CN115850449A - Antibodies and conjugates - Google Patents
Antibodies and conjugates Download PDFInfo
- Publication number
- CN115850449A CN115850449A CN202211197665.7A CN202211197665A CN115850449A CN 115850449 A CN115850449 A CN 115850449A CN 202211197665 A CN202211197665 A CN 202211197665A CN 115850449 A CN115850449 A CN 115850449A
- Authority
- CN
- China
- Prior art keywords
- antigen binding
- amino acid
- vhh
- binding protein
- antibody
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 102000025171 antigen binding proteins Human genes 0.000 claims abstract description 282
- 108091000831 antigen binding proteins Proteins 0.000 claims abstract description 282
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 claims abstract description 261
- 239000000427 antigen Substances 0.000 claims abstract description 112
- 108091007433 antigens Proteins 0.000 claims abstract description 111
- 102000036639 antigens Human genes 0.000 claims abstract description 111
- 230000027455 binding Effects 0.000 claims abstract description 101
- 125000000539 amino acid group Chemical group 0.000 claims description 214
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 claims description 84
- 108010003723 Single-Domain Antibodies Proteins 0.000 claims description 75
- 206010028980 Neoplasm Diseases 0.000 claims description 67
- 229940127121 immunoconjugate Drugs 0.000 claims description 58
- 239000002904 solvent Substances 0.000 claims description 51
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 28
- 125000003396 thiol group Chemical group [H]S* 0.000 claims description 27
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 17
- 229920001184 polypeptide Polymers 0.000 claims description 16
- 239000003638 chemical reducing agent Substances 0.000 claims description 13
- 230000009467 reduction Effects 0.000 claims description 9
- 230000004927 fusion Effects 0.000 claims description 6
- 230000035772 mutation Effects 0.000 description 129
- 238000000034 method Methods 0.000 description 124
- 238000010168 coupling process Methods 0.000 description 120
- 238000005859 coupling reaction Methods 0.000 description 118
- 230000008878 coupling Effects 0.000 description 117
- 125000003275 alpha amino acid group Chemical group 0.000 description 112
- 235000001014 amino acid Nutrition 0.000 description 102
- 108090000623 proteins and genes Proteins 0.000 description 102
- 235000018417 cysteine Nutrition 0.000 description 94
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 93
- 238000001514 detection method Methods 0.000 description 85
- -1 SSEA-4 Proteins 0.000 description 84
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 83
- 150000001413 amino acids Chemical class 0.000 description 81
- 102000004169 proteins and genes Human genes 0.000 description 80
- 238000012512 characterization method Methods 0.000 description 69
- 125000005647 linker group Chemical group 0.000 description 68
- 235000018102 proteins Nutrition 0.000 description 68
- 239000003814 drug Substances 0.000 description 57
- 210000004027 cell Anatomy 0.000 description 53
- 230000014509 gene expression Effects 0.000 description 53
- 238000002965 ELISA Methods 0.000 description 44
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 40
- 239000000178 monomer Substances 0.000 description 39
- 239000000562 conjugate Substances 0.000 description 38
- 102100024216 Programmed cell death 1 ligand 1 Human genes 0.000 description 35
- 230000021615 conjugation Effects 0.000 description 35
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 35
- 238000003998 size exclusion chromatography high performance liquid chromatography Methods 0.000 description 35
- 108010074708 B7-H1 Antigen Proteins 0.000 description 32
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 30
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 30
- 201000010099 disease Diseases 0.000 description 28
- 239000012634 fragment Substances 0.000 description 28
- 150000007523 nucleic acids Chemical class 0.000 description 28
- 238000004458 analytical method Methods 0.000 description 27
- 239000002738 chelating agent Substances 0.000 description 27
- 229940079593 drug Drugs 0.000 description 27
- 238000006467 substitution reaction Methods 0.000 description 27
- 239000000203 mixture Substances 0.000 description 26
- 230000004048 modification Effects 0.000 description 26
- 238000012986 modification Methods 0.000 description 26
- 229940124597 therapeutic agent Drugs 0.000 description 26
- 239000008194 pharmaceutical composition Substances 0.000 description 25
- 102000039446 nucleic acids Human genes 0.000 description 24
- 108020004707 nucleic acids Proteins 0.000 description 24
- 101100330725 Arabidopsis thaliana DAR4 gene Proteins 0.000 description 20
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 description 20
- 239000000523 sample Substances 0.000 description 20
- 230000004071 biological effect Effects 0.000 description 19
- 230000000694 effects Effects 0.000 description 19
- 238000004895 liquid chromatography mass spectrometry Methods 0.000 description 19
- 238000000338 in vitro Methods 0.000 description 18
- 238000004007 reversed phase HPLC Methods 0.000 description 18
- 101100330723 Arabidopsis thaliana DAR2 gene Proteins 0.000 description 17
- 239000013598 vector Substances 0.000 description 17
- PZBFGYYEXUXCOF-UHFFFAOYSA-N TCEP Chemical compound OC(=O)CCP(CCC(O)=O)CCC(O)=O PZBFGYYEXUXCOF-UHFFFAOYSA-N 0.000 description 15
- 230000008569 process Effects 0.000 description 15
- 239000000243 solution Substances 0.000 description 15
- 230000008685 targeting Effects 0.000 description 15
- 238000011282 treatment Methods 0.000 description 15
- 102000004190 Enzymes Human genes 0.000 description 14
- 108090000790 Enzymes Proteins 0.000 description 14
- 229940088598 enzyme Drugs 0.000 description 14
- 238000004519 manufacturing process Methods 0.000 description 14
- 206010009944 Colon cancer Diseases 0.000 description 13
- 238000002156 mixing Methods 0.000 description 13
- 238000005457 optimization Methods 0.000 description 13
- 238000000746 purification Methods 0.000 description 13
- 230000002829 reductive effect Effects 0.000 description 13
- IAKHMKGGTNLKSZ-INIZCTEOSA-N (S)-colchicine Chemical compound C1([C@@H](NC(C)=O)CC2)=CC(=O)C(OC)=CC=C1C1=C2C=C(OC)C(OC)=C1OC IAKHMKGGTNLKSZ-INIZCTEOSA-N 0.000 description 12
- 206010006187 Breast cancer Diseases 0.000 description 12
- 208000026310 Breast neoplasm Diseases 0.000 description 12
- 101150029707 ERBB2 gene Proteins 0.000 description 12
- 239000010949 copper Substances 0.000 description 12
- 238000011156 evaluation Methods 0.000 description 12
- 239000011572 manganese Substances 0.000 description 12
- 239000000546 pharmaceutical excipient Substances 0.000 description 12
- 238000012216 screening Methods 0.000 description 12
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 12
- 238000011895 specific detection Methods 0.000 description 12
- 230000009466 transformation Effects 0.000 description 12
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 11
- 241000702141 Corynephage beta Species 0.000 description 11
- 239000003795 chemical substances by application Substances 0.000 description 11
- 150000001945 cysteines Chemical class 0.000 description 11
- 201000001441 melanoma Diseases 0.000 description 11
- 108091034117 Oligonucleotide Proteins 0.000 description 10
- 208000005718 Stomach Neoplasms Diseases 0.000 description 10
- 238000003556 assay Methods 0.000 description 10
- 231100000433 cytotoxic Toxicity 0.000 description 10
- 230000001472 cytotoxic effect Effects 0.000 description 10
- 206010017758 gastric cancer Diseases 0.000 description 10
- 125000003729 nucleotide group Chemical group 0.000 description 10
- 230000036961 partial effect Effects 0.000 description 10
- 102000040430 polynucleotide Human genes 0.000 description 10
- 108091033319 polynucleotide Proteins 0.000 description 10
- 239000002157 polynucleotide Substances 0.000 description 10
- 201000011549 stomach cancer Diseases 0.000 description 10
- 206010033128 Ovarian cancer Diseases 0.000 description 9
- 206010061535 Ovarian neoplasm Diseases 0.000 description 9
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 9
- WDLRUFUQRNWCPK-UHFFFAOYSA-N Tetraxetan Chemical compound OC(=O)CN1CCN(CC(O)=O)CCN(CC(O)=O)CCN(CC(O)=O)CC1 WDLRUFUQRNWCPK-UHFFFAOYSA-N 0.000 description 9
- 230000000903 blocking effect Effects 0.000 description 9
- 208000014018 liver neoplasm Diseases 0.000 description 9
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 9
- 239000002777 nucleoside Substances 0.000 description 9
- 201000002528 pancreatic cancer Diseases 0.000 description 9
- 208000008443 pancreatic carcinoma Diseases 0.000 description 9
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 9
- 229920000642 polymer Polymers 0.000 description 9
- JJAHTWIKCUJRDK-UHFFFAOYSA-N succinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate Chemical compound C1CC(CN2C(C=CC2=O)=O)CCC1C(=O)ON1C(=O)CCC1=O JJAHTWIKCUJRDK-UHFFFAOYSA-N 0.000 description 9
- JHALWMSZGCVVEM-UHFFFAOYSA-N 2-[4,7-bis(carboxymethyl)-1,4,7-triazonan-1-yl]acetic acid Chemical compound OC(=O)CN1CCN(CC(O)=O)CCN(CC(O)=O)CC1 JHALWMSZGCVVEM-UHFFFAOYSA-N 0.000 description 8
- 108060003951 Immunoglobulin Proteins 0.000 description 8
- 208000034578 Multiple myelomas Diseases 0.000 description 8
- 206010035226 Plasma cell myeloma Diseases 0.000 description 8
- 229940125644 antibody drug Drugs 0.000 description 8
- 239000000611 antibody drug conjugate Substances 0.000 description 8
- 229940049595 antibody-drug conjugate Drugs 0.000 description 8
- 239000002246 antineoplastic agent Substances 0.000 description 8
- 230000008901 benefit Effects 0.000 description 8
- 201000011510 cancer Diseases 0.000 description 8
- 238000010276 construction Methods 0.000 description 8
- 239000002872 contrast media Substances 0.000 description 8
- 238000012217 deletion Methods 0.000 description 8
- 230000037430 deletion Effects 0.000 description 8
- 102000037865 fusion proteins Human genes 0.000 description 8
- 108020001507 fusion proteins Proteins 0.000 description 8
- 201000010536 head and neck cancer Diseases 0.000 description 8
- 208000014829 head and neck neoplasm Diseases 0.000 description 8
- 102000018358 immunoglobulin Human genes 0.000 description 8
- 238000001727 in vivo Methods 0.000 description 8
- XEEYBQQBJWHFJM-UHFFFAOYSA-N iron Substances [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 8
- 201000007270 liver cancer Diseases 0.000 description 8
- 238000002703 mutagenesis Methods 0.000 description 8
- 231100000350 mutagenesis Toxicity 0.000 description 8
- 239000007790 solid phase Substances 0.000 description 8
- 206010005003 Bladder cancer Diseases 0.000 description 7
- 206010014733 Endometrial cancer Diseases 0.000 description 7
- 206010014759 Endometrial neoplasm Diseases 0.000 description 7
- 208000008839 Kidney Neoplasms Diseases 0.000 description 7
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 7
- 206010025323 Lymphomas Diseases 0.000 description 7
- 206010027406 Mesothelioma Diseases 0.000 description 7
- 206010038389 Renal cancer Diseases 0.000 description 7
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 7
- 239000002253 acid Substances 0.000 description 7
- 238000007792 addition Methods 0.000 description 7
- 238000011374 additional therapy Methods 0.000 description 7
- 239000004037 angiogenesis inhibitor Substances 0.000 description 7
- 208000035475 disorder Diseases 0.000 description 7
- 238000005516 engineering process Methods 0.000 description 7
- 201000010982 kidney cancer Diseases 0.000 description 7
- 201000005202 lung cancer Diseases 0.000 description 7
- 208000020816 lung neoplasm Diseases 0.000 description 7
- WKPWGQKGSOKKOO-RSFHAFMBSA-N maytansine Chemical compound CO[C@@H]([C@@]1(O)C[C@](OC(=O)N1)([C@H]([C@@H]1O[C@@]1(C)[C@@H](OC(=O)[C@H](C)N(C)C(C)=O)CC(=O)N1C)C)[H])\C=C\C=C(C)\CC2=CC(OC)=C(Cl)C1=C2 WKPWGQKGSOKKOO-RSFHAFMBSA-N 0.000 description 7
- 229910021645 metal ion Inorganic materials 0.000 description 7
- 239000002773 nucleotide Substances 0.000 description 7
- 238000002360 preparation method Methods 0.000 description 7
- 150000003384 small molecules Chemical class 0.000 description 7
- 210000004881 tumor cell Anatomy 0.000 description 7
- 201000005112 urinary bladder cancer Diseases 0.000 description 7
- 102100026094 C-type lectin domain family 12 member A Human genes 0.000 description 6
- 102100038083 Endosialin Human genes 0.000 description 6
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 6
- 208000022072 Gallbladder Neoplasms Diseases 0.000 description 6
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 6
- 101000884275 Homo sapiens Endosialin Proteins 0.000 description 6
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 6
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 6
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 6
- 208000000728 Thymus Neoplasms Diseases 0.000 description 6
- 102000004243 Tubulin Human genes 0.000 description 6
- 108090000704 Tubulin Proteins 0.000 description 6
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 6
- FPIPGXGPPPQFEQ-OVSJKPMPSA-N all-trans-retinol Chemical compound OC\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C FPIPGXGPPPQFEQ-OVSJKPMPSA-N 0.000 description 6
- 108010044540 auristatin Proteins 0.000 description 6
- 239000011230 binding agent Substances 0.000 description 6
- 238000002512 chemotherapy Methods 0.000 description 6
- 208000006990 cholangiocarcinoma Diseases 0.000 description 6
- 229960001338 colchicine Drugs 0.000 description 6
- VFLDPWHFBUODDF-FCXRPNKRSA-N curcumin Chemical compound C1=C(O)C(OC)=CC(\C=C\C(=O)CC(=O)\C=C\C=2C=C(OC)C(O)=CC=2)=C1 VFLDPWHFBUODDF-FCXRPNKRSA-N 0.000 description 6
- 239000000824 cytostatic agent Substances 0.000 description 6
- 239000003937 drug carrier Substances 0.000 description 6
- 239000002532 enzyme inhibitor Substances 0.000 description 6
- 201000004101 esophageal cancer Diseases 0.000 description 6
- 229960002949 fluorouracil Drugs 0.000 description 6
- 238000009472 formulation Methods 0.000 description 6
- 230000006870 function Effects 0.000 description 6
- 201000010175 gallbladder cancer Diseases 0.000 description 6
- 239000000499 gel Substances 0.000 description 6
- 208000005017 glioblastoma Diseases 0.000 description 6
- 229940088597 hormone Drugs 0.000 description 6
- 239000005556 hormone Substances 0.000 description 6
- 239000003667 hormone antagonist Substances 0.000 description 6
- 208000015181 infectious disease Diseases 0.000 description 6
- 230000002401 inhibitory effect Effects 0.000 description 6
- 230000003993 interaction Effects 0.000 description 6
- 238000002372 labelling Methods 0.000 description 6
- 239000007788 liquid Substances 0.000 description 6
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 6
- 108091070501 miRNA Proteins 0.000 description 6
- 239000002679 microRNA Substances 0.000 description 6
- 239000013612 plasmid Substances 0.000 description 6
- AQHHHDLHHXJYJD-UHFFFAOYSA-N propranolol Chemical compound C1=CC=C2C(OCC(O)CNC(C)C)=CC=CC2=C1 AQHHHDLHHXJYJD-UHFFFAOYSA-N 0.000 description 6
- RXWNCPJZOCPEPQ-NVWDDTSBSA-N puromycin Chemical compound C1=CC(OC)=CC=C1C[C@H](N)C(=O)N[C@H]1[C@@H](O)[C@H](N2C3=NC=NC(=C3N=C2)N(C)C)O[C@@H]1CO RXWNCPJZOCPEPQ-NVWDDTSBSA-N 0.000 description 6
- 238000003127 radioimmunoassay Methods 0.000 description 6
- 238000001959 radiotherapy Methods 0.000 description 6
- 239000000126 substance Substances 0.000 description 6
- 230000001225 therapeutic effect Effects 0.000 description 6
- 238000002560 therapeutic procedure Methods 0.000 description 6
- 201000009377 thymus cancer Diseases 0.000 description 6
- 239000003053 toxin Substances 0.000 description 6
- 231100000765 toxin Toxicity 0.000 description 6
- 108700012359 toxins Proteins 0.000 description 6
- 230000010474 transient expression Effects 0.000 description 6
- 238000005406 washing Methods 0.000 description 6
- BQWBEDSJTMWJAE-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-[(2-iodoacetyl)amino]benzoate Chemical compound C1=CC(NC(=O)CI)=CC=C1C(=O)ON1C(=O)CCC1=O BQWBEDSJTMWJAE-UHFFFAOYSA-N 0.000 description 5
- 208000023275 Autoimmune disease Diseases 0.000 description 5
- 208000035473 Communicable disease Diseases 0.000 description 5
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 5
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 description 5
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 description 5
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 5
- 108091028043 Nucleic acid sequence Proteins 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 230000004663 cell proliferation Effects 0.000 description 5
- 230000008859 change Effects 0.000 description 5
- 230000001268 conjugating effect Effects 0.000 description 5
- 239000013256 coordination polymer Substances 0.000 description 5
- 238000002474 experimental method Methods 0.000 description 5
- 239000003446 ligand Substances 0.000 description 5
- 150000002632 lipids Chemical class 0.000 description 5
- 239000007787 solid Substances 0.000 description 5
- 206010041823 squamous cell carcinoma Diseases 0.000 description 5
- 210000001519 tissue Anatomy 0.000 description 5
- AGGWFDNPHKLBBV-YUMQZZPRSA-N (2s)-2-[[(2s)-2-amino-3-methylbutanoyl]amino]-5-(carbamoylamino)pentanoic acid Chemical compound CC(C)[C@H](N)C(=O)N[C@H](C(O)=O)CCCNC(N)=O AGGWFDNPHKLBBV-YUMQZZPRSA-N 0.000 description 4
- QBPPRVHXOZRESW-UHFFFAOYSA-N 1,4,7,10-tetraazacyclododecane Chemical compound C1CNCCNCCNCCN1 QBPPRVHXOZRESW-UHFFFAOYSA-N 0.000 description 4
- ITWBWJFEJCHKSN-UHFFFAOYSA-N 1,4,7-triazonane Chemical compound C1CNCCNCCN1 ITWBWJFEJCHKSN-UHFFFAOYSA-N 0.000 description 4
