2296 - 2306 |
KUNKEL ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1987, pages 488 |
LAB. INVEST., vol. 82, no. 11, 2002, pages 1573 - 1582 |
LARHAMMAR ET AL., J. BIOL. CHEM., vol. 260, no. 26, 1985, pages 14111 - 14119 |
LDUSOGIE ET AL., J. IMMUNOL., vol. 164, 2000, pages 4178 - 4184 |
LE E, FEBS LETT., vol. 418, no. 1-2, 1997, pages 195 - 199 |
LEE ET AL., CANCER RES., vol. 61, 2001, pages 4474 - 4482 |
LEIMGRUBER ET AL., J. AM. CHEM. SOC., vol. 87, 1965, pages 5791 - 5793 |
LEIMGRUBER ET AL., J. AM. CHEM. SOC., vol. 87, 1965, pages 5793 - 5795 |
LEWIS ET AL., BIOCONJ. CHEM., vol. 9, 1998, pages 72 - 86 |
LEWIS ET AL., BIOCONJUGATE CHEM., vol. 12, 2001, pages 320 - 324 |
LEWIS ET AL., CANCER IMMUNOL. IMMUNOTHER., vol. 37, 1993, pages 255 - 263 |
LEWIS ET AL., CANCER RESEARCH, vol. 56, 1996, pages 1457 - 1465 |
LI ET AL., BIOCONJUGATE CHEM., vol. 13, 2002, pages 110 - 115 |
LIANG ET AL., CANCER RES., vol. 60, 2000, pages 4907 - 12 |
LIU ET AL., J. BIOL. CHEM., vol. 273, 1998, pages 20252 - 20260 |
LODE ET AL., CANCER RESEARCH, vol. 58, 1998, pages 2925 - 2928 |
LOWMAN ET AL., J. BIOL. CHEM., vol. 266, no. 17, 1991, pages 10982 - 10988 |
LOWMAN, HENRY B.: "Combinatorial Peptide Library Protocols", METHODS IN MOLECULAR BIOLOGY, vol. 87, 1998, pages 249 - 264 |
LOWMAN; WELLS, METHODS: A COMPANION TO METHODS IN ENZYMOLOGY, vol. 3, 1991, pages 205 - 0216 |
LUND ET AL., EUR. J. BIOCHEM., vol. 267, 2000, pages 7246 - 7256 |
LUNDBLAD R.L.: "Chemical Reagents for Protein Modification", 1991, CRC PRESS |
LUNDBLAD, R. L.; NOYES, C. M.: "Chemical Reagentsfor Protein Modification", vol. I, II, 1984, CRC PRESS |
MALLYA, M. ET AL., GENOMICS, vol. 80, no. 1, 2002, pages 113 - 123 |
MARDIROSSIAN ET AL., NUCL. MED. BIOL., vol. 20, 1993, pages 65 - 74 |
MARKS ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581 - 597 |
MARSHALL AS ET AL., EUR. J. IMMUNOL., vol. 36, no. 8, 2006, pages 2159 - 69 |
MARSHALL AS ET AL., J. BIOL. CHEM., vol. 279, no. 15, 2004, pages 14792 - 802 |
MARVIN; ZHU, ACTA PHARMACOL. SIN., vol. 26, no. 6, 2005, pages 649 - 658 |
MCDONAGH ET AL., PROT. ENGR. DESIGN & SELECTION, vol. 19, no. 7, 2006, pages 299 - 307 |
MCGLINCHEY, R.P. ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 106, no. 33, 2009, pages 13731 - 13736 |
MEAN, BIOCONJUGATE CHEM., vol. 1, 1990, pages 2 |
MEANS, BIOCONJUGATE CHEM., vol. 1, 1990, pages 2 |
MEARES ET AL., ANAL. BIOCHEM., vol. 142, 1984, pages 68 - 78 |
MEARES ET AL., J. CANCER, vol. 1990, no. 10, 1990, pages 21 - 26 |
MENDOZA ET AL., CANCER RES., vol. 62, 2002, pages 5485 - 5488 |
MIEDERER ET AL., J. NUCL. MED., vol. 45, 2004, pages 129 - 137 |
MIER ET AL., BIOCONJUGATE CHEM., vol. 16, 2005, pages 240 - 237 |
MILLER ET AL., JOUR. OF IMMUNOLOGY, vol. 170, 2003, pages 4854 - 4861 |
MILSTEIN; CUELLO, NATURE, vol. 305, 1983, pages 537 |
MIRZADEH ET AL., BIOCONJUGATE CHEM., vol. 1, 1990, pages 59 - 65 |
MITCHELL ET AL., J. NUCL. MED., vol. 44, pages 1105 - 1112 |
MIURA ET AL., BLOOD, vol. 92, 1998, pages 2815 - 2822 |
MIURA ET AL., GENOMICS, vol. 38, no. 3, 1996, pages 299 - 304 |
MOLDENHAUER ET AL., JNCI, vol. 104, 2012, pages 1 - 13 |
MONTPETIT, A.; SINNETT, D., HUM. GENET., vol. 105, no. 1-2, 1999, pages 162 - 164 |
MOORE M. ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 84, 1987, pages 9194 - 9198 |
MORRISON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1984, pages 6851 - 6855 |
MUELLER ET AL., EUR. J. BIOCHEM., vol. 22, 1992, pages 1621 - 1625 |
MULLER ET AL., EUR. J. IMMUNOL., vol. 22, no. 6, 1992, pages 1621 - 1625 |
MUNGALL A.J. ET AL., NATURE, vol. 425, 2003, pages 805 - 811 |
N R BACHUR: "Free Radical Damage", ANTHRACYCLINE ANTIBIOTICS IN CANCER THERAPY, pages 97 - 102 |
NAGASE T. ET AL., DNA RES., vol. 7, no. 2, 2000, pages 143 - 150 |
NAGY ET AL., PROC. NATL. ACAD. SCI. USA, vol. 97, 2000, pages 829 - 834 |
NAKAMUTA M. ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 177, 1991, pages 34 - 39 |
NAKAYAMA ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 277, no. 1, 2000, pages 124 - 127 |
NAN, H. ET AL., INT. J. CANCER, vol. 125, no. 4, 2009, pages 909 - 917 |
NARITA, N. ET AL., ONCOGENE, vol. 28, no. 34, 2009, pages 3058 - 3068 |
NARUSE ET AL., TISSUE ANTIGENS, vol. 59, 2002, pages 512 - 519 |
NATURE, vol. 395, no. 6699, 1998, pages 288 - 291 |
NAVENOT, J.M. ET AL., MOL. PHARMACOL., vol. 75, no. 6, 2009, pages 1300 - 1306 |
NEUBERGER; WILLIAMS, NUCLEIC ACIDS RES., vol. 16, 1988, pages 6713 |
NIKULA ET AL., J. NUCL. MED., vol. 40, 1999, pages 166 - 76 |
NIKULA ET AL., NUCL. MED. BIOL., vol. 22, 1995, pages 387 - 90 |
O'DOWD, B.F. ET AL., FEBS LETT., vol. 394, no. 3, 1996, pages 325 - 329 |
OGAWA Y. ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 178, 1991, pages 248 - 255 |
OKAMOTO Y. ET AL., BIOL. CHEM., vol. 272, 1997, pages 21589 - 21596 |
OLAFSEN ET AL., PROTEIN ENG. DESIGN & SEL., vol. 17, no. 4, 2004, pages 315 - 323 |
ONCOGENE, vol. 10, no. 5, 1995, pages 897 - 905 |
ONCOGENE, vol. 14, no. 11, 1997, pages 1377 - 1382 |
O'SULLIVAN ET AL.: "Methods in Enzym.", vol. 73, ACADEMIC PRESS, article "Methods for the Preparation of Enzyme-Antibody Conjugates for use in Enzyme Immunoassay", pages: 147 - 166 |
P.H- WIERNIK, ANTHRACYCLINE: CURRENT STATUS AND NEW DEVELOPMENTS, pages 11 |
PACCIARINI ET AL., JOUR. CLIN. ONCOLOGY, vol. 24, 2006, pages 14116 |
PARRISH-NOVAK J. ET AL., J. BIOL. CHEM., vol. 277, 2002, pages 47517 - 47523 |
PETKOVA, S.B. ET AL., INT'L. IMMUNOL., vol. 18, no. 12, 2006, pages 1759 - 1769 |
PETTIT ET AL., ANTIMICROB. AGENTS CHEMOTHER., vol. 42, 1998, pages 2961 - 2965 |
PFLEIDERER, G.: "Modern Methods in Protein Chemistry", 1985, WALTER DEGRYTER, article "Chemical Modification of Proteins" |
PIETRAS ET AL., ONCOGENE, vol. 9, 1994, pages 1829 - 1838 |
PINGAULT V. ET AL., HUM. GENET. ILL, 2002, pages 198 - 206 |
PLETNEV S. ET AL., BIOCHEMISTRY, vol. 42, 2003, pages 12617 - 12624 |
PLUCKTHUN, IMMUNOL. REVS., vol. 130, 1992, pages 151 - 188 |
PLUCKTHUN: "The Pharmacology of Monoclonal Antibodies", vol. 113, 1994, SPRINGER-VERLAG, pages: 269 - 315 |
PRESTA ET AL., J. IMMUNOL., vol. 151, 1993, pages 2623 - 2632 |
PRESTA ET AL., THROMB. HAEMOST., vol. 85, 2001, pages 379 - 389 |
PRESTA, CURR. OP. STRUCT. BIOL., vol. 2, 1992, pages 593 - 596 |
PREUD'HOMME ET AL., CLIN. EXP. IMMUNOL., vol. 90, no. 1, 1992, pages 141 - 146 |
PROC. NATL. ACAD. SCI. U.S.A., vol. 100, no. 7, 2003, pages 4126 - 4131 |
PROC. NATL. ACAD. SCI. U.S.A., vol. 93, no. 1, 1996, pages 136 - 140 |
PROC. NATL. ACAD. SCI. U.S.A., vol. 96, no. 20, 1999, pages 11531 - 11536 |
PROC. NATL. ACAD. SCI. U.S.A., vol. 98, no. 17, 2001, pages 9772 - 9777 |
PROC. NATL. ACAD. SCI. U.S.A., vol. 99, no. 26, 2002, pages 16899 - 16903 |
PUFFENBERGER E.G. ET AL., CELL, vol. 79, 1994, pages 1257 - 1266 |
QUINTIERI ET AL., CLINICAL CANCER RESEARCH, vol. 11, no. 4, 2005, pages 1608 - 1617 |
QUINTIERI: "Proceedings of the American Association of Cancer Research", 2003, pages: 44 |