- MDAXKAUIABOHTD-UHFFFAOYSA-N 1,4,8,11-tetraazacyclotetradecane Chemical compound C1CNCCNCCCNCCNC1 MDAXKAUIABOHTD-UHFFFAOYSA-N 0.000 description 4
- UTPYTEWRMXITIN-YDWXAUTNSA-N 1-methyl-3-[(e)-[(3e)-3-(methylcarbamothioylhydrazinylidene)butan-2-ylidene]amino]thiourea Chemical compound CNC(=S)N\N=C(/C)\C(\C)=N\NC(=S)NC UTPYTEWRMXITIN-YDWXAUTNSA-N 0.000 description 4
- GRUVVLWKPGIYEG-UHFFFAOYSA-N 2-[2-[carboxymethyl-[(2-hydroxyphenyl)methyl]amino]ethyl-[(2-hydroxyphenyl)methyl]amino]acetic acid Chemical compound C=1C=CC=C(O)C=1CN(CC(=O)O)CCN(CC(O)=O)CC1=CC=CC=C1O GRUVVLWKPGIYEG-UHFFFAOYSA-N 0.000 description 4
- SYFGLWDDLZQFNI-UHFFFAOYSA-N 2-[4-(carboxymethyl)-1,4,8,11-tetrazabicyclo[6.6.2]hexadecan-11-yl]acetic acid Chemical compound C1CN(CC(O)=O)CCCN2CCN(CC(=O)O)CCCN1CC2 SYFGLWDDLZQFNI-UHFFFAOYSA-N 0.000 description 4
- GTACSIONMHMRPD-UHFFFAOYSA-N 2-[4-[2-(benzenesulfonamido)ethylsulfanyl]-2,6-difluorophenoxy]acetamide Chemical compound C1=C(F)C(OCC(=O)N)=C(F)C=C1SCCNS(=O)(=O)C1=CC=CC=C1 GTACSIONMHMRPD-UHFFFAOYSA-N 0.000 description 4
- RXACEEPNTRHYBQ-UHFFFAOYSA-N 2-[[2-[[2-[(2-sulfanylacetyl)amino]acetyl]amino]acetyl]amino]acetic acid Chemical compound OC(=O)CNC(=O)CNC(=O)CNC(=O)CS RXACEEPNTRHYBQ-UHFFFAOYSA-N 0.000 description 4
- PTPQJKANBKHDPM-UHFFFAOYSA-N 3,7-diazabicyclo[3.3.1]nonane Chemical compound C1NCC2CNCC1C2 PTPQJKANBKHDPM-UHFFFAOYSA-N 0.000 description 4
- TYYIOZHLPIBQCJ-UHFFFAOYSA-N 4-[1-(4-aminophenyl)-2,2,2-trichloroethyl]aniline Chemical compound C1=CC(N)=CC=C1C(C(Cl)(Cl)Cl)C1=CC=C(N)C=C1 TYYIOZHLPIBQCJ-UHFFFAOYSA-N 0.000 description 4
- OOLRAQKFMNOZBV-UHFFFAOYSA-N 8-n-[(4-aminophenyl)methyl]-3,6,10,13,16,19-hexazabicyclo[6.6.6]icosane-1,8-diamine Chemical compound C1=CC(N)=CC=C1CNC1(CNCCNC2)CNCCNCC2(N)CNCCNC1 OOLRAQKFMNOZBV-UHFFFAOYSA-N 0.000 description 4
- OMNVYXHOSHNURL-WPRPVWTQSA-N Ala-Phe Chemical compound C[C@H](N)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 OMNVYXHOSHNURL-WPRPVWTQSA-N 0.000 description 4
- 101710130081 Aspergillopepsin-1 Proteins 0.000 description 4
- 102100038080 B-cell receptor CD22 Human genes 0.000 description 4
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 4
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 4
- 102000004127 Cytokines Human genes 0.000 description 4
- 108090000695 Cytokines Proteins 0.000 description 4
- 102100031007 Cytosolic non-specific dipeptidase Human genes 0.000 description 4
- 108020004414 DNA Proteins 0.000 description 4
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 4
- 101150084967 EPCAM gene Proteins 0.000 description 4
- 241000588724 Escherichia coli Species 0.000 description 4
- 241000282412 Homo Species 0.000 description 4
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 description 4
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 4
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 4
- 101000914324 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 5 Proteins 0.000 description 4
- 101000914321 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 7 Proteins 0.000 description 4
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 description 4
- 101100356345 Homo sapiens RETREG2 gene Proteins 0.000 description 4
- 101001047681 Homo sapiens Tyrosine-protein kinase Lck Proteins 0.000 description 4
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 4
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 4
- 101150009428 MAG2 gene Proteins 0.000 description 4
- 229930126263 Maytansine Natural products 0.000 description 4
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 description 4
- UBQYURCVBFRUQT-UHFFFAOYSA-N N-benzoyl-Ferrioxamine B Chemical compound CC(=O)N(O)CCCCCNC(=O)CCC(=O)N(O)CCCCCNC(=O)CCC(=O)N(O)CCCCCN UBQYURCVBFRUQT-UHFFFAOYSA-N 0.000 description 4
- 241001181114 Neta Species 0.000 description 4
- 108091005804 Peptidases Proteins 0.000 description 4
- 102000035195 Peptidases Human genes 0.000 description 4
- 102100022019 Pregnancy-specific beta-1-glycoprotein 2 Human genes 0.000 description 4
- 206010060862 Prostate cancer Diseases 0.000 description 4
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 4
- 102000001708 Protein Isoforms Human genes 0.000 description 4
- 108010029485 Protein Isoforms Proteins 0.000 description 4
- 108010076504 Protein Sorting Signals Proteins 0.000 description 4
- 101710100969 Receptor tyrosine-protein kinase erbB-3 Proteins 0.000 description 4
- 102100029986 Receptor tyrosine-protein kinase erbB-3 Human genes 0.000 description 4
- 102100024733 Reticulophagy regulator 2 Human genes 0.000 description 4
- 208000035896 Twin-reversed arterial perfusion sequence Diseases 0.000 description 4
- 102100024036 Tyrosine-protein kinase Lck Human genes 0.000 description 4
- 108010011559 alanylphenylalanine Proteins 0.000 description 4
- 230000002924 anti-infective effect Effects 0.000 description 4
- 239000005082 bioluminescent agent Substances 0.000 description 4
- 239000002775 capsule Substances 0.000 description 4
- 238000012258 culturing Methods 0.000 description 4
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 description 4
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 description 4
- UIWYJDYFSGRHKR-UHFFFAOYSA-N gadolinium atom Chemical compound [Gd] UIWYJDYFSGRHKR-UHFFFAOYSA-N 0.000 description 4
- 239000003102 growth factor Substances 0.000 description 4
- 239000002955 immunomodulating agent Substances 0.000 description 4
- 150000002500 ions Chemical class 0.000 description 4
- JQAACYUZYRBHGG-QHTZZOMLSA-L magnesium;(2s)-5-oxopyrrolidine-2-carboxylate Chemical compound [Mg+2].[O-]C(=O)[C@@H]1CCC(=O)N1.[O-]C(=O)[C@@H]1CCC(=O)N1 JQAACYUZYRBHGG-QHTZZOMLSA-L 0.000 description 4
- 210000004962 mammalian cell Anatomy 0.000 description 4
- YOHYSYJDKVYCJI-UHFFFAOYSA-N n-[3-[[6-[3-(trifluoromethyl)anilino]pyrimidin-4-yl]amino]phenyl]cyclopropanecarboxamide Chemical compound FC(F)(F)C1=CC=CC(NC=2N=CN=C(NC=3C=C(NC(=O)C4CC4)C=CC=3)C=2)=C1 YOHYSYJDKVYCJI-UHFFFAOYSA-N 0.000 description 4
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 4
- 230000005298 paramagnetic effect Effects 0.000 description 4
- 229940124531 pharmaceutical excipient Drugs 0.000 description 4
- 238000012545 processing Methods 0.000 description 4
- 238000002741 site-directed mutagenesis Methods 0.000 description 4
- 241000894007 species Species 0.000 description 4
- 230000009870 specific binding Effects 0.000 description 4
- 238000012360 testing method Methods 0.000 description 4
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 4
- NGGMYCMLYOUNGM-UHFFFAOYSA-N (-)-fumagillin Natural products O1C(CC=C(C)C)C1(C)C1C(OC)C(OC(=O)C=CC=CC=CC=CC(O)=O)CCC21CO2 NGGMYCMLYOUNGM-UHFFFAOYSA-N 0.000 description 3
- JSHOVKSMJRQOGY-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-(pyridin-2-yldisulfanyl)butanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCSSC1=CC=CC=N1 JSHOVKSMJRQOGY-UHFFFAOYSA-N 0.000 description 3
- UEJJHQNACJXSKW-SECBINFHSA-N (R)-thalidomide Chemical compound O=C1C2=CC=CC=C2C(=O)N1[C@@H]1CCC(=O)NC1=O UEJJHQNACJXSKW-SECBINFHSA-N 0.000 description 3
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 3
- FPIPGXGPPPQFEQ-UHFFFAOYSA-N 13-cis retinol Natural products OCC=C(C)C=CC=C(C)C=CC1=C(C)CCCC1(C)C FPIPGXGPPPQFEQ-UHFFFAOYSA-N 0.000 description 3
- NVKAWKQGWWIWPM-ABEVXSGRSA-N 17-β-hydroxy-5-α-Androstan-3-one Chemical compound C1C(=O)CC[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CC[C@H]21 NVKAWKQGWWIWPM-ABEVXSGRSA-N 0.000 description 3
- AMHZIUVRYRVYBA-UHFFFAOYSA-N 2-(2-amino-4,5-dihydroimidazol-1-yl)acetic acid Chemical compound NC1=NCCN1CC(O)=O AMHZIUVRYRVYBA-UHFFFAOYSA-N 0.000 description 3
- DWZFIFZYMHNRRV-UHFFFAOYSA-N 2-[(3,4-dihydroxy-5-methoxyphenyl)methylidene]propanedinitrile Chemical compound COC1=CC(C=C(C#N)C#N)=CC(O)=C1O DWZFIFZYMHNRRV-UHFFFAOYSA-N 0.000 description 3
- BGFTWECWAICPDG-UHFFFAOYSA-N 2-[bis(4-chlorophenyl)methyl]-4-n-[3-[bis(4-chlorophenyl)methyl]-4-(dimethylamino)phenyl]-1-n,1-n-dimethylbenzene-1,4-diamine Chemical compound C1=C(C(C=2C=CC(Cl)=CC=2)C=2C=CC(Cl)=CC=2)C(N(C)C)=CC=C1NC(C=1)=CC=C(N(C)C)C=1C(C=1C=CC(Cl)=CC=1)C1=CC=C(Cl)C=C1 BGFTWECWAICPDG-UHFFFAOYSA-N 0.000 description 3
- ALYNCZNDIQEVRV-UHFFFAOYSA-N 4-aminobenzoic acid Chemical compound NC1=CC=C(C(O)=O)C=C1 ALYNCZNDIQEVRV-UHFFFAOYSA-N 0.000 description 3
- NMUSYJAQQFHJEW-UHFFFAOYSA-N 5-Azacytidine Natural products O=C1N=C(N)N=CN1C1C(O)C(O)C(CO)O1 NMUSYJAQQFHJEW-UHFFFAOYSA-N 0.000 description 3
- LGZKGOGODCLQHG-CYBMUJFWSA-N 5-[(2r)-2-hydroxy-2-(3,4,5-trimethoxyphenyl)ethyl]-2-methoxyphenol Chemical compound C1=C(O)C(OC)=CC=C1C[C@@H](O)C1=CC(OC)=C(OC)C(OC)=C1 LGZKGOGODCLQHG-CYBMUJFWSA-N 0.000 description 3
- XAUDJQYHKZQPEU-KVQBGUIXSA-N 5-aza-2'-deoxycytidine Chemical compound O=C1N=C(N)N=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 XAUDJQYHKZQPEU-KVQBGUIXSA-N 0.000 description 3
- NMUSYJAQQFHJEW-KVTDHHQDSA-N 5-azacytidine Chemical compound O=C1N=C(N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 NMUSYJAQQFHJEW-KVTDHHQDSA-N 0.000 description 3
- SHGAZHPCJJPHSC-ZVCIMWCZSA-N 9-cis-retinoic acid Chemical compound OC(=O)/C=C(\C)/C=C/C=C(/C)\C=C\C1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-ZVCIMWCZSA-N 0.000 description 3
- VSEPZWBTQFZJAU-UHFFFAOYSA-N 9h-carbazole-1,2-dione Chemical compound C1=CC=C2C(C=CC(C3=O)=O)=C3NC2=C1 VSEPZWBTQFZJAU-UHFFFAOYSA-N 0.000 description 3
- 102100040079 A-kinase anchor protein 4 Human genes 0.000 description 3
- 101710109924 A-kinase anchor protein 4 Proteins 0.000 description 3
- 102100031585 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Human genes 0.000 description 3
- 102000017918 ADRB3 Human genes 0.000 description 3
- 108060003355 ADRB3 Proteins 0.000 description 3
- 102100026402 Adhesion G protein-coupled receptor E2 Human genes 0.000 description 3
- 102100026423 Adhesion G protein-coupled receptor E5 Human genes 0.000 description 3
- 102100031836 Adhesion G-protein coupled receptor G2 Human genes 0.000 description 3
- 102400000068 Angiostatin Human genes 0.000 description 3
- 108010079709 Angiostatins Proteins 0.000 description 3
- 102100023003 Ankyrin repeat domain-containing protein 30A Human genes 0.000 description 3
- 108010008014 B-Cell Maturation Antigen Proteins 0.000 description 3
- 102000006942 B-Cell Maturation Antigen Human genes 0.000 description 3
- 102100025218 B-cell differentiation antigen CD72 Human genes 0.000 description 3
- 241000894006 Bacteria Species 0.000 description 3
- 102100027522 Baculoviral IAP repeat-containing protein 7 Human genes 0.000 description 3
- WVDDGKGOMKODPV-UHFFFAOYSA-N Benzyl alcohol Chemical group OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 description 3
- 229940122361 Bisphosphonate Drugs 0.000 description 3
- 102100037086 Bone marrow stromal antigen 2 Human genes 0.000 description 3
- 208000003174 Brain Neoplasms Diseases 0.000 description 3
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 3
- 101710188619 C-type lectin domain family 12 member A Proteins 0.000 description 3
- LWFDUMPGOAKHKC-UHFFFAOYSA-N C1=CC=C2C=C(C(=O)C(C(O)=C3O)=O)C3=CC2=C1 Chemical compound C1=CC=C2C=C(C(=O)C(C(O)=C3O)=O)C3=CC2=C1 LWFDUMPGOAKHKC-UHFFFAOYSA-N 0.000 description 3
- 108700012439 CA9 Proteins 0.000 description 3
- 102100038078 CD276 antigen Human genes 0.000 description 3
- 108010058905 CD44v6 antigen Proteins 0.000 description 3
- 102100029390 CMRF35-like molecule 1 Human genes 0.000 description 3
- 102100024423 Carbonic anhydrase 9 Human genes 0.000 description 3
- 201000009030 Carcinoma Diseases 0.000 description 3
- 206010008342 Cervix carcinoma Diseases 0.000 description 3
- 101710178046 Chorismate synthase 1 Proteins 0.000 description 3
- 102100038449 Claudin-6 Human genes 0.000 description 3
- 108091026890 Coding region Proteins 0.000 description 3
- 102100031162 Collagen alpha-1(XVIII) chain Human genes 0.000 description 3
- 101710152695 Cysteine synthase 1 Proteins 0.000 description 3
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 3
- 102100027417 Cytochrome P450 1B1 Human genes 0.000 description 3
- 239000012625 DNA intercalator Substances 0.000 description 3
- 101100481408 Danio rerio tie2 gene Proteins 0.000 description 3
- 102000012804 EPCAM Human genes 0.000 description 3
- MBYXEBXZARTUSS-QLWBXOBMSA-N Emetamine Natural products O(C)c1c(OC)cc2c(c(C[C@@H]3[C@H](CC)CN4[C@H](c5c(cc(OC)c(OC)c5)CC4)C3)ncc2)c1 MBYXEBXZARTUSS-QLWBXOBMSA-N 0.000 description 3
- 108010079505 Endostatins Proteins 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- 102100031507 Fc receptor-like protein 5 Human genes 0.000 description 3
- 101150032879 Fcrl5 gene Proteins 0.000 description 3
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 3
- 102100035139 Folate receptor alpha Human genes 0.000 description 3
- 102100035144 Folate receptor beta Human genes 0.000 description 3
- 102000003817 Fos-related antigen 1 Human genes 0.000 description 3
- 108090000123 Fos-related antigen 1 Proteins 0.000 description 3
- 102100036939 G-protein coupled receptor 20 Human genes 0.000 description 3
- 102100021197 G-protein coupled receptor family C group 5 member D Human genes 0.000 description 3
- 108700012941 GNRH1 Proteins 0.000 description 3
- 108010010803 Gelatin Proteins 0.000 description 3
- JRZJKWGQFNTSRN-UHFFFAOYSA-N Geldanamycin Natural products C1C(C)CC(OC)C(O)C(C)C=C(C)C(OC(N)=O)C(OC)CCC=C(C)C(=O)NC2=CC(=O)C(OC)=C1C2=O JRZJKWGQFNTSRN-UHFFFAOYSA-N 0.000 description 3
- 102100032530 Glypican-3 Human genes 0.000 description 3
- 239000000579 Gonadotropin-Releasing Hormone Substances 0.000 description 3
- 102100022662 Guanylyl cyclase C Human genes 0.000 description 3
- 108010007712 Hepatitis A Virus Cellular Receptor 1 Proteins 0.000 description 3
- 102100034459 Hepatitis A virus cellular receptor 1 Human genes 0.000 description 3
- 101000777636 Homo sapiens ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Proteins 0.000 description 3
- 101000718211 Homo sapiens Adhesion G protein-coupled receptor E2 Proteins 0.000 description 3
- 101000718243 Homo sapiens Adhesion G protein-coupled receptor E5 Proteins 0.000 description 3
- 101000775058 Homo sapiens Adhesion G-protein coupled receptor G2 Proteins 0.000 description 3
- 101000757191 Homo sapiens Ankyrin repeat domain-containing protein 30A Proteins 0.000 description 3
- 101000934359 Homo sapiens B-cell differentiation antigen CD72 Proteins 0.000 description 3
- 101000936083 Homo sapiens Baculoviral IAP repeat-containing protein 7 Proteins 0.000 description 3
- 101000740785 Homo sapiens Bone marrow stromal antigen 2 Proteins 0.000 description 3
- 101000912622 Homo sapiens C-type lectin domain family 12 member A Proteins 0.000 description 3
- 101000884279 Homo sapiens CD276 antigen Proteins 0.000 description 3
- 101000990055 Homo sapiens CMRF35-like molecule 1 Proteins 0.000 description 3
- 101000882898 Homo sapiens Claudin-6 Proteins 0.000 description 3
- 101000725164 Homo sapiens Cytochrome P450 1B1 Proteins 0.000 description 3
- 101001023230 Homo sapiens Folate receptor alpha Proteins 0.000 description 3
- 101001023204 Homo sapiens Folate receptor beta Proteins 0.000 description 3
- 101001071355 Homo sapiens G-protein coupled receptor 20 Proteins 0.000 description 3
- 101001040713 Homo sapiens G-protein coupled receptor family C group 5 member D Proteins 0.000 description 3
- 101001014668 Homo sapiens Glypican-3 Proteins 0.000 description 3
- 101000899808 Homo sapiens Guanylyl cyclase C Proteins 0.000 description 3
- 101000878602 Homo sapiens Immunoglobulin alpha Fc receptor Proteins 0.000 description 3
- 101000840267 Homo sapiens Immunoglobulin lambda-like polypeptide 1 Proteins 0.000 description 3
- 101001103039 Homo sapiens Inactive tyrosine-protein kinase transmembrane receptor ROR1 Proteins 0.000 description 3
- 101000998120 Homo sapiens Interleukin-3 receptor subunit alpha Proteins 0.000 description 3
- 101000984197 Homo sapiens Leukocyte immunoglobulin-like receptor subfamily A member 2 Proteins 0.000 description 3
- 101001138062 Homo sapiens Leukocyte-associated immunoglobulin-like receptor 1 Proteins 0.000 description 3
- 101001039199 Homo sapiens Low-density lipoprotein receptor-related protein 6 Proteins 0.000 description 3
- 101000956606 Homo sapiens Ly6/PLAUR domain-containing protein 8 Proteins 0.000 description 3
- 101001065550 Homo sapiens Lymphocyte antigen 6K Proteins 0.000 description 3
- 101001018034 Homo sapiens Lymphocyte antigen 75 Proteins 0.000 description 3
- 101001133056 Homo sapiens Mucin-1 Proteins 0.000 description 3
- 101001109501 Homo sapiens NKG2-D type II integral membrane protein Proteins 0.000 description 3
- 101001051490 Homo sapiens Neural cell adhesion molecule L1 Proteins 0.000 description 3
- 101001103036 Homo sapiens Nuclear receptor ROR-alpha Proteins 0.000 description 3
- 101000721757 Homo sapiens Olfactory receptor 51E2 Proteins 0.000 description 3
- 101000613490 Homo sapiens Paired box protein Pax-3 Proteins 0.000 description 3
- 101000601724 Homo sapiens Paired box protein Pax-5 Proteins 0.000 description 3
- 101000589399 Homo sapiens Pannexin-3 Proteins 0.000 description 3
- 101000691463 Homo sapiens Placenta-specific protein 1 Proteins 0.000 description 3
- 101001064779 Homo sapiens Plexin domain-containing protein 2 Proteins 0.000 description 3
- 101001136592 Homo sapiens Prostate stem cell antigen Proteins 0.000 description 3
- 101001136981 Homo sapiens Proteasome subunit beta type-9 Proteins 0.000 description 3
- 101000880770 Homo sapiens Protein SSX2 Proteins 0.000 description 3
- 101000932478 Homo sapiens Receptor-type tyrosine-protein kinase FLT3 Proteins 0.000 description 3
- 101000835984 Homo sapiens SLIT and NTRK-like protein 6 Proteins 0.000 description 3
- 101000884271 Homo sapiens Signal transducer CD24 Proteins 0.000 description 3