RAO ET AL., BREAST CANCER RES. AND TREATMENT, vol. 45, 1997, pages 149 - 158 |
RAVETCH; KINET, ANNU. REV. IMMUNOL., vol. 9, 1991, pages 457 - 492 |
REITER R.E. ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 95, 1998, pages 1735 - 1740 |
REMILLARD ET AL., SCIENCE, vol. 189, 1975, pages 1002 - 1005 |
RIBAS, G. ET AL., J. IMMUNOL., vol. 163, no. 1, 1999, pages 278 - 287 |
RIECHMANN ET AL., J. MOL. BIOL., vol. 224, 1992, pages 487 - 499 |
RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 329 |
RIPAMONTI ET AL., BRIT. J. CANCER, vol. 65, 1992, pages 703 |
RODRIGUES ET AL., CHEMISTRY BIOLOGY, vol. 2, 1995, pages 223 |
ROSELLI ET AL., CANCER BIOTHERAPY & RADIOPHARMACEUTICALS, vol. 14, 1999, pages 209 - 20 |
ROSS ET AL., CANCER RES., vol. 62, 2002, pages 2546 - 2553 |
ROUX ET AL., J. IMMUNOL., vol. 161, 1998, pages 4083 - 4090 |
RUEGG ET AL., CANCER RES., vol. 50, 1990, pages 4221 - 4226 |
SABBATH ET AL., J. CLIN. INVEST., vol. 75, 1985, pages 756 - 56 |
SAKAGUCHI ET AL., EMBO J., vol. 7, no. 11, 1988, pages 3457 - 3464 |
SAKAMOTO A.; YANAGISAWA M. ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 178, 1991, pages 656 - 663 |
SALANTI, G. ET AL., AM. J. EPIDEMIOL., vol. 170, no. 5, 2009, pages 537 - 545 |
SALEH ET AL., J. CLIN. ONCOLOGY, vol. 18, 2000, pages 2282 - 2292 |
SAMBROOK ET AL.: "Molecular Cloning, A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
SAMBROOK; RUSSEL: "Molecular Cloning: A Laboratory Manual", 2001 |
SARUP ET AL., GROWTH REGULATION, vol. 1, 1991, pages 72 - 82 |
SCHAEFER ET AL., ONCOGENE, vol. 15, 1997, pages 1385 - 1394 |
SCHECTER ET AL., NATURE, vol. 312, 1984, pages 513 |
SCHERER, S.E. ET AL., NATURE, vol. 440, no. 7082, 2006, pages 346 - 351 |
SCOTT ET AL., J. BIOL. CHEM., vol. 266, 1991, pages 14300 - 5 |
SEMBA K. ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 82, 1985, pages 6497 - 6501 |
SERVENIUS ET AL., J. BIOL. CHEM., vol. 262, 1987, pages 8759 - 8766 |
SHAMIS ET AL., J. AMER. CHEM. SOC., vol. 126, 2004, pages 1726 - 1731 |
SHEIKH F. ET AL., J. IMMUNOL., vol. 172, 2004, pages 2006 - 2010 |
SHEPARD ET AL., CLIN. IMMUNOL., vol. 11, no. 3, 1991, pages 117 - 127 |
SHIELDS ET AL., J. BIOL. CHEM., vol. 9, no. 2, 2001, pages 6591 - 6604 |
SINGH ET AL., ANAL. BIOCHEM., vol. 304, 2002, pages 147 - 15 |
SINGLETON ET AL.: "Dictionary of Microbiology and Molecular Biology", 1994, J. WILEY & SONS |
SINHA S.K. ET AL., J. IMMUNOL., vol. 150, 1993, pages 5311 - 5320 |
SKERRA ET AL., CURR. OPINION IN IMMUNOL., vol. 5, 1993, pages 256 - 262 |
SLIWKOWSKI ET AL., J. BIOL. CHEM., vol. 269, no. 20, 1994, pages 14661 - 14665 |
SONDERMANN ET AL., NATURE, vol. 406, 20 July 2000 (2000-07-20), pages 267 - 273 |
STORM ET AL., J. AMER. CHEM. SOC., vol. 94, 1972, pages 5815 |
STRAUSBERG ET AL., PROC. NATL. ACAD. SCI USA, vol. 99, 2002, pages 16899 - 16903 |
STRAUSBERG R.L. ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 99, 2002, pages 16899 - 16903 |
SUN ET AL., BIOORGANIC & MEDICINAL CHEMISTRY LETTERS, vol. 12, 2002, pages 2213 - 2215 |
SUN ET AL., BIOORGANIC & MEDICINAL CHEMISTRY, vol. 11, 2003, pages 1761 - 1768 |
SUN ET AL., PROCEEDINGS OF THE AMERICAN SOCIETY FOR CLINICAL ONCOLOGY, 2003, pages 22 |
SVENSSON P.J. ET AL., HUM. GENET., vol. 103, 1998, pages 145 - 148 |
SWIERCZ J.M. ET AL., J. CELL BIOL., vol. 165, 2004, pages 869 - 880 |
SZALAI ET AL., J. AMER. CHEM. SOC., vol. 125, 2003, pages 15688 - 15689 |
TAKEDA, S. ET AL., FEBS LETT., vol. 520, no. 1-3, 2002, pages 97 - 101 |