- 101000824971 Homo sapiens Sperm surface protein Sp17 Proteins 0.000 description 3
- 101000873927 Homo sapiens Squamous cell carcinoma antigen recognized by T-cells 3 Proteins 0.000 description 3
- 101000714168 Homo sapiens Testisin Proteins 0.000 description 3
- 101000772267 Homo sapiens Thyrotropin receptor Proteins 0.000 description 3
- 101000894428 Homo sapiens Transcriptional repressor CTCFL Proteins 0.000 description 3
- 101000904724 Homo sapiens Transmembrane glycoprotein NMB Proteins 0.000 description 3
- 101000801433 Homo sapiens Trophoblast glycoprotein Proteins 0.000 description 3
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 3
- 101000808105 Homo sapiens Uroplakin-2 Proteins 0.000 description 3
- 101000955999 Homo sapiens V-set domain-containing T-cell activation inhibitor 1 Proteins 0.000 description 3
- 101000814512 Homo sapiens X antigen family member 1 Proteins 0.000 description 3
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 3
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 3
- 102100038005 Immunoglobulin alpha Fc receptor Human genes 0.000 description 3
- 102100029616 Immunoglobulin lambda-like polypeptide 1 Human genes 0.000 description 3
- 102100039615 Inactive tyrosine-protein kinase transmembrane receptor ROR1 Human genes 0.000 description 3
- 102100033493 Interleukin-3 receptor subunit alpha Human genes 0.000 description 3
- SHGAZHPCJJPHSC-NUEINMDLSA-N Isotretinoin Chemical compound OC(=O)C=C(C)/C=C/C=C(C)C=CC1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-NUEINMDLSA-N 0.000 description 3
- 102100025586 Leukocyte immunoglobulin-like receptor subfamily A member 2 Human genes 0.000 description 3
- 102100020943 Leukocyte-associated immunoglobulin-like receptor 1 Human genes 0.000 description 3
- 108010000817 Leuprolide Proteins 0.000 description 3
- NNJVILVZKWQKPM-UHFFFAOYSA-N Lidocaine Chemical compound CCN(CC)CC(=O)NC1=C(C)C=CC=C1C NNJVILVZKWQKPM-UHFFFAOYSA-N 0.000 description 3
- 102100040704 Low-density lipoprotein receptor-related protein 6 Human genes 0.000 description 3
- 102100038491 Ly6/PLAUR domain-containing protein 8 Human genes 0.000 description 3
- 102100032129 Lymphocyte antigen 6K Human genes 0.000 description 3
- 102100033486 Lymphocyte antigen 75 Human genes 0.000 description 3
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 3
- 108700012912 MYCN Proteins 0.000 description 3
- 101150022024 MYCN gene Proteins 0.000 description 3
- YJPIGAIKUZMOQA-UHFFFAOYSA-N Melatonin Natural products COC1=CC=C2N(C(C)=O)C=C(CCN)C2=C1 YJPIGAIKUZMOQA-UHFFFAOYSA-N 0.000 description 3
- 102000018697 Membrane Proteins Human genes 0.000 description 3
- 108010052285 Membrane Proteins Proteins 0.000 description 3
- PCZOHLXUXFIOCF-UHFFFAOYSA-N Monacolin X Natural products C12C(OC(=O)C(C)CC)CC(C)C=C2C=CC(C)C1CCC1CC(O)CC(=O)O1 PCZOHLXUXFIOCF-UHFFFAOYSA-N 0.000 description 3
- 102100034256 Mucin-1 Human genes 0.000 description 3
- 101100481410 Mus musculus Tek gene Proteins 0.000 description 3
- 108700026495 N-Myc Proto-Oncogene Proteins 0.000 description 3
- 102100030124 N-myc proto-oncogene protein Human genes 0.000 description 3
- 102100022680 NKG2-D type II integral membrane protein Human genes 0.000 description 3
- 101710204212 Neocarzinostatin Proteins 0.000 description 3
- 108010069196 Neural Cell Adhesion Molecules Proteins 0.000 description 3
- 102100027347 Neural cell adhesion molecule 1 Human genes 0.000 description 3
- 102100024964 Neural cell adhesion molecule L1 Human genes 0.000 description 3
- KYRVNWMVYQXFEU-UHFFFAOYSA-N Nocodazole Chemical compound C1=C2NC(NC(=O)OC)=NC2=CC=C1C(=O)C1=CC=CS1 KYRVNWMVYQXFEU-UHFFFAOYSA-N 0.000 description 3
- 102100025128 Olfactory receptor 51E2 Human genes 0.000 description 3
- 229930012538 Paclitaxel Natural products 0.000 description 3
- 102100040891 Paired box protein Pax-3 Human genes 0.000 description 3
- 102100037504 Paired box protein Pax-5 Human genes 0.000 description 3
- 102100032364 Pannexin-3 Human genes 0.000 description 3
- 102100026181 Placenta-specific protein 1 Human genes 0.000 description 3
- 108010051742 Platelet-Derived Growth Factor beta Receptor Proteins 0.000 description 3
- 102100026547 Platelet-derived growth factor receptor beta Human genes 0.000 description 3
- 102100031889 Plexin domain-containing protein 2 Human genes 0.000 description 3
- 229920002873 Polyethylenimine Polymers 0.000 description 3
- 102100036735 Prostate stem cell antigen Human genes 0.000 description 3
- 229940079156 Proteasome inhibitor Drugs 0.000 description 3
- 102100035764 Proteasome subunit beta type-9 Human genes 0.000 description 3
- 102100032831 Protein ITPRID2 Human genes 0.000 description 3
- 102100037686 Protein SSX2 Human genes 0.000 description 3
- 241000700159 Rattus Species 0.000 description 3
- 102100020718 Receptor-type tyrosine-protein kinase FLT3 Human genes 0.000 description 3
- NCYCYZXNIZJOKI-OVSJKPMPSA-N Retinaldehyde Chemical compound O=C\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C NCYCYZXNIZJOKI-OVSJKPMPSA-N 0.000 description 3
- OWPCHSCAPHNHAV-UHFFFAOYSA-N Rhizoxin Natural products C1C(O)C2(C)OC2C=CC(C)C(OC(=O)C2)CC2CC2OC2C(=O)OC1C(C)C(OC)C(C)=CC=CC(C)=CC1=COC(C)=N1 OWPCHSCAPHNHAV-UHFFFAOYSA-N 0.000 description 3
- AUVVAXYIELKVAI-UHFFFAOYSA-N SJ000285215 Natural products N1CCC2=CC(OC)=C(OC)C=C2C1CC1CC2C3=CC(OC)=C(OC)C=C3CCN2CC1CC AUVVAXYIELKVAI-UHFFFAOYSA-N 0.000 description 3
- 108091006576 SLC34A2 Proteins 0.000 description 3
- 108091006938 SLC39A6 Proteins 0.000 description 3
- 102100025504 SLIT and NTRK-like protein 6 Human genes 0.000 description 3
- 238000012300 Sequence Analysis Methods 0.000 description 3
- 108010089417 Sex Hormone-Binding Globulin Proteins 0.000 description 3
- 102100030758 Sex hormone-binding globulin Human genes 0.000 description 3
- 102100038081 Signal transducer CD24 Human genes 0.000 description 3
- 102100038437 Sodium-dependent phosphate transport protein 2B Human genes 0.000 description 3
- 102100022441 Sperm surface protein Sp17 Human genes 0.000 description 3
- 102100035748 Squamous cell carcinoma antigen recognized by T-cells 3 Human genes 0.000 description 3
- 101150057140 TACSTD1 gene Proteins 0.000 description 3
- 108700012457 TACSTD2 Proteins 0.000 description 3
- 229940123237 Taxane Drugs 0.000 description 3
- 102100036494 Testisin Human genes 0.000 description 3
- HATRDXDCPOXQJX-UHFFFAOYSA-N Thapsigargin Natural products CCCCCCCC(=O)OC1C(OC(O)C(=C/C)C)C(=C2C3OC(=O)C(C)(O)C3(O)C(CC(C)(OC(=O)C)C12)OC(=O)CCC)C HATRDXDCPOXQJX-UHFFFAOYSA-N 0.000 description 3
- 102100029337 Thyrotropin receptor Human genes 0.000 description 3
- 102100021393 Transcriptional repressor CTCFL Human genes 0.000 description 3
- 102100023935 Transmembrane glycoprotein NMB Human genes 0.000 description 3
- RTKIYFITIVXBLE-UHFFFAOYSA-N Trichostatin A Natural products ONC(=O)C=CC(C)=CC(C)C(=O)C1=CC=C(N(C)C)C=C1 RTKIYFITIVXBLE-UHFFFAOYSA-N 0.000 description 3
- FYAMXEPQQLNQDM-UHFFFAOYSA-N Tris(1-aziridinyl)phosphine oxide Chemical compound C1CN1P(N1CC1)(=O)N1CC1 FYAMXEPQQLNQDM-UHFFFAOYSA-N 0.000 description 3
- 102100033579 Trophoblast glycoprotein Human genes 0.000 description 3
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 3
- 102100027212 Tumor-associated calcium signal transducer 2 Human genes 0.000 description 3
- GBOGMAARMMDZGR-UHFFFAOYSA-N UNPD149280 Natural products N1C(=O)C23OC(=O)C=CC(O)CCCC(C)CC=CC3C(O)C(=C)C(C)C2C1CC1=CC=CC=C1 GBOGMAARMMDZGR-UHFFFAOYSA-N 0.000 description 3
- 102100038851 Uroplakin-2 Human genes 0.000 description 3
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 3
- 102100038929 V-set domain-containing T-cell activation inhibitor 1 Human genes 0.000 description 3
- 241001416177 Vicugna pacos Species 0.000 description 3
- OIRDTQYFTABQOQ-UHTZMRCNSA-N Vidarabine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@@H]1O OIRDTQYFTABQOQ-UHTZMRCNSA-N 0.000 description 3
- 229940122803 Vinca alkaloid Drugs 0.000 description 3
- QYSXJUFSXHHAJI-XFEUOLMDSA-N Vitamin D3 Natural products C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@H](C)CCCC(C)C)=C/C=C1\C[C@@H](O)CCC1=C QYSXJUFSXHHAJI-XFEUOLMDSA-N 0.000 description 3
- 102100039490 X antigen family member 1 Human genes 0.000 description 3
- 102100023144 Zinc transporter ZIP6 Human genes 0.000 description 3
- 238000010521 absorption reaction Methods 0.000 description 3
- 230000004913 activation Effects 0.000 description 3
- 238000001042 affinity chromatography Methods 0.000 description 3
- 229960001445 alitretinoin Drugs 0.000 description 3
- SHGAZHPCJJPHSC-YCNIQYBTSA-N all-trans-retinoic acid Chemical compound OC(=O)\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-YCNIQYBTSA-N 0.000 description 3
- ORDAZKGHSNRHTD-UHFFFAOYSA-N alpha-Toxicarol Natural products O1C(C)(C)C=CC2=C1C=CC1=C2OC2COC(C=C(C(=C3)OC)OC)=C3C2C1=O ORDAZKGHSNRHTD-UHFFFAOYSA-N 0.000 description 3
- 229940064734 aminobenzoate Drugs 0.000 description 3
- 230000003444 anaesthetic effect Effects 0.000 description 3
- 239000003098 androgen Substances 0.000 description 3
- 229940030486 androgens Drugs 0.000 description 3
- 229940045799 anthracyclines and related substance Drugs 0.000 description 3
- PYKYMHQGRFAEBM-UHFFFAOYSA-N anthraquinone Natural products CCC(=O)c1c(O)c2C(=O)C3C(C=CC=C3O)C(=O)c2cc1CC(=O)OC PYKYMHQGRFAEBM-UHFFFAOYSA-N 0.000 description 3
- 150000004056 anthraquinones Chemical class 0.000 description 3
- 229940046836 anti-estrogen Drugs 0.000 description 3
- 230000001833 anti-estrogenic effect Effects 0.000 description 3
- 230000003110 anti-inflammatory effect Effects 0.000 description 3
- KZNIFHPLKGYRTM-UHFFFAOYSA-N apigenin Chemical compound C1=CC(O)=CC=C1C1=CC(=O)C2=C(O)C=C(O)C=C2O1 KZNIFHPLKGYRTM-UHFFFAOYSA-N 0.000 description 3
- 229940117893 apigenin Drugs 0.000 description 3
- XADJWCRESPGUTB-UHFFFAOYSA-N apigenin Natural products C1=CC(O)=CC=C1C1=CC(=O)C2=CC(O)=C(O)C=C2O1 XADJWCRESPGUTB-UHFFFAOYSA-N 0.000 description 3
- 235000008714 apigenin Nutrition 0.000 description 3
- 239000003886 aromatase inhibitor Substances 0.000 description 3
- 229940046844 aromatase inhibitors Drugs 0.000 description 3
- FZCSTZYAHCUGEM-UHFFFAOYSA-N aspergillomarasmine B Natural products OC(=O)CNC(C(O)=O)CNC(C(O)=O)CC(O)=O FZCSTZYAHCUGEM-UHFFFAOYSA-N 0.000 description 3
- 229960002756 azacitidine Drugs 0.000 description 3
- 150000004663 bisphosphonates Chemical class 0.000 description 3
- 238000006664 bond formation reaction Methods 0.000 description 3
- KQNZDYYTLMIZCT-KQPMLPITSA-N brefeldin A Chemical compound O[C@@H]1\C=C\C(=O)O[C@@H](C)CCC\C=C\[C@@H]2C[C@H](O)C[C@H]21 KQNZDYYTLMIZCT-KQPMLPITSA-N 0.000 description 3
- JUMGSHROWPPKFX-UHFFFAOYSA-N brefeldin-A Natural products CC1CCCC=CC2(C)CC(O)CC2(C)C(O)C=CC(=O)O1 JUMGSHROWPPKFX-UHFFFAOYSA-N 0.000 description 3
- 229960002092 busulfan Drugs 0.000 description 3
- 229930195731 calicheamicin Natural products 0.000 description 3
- HXCHCVDVKSCDHU-LULTVBGHSA-N calicheamicin Chemical compound C1[C@H](OC)[C@@H](NCC)CO[C@H]1O[C@H]1[C@H](O[C@@H]2C\3=C(NC(=O)OC)C(=O)C[C@](C/3=C/CSSSC)(O)C#C\C=C/C#C2)O[C@H](C)[C@@H](NO[C@@H]2O[C@H](C)[C@@H](SC(=O)C=3C(=C(OC)C(O[C@H]4[C@@H]([C@H](OC)[C@@H](O)[C@H](C)O4)O)=C(I)C=3C)OC)[C@@H](O)C2)[C@@H]1O HXCHCVDVKSCDHU-LULTVBGHSA-N 0.000 description 3
- VSJKWCGYPAHWDS-FQEVSTJZSA-N camptothecin Chemical compound C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-FQEVSTJZSA-N 0.000 description 3
- 150000001720 carbohydrates Chemical class 0.000 description 3
- 235000014633 carbohydrates Nutrition 0.000 description 3
- 201000010881 cervical cancer Diseases 0.000 description 3
- XRZYELWZLNAXGE-KPKJPENVSA-N chembl539947 Chemical compound CC(C)(C)C1=CC(\C=C(/C#N)C(N)=S)=CC(C(C)(C)C)=C1O XRZYELWZLNAXGE-KPKJPENVSA-N 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 239000005081 chemiluminescent agent Substances 0.000 description 3
- AQIXAKUUQRKLND-UHFFFAOYSA-N cimetidine Chemical compound N#C/N=C(/NC)NCCSCC=1N=CNC=1C AQIXAKUUQRKLND-UHFFFAOYSA-N 0.000 description 3
- 229960001380 cimetidine Drugs 0.000 description 3
- 229960002173 citrulline Drugs 0.000 description 3
- ACSIXWWBWUQEHA-UHFFFAOYSA-N clodronic acid Chemical compound OP(O)(=O)C(Cl)(Cl)P(O)(O)=O ACSIXWWBWUQEHA-UHFFFAOYSA-N 0.000 description 3
- 229960002286 clodronic acid Drugs 0.000 description 3
- 239000011248 coating agent Substances 0.000 description 3
- 238000000576 coating method Methods 0.000 description 3
- LGZKGOGODCLQHG-UHFFFAOYSA-N combretastatin Natural products C1=C(O)C(OC)=CC=C1CC(O)C1=CC(OC)=C(OC)C(OC)=C1 LGZKGOGODCLQHG-UHFFFAOYSA-N 0.000 description 3
- 239000003246 corticosteroid Substances 0.000 description 3
- 229960001334 corticosteroids Drugs 0.000 description 3
- 229940109262 curcumin Drugs 0.000 description 3
- 235000012754 curcumin Nutrition 0.000 description 3
- 239000004148 curcumin Substances 0.000 description 3
- 229960000684 cytarabine Drugs 0.000 description 3
- GBOGMAARMMDZGR-JREHFAHYSA-N cytochalasin B Natural products C[C@H]1CCC[C@@H](O)C=CC(=O)O[C@@]23[C@H](C=CC1)[C@H](O)C(=C)[C@@H](C)[C@@H]2[C@H](Cc4ccccc4)NC3=O GBOGMAARMMDZGR-JREHFAHYSA-N 0.000 description 3
- GBOGMAARMMDZGR-TYHYBEHESA-N cytochalasin B Chemical compound C([C@H]1[C@@H]2[C@@H](C([C@@H](O)[C@@H]3/C=C/C[C@H](C)CCC[C@@H](O)/C=C/C(=O)O[C@@]23C(=O)N1)=C)C)C1=CC=CC=C1 GBOGMAARMMDZGR-TYHYBEHESA-N 0.000 description 3
- 230000001085 cytostatic effect Effects 0.000 description 3
- ORDAZKGHSNRHTD-UXHICEINSA-N deguelin Chemical compound O1C(C)(C)C=CC2=C1C=CC1=C2O[C@@H]2COC(C=C(C(=C3)OC)OC)=C3[C@@H]2C1=O ORDAZKGHSNRHTD-UXHICEINSA-N 0.000 description 3
- FHIVAFMUCKRCQO-UHFFFAOYSA-N diazinon Chemical compound CCOP(=S)(OCC)OC1=CC(C)=NC(C(C)C)=N1 FHIVAFMUCKRCQO-UHFFFAOYSA-N 0.000 description 3
- VFLDPWHFBUODDF-UHFFFAOYSA-N diferuloylmethane Natural products C1=C(O)C(OC)=CC(C=CC(=O)CC(=O)C=CC=2C=C(OC)C(O)=CC=2)=C1 VFLDPWHFBUODDF-UHFFFAOYSA-N 0.000 description 3
- VSJKWCGYPAHWDS-UHFFFAOYSA-N dl-camptothecin Natural products C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-UHFFFAOYSA-N 0.000 description 3
- AMRJKAQTDDKMCE-UHFFFAOYSA-N dolastatin Chemical compound CC(C)C(N(C)C)C(=O)NC(C(C)C)C(=O)N(C)C(C(C)C)C(OC)CC(=O)N1CCCC1C(OC)C(C)C(=O)NC(C=1SC=CN=1)CC1=CC=CC=C1 AMRJKAQTDDKMCE-UHFFFAOYSA-N 0.000 description 3
- 229930188854 dolastatin Natural products 0.000 description 3
- VQNATVDKACXKTF-XELLLNAOSA-N duocarmycin Chemical class COC1=C(OC)C(OC)=C2NC(C(=O)N3C4=CC(=O)C5=C([C@@]64C[C@@H]6C3)C=C(N5)C(=O)OC)=CC2=C1 VQNATVDKACXKTF-XELLLNAOSA-N 0.000 description 3
- 229960002694 emetine Drugs 0.000 description 3
- AUVVAXYIELKVAI-CKBKHPSWSA-N emetine Chemical compound N1CCC2=CC(OC)=C(OC)C=C2[C@H]1C[C@H]1C[C@H]2C3=CC(OC)=C(OC)C=C3CCN2C[C@@H]1CC AUVVAXYIELKVAI-CKBKHPSWSA-N 0.000 description 3
- AUVVAXYIELKVAI-UWBTVBNJSA-N emetine Natural products N1CCC2=CC(OC)=C(OC)C=C2[C@H]1C[C@H]1C[C@H]2C3=CC(OC)=C(OC)C=C3CCN2C[C@H]1CC AUVVAXYIELKVAI-UWBTVBNJSA-N 0.000 description 3
- HKSZLNNOFSGOKW-UHFFFAOYSA-N ent-staurosporine Natural products C12=C3N4C5=CC=CC=C5C3=C3CNC(=O)C3=C2C2=CC=CC=C2N1C1CC(NC)C(OC)C4(C)O1 HKSZLNNOFSGOKW-UHFFFAOYSA-N 0.000 description 3
- 229940125532 enzyme inhibitor Drugs 0.000 description 3
- 108010087914 epidermal growth factor receptor VIII Proteins 0.000 description 3
- YJGVMLPVUAXIQN-UHFFFAOYSA-N epipodophyllotoxin Natural products COC1=C(OC)C(OC)=CC(C2C3=CC=4OCOC=4C=C3C(O)C3C2C(OC3)=O)=C1 YJGVMLPVUAXIQN-UHFFFAOYSA-N 0.000 description 3
- 229940011871 estrogen Drugs 0.000 description 3
- 239000000262 estrogen Substances 0.000 description 3
- 239000000328 estrogen antagonist Substances 0.000 description 3
- 229960005542 ethidium bromide Drugs 0.000 description 3
- ZMMJGEGLRURXTF-UHFFFAOYSA-N ethidium bromide Chemical compound [Br-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CC)=C1C1=CC=CC=C1 ZMMJGEGLRURXTF-UHFFFAOYSA-N 0.000 description 3
- 229960005420 etoposide Drugs 0.000 description 3
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 3
- 239000013604 expression vector Substances 0.000 description 3
- 229960000390 fludarabine Drugs 0.000 description 3
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 3
- 229960004421 formestane Drugs 0.000 description 3
- OSVMTWJCGUFAOD-KZQROQTASA-N formestane Chemical compound O=C1CC[C@]2(C)[C@H]3CC[C@](C)(C(CC4)=O)[C@@H]4[C@@H]3CCC2=C1O OSVMTWJCGUFAOD-KZQROQTASA-N 0.000 description 3
- NGGMYCMLYOUNGM-CSDLUJIJSA-N fumagillin Chemical compound C([C@H]([C@H]([C@@H]1[C@]2(C)[C@H](O2)CC=C(C)C)OC)OC(=O)\C=C\C=C\C=C\C=C\C(O)=O)C[C@@]21CO2 NGGMYCMLYOUNGM-CSDLUJIJSA-N 0.000 description 3
- 229960000936 fumagillin Drugs 0.000 description 3
- 230000002496 gastric effect Effects 0.000 description 3
- 239000008273 gelatin Substances 0.000 description 3
- 229920000159 gelatin Polymers 0.000 description 3
- 235000019322 gelatine Nutrition 0.000 description 3
- 235000011852 gelatine desserts Nutrition 0.000 description 3
- QTQAWLPCGQOSGP-GBTDJJJQSA-N geldanamycin Chemical compound N1C(=O)\C(C)=C/C=C\[C@@H](OC)[C@H](OC(N)=O)\C(C)=C/[C@@H](C)[C@@H](O)[C@H](OC)C[C@@H](C)CC2=C(OC)C(=O)C=C1C2=O QTQAWLPCGQOSGP-GBTDJJJQSA-N 0.000 description 3
- 238000001415 gene therapy Methods 0.000 description 3
- 229940045109 genistein Drugs 0.000 description 3
- TZBJGXHYKVUXJN-UHFFFAOYSA-N genistein Natural products C1=CC(O)=CC=C1C1=COC2=CC(O)=CC(O)=C2C1=O TZBJGXHYKVUXJN-UHFFFAOYSA-N 0.000 description 3
- 235000006539 genistein Nutrition 0.000 description 3
- ZCOLJUOHXJRHDI-CMWLGVBASA-N genistein 7-O-beta-D-glucoside Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=CC(O)=C2C(=O)C(C=3C=CC(O)=CC=3)=COC2=C1 ZCOLJUOHXJRHDI-CMWLGVBASA-N 0.000 description 3
- 208000007475 hemolytic anemia Diseases 0.000 description 3
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 3