TAWARAGI Y. ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 150, 1988, pages 89 - 96 |
TEN DIJKE,P. ET AL., SCIENCE, vol. 264, no. 5155, 1994, pages 101 - 104 |
TERCEL ET AL., ANGEW. CHEM., INT. ED., vol. 50, 2011, pages 2606 - 2609 |
TERCEL ET AL., J. MED. CHEM, vol. 46, 2003, pages 2132 - 2151 |
THOMPSON, J.S. ET AL., SCIENCE, vol. 293, no. 5537, 2001, pages 2108 - 2111 |
THURSTON ET AL., CHEM. REV., 1994, pages 433 - 465 |
THURSTON ET AL., CHEM. REV., vol. 1994, 1994, pages 433 - 465 |
TINIANOW, J. ET AL., NUCLEAR MEDICINE AND BIOLOGY, vol. 37, no. 3, 2010, pages 289 - 297 |
TOKI ET AL., J. ORG. CHEM., vol. 67, 2002, pages 1866 - 1872 |
TOLCHER ET AL., J. CLIN. ONCOLOGY, vol. 17, 1999, pages 478 - 484 |
TONNELLE ET AL., EMBO J., vol. 4, no. 11, 1985, pages 2839 - 2847 |
TORGOV ET AL., BIOCONJ. CHEM., vol. 16, 2005, pages 717 - 721 |
TOUCHMAN ET AL., GENOME RES., vol. 10, 2000, pages 165 - 173 |
TRAUNECKER ET AL., EMBO J., vol. 10, 1991, pages 3655 |
TREANOR, J.J. ET AL., NATURE, vol. 382, no. 6586, 1996, pages 80 - 83 |
TSUKAMOTO, H. ET AL., CANCER SCI., vol. 100, no. 10, 2009, pages 1895 - 1901 |
TSUTSUMI M. ET AL., GENE, vol. 228, 1999, pages 43 - 49 |
TUTT ET AL., J. IMMUNOL., vol. 147, 1991, pages 60 |
UCHIDA ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 266, 1999, pages 593 - 602 |
VALLETTE ET AL., NUC. ACIDS RES., vol. 17, 1989, pages 723 - 733 |
VAN RHENEN A, BLOOD, vol. 110, no. 7, 2007, pages 2659 - 66 |
VEREL ET AL., J. NUCL. MED., vol. 44, 2003, pages 1663 - 1670 |
VERHEIJ J.B. ET AL., AM. J. MED. GENET., vol. 108, 2002, pages 223 - 225 |
VITETTA ET AL., CANCER RESEARCH, vol. 54, 1994, pages 5301 - 5309 |
VITETTA ET AL., SCIENCE, vol. 238, 1987, pages 1098 |
VON HOEGEN ET AL., J. IMMUNOL., vol. 144, no. 12, 1990, pages 4870 - 4877 |
WALKER, M.A., J. ORG. CHEM., vol. 60, 1995, pages 5352 - 5355 |
WEBSTER ET AL., SEMIN. CANCER BIOL., vol. 5, 1994, pages 69 - 76 |
WEIS J.J ET AL., J. EXP. MED., vol. 167, 1988, pages 1047 - 1066 |
WEIS J.J. ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 83, 1986, pages 5639 - 5643 |
WELLS AND LOWMAN, CURR. OPIN. STRUCT. BIOL., vol. 3, pages 355 - 362 |
WELLS ET AL., GENE, vol. 34, 1985, pages 315 - 323 |
WERTHER ET AL., J. IMMUNOL., vol. 157, 1996, pages 4986 - 4995 |
WILSON ET AL., J. EXP. MED., vol. 173, 1991, pages 137 - 146 |
WONG: "Chemistry of Protein Conjugation and Cross-linking", 1991, CRC PRESS |
WOYKE ET AL., ANTIMICROB. AGENTS AND CHEMOTHER., vol. 45, no. 12, 2001, pages 3580 - 3584 |
WU ET AL., NATURE BIOTECHNOLOGY, 2007 |
WU ET AL., NATURE BIOTECHNOLOGY, vol. 23, no. 9, 2005, pages 1137 - 1146 |
XU, M.J. ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 280, no. 3, 2001, pages 768 - 775 |
XU, X.Z. ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 98, no. 19, 2001, pages 10692 - 10697 |
YAMAGUCHI, N. ET AL., BIOL. CHEM., vol. 269, no. 2, 1994, pages 805 - 808 |
YAMAMOTO T. ET AL., NATURE, vol. 319, 1986, pages 230 - 234 |
YAMAMOTO, Y. ET AL., HEPATOLOGY, vol. 37, no. 3, 2003, pages 528 - 533 |
YU ET AL., J. IMMUNOL., vol. 148, no. 2, 1992, pages 633 - 637 |
YU ET AL., PROC. NAT. ACAD. SCI. (USA, vol. 99, 2002, pages 7968 - 7973 |
ZAMMIT, D.J. ET AL., MOL. CELL. BIOL., vol. 22, no. 3, 2002, pages 946 - 952 |
ZHANG ET AL., ANAL. BIOCHEM., vol. 311, 2002, pages 1 - 9 |
ZHU ET AL., PROTEIN SCIENCE, vol. 6, 1997, pages 781 - 788 |
ZOLA: "Monoclonal Antibodies: A Manual of Techniques", 1987, CRC PRESS, INC., pages: 147 - 158 |