- SGJNQVTUYXCBKH-HNQUOIGGSA-N hispidin Chemical compound O1C(=O)C=C(O)C=C1\C=C\C1=CC=C(O)C(O)=C1 SGJNQVTUYXCBKH-HNQUOIGGSA-N 0.000 description 3
- SGJNQVTUYXCBKH-UHFFFAOYSA-N hispidin Natural products O1C(=O)C=C(O)C=C1C=CC1=CC=C(O)C(O)=C1 SGJNQVTUYXCBKH-UHFFFAOYSA-N 0.000 description 3
- 150000007857 hydrazones Chemical class 0.000 description 3
- HOMGKSMUEGBAAB-UHFFFAOYSA-N ifosfamide Chemical compound ClCCNP1(=O)OCCCN1CCCl HOMGKSMUEGBAAB-UHFFFAOYSA-N 0.000 description 3
- 229960001101 ifosfamide Drugs 0.000 description 3
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Substances C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 3
- 229940072221 immunoglobulins Drugs 0.000 description 3
- 229940121354 immunomodulator Drugs 0.000 description 3
- 230000002584 immunomodulator Effects 0.000 description 3
- 230000003834 intracellular effect Effects 0.000 description 3
- 229960005280 isotretinoin Drugs 0.000 description 3
- GFIJNRVAKGFPGQ-LIJARHBVSA-N leuprolide Chemical compound CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=CC=C(O)C=C1 GFIJNRVAKGFPGQ-LIJARHBVSA-N 0.000 description 3
- 229960004338 leuprorelin Drugs 0.000 description 3
- 229960004194 lidocaine Drugs 0.000 description 3
- PCZOHLXUXFIOCF-BXMDZJJMSA-N lovastatin Chemical compound C([C@H]1[C@@H](C)C=CC2=C[C@H](C)C[C@@H]([C@H]12)OC(=O)[C@@H](C)CC)C[C@@H]1C[C@@H](O)CC(=O)O1 PCZOHLXUXFIOCF-BXMDZJJMSA-N 0.000 description 3
- QLJODMDSTUBWDW-UHFFFAOYSA-N lovastatin hydroxy acid Natural products C1=CC(C)C(CCC(O)CC(O)CC(O)=O)C2C(OC(=O)C(C)CC)CC(C)C=C21 QLJODMDSTUBWDW-UHFFFAOYSA-N 0.000 description 3
- 230000003211 malignant effect Effects 0.000 description 3
- 238000013507 mapping Methods 0.000 description 3
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical compound ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 3
- 229960004961 mechlorethamine Drugs 0.000 description 3
- 239000002609 medium Substances 0.000 description 3
- 229960003987 melatonin Drugs 0.000 description 3
- DRLFMBDRBRZALE-UHFFFAOYSA-N melatonin Chemical compound COC1=CC=C2NC=C(CCNC(C)=O)C2=C1 DRLFMBDRBRZALE-UHFFFAOYSA-N 0.000 description 3
- 229960001428 mercaptopurine Drugs 0.000 description 3
- 108020004999 messenger RNA Proteins 0.000 description 3
- 229960003248 mifepristone Drugs 0.000 description 3
- VKHAHZOOUSRJNA-GCNJZUOMSA-N mifepristone Chemical compound C1([C@@H]2C3=C4CCC(=O)C=C4CC[C@H]3[C@@H]3CC[C@@]([C@]3(C2)C)(O)C#CC)=CC=C(N(C)C)C=C1 VKHAHZOOUSRJNA-GCNJZUOMSA-N 0.000 description 3
- DYKFCLLONBREIL-KVUCHLLUSA-N minocycline Chemical compound C([C@H]1C2)C3=C(N(C)C)C=CC(O)=C3C(=O)C1=C(O)[C@@]1(O)[C@@H]2[C@H](N(C)C)C(O)=C(C(N)=O)C1=O DYKFCLLONBREIL-KVUCHLLUSA-N 0.000 description 3
- 229960004023 minocycline Drugs 0.000 description 3
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 3
- 229960001156 mitoxantrone Drugs 0.000 description 3
- QZGIWPZCWHMVQL-UIYAJPBUSA-N neocarzinostatin chromophore Chemical compound O1[C@H](C)[C@H](O)[C@H](O)[C@@H](NC)[C@H]1O[C@@H]1C/2=C/C#C[C@H]3O[C@@]3([C@@H]3OC(=O)OC3)C#CC\2=C[C@H]1OC(=O)C1=C(O)C=CC2=C(C)C=C(OC)C=C12 QZGIWPZCWHMVQL-UIYAJPBUSA-N 0.000 description 3
- OSTGTTZJOCZWJG-UHFFFAOYSA-N nitrosourea Chemical class NC(=O)N=NO OSTGTTZJOCZWJG-UHFFFAOYSA-N 0.000 description 3
- 229950006344 nocodazole Drugs 0.000 description 3
- 239000003865 nucleic acid synthesis inhibitor Substances 0.000 description 3
- 150000003833 nucleoside derivatives Chemical class 0.000 description 3
- 125000003835 nucleoside group Chemical group 0.000 description 3
- 210000000056 organ Anatomy 0.000 description 3
- 229960001592 paclitaxel Drugs 0.000 description 3
- HAGVCKULCLQGRF-UHFFFAOYSA-N pifithrin Chemical compound [Br-].C1=CC(C)=CC=C1C(=O)CN1[C+](N)SC2=C1CCCC2 HAGVCKULCLQGRF-UHFFFAOYSA-N 0.000 description 3
- 229960001237 podophyllotoxin Drugs 0.000 description 3
- YJGVMLPVUAXIQN-XVVDYKMHSA-N podophyllotoxin Chemical compound COC1=C(OC)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@H](O)[C@@H]3[C@@H]2C(OC3)=O)=C1 YJGVMLPVUAXIQN-XVVDYKMHSA-N 0.000 description 3
- YVCVYCSAAZQOJI-UHFFFAOYSA-N podophyllotoxin Natural products COC1=C(O)C(OC)=CC(C2C3=CC=4OCOC=4C=C3C(O)C3C2C(OC3)=O)=C1 YVCVYCSAAZQOJI-UHFFFAOYSA-N 0.000 description 3
- 239000002243 precursor Substances 0.000 description 3
- MFDFERRIHVXMIY-UHFFFAOYSA-N procaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1 MFDFERRIHVXMIY-UHFFFAOYSA-N 0.000 description 3
- 229960004919 procaine Drugs 0.000 description 3
- 239000000583 progesterone congener Substances 0.000 description 3
- 229960003712 propranolol Drugs 0.000 description 3
- 239000003207 proteasome inhibitor Substances 0.000 description 3
- CPNGPNLZQNNVQM-UHFFFAOYSA-N pteridine Chemical compound N1=CN=CC2=NC=CN=C21 CPNGPNLZQNNVQM-UHFFFAOYSA-N 0.000 description 3
- 229950010131 puromycin Drugs 0.000 description 3
- 150000004059 quinone derivatives Chemical class 0.000 description 3
- 230000002285 radioactive effect Effects 0.000 description 3
- 229960004622 raloxifene Drugs 0.000 description 3
- GZUITABIAKMVPG-UHFFFAOYSA-N raloxifene Chemical compound C1=CC(O)=CC=C1C1=C(C(=O)C=2C=CC(OCCN3CCCCC3)=CC=2)C2=CC=C(O)C=C2S1 GZUITABIAKMVPG-UHFFFAOYSA-N 0.000 description 3
- ZAHRKKWIAAJSAO-UHFFFAOYSA-N rapamycin Natural products COCC(O)C(=C/C(C)C(=O)CC(OC(=O)C1CCCCN1C(=O)C(=O)C2(O)OC(CC(OC)C(=CC=CC=CC(C)CC(C)C(=O)C)C)CCC2C)C(C)CC3CCC(O)C(C3)OC)C ZAHRKKWIAAJSAO-UHFFFAOYSA-N 0.000 description 3
- 229930002330 retinoic acid Natural products 0.000 description 3
- 229960003471 retinol Drugs 0.000 description 3
- 235000020944 retinol Nutrition 0.000 description 3
- 239000011607 retinol Substances 0.000 description 3
- OWPCHSCAPHNHAV-LMONGJCWSA-N rhizoxin Chemical compound C/C([C@H](OC)[C@@H](C)[C@@H]1C[C@H](O)[C@]2(C)O[C@@H]2/C=C/[C@@H](C)[C@]2([H])OC(=O)C[C@@](C2)(C[C@@H]2O[C@H]2C(=O)O1)[H])=C\C=C\C(\C)=C\C1=COC(C)=N1 OWPCHSCAPHNHAV-LMONGJCWSA-N 0.000 description 3
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 3
- 150000003839 salts Chemical class 0.000 description 3
- 229960002930 sirolimus Drugs 0.000 description 3
- QFJCIRLUMZQUOT-HPLJOQBZSA-N sirolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 QFJCIRLUMZQUOT-HPLJOQBZSA-N 0.000 description 3
- HKSZLNNOFSGOKW-FYTWVXJKSA-N staurosporine Chemical compound C12=C3N4C5=CC=CC=C5C3=C3CNC(=O)C3=C2C2=CC=CC=C2N1[C@H]1C[C@@H](NC)[C@@H](OC)[C@]4(C)O1 HKSZLNNOFSGOKW-FYTWVXJKSA-N 0.000 description 3
- CGPUWJWCVCFERF-UHFFFAOYSA-N staurosporine Natural products C12=C3N4C5=CC=CC=C5C3=C3CNC(=O)C3=C2C2=CC=CC=C2N1C1CC(NC)C(OC)C4(OC)O1 CGPUWJWCVCFERF-UHFFFAOYSA-N 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 229960001603 tamoxifen Drugs 0.000 description 3
- AYUNIORJHRXIBJ-TXHRRWQRSA-N tanespimycin Chemical compound N1C(=O)\C(C)=C\C=C/[C@H](OC)[C@@H](OC(N)=O)\C(C)=C\[C@H](C)[C@@H](O)[C@@H](OC)C[C@H](C)CC2=C(NCC=C)C(=O)C=C1C2=O AYUNIORJHRXIBJ-TXHRRWQRSA-N 0.000 description 3
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 3
- GKCBAIGFKIBETG-UHFFFAOYSA-N tetracaine Chemical compound CCCCNC1=CC=C(C(=O)OCCN(C)C)C=C1 GKCBAIGFKIBETG-UHFFFAOYSA-N 0.000 description 3
- 229960002372 tetracaine Drugs 0.000 description 3
- IXFPJGBNCFXKPI-FSIHEZPISA-N thapsigargin Chemical compound CCCC(=O)O[C@H]1C[C@](C)(OC(C)=O)[C@H]2[C@H](OC(=O)CCCCCCC)[C@@H](OC(=O)C(\C)=C/C)C(C)=C2[C@@H]2OC(=O)[C@@](C)(O)[C@]21O IXFPJGBNCFXKPI-FSIHEZPISA-N 0.000 description 3
- 229960000303 topotecan Drugs 0.000 description 3
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 3
- 238000013518 transcription Methods 0.000 description 3
- 230000035897 transcription Effects 0.000 description 3
- 230000026683 transduction Effects 0.000 description 3
- 238000010361 transduction Methods 0.000 description 3
- 230000001052 transient effect Effects 0.000 description 3
- 229960001727 tretinoin Drugs 0.000 description 3
- RTKIYFITIVXBLE-QEQCGCAPSA-N trichostatin A Chemical compound ONC(=O)/C=C/C(/C)=C/[C@@H](C)C(=O)C1=CC=C(N(C)C)C=C1 RTKIYFITIVXBLE-QEQCGCAPSA-N 0.000 description 3
- 229960001641 troglitazone Drugs 0.000 description 3
- GXPHKUHSUJUWKP-UHFFFAOYSA-N troglitazone Chemical compound C1CC=2C(C)=C(O)C(C)=C(C)C=2OC1(C)COC(C=C1)=CC=C1CC1SC(=O)NC1=O GXPHKUHSUJUWKP-UHFFFAOYSA-N 0.000 description 3
- GXPHKUHSUJUWKP-NTKDMRAZSA-N troglitazone Natural products C([C@@]1(OC=2C(C)=C(C(=C(C)C=2CC1)O)C)C)OC(C=C1)=CC=C1C[C@H]1SC(=O)NC1=O GXPHKUHSUJUWKP-NTKDMRAZSA-N 0.000 description 3
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 3
- 238000012795 verification Methods 0.000 description 3
- 229960003636 vidarabine Drugs 0.000 description 3
- NCYCYZXNIZJOKI-UHFFFAOYSA-N vitamin A aldehyde Natural products O=CC=C(C)C=CC=C(C)C=CC1=C(C)CCCC1(C)C NCYCYZXNIZJOKI-UHFFFAOYSA-N 0.000 description 3
- QYSXJUFSXHHAJI-YRZJJWOYSA-N vitamin D3 Chemical compound C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@H](C)CCCC(C)C)=C\C=C1\C[C@@H](O)CCC1=C QYSXJUFSXHHAJI-YRZJJWOYSA-N 0.000 description 3
- 235000005282 vitamin D3 Nutrition 0.000 description 3
- 239000011647 vitamin D3 Substances 0.000 description 3
- 229940021056 vitamin d3 Drugs 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- 229950009268 zinostatin Drugs 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical group N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- VEVRNHHLCPGNDU-MUGJNUQGSA-N (2s)-2-amino-5-[1-[(5s)-5-amino-5-carboxypentyl]-3,5-bis[(3s)-3-amino-3-carboxypropyl]pyridin-1-ium-4-yl]pentanoate Chemical class OC(=O)[C@@H](N)CCCC[N+]1=CC(CC[C@H](N)C(O)=O)=C(CCC[C@H](N)C([O-])=O)C(CC[C@H](N)C(O)=O)=C1 VEVRNHHLCPGNDU-MUGJNUQGSA-N 0.000 description 2
- NKIJBSVPDYIEAT-UHFFFAOYSA-N 1,4,7,10-tetrazacyclododec-10-ene Chemical compound C1CNCCN=CCNCCN1 NKIJBSVPDYIEAT-UHFFFAOYSA-N 0.000 description 2
- MRLKMCJVGAIGGE-UHFFFAOYSA-N 1,4,8,11-tetrazacyclotetradec-10-ene Chemical compound C1CNCCNCCCN=CCNC1 MRLKMCJVGAIGGE-UHFFFAOYSA-N 0.000 description 2
- VBICKXHEKHSIBG-UHFFFAOYSA-N 1-monostearoylglycerol Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCC(O)CO VBICKXHEKHSIBG-UHFFFAOYSA-N 0.000 description 2
- LQILVUYCDHSGEU-UHFFFAOYSA-N 4-[(2,5-dioxopyrrol-1-yl)methyl]cyclohexane-1-carboxylic acid Chemical compound C1CC(C(=O)O)CCC1CN1C(=O)C=CC1=O LQILVUYCDHSGEU-UHFFFAOYSA-N 0.000 description 2
- 101100330727 Arabidopsis thaliana DAR6 gene Proteins 0.000 description 2
- 206010003827 Autoimmune hepatitis Diseases 0.000 description 2
- 208000023328 Basedow disease Diseases 0.000 description 2
- 101100314454 Caenorhabditis elegans tra-1 gene Proteins 0.000 description 2
- 241000282832 Camelidae Species 0.000 description 2
- 241000282836 Camelus dromedarius Species 0.000 description 2
- 102100028757 Chondroitin sulfate proteoglycan 4 Human genes 0.000 description 2
- 206010009900 Colitis ulcerative Diseases 0.000 description 2
- 208000011231 Crohn disease Diseases 0.000 description 2
- 101150034590 DAR1 gene Proteins 0.000 description 2
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 2
- 241000282326 Felis catus Species 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- 208000015023 Graves' disease Diseases 0.000 description 2
- 208000001204 Hashimoto Disease Diseases 0.000 description 2
- 208000030836 Hashimoto thyroiditis Diseases 0.000 description 2
- 101000916489 Homo sapiens Chondroitin sulfate proteoglycan 4 Proteins 0.000 description 2
- 101001117317 Homo sapiens Programmed cell death 1 ligand 1 Proteins 0.000 description 2
- 101000938391 Homo sapiens Transmembrane protein Proteins 0.000 description 2
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 2
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 2
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 2
- 108091092195 Intron Proteins 0.000 description 2
- 125000000393 L-methionino group Chemical group [H]OC(=O)[C@@]([H])(N([H])[*])C([H])([H])C(SC([H])([H])[H])([H])[H] 0.000 description 2
- 108060001084 Luciferase Proteins 0.000 description 2
- 239000005089 Luciferase Substances 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- 206010028665 Myxoedema Diseases 0.000 description 2
- 208000001894 Nasopharyngeal Neoplasms Diseases 0.000 description 2
- 206010061306 Nasopharyngeal cancer Diseases 0.000 description 2
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 206010034038 Parotitis Diseases 0.000 description 2
- 201000011152 Pemphigus Diseases 0.000 description 2
- 101710094000 Programmed cell death 1 ligand 1 Proteins 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- 201000004681 Psoriasis Diseases 0.000 description 2
- 208000015634 Rectal Neoplasms Diseases 0.000 description 2
- 101100393304 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GPD1 gene Proteins 0.000 description 2
- 206010039491 Sarcoma Diseases 0.000 description 2
- 206010039710 Scleroderma Diseases 0.000 description 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 2
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 229920002472 Starch Polymers 0.000 description 2
- 108010000449 TNF-Related Apoptosis-Inducing Ligand Receptors Proteins 0.000 description 2
- 102000002259 TNF-Related Apoptosis-Inducing Ligand Receptors Human genes 0.000 description 2
- 208000024313 Testicular Neoplasms Diseases 0.000 description 2
- 206010057644 Testis cancer Diseases 0.000 description 2
- 101000980463 Treponema pallidum (strain Nichols) Chaperonin GroEL Proteins 0.000 description 2
- 208000003721 Triple Negative Breast Neoplasms Diseases 0.000 description 2
- 201000006704 Ulcerative Colitis Diseases 0.000 description 2
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 2
- 108091008605 VEGF receptors Proteins 0.000 description 2
- 102000009484 Vascular Endothelial Growth Factor Receptors Human genes 0.000 description 2
- 206010047115 Vasculitis Diseases 0.000 description 2
- 241000700605 Viruses Species 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 238000001261 affinity purification Methods 0.000 description 2
- 125000001931 aliphatic group Chemical group 0.000 description 2
- 150000008064 anhydrides Chemical class 0.000 description 2
- 230000000890 antigenic effect Effects 0.000 description 2
- 230000001363 autoimmune Effects 0.000 description 2
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 2
- 208000002458 carcinoid tumor Diseases 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 239000006143 cell culture medium Substances 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 239000007795 chemical reaction product Substances 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 238000009643 clonogenic assay Methods 0.000 description 2
- 231100000096 clonogenic assay Toxicity 0.000 description 2
- 208000029742 colonic neoplasm Diseases 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 239000012228 culture supernatant Substances 0.000 description 2
- 229940127089 cytotoxic agent Drugs 0.000 description 2
- 231100000599 cytotoxic agent Toxicity 0.000 description 2
- 239000002619 cytotoxin Substances 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 206010012601 diabetes mellitus Diseases 0.000 description 2
- 230000004069 differentiation Effects 0.000 description 2
- 238000004043 dyeing Methods 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 230000002255 enzymatic effect Effects 0.000 description 2
- 150000002148 esters Chemical class 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- 239000000945 filler Substances 0.000 description 2
- 239000007903 gelatin capsule Substances 0.000 description 2
- 150000004676 glycans Chemical class 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- 210000004408 hybridoma Anatomy 0.000 description 2
- 238000003364 immunohistochemistry Methods 0.000 description 2
- 238000007901 in situ hybridization Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- 230000010354 integration Effects 0.000 description 2
- YACHGFWEQXFSBS-RJXCBBHPSA-N leptomycin Chemical class OC(=O)/C=C(C)/C[C@H](C)[C@@H](O)[C@H](C)C(=O)[C@H](C)/C=C(\C)/C=C/C[C@@H](C)\C=C(/CC)\C=C\[C@@H]1OC(=O)C=C[C@@H]1C YACHGFWEQXFSBS-RJXCBBHPSA-N 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 238000011068 loading method Methods 0.000 description 2
- 238000002595 magnetic resonance imaging Methods 0.000 description 2
- 125000005439 maleimidyl group Chemical group C1(C=CC(N1*)=O)=O 0.000 description 2
- 238000004949 mass spectrometry Methods 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 229910052751 metal Inorganic materials 0.000 description 2
- 239000002184 metal Substances 0.000 description 2
- 229910044991 metal oxide Inorganic materials 0.000 description 2
- 150000004706 metal oxides Chemical class 0.000 description 2
- 238000010232 migration assay Methods 0.000 description 2
- 201000006417 multiple sclerosis Diseases 0.000 description 2
- 238000002887 multiple sequence alignment Methods 0.000 description 2
- 206010028417 myasthenia gravis Diseases 0.000 description 2
- 208000003786 myxedema Diseases 0.000 description 2
- 201000001976 pemphigus vulgaris Diseases 0.000 description 2
- 230000000149 penetrating effect Effects 0.000 description 2
- 201000002628 peritoneum cancer Diseases 0.000 description 2
- 238000002428 photodynamic therapy Methods 0.000 description 2
- 239000002504 physiological saline solution Substances 0.000 description 2
- 229920001282 polysaccharide Polymers 0.000 description 2
- 239000005017 polysaccharide Substances 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 235000019833 protease Nutrition 0.000 description 2
- 238000011363 radioimmunotherapy Methods 0.000 description 2
- 206010038038 rectal cancer Diseases 0.000 description 2
- 201000001275 rectum cancer Diseases 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 201000000306 sarcoidosis Diseases 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 235000017281 sodium acetate Nutrition 0.000 description 2
- 239000001632 sodium acetate Substances 0.000 description 2
- 208000017572 squamous cell neoplasm Diseases 0.000 description 2
- 239000008107 starch Substances 0.000 description 2
- 235000019698 starch Nutrition 0.000 description 2
- 238000000547 structure data Methods 0.000 description 2
- 230000009885 systemic effect Effects 0.000 description 2
- 239000000454 talc Substances 0.000 description 2
- 229910052623 talc Inorganic materials 0.000 description 2
- 201000003120 testicular cancer Diseases 0.000 description 2
- 206010043778 thyroiditis Diseases 0.000 description 2
- 238000001890 transfection Methods 0.000 description 2
- 208000022679 triple-negative breast carcinoma Diseases 0.000 description 2
- 238000010200 validation analysis Methods 0.000 description 2
- 230000003612 virological effect Effects 0.000 description 2
- RQJMOCIAILRHIC-JUUVMNCLSA-N (2s)-2-amino-4-methylpentanoic acid;(2s)-2-amino-3-phenylpropanoic acid Chemical compound CC(C)C[C@H](N)C(O)=O.OC(=O)[C@@H](N)CC1=CC=CC=C1 RQJMOCIAILRHIC-JUUVMNCLSA-N 0.000 description 1
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 1
- KFBVMHSLZBTTAQ-UHFFFAOYSA-N (pyridin-2-yldisulfanyl) butanoate Chemical compound C(CCC)(=O)OSSC1=NC=CC=C1 KFBVMHSLZBTTAQ-UHFFFAOYSA-N 0.000 description 1
- UDOPJKHABYSVIX-UHFFFAOYSA-N 2-[4,7,10-tris(carboxymethyl)-6-[(4-isothiocyanatophenyl)methyl]-1,4,7,10-tetrazacyclododec-1-yl]acetic acid Chemical compound C1N(CC(O)=O)CCN(CC(=O)O)CCN(CC(O)=O)CCN(CC(O)=O)C1CC1=CC=C(N=C=S)C=C1 UDOPJKHABYSVIX-UHFFFAOYSA-N 0.000 description 1
- PTUJJIPXBJJLLV-UHFFFAOYSA-N 2-[[2-[[2-[[2-[(2-methylpropan-2-yl)oxycarbonylamino]acetyl]amino]acetyl]amino]-3-phenylpropanoyl]amino]acetic acid Chemical compound CC(C)(C)OC(=O)NCC(=O)NCC(=O)NC(C(=O)NCC(O)=O)CC1=CC=CC=C1 PTUJJIPXBJJLLV-UHFFFAOYSA-N 0.000 description 1
- GOJUJUVQIVIZAV-UHFFFAOYSA-N 2-amino-4,6-dichloropyrimidine-5-carbaldehyde Chemical group NC1=NC(Cl)=C(C=O)C(Cl)=N1 GOJUJUVQIVIZAV-UHFFFAOYSA-N 0.000 description 1
- YCTIVQHRJIAMKZ-UHFFFAOYSA-N 2-amino-4-(2-iodoacetyl)benzoic acid Chemical compound NC1=CC(C(=O)CI)=CC=C1C(O)=O YCTIVQHRJIAMKZ-UHFFFAOYSA-N 0.000 description 1
- NNPUPCNWEHWRPW-UHFFFAOYSA-N 4-(pyridin-2-yldisulfanyl)-2-sulfobutanoic acid Chemical compound OC(=O)C(S(O)(=O)=O)CCSSC1=CC=CC=N1 NNPUPCNWEHWRPW-UHFFFAOYSA-N 0.000 description 1
- HUDPLKWXRLNSPC-UHFFFAOYSA-N 4-aminophthalhydrazide Chemical compound O=C1NNC(=O)C=2C1=CC(N)=CC=2 HUDPLKWXRLNSPC-UHFFFAOYSA-N 0.000 description 1
- QCVGEOXPDFCNHA-UHFFFAOYSA-N 5,5-dimethyl-2,4-dioxo-1,3-oxazolidine-3-carboxamide Chemical compound CC1(C)OC(=O)N(C(N)=O)C1=O QCVGEOXPDFCNHA-UHFFFAOYSA-N 0.000 description 1
- YEEGWNXDUZONAA-UHFFFAOYSA-K 5-hydroxy-2,8,9-trioxa-1-gallabicyclo[3.3.2]decane-3,7,10-trione Chemical compound [Ga+3].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O YEEGWNXDUZONAA-UHFFFAOYSA-K 0.000 description 1
- 108010066676 Abrin Proteins 0.000 description 1
- 244000215068 Acacia senegal Species 0.000 description 1
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 1
- 108010000239 Aequorin Proteins 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 206010061424 Anal cancer Diseases 0.000 description 1
- 102100022014 Angiopoietin-1 receptor Human genes 0.000 description 1
- 206010002556 Ankylosing Spondylitis Diseases 0.000 description 1
- 244000303258 Annona diversifolia Species 0.000 description 1
- 235000002198 Annona diversifolia Nutrition 0.000 description 1
- 108010032595 Antibody Binding Sites Proteins 0.000 description 1
- 241000711404 Avian avulavirus 1 Species 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 1
- 208000003950 B-cell lymphoma Diseases 0.000 description 1
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 1
- 102100026189 Beta-galactosidase Human genes 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 101100481403 Bos taurus TIE1 gene Proteins 0.000 description 1
- 101710149863 C-C chemokine receptor type 4 Proteins 0.000 description 1
- 102100032976 CCR4-NOT transcription complex subunit 6 Human genes 0.000 description 1
- 101150013553 CD40 gene Proteins 0.000 description 1
- 108010021064 CTLA-4 Antigen Proteins 0.000 description 1
- 229940045513 CTLA4 antagonist Drugs 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 108010076119 Caseins Proteins 0.000 description 1
- 108090000994 Catalytic RNA Proteins 0.000 description 1
- 102000053642 Catalytic RNA Human genes 0.000 description 1
- 102000004225 Cathepsin B Human genes 0.000 description 1
- 108090000712 Cathepsin B Proteins 0.000 description 1
- 102000005600 Cathepsins Human genes 0.000 description 1
- 108010084457 Cathepsins Proteins 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- RZXLPPRPEOUENN-UHFFFAOYSA-N Chlorfenson Chemical compound C1=CC(Cl)=CC=C1OS(=O)(=O)C1=CC=C(Cl)C=C1 RZXLPPRPEOUENN-UHFFFAOYSA-N 0.000 description 1
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- JPVYNHNXODAKFH-UHFFFAOYSA-N Cu2+ Chemical compound [Cu+2] JPVYNHNXODAKFH-UHFFFAOYSA-N 0.000 description 1
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 1
- 101710112752 Cytotoxin Proteins 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- 238000012270 DNA recombination Methods 0.000 description 1
- 229940123780 DNA topoisomerase I inhibitor Drugs 0.000 description 1
- CYCGRDQQIOGCKX-UHFFFAOYSA-N Dehydro-luciferin Natural products OC(=O)C1=CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 CYCGRDQQIOGCKX-UHFFFAOYSA-N 0.000 description 1
- RPNUMPOLZDHAAY-UHFFFAOYSA-N Diethylenetriamine Chemical compound NCCNCCN RPNUMPOLZDHAAY-UHFFFAOYSA-N 0.000 description 1
- 102000016607 Diphtheria Toxin Human genes 0.000 description 1
- 108010053187 Diphtheria Toxin Proteins 0.000 description 1
- 229910052692 Dysprosium Inorganic materials 0.000 description 1
- 208000010975 Dystrophic epidermolysis bullosa Diseases 0.000 description 1
- 102000001301 EGF receptor Human genes 0.000 description 1
- 108060006698 EGF receptor Proteins 0.000 description 1
- 108010000912 Egg Proteins Proteins 0.000 description 1
- 102000002322 Egg Proteins Human genes 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 229910052691 Erbium Inorganic materials 0.000 description 1
- 241000701959 Escherichia virus Lambda Species 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 108091092566 Extrachromosomal DNA Proteins 0.000 description 1
- CWYNVVGOOAEACU-UHFFFAOYSA-N Fe2+ Chemical compound [Fe+2] CWYNVVGOOAEACU-UHFFFAOYSA-N 0.000 description 1
- 108010067306 Fibronectins Proteins 0.000 description 1
- 102000016359 Fibronectins Human genes 0.000 description 1
- BJGNCJDXODQBOB-UHFFFAOYSA-N Fivefly Luciferin Natural products OC(=O)C1CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 BJGNCJDXODQBOB-UHFFFAOYSA-N 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 229910052688 Gadolinium Inorganic materials 0.000 description 1
- 206010017993 Gastrointestinal neoplasms Diseases 0.000 description 1
- 208000031852 Gastrointestinal stromal cancer Diseases 0.000 description 1
- 206010018364 Glomerulonephritis Diseases 0.000 description 1
- 108010024636 Glutathione Proteins 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 208000035895 Guillain-Barré syndrome Diseases 0.000 description 1
- 229920000084 Gum arabic Polymers 0.000 description 1
- 206010066896 HER-2 positive gastric cancer Diseases 0.000 description 1
- 208000017891 HER2 positive breast carcinoma Diseases 0.000 description 1
- 108090001101 Hepsin Proteins 0.000 description 1
- 102000004989 Hepsin Human genes 0.000 description 1
- 208000009889 Herpes Simplex Diseases 0.000 description 1
- 229910052689 Holmium Inorganic materials 0.000 description 1
- 101000753291 Homo sapiens Angiopoietin-1 receptor Proteins 0.000 description 1
- 101000617725 Homo sapiens Pregnancy-specific beta-1-glycoprotein 2 Proteins 0.000 description 1
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 1
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 1
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 1
- SMQYOVYWPWASGU-UHFFFAOYSA-N Iocarmic acid Chemical compound OC(=O)C1=C(I)C(C(=O)NC)=C(I)C(NC(=O)CCCCC(=O)NC=2C(=C(C(=O)NC)C(I)=C(C(O)=O)C=2I)I)=C1I SMQYOVYWPWASGU-UHFFFAOYSA-N 0.000 description 1
- UXIGWFXRQKWHHA-UHFFFAOYSA-N Iotalamic acid Chemical compound CNC(=O)C1=C(I)C(NC(C)=O)=C(I)C(C(O)=O)=C1I UXIGWFXRQKWHHA-UHFFFAOYSA-N 0.000 description 1
- JXMIBUGMYLQZGO-UHFFFAOYSA-N Iotroxic acid Chemical compound OC(=O)C1=C(I)C=C(I)C(NC(=O)COCCOCCOCC(=O)NC=2C(=C(C(O)=O)C(I)=CC=2I)I)=C1I JXMIBUGMYLQZGO-UHFFFAOYSA-N 0.000 description 1
- 208000007766 Kaposi sarcoma Diseases 0.000 description 1
- 108010076876 Keratins Proteins 0.000 description 1
- 102000011782 Keratins Human genes 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 239000000232 Lipid Bilayer Substances 0.000 description 1
- DDWFXDSYGUXRAY-UHFFFAOYSA-N Luciferin Natural products CCc1c(C)c(CC2NC(=O)C(=C2C=C)C)[nH]c1Cc3[nH]c4C(=C5/NC(CC(=O)O)C(C)C5CC(=O)O)CC(=O)c4c3C DDWFXDSYGUXRAY-UHFFFAOYSA-N 0.000 description 1
- 108010091221 Lymphotoxin beta Receptor Proteins 0.000 description 1
- 102000018170 Lymphotoxin beta Receptor Human genes 0.000 description 1
- 241000282567 Macaca fascicularis Species 0.000 description 1
- 102100028198 Macrophage colony-stimulating factor 1 receptor Human genes 0.000 description 1
- 101710150918 Macrophage colony-stimulating factor 1 receptor Proteins 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- WAEMQWOKJMHJLA-UHFFFAOYSA-N Manganese(2+) Chemical compound [Mn+2] WAEMQWOKJMHJLA-UHFFFAOYSA-N 0.000 description 1
- 201000005505 Measles Diseases 0.000 description 1
- 206010027145 Melanocytic naevus Diseases 0.000 description 1
- 102000012750 Membrane Glycoproteins Human genes 0.000 description 1
- 108010090054 Membrane Glycoproteins Proteins 0.000 description 1
- 206010049567 Miller Fisher syndrome Diseases 0.000 description 1
- 240000002769 Morchella esculenta Species 0.000 description 1
- 235000002779 Morchella esculenta Nutrition 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 1
- GXCLVBGFBYZDAG-UHFFFAOYSA-N N-[2-(1H-indol-3-yl)ethyl]-N-methylprop-2-en-1-amine Chemical compound CN(CCC1=CNC2=C1C=CC=C2)CC=C GXCLVBGFBYZDAG-UHFFFAOYSA-N 0.000 description 1
- MBBZMMPHUWSWHV-BDVNFPICSA-N N-methylglucamine Chemical compound CNC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO MBBZMMPHUWSWHV-BDVNFPICSA-N 0.000 description 1
- 206010029260 Neuroblastoma Diseases 0.000 description 1
- 208000007256 Nevus Diseases 0.000 description 1
- VEQPNABPJHWNSG-UHFFFAOYSA-N Nickel(2+) Chemical compound [Ni+2] VEQPNABPJHWNSG-UHFFFAOYSA-N 0.000 description 1
- 108020004711 Nucleic Acid Probes Proteins 0.000 description 1
- 206010030113 Oedema Diseases 0.000 description 1
- 240000007594 Oryza sativa Species 0.000 description 1
- 235000007164 Oryza sativa Nutrition 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 108010053210 Phycocyanin Proteins 0.000 description 1
- 108010004729 Phycoerythrin Proteins 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 102100040678 Programmed cell death protein 1 Human genes 0.000 description 1
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 1
- 102000002067 Protein Subunits Human genes 0.000 description 1
- 108010001267 Protein Subunits Proteins 0.000 description 1
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 1
- 101000762949 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) Exotoxin A Proteins 0.000 description 1
- 101710100963 Receptor tyrosine-protein kinase erbB-4 Proteins 0.000 description 1
- 102100029981 Receptor tyrosine-protein kinase erbB-4 Human genes 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 208000006265 Renal cell carcinoma Diseases 0.000 description 1
- 241000702263 Reovirus sp. Species 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- 108010039491 Ricin Proteins 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 206010061934 Salivary gland cancer Diseases 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 208000021386 Sjogren Syndrome Diseases 0.000 description 1
- 206010041067 Small cell lung cancer Diseases 0.000 description 1
- 208000021712 Soft tissue sarcoma Diseases 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- 230000006044 T cell activation Effects 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 1
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 1
- 229910052771 Terbium Inorganic materials 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- 239000000365 Topoisomerase I Inhibitor Substances 0.000 description 1
- 108091023040 Transcription factor Proteins 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 108020004566 Transfer RNA Proteins 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 1
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 1
- 108091005906 Type I transmembrane proteins Proteins 0.000 description 1
- 208000037386 Typhoid Diseases 0.000 description 1
- 208000006593 Urologic Neoplasms Diseases 0.000 description 1
- 206010046865 Vaccinia virus infection Diseases 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Chemical compound CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 235000009392 Vitis Nutrition 0.000 description 1
- 241000219095 Vitis Species 0.000 description 1
- 206010047741 Vulval cancer Diseases 0.000 description 1
- 229910052769 Ytterbium Inorganic materials 0.000 description 1
- 239000000205 acacia gum Substances 0.000 description 1
- 235000010489 acacia gum Nutrition 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- DZBUGLKDJFMEHC-UHFFFAOYSA-N acridine Chemical class C1=CC=CC2=CC3=CC=CC=C3N=C21 DZBUGLKDJFMEHC-UHFFFAOYSA-N 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- FFINMCNLQNTKLU-UHFFFAOYSA-N adipiodone Chemical compound OC(=O)C1=C(I)C=C(I)C(NC(=O)CCCCC(=O)NC=2C(=C(C(O)=O)C(I)=CC=2I)I)=C1I FFINMCNLQNTKLU-UHFFFAOYSA-N 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 108010004469 allophycocyanin Proteins 0.000 description 1
- 208000004631 alopecia areata Diseases 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- YVPYQUNUQOZFHG-UHFFFAOYSA-N amidotrizoic acid Chemical compound CC(=O)NC1=C(I)C(NC(C)=O)=C(I)C(C(O)=O)=C1I YVPYQUNUQOZFHG-UHFFFAOYSA-N 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 201000007538 anal carcinoma Diseases 0.000 description 1
- 208000007502 anemia Diseases 0.000 description 1
- 230000000840 anti-viral effect Effects 0.000 description 1
- 239000004599 antimicrobial Substances 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 239000002216 antistatic agent Substances 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 206010003246 arthritis Diseases 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 230000006472 autoimmune response Effects 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- 230000001588 bifunctional effect Effects 0.000 description 1
- 229920000249 biocompatible polymer Polymers 0.000 description 1
- 230000008033 biological extinction Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 201000000053 blastoma Diseases 0.000 description 1
- 210000000601 blood cell Anatomy 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 238000007707 calorimetry Methods 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- 229910002091 carbon monoxide Inorganic materials 0.000 description 1
- 239000005018 casein Substances 0.000 description 1
- BECPQYXYKAMYBN-UHFFFAOYSA-N casein, tech. Chemical compound NCCCCC(C(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(CC(C)C)N=C(O)C(CCC(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(C(C)O)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(COP(O)(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(N)CC1=CC=CC=C1 BECPQYXYKAMYBN-UHFFFAOYSA-N 0.000 description 1
- 235000021240 caseins Nutrition 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 210000002421 cell wall Anatomy 0.000 description 1
- 230000009920 chelation Effects 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- BFGKITSFLPAWGI-UHFFFAOYSA-N chromium(3+) Chemical compound [Cr+3] BFGKITSFLPAWGI-UHFFFAOYSA-N 0.000 description 1
- XLJKHNWPARRRJB-UHFFFAOYSA-N cobalt(2+) Chemical compound [Co+2] XLJKHNWPARRRJB-UHFFFAOYSA-N 0.000 description 1
- 239000008119 colloidal silica Substances 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 238000012875 competitive assay Methods 0.000 description 1
- 230000006957 competitive inhibition Effects 0.000 description 1
- 239000008139 complexing agent Substances 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- NKLPQNGYXWVELD-UHFFFAOYSA-M coomassie brilliant blue Chemical compound [Na+].C1=CC(OCC)=CC=C1NC1=CC=C(C(=C2C=CC(C=C2)=[N+](CC)CC=2C=C(C=CC=2)S([O-])(=O)=O)C=2C=CC(=CC=2)N(CC)CC=2C=C(C=CC=2)S([O-])(=O)=O)C=C1 NKLPQNGYXWVELD-UHFFFAOYSA-M 0.000 description 1
- 230000001808 coupling effect Effects 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 1
- 210000004443 dendritic cell Anatomy 0.000 description 1
- 239000005547 deoxyribonucleotide Substances 0.000 description 1
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 230000003831 deregulation Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 238000002059 diagnostic imaging Methods 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 229960005423 diatrizoate Drugs 0.000 description 1
- 229960005156 digoxin Drugs 0.000 description 1
- 238000007865 diluting Methods 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- 231100000676 disease causative agent Toxicity 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 1
- 239000006196 drop Substances 0.000 description 1
- KBQHZAAAGSGFKK-UHFFFAOYSA-N dysprosium atom Chemical compound [Dy] KBQHZAAAGSGFKK-UHFFFAOYSA-N 0.000 description 1
- 235000014103 egg white Nutrition 0.000 description 1
- 210000000969 egg white Anatomy 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 201000008184 embryoma Diseases 0.000 description 1