ZOLLER ET AL., METHODS ENZYMOL., vol. 100, 1983, pages 468 - 500 |
ZOLLER, M.J.; SMITH, M., NUCL. ACIDS RES., vol. 10, 1982, pages 6487 - 6500 |
Cited By (86)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10632210B2 (en) | 2013-12-16 | 2020-04-28 | Genentech, Inc. | Peptidomimetic compounds and antibody-drug conjugates thereof |
US10124069B2 (en) | 2013-12-16 | 2018-11-13 | Genentech, Inc. | Peptidomimetic compounds and antibody-drug conjugates thereof |
US10533058B2 (en) | 2013-12-16 | 2020-01-14 | Genentech Inc. | Peptidomimetic compounds and antibody-drug conjugates thereof |
US11692043B2 (en) | 2013-12-16 | 2023-07-04 | Medimmune Limited | Peptidomimetic compounds and antibody-drug conjugates thereof |
US10556966B2 (en) | 2014-09-12 | 2020-02-11 | Genentech, Inc. | Anti-HER2 antibodies and immunoconjugates |
US10179820B2 (en) | 2014-09-12 | 2019-01-15 | Genentech, Inc. | Anti-HER2 antibodies and immunoconjugates |
US11833222B2 (en) | 2015-02-16 | 2023-12-05 | Lonza Ltd | CL and/or CH1 mutated antibodies for drug conjugation |
US10953106B2 (en) | 2015-02-16 | 2021-03-23 | Lonza Ltd | Antibodies |
US20170002086A1 (en) * | 2015-06-15 | 2017-01-05 | Genentech, Inc. | Antibodies and immunoconjugates |
US10017577B2 (en) * | 2015-06-15 | 2018-07-10 | Genentech, Inc. | Antibodies and immunoconjugates |
US10639373B2 (en) | 2015-10-02 | 2020-05-05 | Genentech, Inc. | Pyrrolobenzodiazepine antibody drug conjugates and methods of use |
US10632196B2 (en) | 2015-10-02 | 2020-04-28 | Genentech, Inc. | Pyrrolobenzodiazepine antibody drug conjugates and methods of use |
US10058613B2 (en) | 2015-10-02 | 2018-08-28 | Genentech, Inc. | Pyrrolobenzodiazepine antibody drug conjugates and methods of use |
US11793880B2 (en) | 2015-12-04 | 2023-10-24 | Seagen Inc. | Conjugates of quaternized tubulysin compounds |
US11229708B2 (en) | 2015-12-04 | 2022-01-25 | Seagen Inc. | Conjugates of quaternized tubulysin compounds |
WO2018045090A1 (en) * | 2016-09-01 | 2018-03-08 | Immunomab, Inc. | Bispecific antibodies |
WO2018175752A1 (en) | 2017-03-22 | 2018-09-27 | Genentech, Inc. | Optimized antibody compositions for treatment of ocular disorders |
US11685790B2 (en) | 2017-04-03 | 2023-06-27 | Hoffmann-La Roche Inc. | Antibodies binding to STEAP-1 |
US11180571B2 (en) | 2017-04-03 | 2021-11-23 | Hoffmann-La Roche Inc. | Antibodies binding to STEAP-1 |
WO2018184966A1 (en) | 2017-04-03 | 2018-10-11 | F. Hoffmann-La Roche Ag | Antibodies binding to steap-1 |
US20210393794A1 (en) * | 2017-06-20 | 2021-12-23 | Sichuan Baili Pharm Co.Ltd | Screening of fixed-point coupling sites of cysteine-modified antibody-toxin conjugate (tdc) |
US11932673B2 (en) | 2017-07-12 | 2024-03-19 | Maxion Therapeutics Limited | Sodium channel inhibitors |
EP3437657A1 (en) * | 2017-08-04 | 2019-02-06 | Sysmex Corporation | Antibody modified by substituting cysteine at amino acid positions 80 and 171 of kabat numbering |
AU2018208774B2 (en) * | 2017-08-04 | 2019-07-11 | Sysmex Corporation | Antibody and method for producing same |
US10995133B2 (en) | 2017-08-04 | 2021-05-04 | Sysmex Corporation | Method for producing antibody |
US11192954B2 (en) | 2017-08-11 | 2021-12-07 | Bio-Thera Solutions, Ltd. | Compounds and methods for the treatment of TROP2 positive diseases |
JP2020503243A (en) * | 2017-08-11 | 2020-01-30 | バイオ − テラ ソリューションズ、リミテッド | Compounds and methods for the treatment of trop2 positive disease |