- 201000003914 endometrial carcinoma Diseases 0.000 description 1
- 230000002357 endometrial effect Effects 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 208000004298 epidermolysis bullosa dystrophica Diseases 0.000 description 1
- 201000010063 epididymitis Diseases 0.000 description 1
- 206010015037 epilepsy Diseases 0.000 description 1
- UYAHIZSMUZPPFV-UHFFFAOYSA-N erbium Chemical compound [Er] UYAHIZSMUZPPFV-UHFFFAOYSA-N 0.000 description 1
- DNJIEGIFACGWOD-UHFFFAOYSA-N ethyl mercaptane Natural products CCS DNJIEGIFACGWOD-UHFFFAOYSA-N 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- 210000003495 flagella Anatomy 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 235000013312 flour Nutrition 0.000 description 1
- ZFKJVJIDPQDDFY-UHFFFAOYSA-N fluorescamine Chemical compound C12=CC=CC=C2C(=O)OC1(C1=O)OC=C1C1=CC=CC=C1 ZFKJVJIDPQDDFY-UHFFFAOYSA-N 0.000 description 1
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- 238000009432 framing Methods 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- 210000004475 gamma-delta t lymphocyte Anatomy 0.000 description 1
- 238000003209 gene knockout Methods 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 1
- YQEMORVAKMFKLG-UHFFFAOYSA-N glycerine monostearate Natural products CCCCCCCCCCCCCCCCCC(=O)OC(CO)CO YQEMORVAKMFKLG-UHFFFAOYSA-N 0.000 description 1
- SVUQHVRAGMNPLW-UHFFFAOYSA-N glycerol monostearate Natural products CCCCCCCCCCCCCCCCC(=O)OCC(O)CO SVUQHVRAGMNPLW-UHFFFAOYSA-N 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 201000009277 hairy cell leukemia Diseases 0.000 description 1
- 230000002440 hepatic effect Effects 0.000 description 1
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 1
- KJZYNXUDTRRSPN-UHFFFAOYSA-N holmium atom Chemical compound [Ho] KJZYNXUDTRRSPN-UHFFFAOYSA-N 0.000 description 1
- 102000048776 human CD274 Human genes 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 150000002460 imidazoles Chemical class 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 230000009851 immunogenic response Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 239000000411 inducer Substances 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 102000014909 interleukin-1 receptor activity proteins Human genes 0.000 description 1
- 108040006732 interleukin-1 receptor activity proteins Proteins 0.000 description 1
- 230000004068 intracellular signaling Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 229960002517 iocarmic acid Drugs 0.000 description 1
- 229940029355 iodipamide Drugs 0.000 description 1
- 229960000929 iotalamic acid Drugs 0.000 description 1
- 229960000506 iotroxic acid Drugs 0.000 description 1
- 229910052742 iron Inorganic materials 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 229910052747 lanthanoid Inorganic materials 0.000 description 1
- 150000002602 lanthanoids Chemical class 0.000 description 1
- 206010024217 lentigo Diseases 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 230000031700 light absorption Effects 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 239000007937 lozenge Substances 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- HWYHZTIRURJOHG-UHFFFAOYSA-N luminol Chemical compound O=C1NNC(=O)C2=C1C(N)=CC=C2 HWYHZTIRURJOHG-UHFFFAOYSA-N 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 201000005249 lung adenocarcinoma Diseases 0.000 description 1
- 206010025135 lupus erythematosus Diseases 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 239000008176 lyophilized powder Substances 0.000 description 1
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 230000002132 lysosomal effect Effects 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 238000001819 mass spectrum Methods 0.000 description 1
- 238000013160 medical therapy Methods 0.000 description 1
- 229960003194 meglumine Drugs 0.000 description 1
- 230000001394 metastastic effect Effects 0.000 description 1
- 206010061289 metastatic neoplasm Diseases 0.000 description 1
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 239000003607 modifier Substances 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 210000000581 natural killer T-cell Anatomy 0.000 description 1
- QEFYFXOXNSNQGX-UHFFFAOYSA-N neodymium atom Chemical compound [Nd] QEFYFXOXNSNQGX-UHFFFAOYSA-N 0.000 description 1
- 230000001613 neoplastic effect Effects 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 238000010606 normalization Methods 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 239000002853 nucleic acid probe Substances 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 244000309459 oncolytic virus Species 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 229940043515 other immunoglobulins in atc Drugs 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 150000003891 oxalate salts Chemical class 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 230000001590 oxidative effect Effects 0.000 description 1
- WKMKTIVRRLOHAJ-UHFFFAOYSA-N oxygen(2-);thallium(1+) Chemical compound [O-2].[Tl+].[Tl+] WKMKTIVRRLOHAJ-UHFFFAOYSA-N 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 208000030940 penile carcinoma Diseases 0.000 description 1
- 201000008174 penis carcinoma Diseases 0.000 description 1
- 239000003208 petroleum Substances 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- ZWLUXSQADUDCSB-UHFFFAOYSA-N phthalaldehyde Chemical compound O=CC1=CC=CC=C1C=O ZWLUXSQADUDCSB-UHFFFAOYSA-N 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 229940012957 plasmin Drugs 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 238000006116 polymerization reaction Methods 0.000 description 1
- 208000017805 post-transplant lymphoproliferative disease Diseases 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 229940002612 prodrug Drugs 0.000 description 1
- 239000000651 prodrug Substances 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- XJMOSONTPMZWPB-UHFFFAOYSA-M propidium iodide Chemical compound [I-].[I-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CCC[N+](C)(CC)CC)=C1C1=CC=CC=C1 XJMOSONTPMZWPB-UHFFFAOYSA-M 0.000 description 1
- QQONPFPTGQHPMA-UHFFFAOYSA-N propylene Natural products CC=C QQONPFPTGQHPMA-UHFFFAOYSA-N 0.000 description 1
- 125000004805 propylene group Chemical group [H]C([H])([H])C([H])([*:1])C([H])([H])[*:2] 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 239000012460 protein solution Substances 0.000 description 1
- 230000005180 public health Effects 0.000 description 1
- 239000012521 purified sample Substances 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 201000003068 rheumatic fever Diseases 0.000 description 1
- 206010039073 rheumatoid arthritis Diseases 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 108020004418 ribosomal RNA Proteins 0.000 description 1
- 238000002702 ribosome display Methods 0.000 description 1
- 108091092562 ribozyme Proteins 0.000 description 1
- 235000009566 rice Nutrition 0.000 description 1
- 201000003804 salivary gland carcinoma Diseases 0.000 description 1
- DOSGOCSVHPUUIA-UHFFFAOYSA-N samarium(3+) Chemical compound [Sm+3] DOSGOCSVHPUUIA-UHFFFAOYSA-N 0.000 description 1
- 230000037390 scarring Effects 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 238000007086 side reaction Methods 0.000 description 1
- 230000008054 signal transmission Effects 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 239000000741 silica gel Substances 0.000 description 1
- 229910002027 silica gel Inorganic materials 0.000 description 1
- 238000002603 single-photon emission computed tomography Methods 0.000 description 1
- 235000020183 skimmed milk Nutrition 0.000 description 1
- 208000000587 small cell lung carcinoma Diseases 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- RYYKJJJTJZKILX-UHFFFAOYSA-M sodium octadecanoate Chemical compound [Na+].CCCCCCCCCCCCCCCCCC([O-])=O RYYKJJJTJZKILX-UHFFFAOYSA-M 0.000 description 1
- 239000003549 soybean oil Substances 0.000 description 1
- 235000012424 soybean oil Nutrition 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- 201000005671 spondyloarthropathy Diseases 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 125000002653 sulfanylmethyl group Chemical group [H]SC([H])([H])[*] 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- GZCRRIHWUXGPOV-UHFFFAOYSA-N terbium atom Chemical compound [Tb] GZCRRIHWUXGPOV-UHFFFAOYSA-N 0.000 description 1
- 229910003438 thallium oxide Inorganic materials 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- 150000003568 thioethers Chemical class 0.000 description 1
- 150000003573 thiols Chemical class 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 238000011830 transgenic mouse model Methods 0.000 description 1
- 238000003146 transient transfection Methods 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 230000005740 tumor formation Effects 0.000 description 1
- 230000000381 tumorigenic effect Effects 0.000 description 1
- 201000008297 typhoid fever Diseases 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 238000000108 ultra-filtration Methods 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
- 208000012991 uterine carcinoma Diseases 0.000 description 1
- 208000007089 vaccinia Diseases 0.000 description 1
- 229910052720 vanadium Inorganic materials 0.000 description 1
- LEONUFNNVUYDNQ-UHFFFAOYSA-N vanadium atom Chemical compound [V] LEONUFNNVUYDNQ-UHFFFAOYSA-N 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 230000000007 visual effect Effects 0.000 description 1
- 239000011800 void material Substances 0.000 description 1
- 201000005102 vulva cancer Diseases 0.000 description 1
- NAWDYIZEMPQZHO-UHFFFAOYSA-N ytterbium Chemical compound [Yb] NAWDYIZEMPQZHO-UHFFFAOYSA-N 0.000 description 1
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 1
Images
Abstract
The present application relates to an isolated antigen binding protein comprising a variable antigen binding domain (VHH) of a heavy chain antibody, wherein the VHH comprises one or more pairs of engineered cysteine residues, wherein each pair of the cysteine residues independently comprises a cysteine residue at a first position and a cysteine residue at a second position, the cysteine residue at the first position being capable of pairing to form a disulfide bond with the cysteine residue at the second position.
Description
Technical Field
The application relates to the field of biomedicine, in particular to an antibody and a conjugate.
Background
In recent years, antibody drugs have been used in many fields, and many diseases have been diagnosed and treated by antibody drugs. Because antibody drugs have good targeting properties, many therapeutic approaches have been developed for different types of antibodies. One type of antibody-drug conjugate/radionuclide is. And increasing the ratio of drug to antibody (DAR) can be effective in improving therapeutic efficacy.
Compared with the traditional antibody, the nano antibody has many advantages, such as smaller molecular weight which is only 12-15 kDa, strong penetrating power and good stability. Compared with human VH, the CDR3 region of the nano antibody is longer, can form a convex ring structure, can penetrate into the interior of an antigen to better combine with the antigen, and therefore has better affinity.
At present, the coupling mode of the nano antibody mostly adopts the fixed-point coupling of the lysine residue or the terminal cys of the random coupling to the antibody. Random conjugation, while increasing the DAR value, also adds a lot of uncertainty, such as relatively random conjugation sites, also creates a heterogeneous antibody-drug conjugate mixture, and is relatively complex to control, and may also affect the biological activity and stability of the sample. The advantages of end-directed conjugation over random conjugation are that the conjugation site is relatively fixed, but the relative DAR value is low and is only 1, and because cysteine is added at the end of the antibody, a polymer is easily formed, which has great challenges for the production process of naked antibody.
Disclosure of Invention
In order to overcome the technical problems in the background art, the application provides a surface cysteine fixed-point coupling technology based on a nano antibody. Compared with the two coupling modes mentioned above, the surface fixed-point coupling technology has many advantages, such as high DAR value and controllable DAR value, and can be designed into DAR2, DAR4 or DAR6 and the like according to requirements, the process is relatively simple, and higher drug loading capacity can be achieved under the condition of the same protein amount. The antibody-drug complex based on the nano-antibody can be applied to a plurality of fields, and the invention can simultaneously solve the problems of high DAR value of the traditional ADC drug and low DAR value of the nano-antibody-drug complex, thereby advancing the treatment based on the nano-antibody drug.
Briefly, the present application discloses methods for preparing antibody-drug (including but not limited to toxins, nuclides, affinity payloads, etc.) immunoconjugates that design high DAR values based on nanobodies, and discloses the diagnostic and therapeutic utility of cysteine engineered antibody drugs.
In one aspect, the present application provides an antigen binding protein comprising a variable antigen binding domain (VHH) of a heavy chain antibody, wherein the VHH comprises one or more pairs of engineered cysteine residues, wherein each pair of the engineered cysteine residues independently comprises a cysteine residue at a first position and a cysteine residue at a second position, the cysteine residue at the first position and the cysteine residue at the second position being capable of pairing to form a disulfide bond; wherein at least one of the cysteine residue at the first position and the cysteine residue at the second position is mutated.
In certain embodiments, wherein the cysteine residue at the first position and the cysteine residue at the second position are both mutated.
In certain embodiments, wherein the surface disulfide bond is capable of forming a sulfhydryl group upon reduction by a reducing agent, wherein the sulfhydryl group allows the antigen binding protein to be conjugated to a payload at the first location and/or the second location.
In certain embodiments, wherein the engineered cysteine residue does not substantially reduce the affinity of the antigen binding protein.
In certain embodiments, wherein neither the first position nor the second position is adjacent to a cysteine residue of a disulfide bond carried by the VHH.
In certain embodiments, wherein the engineered cysteine residue does not pair with a cysteine residue carried by the antigen binding protein.
In certain embodiments, wherein the first position and the second position are both located in the Framework Region (FR) of the VHH.
In certain embodiments, wherein neither the first location nor the second location is located in a loop region of the VHH.
In certain embodiments, wherein neither the first location nor the second location is located in a Complementarity Determining Region (CDR) of the VHH.
In certain embodiments, wherein the cysteine residue at the first position and the cysteine residue at the second position have a C.beta. -C.beta.of no more than aboutThe spatial distance of amino acid residues can be calculated predictively by Swiss-PdbViewer software.
In certain embodiments, wherein the cysteine residue at the first position and the cysteine residue at the second position are both located on the surface of the antigen binding protein.
In certain embodiments, wherein the relative solvent accessibility (ASA%) of the amino acid residue at the first position to the amino acid residue at the second position is not less than about 20%; solvent accessibility of amino acid residues was predicted from http:// cib.cf.ocha.ac.jp/bitool/ASA/website or calculated by the Swiss-PdbViewer software.
In certain embodiments, wherein the first location and the second location are each independently selected from the following: 3. 7, 9, 11, 12, 13, 17, 23, 39, 41, 66, 68, 83, 84, 87, 8, 16, 18, 25, 42, 45, 81, 82a, 82b, 85, 108, 110, 111, and 113; wherein the first location and the second location are different; wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
In certain embodiments, wherein the first position is selected from: 3. 7, 9, 11, 12, 13, 17, 23, 39, 41, 66, 68, 83, 84, and 87; the second position is selected from: 8. 16, 18, 25, 42, 45, 81, 82a, 82b, 85, 108, 110, 111 and 113; the first and second positions are different; wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
In certain embodiments, wherein the combination of the first and second locations is selected from at least one of the following combinations: a) 66-82b; b) 3-25; c) 7-8; d) 84-113; e) 83-85; f) 68-81; g) 17-82a; h) 41-42; i) 9-108; j) 11-110; k) 87-111; l) 13 to 16; m) 12 to 18; n) 39-45; and o) 14 to 113; wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering.
In certain embodiments, wherein the combination of amino acid residues at the first position and amino acid residues at the second position is selected from at least one of the following combinations: a) 66 (R/E) -82b (S/N/R/T/D/Y); b) 3 (Q) -25 (S); c) 7 (S) -8 (G); d) 84 (A/P/M) -113 (S); e) 83 (K/R/Q/S/T/E) -85 (E/D); f) 68 (T/V/A) -81 (Q/E/N); g) 17 (S) -82a (N/L/D); h) 41 (P/A/R) -42 (G); i) 9 (G) -108 (L/Q/H); j) 11 (S/L) -110 (T); k) 87 (T/A/L) -111 (V/D); l) 13 (Q/R) -16 (G); m) 12 (V/G) -18 (L); n) 39 (Q) -45 (R/C/L/H); and o) 14 (P) -113 (S); wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
In certain embodiments, wherein the VHH comprises 1, 2, 3 or 4 cysteine residues.