CN111670051A (en) * | 2017-11-08 | 2020-09-15 | 亚飞(上海)生物医药科技有限公司 | Biomolecular conjugates and uses thereof |
US11192957B2 (en) | 2017-12-21 | 2021-12-07 | Hoffmann-La Roche Inc. | Antibodies binding to HLA-A2/WT1 |
WO2019122052A2 (en) | 2017-12-21 | 2019-06-27 | F. Hoffmann-La Roche Ag | Antibodies binding to hla-a2/wt1 |
WO2019129677A1 (en) | 2017-12-29 | 2019-07-04 | F. Hoffmann-La Roche Ag | Anti-vegf antibodies and methods of use |
WO2019143636A1 (en) | 2018-01-16 | 2019-07-25 | Lakepharma, Inc. | Bispecific antibody that binds cd3 and another target |
WO2019154890A1 (en) | 2018-02-09 | 2019-08-15 | F. Hoffmann-La Roche Ag | Antibodies binding to gprc5d |
WO2019191552A1 (en) | 2018-03-29 | 2019-10-03 | Genentech, Inc. | Modulating lactogenic activity in mammalian cells |
US11530274B2 (en) | 2018-07-02 | 2022-12-20 | Amgen Inc. | Anti-STEAP1 antigen-binding protein |
KR20210040989A (en) | 2018-08-03 | 2021-04-14 | 추가이 세이야쿠 가부시키가이샤 | Antigen-binding molecule comprising two antigen-binding domains linked to each other |
WO2020027330A1 (en) | 2018-08-03 | 2020-02-06 | 中外製薬株式会社 | Antigen-binding molecule containing two antigen-binding domains that are linked to each other |
CN113365664A (en) * | 2018-10-29 | 2021-09-07 | 梅尔莎纳医疗公司 | Cysteine engineered antibody-drug conjugates with peptide-containing linkers |
WO2020092385A1 (en) * | 2018-10-29 | 2020-05-07 | Mersana Therapeutics, Inc. | Cysteine engineered antibody-drug conjugates with peptide-containing linkers |
WO2020127873A1 (en) | 2018-12-21 | 2020-06-25 | F. Hoffmann-La Roche Ag | Antibody that binds to vegf and il-1beta and methods of use |
WO2020127619A1 (en) | 2018-12-21 | 2020-06-25 | F. Hoffmann-La Roche Ag | Antibodies binding to cd3 |
WO2020156439A1 (en) | 2019-01-28 | 2020-08-06 | 上海拓界生物医药科技有限公司 | Anti-cd79b antibody, antigen-binding fragment thereof, and pharmaceutical use thereof |
WO2020191306A1 (en) | 2019-03-21 | 2020-09-24 | Immunogen, Inc. | Methods of preparing cell-binding agent-drug conjugates |
WO2021009146A1 (en) | 2019-07-15 | 2021-01-21 | F. Hoffmann-La Roche Ag | Antibodies binding to nkg2d |
WO2021018859A2 (en) | 2019-07-31 | 2021-02-04 | F. Hoffmann-La Roche Ag | Antibodies binding to gprc5d |
WO2021018925A1 (en) | 2019-07-31 | 2021-02-04 | F. Hoffmann-La Roche Ag | Antibodies binding to gprc5d |
EP4019544A4 (en) * | 2019-08-19 | 2023-10-18 | Shenyang Pharmaceutical University | Antibody mutant and application thereof |
WO2021055577A2 (en) | 2019-09-18 | 2021-03-25 | Genentech, Inc. | Anti-klk7 antibodies, anti-klk5 antibodies, multispecific anti-klk5/klk7 antibodies, and methods of use |
WO2021122875A1 (en) | 2019-12-18 | 2021-06-24 | F. Hoffmann-La Roche Ag | Antibodies binding to hla-a2/mage-a4 |
KR20220137923A (en) | 2020-02-05 | 2022-10-12 | 추가이 세이야쿠 가부시키가이샤 | Methods for making and/or enriching recombinant antigen binding molecules |
WO2021157679A1 (en) * | 2020-02-05 | 2021-08-12 | Chugai Seiyaku Kabushiki Kaisha | Methods for producing and/or enriching recombinant antigen-binding molecules |
US11179473B2 (en) | 2020-02-21 | 2021-11-23 | Silverback Therapeutics, Inc. | Nectin-4 antibody conjugates and uses thereof |
US20210347910A1 (en) * | 2020-02-25 | 2021-11-11 | Sysmex Corporation | Method for improving thermal stability of antibody and method for producing modified antibody |
US11884741B2 (en) * | 2020-02-25 | 2024-01-30 | Sysmex Corporation | Method for improving thermal stability of antibody and method for producing modified antibody |
WO2021195464A2 (en) | 2020-03-26 | 2021-09-30 | Genentech, Inc. | Modified mammalian cells |
WO2021198034A1 (en) | 2020-03-30 | 2021-10-07 | F. Hoffmann-La Roche Ag | Antibody that binds to vegf and pdgf-b and methods of use |
US11274151B2 (en) | 2020-03-31 | 2022-03-15 | Chugai Seiyaku Kabushiki Kaisha | CD3-targeting and DLL3-targeting multispecific antigen-binding molecules and uses thereof |
US11718672B2 (en) | 2020-03-31 | 2023-08-08 | Chugai Seiyaki Kabushiki Kaisha | CD137- and DLL3-targeting multispecific antigen-binding molecules |
WO2021249990A2 (en) | 2020-06-08 | 2021-12-16 | Hoffmann-La Roche Inc. | Anti-hbv antibodies and methods of use |
WO2021255143A1 (en) | 2020-06-19 | 2021-12-23 | F. Hoffmann-La Roche Ag | Antibodies binding to cd3 and folr1 |
WO2021255155A1 (en) | 2020-06-19 | 2021-12-23 | F. Hoffmann-La Roche Ag | Antibodies binding to cd3 and cd19 |
WO2021255142A1 (en) | 2020-06-19 | 2021-12-23 | F. Hoffmann-La Roche Ag | Antibodies binding to cd3 |
WO2021255146A1 (en) | 2020-06-19 | 2021-12-23 | F. Hoffmann-La Roche Ag | Antibodies binding to cd3 and cea |
WO2021262783A1 (en) | 2020-06-24 | 2021-12-30 | Genentech, Inc. | Apoptosis resistant cell lines |
US11541126B1 (en) | 2020-07-01 | 2023-01-03 | Silverback Therapeutics, Inc. | Anti-ASGR1 antibody TLR8 agonist comprising conjugates and uses thereof |
WO2022016037A1 (en) | 2020-07-17 | 2022-01-20 | Genentech, Inc. | Anti-notch2 antibodies and methods of use |
WO2022047222A2 (en) | 2020-08-28 | 2022-03-03 | Genentech, Inc. | Crispr/cas9 multiplex knockout of host cell proteins |
WO2022049165A1 (en) | 2020-09-04 | 2022-03-10 | F. Hoffmann-La Roche Ag | Antibody that binds to vegf-a and ang2 and methods of use |
WO2022086957A1 (en) | 2020-10-20 | 2022-04-28 | Genentech, Inc. | Peg-conjugated anti-mertk antibodies and methods of use |
WO2022169872A1 (en) | 2021-02-03 | 2022-08-11 | Genentech, Inc. | Multispecific binding protein degrader platform and methods of use |
WO2022192647A1 (en) | 2021-03-12 | 2022-09-15 | Genentech, Inc. | Anti-klk7 antibodies, anti-klk5 antibodies, multispecific anti-klk5/klk7 antibodies, and methods of use |
WO2022217022A1 (en) | 2021-04-10 | 2022-10-13 | Profoundbio Us Co. | Folr1 binding agents, conjugates thereof and methods of using the same |
WO2022225880A1 (en) | 2021-04-19 | 2022-10-27 | Genentech, Inc. | Modified mammalian cells |
WO2022226317A1 (en) | 2021-04-23 | 2022-10-27 | Profoundbio Us Co. | Anti-cd70 antibodies, conjugates thereof and methods of using the same |
WO2022246259A1 (en) | 2021-05-21 | 2022-11-24 | Genentech, Inc. | Modified cells for the production of a recombinant product of interest |
WO2023288182A1 (en) | 2021-07-12 | 2023-01-19 | Genentech, Inc. | Structures for reducing antibody-lipase binding |
WO2023288241A1 (en) | 2021-07-14 | 2023-01-19 | Genentech, Inc. | Anti-c-c motif chemokine receptor 8 (ccr8) antibodies and methods of use |
WO2023001884A1 (en) | 2021-07-22 | 2023-01-26 | F. Hoffmann-La Roche Ag | Heterodimeric fc domain antibodies |
WO2023007481A1 (en) * | 2021-07-28 | 2023-02-02 | Ramot At Tel-Aviv University Ltd. | Water soluble prodrug, conjugates and uses thereof |
WO2023012147A1 (en) | 2021-08-03 | 2023-02-09 | F. Hoffmann-La Roche Ag | Bispecific antibodies and methods of use |
WO2023092099A1 (en) | 2021-11-19 | 2023-05-25 | Ardeagen Corporation | Gpc3 binding agents, conjugates thereof and methods of using the same |