In certain embodiments, wherein the VHH comprises 2 pairs of cysteine residues, wherein the combination of the first and second positions in each pair of cysteine residues is selected from any two of the following combinations: a) 66-82b; b) 3-25; c) 7-8; d) 84-113; e) 83-85; f) 68-81; g) 17-82a; h) 41-42; i) 9-108; j) 11-110; k) 87-111; l) 13 to 16; m) 12 to 18; n) 39-45; and o) 14-113; wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
In certain embodiments, wherein said VHH comprises 2 pairs of cysteine residues, wherein the combination of said first and second positions in each pair of cysteine residues is selected from any two of the following combinations: a) 66 (R/E) -82b (S/N/R/T/D/Y); b) 3 (Q) -25 (S); c) 7 (S) -8 (G); d) 84 (A/P/M) -113 (S); e) 83 (K/R/Q/S/T/E) -85 (E/D); f) 68 (T/V/A) -81 (Q/E/N); g) 17 (S) -82a (N/L/D); h) 41 (P/A/R) -42 (G); i) 9 (G) -108 (L/Q/H); j) 11 (S/L) -110 (T); k) 87 (T/A/L) -111 (V/D); l) 13 (Q/R) -16 (G); m) 12 (V/G) -18 (L); n) 39 (Q) -45 (R/C/L/H); and o) 14 (P) -113 (S); wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
In certain embodiments, wherein the VHH comprises 2 pairs of cysteine residues, wherein the combination of the first and second positions in each pair of cysteine residues is selected from the group consisting of: a) 3-25 and 84-113; b) 7-8 and 3-25; c) 7-8 and 84-113; and d) 11-110 and 84-113; wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
In certain embodiments, wherein the VHH comprises 2 pairs of cysteine residues, wherein the combination of the first and second positions in each pair of cysteine residues is selected from the group consisting of: a) 3 (Q) -25 (S) and 84 (A/P/M) -113 (S); b) 7 (S) -8 (G) and 3 (Q) -25 (S); c) 7 (S) -8 (G) and 84 (A/P/M) -113 (S); and d) 11 (S/L) -110 (T) and 84 (A/P/M) -113 (S); wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
In certain embodiments, wherein the antigen binding protein comprises an antibody or antigen binding fragment thereof.
In certain embodiments, wherein the antibody or antigen binding fragment comprises a monoclonal antibody.
In certain embodiments, wherein the antibody or antigen-binding fragment thereof comprises a single domain antibody or a heavy chain antibody.
In certain embodiments, wherein the antibody or antigen-binding fragment comprises a chimeric antibody, a humanized antibody, and/or a fully human antibody.
In certain embodiments, wherein the antigen binding protein is a humanized VHH antibody or a fully human VHH antibody.
In certain embodiments, wherein the antigen binding protein specifically binds to a tumor antigen or a non-tumor antigen.
<xnotran> , CD19, BCMA, TSHR, CD171, CS-1, CLL-1, GD3, tn Ag, FLT3, CD38, CD123, CD44v6, B7H3, B7H4, KIT, IL-13Ra2, IL-11Ra, PSCA, PSMA, PRSS21, EGFR2, lewisY, CD24, PDGFR-beta, SSEA-4, MUC1, EGFR, NCAM, CAIX, LMP2, ephA2, GM1, sLe, GM3, TGS5, HMWMAA, FOLR1, FOLR2, TEM1/CD248, TEM7R, CLDN6, CLDN18.2, GPRC5D, CXORF61, CD97, CD179a, ALK, , PLAC1, globoH, NY-BR-1, UPK2, HAVCR1, ADRB3, PANX3, GPR20, LY6K, OR51E2, TAARP, WT1, ETV6-AML, SPA17, XAGE1, tie 2, MAD-CT-1, MAD-CT-2, FOSL1, hTERT, ML-IAP, ERG, NA17, PAX3, AR, B1, MYCN, rhoC, CYP1B1, BORIS, SART3, PAX5, OY-TES1, LCK, AKAP-4, SSX2, CD79a, CD79b, CD72, LAIR1, FCAR, LILRA2, CD300LF, CLEC12A, BST2, EMR2, LY75, GPC3, FCRL5, IGLL1, CD20, CD30, HER2, ROR1, TAAG72, CD22, CD33, GD2, gp100Tn, FAP, , EPCAM, CEA, IGF-1R, ephB2, , 17, CD32b, EGFRvIII, GPNMB, GPR64, HER3, LRP6, LYPD8, NKG2D, SLC34A2, SLC39A6, SLITRK6, GUCY2C, 5T4 / TACSTD2. </xnotran>
In certain embodiments, wherein the antigen binding protein comprises an anti-PD-L1 VHH antibody, an anti-HER 2 VHH antibody, or an anti-CD 8 α VHH antibody.
In certain embodiments, wherein the anti-PD-L1 VHH antibody comprises: CDR1 of the amino acid sequence shown in SEQ ID NO. 46, CDR2 of the amino acid sequence shown in SEQ ID NO. 47 and CDR3 of the amino acid sequence shown in SEQ ID NO. 48.
In another aspect, the present application provides an antigen binding protein that specifically binds to PD-L1, comprising a variable antigen binding domain (VHH) of a heavy chain antibody, the VHH comprising a cysteine mutation at a position selected from any one or more of the following: a) 66-82b; b) 3-25; c) 7-8; d) 84-113; e) 83-85; f) 68-81; g) 17-82a; h) 41-42; i) 9-108; j) 11 to 110; k) 87-111; l) 13 to 16; m) 12 to 18; n) 39-45; and o) 14 to 113; wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
In certain embodiments, it comprises a variable antigen binding domain (VHH) of a heavy chain antibody, said VHH comprising a cysteine mutation compared to the sequence set forth in SEQ ID NO. 49, said cysteine mutation position selected from any one or more of the following: a) 66 (R/E) -82b (S/N/R/T/D/Y); b) 3 (Q) -25 (S); c) 7 (S) -8 (G); d) 84 (A/P/M) -113 (S); e) 83 (K/R/Q/S/T/E) -85 (E/D); f) 68 (T/V/A) -81 (Q/E/N); g) 17 (S) -82a (N/L/D); h) 41 (P/A/R) -42 (G); i) 9 (G) -108 (L/Q/H); j) 11 (S/L) -110 (T); k) 87 (T/A/L) -111 (V/D); l) 13 (Q/R) -16 (G); m) 12 (V/G) -18 (L); n) 39 (Q) -45 (R/C/L/H); and o) 14 (P) -113 (S); wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
In certain embodiments, the antigen binding protein comprises the amino acid sequence of any one of SEQ ID NOs 50-63.
In another aspect, the present application provides an antigen binding protein that specifically binds PD-L1 comprising CDR1, CDR2 and CDR3 of a variable antigen binding domain (VHH) of a heavy chain antibody, wherein the amino acid sequence of the VHH is as set forth in any one of SEQ ID NOS: 50-63.
In another aspect, the present application provides an antigen binding protein that competes for binding to PD-L1 with an antigen binding protein described herein.
In certain embodiments, wherein the anti-CD 8 α VHH antibody comprises: CDR1 of the amino acid sequence shown in SEQ ID NO. 1, CDR2 of the amino acid sequence shown in SEQ ID NO. 2 and CDR3 of the amino acid sequence shown in SEQ ID NO. 3.
In another aspect, the present application provides an antigen binding protein that specifically binds CD8 α, comprising a variable antigen binding domain (VHH) of a heavy chain antibody, said VHH comprising a cysteine mutation compared to the sequence set forth in SEQ ID No. 4, at a position selected from any one or more of the following: a) 66-82b; b) 3-25; c) 7-8; d) 84-113; e) 83-85; f) 68-81; g) 17-82a; h) 41-42; i) 9-108; j) 11 to 110; k) 87-111; l) 13 to 16; m) 12 to 18; n) 39-45; and o) 14 to 113; wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
In certain embodiments, it comprises a variable antigen binding domain (VHH) of a heavy chain antibody, said VHH comprising a cysteine mutation compared to the sequence set forth in SEQ ID NO:4 at a position selected from any one or more of the following: a) 66 (R/E) -82b (S/N/R/T/D/Y); b) 3 (Q) -25 (S); c) 7 (S) -8 (G); d) 84 (A/P/M) -113 (S); e) 83 (K/R/Q/S/T/E) -85 (E/D); f) 68 (T/V/A) -81 (Q/E/N); g) 17 (S) -82a (N/L/D); h) 41 (P/A/R) -42 (G); i) 9 (G) -108 (L/Q/H); j) 11 (S/L) -110 (T); k) 87 (T/A/L) -111 (V/D); l) 13 (Q/R) -16 (G); m) 12 (V/G) -18 (L); n) 39 (Q) -45 (R/C/L/H); and o) 14 (P) -113 (S); wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
In certain embodiments, the antigen binding protein comprises the amino acid sequence of any one of SEQ ID NOs 5-18, 20.
In another aspect, the present application provides an antigen binding protein that specifically binds CD8 a comprising CDR1, CDR2 and CDR3 of a variable antigen binding domain (VHH) of a heavy chain antibody, wherein the amino acid sequence of said VHH is set forth in any one of SEQ ID NOs 5-18, 20.
In another aspect, the present application provides an antigen binding protein that competes for binding to CD8 a with an antigen binding protein described herein.
In certain embodiments, wherein the anti-HER 2 VHH antibody comprises:
i) CDR1 of the amino acid sequence shown as SEQ ID NO. 21, CDR2 of the amino acid sequence shown as SEQ ID NO. 22 and CDR3 of the amino acid sequence shown as SEQ ID NO. 23; or
ii) CDR1 of the amino acid sequence shown in SEQ ID NO. 64, CDR2 of the amino acid sequence shown in SEQ ID NO. 65 and CDR3 of the amino acid sequence shown in SEQ ID NO. 66.
In another aspect, the present application provides an antigen binding protein that specifically binds HER2 comprising a variable antigen binding domain (VHH) of a heavy chain antibody, said VHH comprising a cysteine mutation compared to the sequence shown in SEQ ID No. 24, at a position selected from any one or more of the following: a) 66-82b; b) 3-25; c) 7-8; d) 84-113; e) 83-85; f) 68-81; g) 17-82a; h) 41-42; i) 9-108; j) 11 to 110; k) 87-111; l) 13 to 16; m) 12 to 18; n) 39-45; and o) 14 to 113; wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
In certain embodiments, the VHH comprises a cysteine mutation compared to the sequence set forth in SEQ ID No. 24 at a position selected from any one or more of: a) 66 (R/E) -82b (S/N/R/T/D/Y); b) 3 (Q) -25 (S); c) 7 (S) -8 (G); d) 84 (A/P/M) -113 (S); e) 83 (K/R/Q/S/T/E) -85 (E/D); f) 68 (T/V/A) -81 (Q/E/N); g) 17 (S) -82a (N/L/D); h) 41 (P/A/R) -42 (G); i) 9 (G) -108 (L/Q/H); j) 11 (S/L) -110 (T); k) 87 (T/A/L) -111 (V); l) 13 (Q/R) -16 (G); m) 12 (V/G) -18 (L); n) 39 (Q) -45 (R/C/L/H); and o) 14 (P) -113 (S); wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering.
In certain embodiments, the antigen binding protein comprises the amino acid sequence of any one of SEQ ID NOs 25-45.
In another aspect, the present application provides an antigen binding protein that specifically binds HER2 comprising a variable antigen binding domain (VHH) of a heavy chain antibody, said VHH comprising a cysteine mutation compared to the sequence shown in SEQ ID NO:67, the cysteine mutation position being selected from any one or more of the following: a) 66-82b; b) 3-25; c) 7-8; d) 84-113; e) 83-85; f) 68-81; g) 17-82a; h) 41-42; i) 9-108; j) 11-110; k) 87-111; l) 13 to 16; m) 12 to 18; n) 39-45; and o) 14 to 113; wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
In certain embodiments, the VHH comprises a cysteine mutation compared to the sequence set forth in SEQ ID NO 67 at a position selected from any one or more of: a) 66 (R/E) -82b (S/N/R/T/D/Y); b) 3 (Q) -25 (S); c) 7 (S) -8 (G); d) 84 (A/P/M) -113 (S); e) 83 (K/R/Q/S/T/E) -85 (E/D); f) 68 (T/V/A) -81 (Q/E/N); g) 17 (S) -82a (N/L/D); h) 41 (P/A/R) -42 (G); i) 9 (G) -108 (L/Q/H); j) 11 (S/L) -110 (T); k) 87 (T/A/L) -111 (V); l) 13 (Q/R) -16 (G); m) 12 (V/G) -18 (L); n) 39 (Q) -45 (R/C/L/H); and o) 14 (P) -113 (S); wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
In certain embodiments, the antigen binding protein comprises the amino acid sequence of any one of SEQ ID NOs 68-83.
In certain embodiments, the VHH is further affinity optimized compared to the amino acid sequence of any one of SEQ ID NOs 68-83.
In certain embodiments, it comprises the amino acid sequence set forth in any one of SEQ ID NOs 84-94.
In another aspect, the present application provides an antigen binding protein that specifically binds HER2 comprising CDR1, CDR2 and CDR3 of a variable antigen binding domain (VHH) of a heavy chain antibody, wherein the amino acid sequence of said VHH is set forth in any one of SEQ ID NOs 25-45, 68-95.
In another aspect, the present application provides an antigen binding protein that competes for binding to HER2 with an antigen binding protein described herein.
In another aspect, the present application provides a fusion polypeptide comprising an antigen binding protein as described herein,
in another aspect, the present application provides an immunoconjugate comprising an antigen binding protein as described herein, a payload, and a linker linking the payload to the antigen binding protein.
In certain embodiments, the immunoconjugate has the structure shown in formula I:
VHH-(L-D) n (I)
Wherein L is a linker; d is a payload; n is any number from 1 to 8.
In certain embodiments, wherein the VHH comprises the amino acid sequence set forth in any one of SEQ ID NOs 5-18, 20, 25-45, 50-63, 68-95.
In certain embodiments, wherein the VHH is linked to the linker through a thiol group of a cysteine at a first position and/or a thiol group of a cysteine at a second position.
In certain embodiments, the surface disulfide bond formed by pairing a cysteine residue at a first position with a cysteine residue at a second position in the VHH is reduced to form a free cysteine, the free cysteine comprising a thiol group, and the linker is attached to the thiol group.
In certain embodiments, wherein the linker is cleavable or non-cleavable.
In certain embodiments, wherein the linker is selected from the group consisting of: 6-Maleimidocaproyl (MC), maleimidopropanoyl (MP), valine-citrulline (val-cit), alanine-phenylalanine (alaphe), p-aminobenzyloxycarbonyl (PAB), N-succinimidyl 4- (2-pyridylthio) pentanoate (SPP), N-succinimidyl 4- (N-maleimidomethyl) cyclohexane-1-carboxylate (SMCC), (N-succinimidyl 4-iodo-acetyl) aminobenzoate (SIAB),), SPDB, hydrazone, maleimidocaproyl and 6-maleimidocaproyl-valine-citrulline-p-aminobenzyloxycarbonyl (MC-vc-PAB); or a branched linker comprising a peptide chain and derived from o-hydroxy p-aminobenzyl alcohol, wherein the peptide chain is linked to a benzene ring through a p-amino group, the payload is linked to a benzene ring through a benzyl alcohol moiety, and the antigen binding protein is linked to a benzene ring through an o-hydroxy group.
In certain embodiments, wherein the linker comprises a chelating agent.
In certain embodiments, wherein the chelator is selected from DTPA, EDTA, NOTA, DOTA, TRAP, TETA, NETA, CB-TE2A, cyclen, cyclam, bispidine, TACN, ATSM, sarAR, amBaSar, MAG3, MAG2, HYNIC, DADT, EC, NS3, H2dedpa, HBED, DFO, PEPA or HEHA and derivatives thereof.
In certain embodiments, wherein the payload comprises a detectable label.
In certain embodiments, wherein the detectable label is selected from the group consisting of: radionuclides, fluorescers, chemiluminescent agents, bioluminescent agents, paramagnetic ions and enzymes, and combinations thereof.
In certain embodiments, wherein the detectable label comprises a radionuclide.
In certain embodiments, wherein the radionuclide comprises 110 In、 111 In、 177 Lu、 18 F、 52 Fe、 62 Cu、 67 Cu、 67 Ga、 68 Ga、 68 Ge、 86 Y、 90 Y、 89 Zr、 94m Tc、 120 I、 123 I、 124 I、 125 I、 131 I、 154-158 Gd、 32 P、 11 C、 13 N、 15 O、 186 Re、 188 Re、 51 Mn、 52m Mn、 72 As、 75 Br、 76 Br、 82m Rb、 83 Sr or other gamma-, beta-, or positron emitters.
In certain embodiments, wherein the radionuclide is linked to the antigen binding protein by a chelator.
In certain embodiments, wherein the payload comprises a targeting moiety.
In certain embodiments, wherein the targeting moiety is selected from the group consisting of: proteins, nucleic acids, lipids, carbohydrates, and combinations thereof.
In certain embodiments, wherein the payload comprises a drug.
In certain embodiments, wherein the drug is selected from: an anti-cancer therapeutic agent, an anti-inflammatory therapeutic agent, an anti-infection therapeutic agent, an anesthetic therapeutic agent, a cytotoxic therapeutic agent, a radionuclide, an immunomodulator, a cell signal peptide, a growth factor, an enzyme, an oligonucleotide, a photoactive therapeutic agent, and any combination thereof.
In certain embodiments, wherein the anti-cancer therapeutic is selected from: cytostatics, cytotoxic nucleosides, tubulin binding agents, hormones and hormone antagonists, anti-angiogenic agents, enzyme inhibitors, gene modulators, proteasome inhibitors, pteridine, diyne, podophyllotoxin, auristatin, geldanamycin, calicheamicin, gramicin D, maytansine, neocarzinostatin, topotecan, taxanes, cytochalasin B, ethidium bromide, emetine, tinosporine, colchicine, dihydroxyanthracenedione, mitoxantrone, procaine, tetracaine, lidocaine, propranolol, puromycin, maytansine derivatives, anthracycline derivatives, bisphosphonate derivatives, leptomycin derivatives, desmosine derivatives, auristatin derivatives, duocarmycin derivatives, and any combination thereof.
In certain embodiments, the cytostatic agent is selected from: anthraquinone, DNA synthesis inhibitors, DNA-intercalators, DNA-RNA transcription regulators, ansamycinquinone, quinone derivatives, busulfan, ifosfamide, mechlorethamine, triazone, diazinon, carbazolquinone, indoloquinone E09, diazaspinyl-benzoquinone methyl DZQ, triethylenephosphoramide, nitrosourea compounds, and any combination thereof.
In certain embodiments, wherein the cytotoxic nucleoside is selected from the group consisting of: vidarabine, cytarabine, 5-fluorouracil, fludarabine, fluorouracil nucleoside, ftoracure, 6-mercaptopurine, and combinations of any of these.
In certain embodiments, wherein the tubulin-binding agent is selected from the group consisting of: paclitaxel, nocodazole, rhizoxin, dolastatin, colchicine, combretastatin, vinca alkaloids, and any combination thereof.
In certain embodiments, wherein the hormone and hormone antagonist are selected from the group consisting of: corticosteroids, progestins, estrogens, antiestrogens, androgens, aromatase inhibitors, 17- (allylamino) -17-demethoxygeldanamycin, 4-amino-I, 8-naphthalimide, apigenin, brefeldin A, cimetidine, dichloromethylene diphosphonic acid, leuprolide, luteinizing hormone releasing hormone, pifithrin-a, rapamycin, sex hormone binding globulin, thapsigargin, and any combination thereof.
In certain embodiments, wherein the anti-angiogenic agent is selected from the group consisting of: angiostatin K1-3, DL- α -difluoromethyl-ornithine, endostatin, fumagillin, genistein, minocycline, staurosporine, (+) -thalidomide, and any combination thereof.
In certain embodiments, wherein the enzyme inhibitor is selected from the group consisting of: s (+) -camptothecin, curcumin, (-) -deguelin, 5, 6-dichlorobenzene-imidazole I-beta-D-ribofuranoside, etoposide, formestane, fosstricin, hispidin, 2-imino-1-imidazolidineacetic acid, mevinolin, trichostatin A, tyrphostin AG 34, tyrphostin AG 879, and any combination thereof.
In certain embodiments, wherein the gene modulator is selected from the group consisting of: 5-aza-2' -deoxycytidine, 5-azacytidine, cholecalciferol, 4-hydroxyttamoxifen, melatonin, mifepristone, raloxifene, trans retinal, retinoic acid, 9-cis-retinoic acid, 13-cis-retinoic acid, retinol, tamoxifen, troglitazone, and any combination thereof.
In certain embodiments, wherein the radionuclide comprises 110 In、 111 In、 177 Lu、 18 F、 52 Fe、 62 Cu、 67 Cu、 67 Ga、 68 Ga、 68 Ge、 86 Y、 90 Y、 89 Zr、 94m Tc、 120 I、 123 I、 124 I、 125 I、 131 I、 154-158 Gd、 32 P、 11 C、 13 N、 15 O、 186 Re、 188 Re、 51 Mn、 52m Mn、 72 As、 75 Br、 76 Br、 82m Rb、 83 Sr or other gamma-, beta-, or positron emitters.
In certain embodiments, wherein n is any integer from 1 to 8.
In certain embodiments, wherein n is 2, 4, 6, or 8.