WO2023104938A1 (en) | 2021-12-10 | 2023-06-15 | F. Hoffmann-La Roche Ag | Antibodies binding to cd3 and plap |
WO2023141445A1 (en) | 2022-01-19 | 2023-07-27 | Genentech, Inc. | Anti-notch2 antibodies and conjugates and methods of use |
WO2023215737A1 (en) * | 2022-05-03 | 2023-11-09 | Genentech, Inc. | Anti-ly6e antibodies, immunoconjugates, and uses thereof |
WO2023217933A1 (en) | 2022-05-11 | 2023-11-16 | F. Hoffmann-La Roche Ag | Antibody that binds to vegf-a and il6 and methods of use |
WO2024077239A1 (en) | 2022-10-07 | 2024-04-11 | Genentech, Inc. | Methods of treating cancer with anti-c-c motif chemokine receptor 8 (ccr8) antibodies |
Also Published As
Publication number | Publication date |
---|---|
EP3388449A2 (en) | 2018-10-17 |
BR112017003236A2 (en) | 2017-11-28 |
JP2022137034A (en) | 2022-09-21 |
AU2015314826A1 (en) | 2017-03-02 |
JP2020143067A (en) | 2020-09-10 |
IL250449A0 (en) | 2017-03-30 |
CA2957354A1 (en) | 2016-03-17 |
EP3388449A3 (en) | 2018-10-24 |
RU2017107502A (en) | 2018-10-12 |
ZA201700944B (en) | 2019-06-26 |
KR20170052600A (en) | 2017-05-12 |
US20230130874A1 (en) | 2023-04-27 |
SG11201701128YA (en) | 2017-03-30 |
RU2017107502A3 (en) | 2019-07-24 |
US20200017601A1 (en) | 2020-01-16 |
US10077318B2 (en) | 2018-09-18 |
WO2016040856A3 (en) | 2016-05-06 |
MX2017003123A (en) | 2017-05-12 |
JP2021073176A (en) | 2021-05-13 |
EP3191521A2 (en) | 2017-07-19 |
JP2017531620A (en) | 2017-10-26 |
AR101844A1 (en) | 2017-01-18 |
CN107108724A (en) | 2017-08-29 |
US20160130358A1 (en) | 2016-05-12 |
TW201625688A (en) | 2016-07-16 |
HK1243103A1 (en) | 2018-07-06 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20230130874A1 (en) | Cysteine Engineered Antibodies and Conjugates | |
US20180000962A1 (en) | Cysteine engineered antibodies and conjugates | |
CA2799540A1 (en) | Cysteine engineered antibodies and conjugates | |
MX2007003404A (en) | Cysteine engineered antibodies and conjugates |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15771364 Country of ref document: EP Kind code of ref document: A2 |
|
ENP | Entry into the national phase |
Ref document number: 2957354 Country of ref document: CA |
|
WWE | Wipo information: entry into national phase |
Ref document number: 250449 Country of ref document: IL |
|
REEP | Request for entry into the european phase |
Ref document number: 2015771364 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2015771364 Country of ref document: EP |
|
REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112017003236 Country of ref document: BR |
|
ENP | Entry into the national phase |
Ref document number: 2015314826 Country of ref document: AU Date of ref document: 20150911 Kind code of ref document: A |
|
ENP | Entry into the national phase |
Ref document number: 2017513087 Country of ref document: JP Kind code of ref document: A |
|
WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2017/003123 Country of ref document: MX |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15771364 Country of ref document: EP Kind code of ref document: A2 |
|
ENP | Entry into the national phase |
Ref document number: 20177008038 Country of ref document: KR Kind code of ref document: A |
|
ENP | Entry into the national phase |
Ref document number: 2017107502 Country of ref document: RU Kind code of ref document: A |
|
ENP | Entry into the national phase |
Ref document number: 112017003236 Country of ref document: BR Kind code of ref document: A2 Effective date: 20170217 |