In another aspect, the present application provides a pharmaceutical composition comprising an antigen binding protein as described herein or a conjugate as described herein, or a pharmaceutically acceptable salt thereof, and optionally a pharmaceutically acceptable carrier.
In another aspect, the present application provides an isolated nucleic acid molecule comprising a polynucleotide encoding an antigen binding protein as described herein or a fusion protein as described herein.
In another aspect, the present application provides a vector comprising a nucleic acid molecule as described herein.
In another aspect, the present application provides a cell comprising a nucleic acid molecule as described herein and/or a vector as described herein.
In another aspect, the present application provides a method of making an antigen binding protein described herein, the method comprising:
i) Site-directed mutagenesis of a nucleic acid sequence of a parent antibody, wherein the mutagenesis comprises substitution of one or more pairs of amino acid residues with cysteine residues; wherein each pair of said cysteine residues comprises a cysteine residue at a first position and a cysteine residue at a second position, said cysteine residue at the first position being capable of pairing with said cysteine residue at the second position to form a disulfide bond; and
ii) expressing the antigen binding protein.
In certain embodiments, wherein the method further comprises recovering the antigen binding protein.
In certain embodiments, wherein the method further comprises purifying the antigen binding protein.
In certain embodiments, wherein the mutagenesis further comprises affinity optimization of the antibody after substitution with a cysteine residue.
In another aspect, the present application provides a method of making an antigen binding protein described herein, the method comprising: comprising culturing the cells described herein under conditions that allow expression of the antigen binding protein.
In another aspect, the present application provides a method of making a conjugate described herein, the method comprising: the antigen binding proteins described herein are conjugated to a payload.
In certain embodiments, the method comprises: reacting at least one pair of cysteines of the antigen binding protein with the linker-payload intermediate to form an antigen binding protein-payload conjugate:
VHH-(L-D) n (I)
wherein L is a linker; d is a payload; n is any number from 1 to 8.
In certain embodiments, where n is any integer from 1 to 8.
In certain embodiments, wherein n is 2, 4, 6, or 8.
In certain embodiments, wherein the method comprises: i) Reducing and opening disulfide bonds formed by paired cysteines in the antigen binding protein to form sulfhydryl free cysteine; ii) linking the sulfhydryl group of a free cysteine with a linker to form an antigen binding protein-payload conjugate.
In certain embodiments, wherein the method comprises: i) Reducing open disulfide bonds formed by paired cysteine residues in the antigen binding protein to form free cysteines; ii) linking the sulfhydryl group of the free cysteine to a linker to form an antigen binding protein-linker intermediate; iii) Conjugating the antigen binding protein-linker intermediate to a payload to form an antigen binding protein-payload conjugate.
In another aspect, the present application provides a method of inhibiting cell proliferation comprising contacting a cell with an effective amount of an antigen binding protein described herein, a conjugate described herein, or a pharmaceutical composition described herein.
In certain embodiments, the contacting is performed in vivo or in vitro.
In another aspect, the present application provides a method of inhibiting cell proliferation comprising exposing cells in a cell culture medium to an antigen binding protein described herein, a conjugate described herein, or a pharmaceutical composition described herein.
In certain embodiments, the cell comprises a mammalian cell.
In certain embodiments, the cell comprises a tumor cell.
In another aspect, the present application provides a method of detecting, preventing and/or treating a tumor or other disease comprising administering to a subject in need thereof an antigen binding protein described herein, a conjugate described herein or a pharmaceutical composition described herein.
In certain embodiments, wherein the tumor comprises a solid tumor and a non-solid tumor.
In certain embodiments, wherein the tumor is selected from any one or more of the group consisting of: lymphoma, multiple myeloma, breast cancer, ovarian cancer, kidney cancer, endometrial cancer, melanoma, pancreatic cancer, lung cancer, gastric cancer, liver cancer, mesothelioma, esophageal cancer, head and neck cancer, cholangiocarcinoma, gallbladder cancer, bladder cancer, thymus cancer, and colorectal cancer.
In certain embodiments, the method further comprises administering to the subject an additional therapy or drug.
In certain embodiments, wherein the additional therapy is selected from the group consisting of: chemotherapy, radiation therapy, miRNA, and oligonucleotides.
In another aspect, the present application provides the use of an antigen binding protein as described herein, an immunoconjugate as described herein and/or a pharmaceutical composition as described herein for the preparation of a medicament for the treatment of a tumor or other disease.
In another aspect, the present application provides the use of an antigen binding protein as described herein, an immunoconjugate as described herein and/or a pharmaceutical composition as described herein in combination with other therapies or drugs in the manufacture of a medicament for the treatment of tumors or other diseases.
In certain embodiments, wherein the additional therapy is selected from the group consisting of: chemotherapy, radiation therapy, miRNA, and oligonucleotides.
In certain embodiments, wherein the tumor comprises a solid tumor and a non-solid tumor.
In certain embodiments, wherein the tumor is selected from any one or more of the group consisting of: lymphoma, multiple myeloma, breast cancer, ovarian cancer, kidney cancer, endometrial cancer, melanoma, pancreatic cancer, lung cancer, gastric cancer, liver cancer, mesothelioma, esophageal cancer, head and neck cancer, cholangiocarcinoma, gallbladder cancer, bladder cancer, thymus cancer, and colorectal cancer.
In another aspect, the present application provides a method of detecting a specific target for non-disease diagnostic purposes comprising the use of an antigen binding protein as described herein, an immunoconjugate as described herein and/or a pharmaceutical composition as described herein.
In another aspect, the present application provides a kit comprising an antigen binding protein as described herein, an immunoconjugate as described herein and/or a pharmaceutical composition as described herein, and optionally instructions for use.
In another aspect, the present application provides a kit comprising an antigen binding protein as described herein, an immunoconjugate as described herein and/or a pharmaceutical composition as described herein, and optionally an administration device.
In another aspect, the present application provides a method for screening a nanobody site-directed conjugation site, the method comprising: screening for amino acid residue pairing in VHHs at about C.beta. -C.beta.Combinations within the range.
In certain embodiments, the method further comprises excluding amino acid residues having ASA% less than about 20% relative solvent accessibility.
In certain embodiments, the spatial distance and/or solvent accessibility of amino acid residues therein is calculated as predicted according to Swiss-PdbViewer software.
In certain embodiments, the method further comprises excluding amino acid residues located in the CDR regions, or loop regions, or near the internal disulfide bond of the VHH.
In certain embodiments, the method further comprises homology modeling the VHH prior to screening for amino acid residue pairing.
In some embodiments, the homology modeling is calculated using modeler 9 software.
In certain embodiments, the method comprises:
1) Performing homologous modeling on the VHH;
3) Excluding amino acid residues having ASA% less than about 20% relative solvent accessibility;
4) Amino acid residues located in the CDR regions of the VHH, or in the loop regions, or near the internal disulfide bonds of the VHH are excluded.
Other aspects and advantages of the present application will be readily apparent to those skilled in the art from the following detailed description. Only exemplary embodiments of the present application have been shown and described in the following detailed description. As those skilled in the art will recognize, the disclosure of the present application enables those skilled in the art to make changes to the specific embodiments disclosed without departing from the spirit and scope of the invention as it is directed to the present application. Accordingly, the descriptions in the drawings and the specification of the present application are illustrative only and not limiting.
Drawings
The specific features of the invention to which this application relates are set forth in the appended claims. The features and advantages of the invention to which this application relates will be better understood by reference to the exemplary embodiments described in detail below and the accompanying drawings. The drawings are briefly described as follows:
figure 1 shows multiple sequence alignment data for 90 multiple single domain antibody sequences in the PDB database.
Detailed Description
The embodiments of the present invention are described below with reference to specific embodiments, and other advantages and effects of the present invention will be easily understood by those skilled in the art from the disclosure of the present specification.
Definition of terms
In the present application, the term "PD-L1" or "PD-L1" generally refers to programmed cell death 1 ligand 1, also referred to as B7 homolog 1, B7-H1, cluster of differentiation 274, (3) 274 or CD274, which upon binding to PD-1 down-regulates T cell activation and cytokine secretion. "PD-L1" includes any native PD-L1 of any vertebrate origin, including mammals, such as primates (e.g., humans and cynomolgus monkeys) and rodents (e.g., mice and rats). The term encompasses "full-length," unprocessed PD-L1, as well as any form of PD-L1 that results from cellular processing. PD-L1 may exist as a transmembrane protein or as a soluble protein. "PD-L1" includes intact PD-L1 and fragments thereof, and also includes functional variants, isoforms, species homologs, derivatives, analogs of PD-L1, and analogs having at least one common epitope with PD-L1. The basic structure of PD-L1 includes 4 domains: an extracellular Ig-like V-type domain and an Ig-like C2-type domain, a transmembrane domain, and a cytoplasmic domain. Exemplary human PD-L1 amino acid sequences can be found under NCBI accession No. NP _001254653 or UniProt accession No. Q9NZQ 7.
In the present application, the term "HER2" generally refers to a type I transmembrane protein belonging to the epidermal growth factor receptor family, also known as c-erbB2, erbB2 or Neu. The term "HER2" also encompasses homologs, variants, and isoforms of HER2, including splice isoforms. HER2 is associated with tumor transformation in human breast cancer cells, as overexpression of HER2 protein has been detected in patients with breast, gastric, pancreatic, ovarian, peritoneal or colon cancer. The terms "HER2 positive" and "expressing HER2" are used interchangeably in this application. A "HER2 positive" tumor comprises tumor cells having higher than normal levels of HER 2. Examples of HER2 positive tumors include HER2 positive breast cancer and HER2 positive gastric cancer. Optionally, the HER2 positive is a HER2 overexpressing cancer, and in certain embodiments, the HER-2 positive cancer has an Immunohistochemistry (IHC) score of 2+ or 3+ and/or an In Situ Hybridization (ISH) amplification rate ≧ 2.0.
The term "CD8" (cluster of differentiation 8) refers to a cell surface glycoprotein that is expressed predominantly on cytotoxic T lymphocytes, but also on subsets of dendritic cells, natural killer T cells, and γ δ T cells. Glycoproteins are composed of the two isoforms α and β (which are encoded by different genes) and are expressed as α α homodimers or α β heterodimers, the latter of which predominates. The CD8 co-receptor stabilizes the T cell receptor MHC-1 interaction and triggers intracellular signaling for activation by lymphocyte-specific protein tyrosine kinase (Lck) phosphorylation of the CD 3-associated Immunoreceptor Tyrosine Activation Motif (ITAM).
In the present application, the term "antigen" generally refers to any immunogenic fragment or determinant comprising the selected target, including a single epitope, multiple epitopes, single or multiple domains or the entire extracellular domain (ECD). The antigen can be an isolated full-length protein, a cell surface protein (e.g., immunized with cells expressing at least a portion of the antigen on their surface), or a soluble protein (e.g., immunized with an ECD portion having only the protein). The antigen may be produced in a genetically modified cell. Any of the above antigens may be used alone or in combination with one or more immunogenicity-enhancing adjuvants known in the art. The DNA encoding the antigen may be genomic or non-genomic (e.g., cDNA), and may encode at least a portion of the ECD sufficient to elicit an immunogenic response. Any vector can be used to transform the cells in which the antigen is expressed, including but not limited to adenoviral vectors, lentiviral vectors, plasmids, and non-viral vectors, such as cationic lipids. The term "antigen" as used herein includes, for example, proteins, different epitopes on proteins (as different antigens within the meaning of the invention) and polysaccharides. This includes mainly parts of bacteria, viruses and other microorganisms (shells, envelopes, cell walls, flagella, fimbrae and toxins). Lipids and nucleic acids are antigenic only when combined with proteins and polysaccharides. Non-microbial foreign (non-self) antigens may include pollen, egg white, and proteins from transplanted tissues and organs or proteins on the surface of blood cells that are transfused. Without limitation, the antigen may be selected from the group consisting of cytokines, cell surface proteins, enzymes and receptors.
As used herein, "tumor antigen" includes its meaning known in the art, which includes any molecule expressed on (or associated with the development of) a tumor cell that is known or believed to have an effect on the tumorigenic properties of the tumor cell. Many tumor antigens are known in the art. Whether a molecule is a tumor antigen can also be determined according to techniques and assays well known to those skilled in the art, such as clonogenic assays (clonogenic assays), transformation assays, in vitro or in vivo tumor formation assays, gel migration assays (gel migration assays), gene knock-out assays, and the like. In some embodiments, the term "tumor antigen" as used herein refers to a human transmembrane protein, i.e., a cell membrane protein anchored in a cellular lipid bilayer. As used herein, a human transmembrane protein will typically comprise an "extracellular domain" which may bind a ligand, a lipophilic transmembrane domain, a conserved intracellular domain, such as a tyrosine kinase domain, and a carboxy-terminal signaling domain having several tyrosine residues which may be phosphorylated. Tumor antigens include molecules such as EGFR, HER2/neu, HER3, HER4, epCAM, CEA, TRAIL receptor 1, TRAIL receptor 2, lymphotoxin-beta receptor, CCR4, CD19, CD20, CD22, CD28, CD33, CD40, CD80, CSF-1R, CTLA-4, fibroblast Activation Protein (FAP), hepsin, melanoma-associated chondroitin sulfate proteoglycan (MCSP), prostate Specific Membrane Antigen (PSMA), VEGF receptor 1, VEGF receptor 2, IGF1-R, TSLP-R, TIE-1, TIE-2, TNF-alpha, TNF-like weak inducer of apoptosis (TWEAK), or IL-1R.
The term "antigen binding protein" is used in its broadest sense and means a protein that comprises a moiety that binds to an antigen or target and optionally a framework or framework portion that allows the antigen binding moiety to adopt a configuration that facilitates binding of the antigen binding protein to the antigen. Examples of antigen binding proteins include human antibodies, humanized antibodies; a chimeric antibody; a recombinant antibody; a single chain antibody; a bifunctional antibody; a trifunctional antibody; a tetrafunctional antibody; a Fab fragment; f (ab') 2 A fragment; an IgD antibody; an IgE antibody; an IgM antibody; an IgG1 antibody; an IgG2 antibody; an IgG3 antibody; or IgG4 antibodies and fragments thereof. Antigen binding proteins may include, for example, alternative protein frameworks or artificial frameworks with grafted CDRs or CDR derivatives. Such frameworks include, but are not limited to: an antibody-derived framework comprising mutations introduced to, for example, stabilize the three-dimensional structure of an antigen-binding protein; and fully synthetic frameworks comprising, for example, biocompatible polymers. See, e.g., korndorfer et al, 2003, proteins: structure, function, and Bioinformatics,53 (1): 121-129 (2003); roque et al, biotechnol. Prog.20:639-654 (2004). In addition, peptide antibody mimetics ("PAM") can be used, as can frameworks based on antibody mimetics that utilize a fibronectin component as a framework.
In the present application, the term "antibody" is used in the broadest sense and specifically encompasses monoclonal antibodies, polyclonal antibodies, dimers, multimers, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired biological activity (Milleretal (2003) journal. Of immunology170: 4854-4861). The antibody may be murine, human, humanized, chimeric, or derived from other species.
In the present application, the techniqueThe term "antigen-binding fragment" generally refers to a portion of an antibody molecule that comprises amino acids responsible for specific binding between an antibody and an antigen. The portion of the antigen specifically recognized and bound by the antibody is referred to as an "epitope" as described above. The antigen binding domain may typically comprise an antibody light chain variable region (VL) and an antibody heavy chain variable region (VH); however, it does not necessarily include both. Examples of antigen-binding fragments of antibodies include (1) Fab fragments, monovalent fragments with VL, VH, constant light Chain (CL) and CH1 domains; (2) F (ab') 2 A fragment, a bivalent fragment having two Fab fragments linked by a disulfide bridge of the hinge region; (3) an Fd fragment having two VH and CH1 domains; (4) Fv fragments with VL and VH Domains of a Single arm of an antibody, (5) dAb fragments (Ward et al, "Binding Activities of a repertile of Single Immunoglobulin Variable Domains From Escherichia coli," Nature 341-546 (1989), which is incorporated herein by reference in its entirety), having a VH domain; (6) an isolated Complementarity Determining Region (CDR); (7) Single chain Fv (scFv), e.g.derived from a scFv-library. Although the two domains of the Fv fragment, VL and VH, are encoded by separate genes, they can be joined using recombinant methods by synthetic linkers that allow them to be prepared as a Single Protein Chain in which the VL and VH regions pair to form monovalent molecules (known as Single Chain Fv (scFv)) (see, e.g., huston et al, "Protein Engineering of Antibody Binding Sites: recovery of Specific Activity in an Anti-Digoxin Single-Chain Fv antigen Produced in Escherichia coli," proc. Natl. Acad. Sci. Usa 85-5879-5883 (1988)); and (8) VHH, "VHH" relates to the variable antigen-binding domain of heavy chain antibodies from camelidae (camel, dromedary, llama, alpaca, etc.) (see Nguyen v.k. Et al, 2000, the EMBO journal,19, 921-930, muydermans S, 2001, j Biotechnol, 74, 277-302 and reviewed in Vanlandschoot p. Et al, 2011, antiviral Research 92, 389-407).
In the present application, the terms "heavy chain single domain antibody", "VHH domain", "VHH", "V H H domain, VHH antibody fragment, VHH antibody andand & ->Domain "(" Nanobody "is a trademark of Ablynx n.v. company, ghent, belgium) is used interchangeably.
In the present application, the term "variable domain" generally refers to a variable domain of an antibody capable of specifically binding an epitope of an antigen. For example, antibody variable domains VH and VL (VH and VL domains). Another example of a variable domain is a "VHH domain" (or simply "VHH"). "VHH domain", also called heavy chain single domain antibody, VHH, V H H domains, VHH antibody fragments and VHH antibodies, variable domains of antigen-binding immunoglobulins called "heavy chain antibodies" (i.e. "antibodies lacking light chain") (Hamers-Casterman C, atarhouch T, muylermans S, robinson G, hamers C, songa EB, bendahman N, hamers R.: naturally occuring antibodies void of light chains "; nature 363,446-448 (1993)). The term "VHH domain" is used to distinguish the variable domain from a heavy chain variable domain (which is referred to herein as a "VH domain") present in a conventional 4 chain antibody, and a light chain variable domain (which is referred to herein as a "VL domain") present in a conventional 4 chain antibody. The VHH domain specifically binds to an epitope without the need for an additional antigen binding domain (as opposed to the VH or VL domain in conventional 4 chain antibodies, in which case the epitope is recognized by the VL domain together with the VH domain).
In the present application, "variable domains" typically have the same general structure, each domain comprising 4 Framework (FR) regions highly conserved in sequence, wherein the FR regions include four "framework regions" of "framework region 1" or "FR1", "framework region 2" or "FR2", "framework region 3" or "FR3", and "framework region 4" or "FR4", three "complementarity determining regions" or "CDRs" of FR region "complementarity determining region 1" or "CDR1", "complementarity determining region 2" or "CDR2", and "complementarity determining region 3" or "CDR3" are linked. The general structure or sequence of a variable domain can be represented as follows: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4. Antibody variable domains confer specificity for an antigen by virtue of having an antigen binding site.
In this application, the term "CDR" generally refers to complementarity determining regions within the variable sequence of an antibody. There are 3 CDRs in each variable region of the heavy and light chains, which for each variable region are referred to as CDR1, CDR2 and CDR3. The exact boundaries of these CDRs have been defined differently for different systems. For example, for amino acid residues used in VHH domains of the Camelidae family, the FR regions of the humanized nanobody h-NbBcII10FGLA (JANUARY 30, 2009-VOLUME 284-NUMBER 5) may be numbered according to the general numbering of VH domains given by Kabat et al ("Sequence of proteins of immunological interest", US Public Health Services, NIH Bethesda, MD, publication No. 91). According to this numbering, FR1 comprises amino acid residues at positions 1-25, CDR1 comprises amino acid residues at positions 26-35, FR2 comprises amino acids at positions 36-49, CDR2 comprises amino acid residues at positions 50-59, FR3 comprises amino acid residues at positions 60-97, CDR3 comprises amino acid residues at positions 98-116, and FR4 comprises amino acid residues at positions 117-126. It should be noted, however, that the total number of amino acid residues in each CDR may be different and may not correspond to the total number of amino acid residues indicated by the Kabat numbering, as is well known in the art for VH and VHH domains (i.e., one or more positions according to the Kabat numbering may not be occupied in the actual sequence, or the actual sequence may contain more amino acid residues than allowed by the Kabat numbering). This means that, in general, the numbering according to Kabat may or may not correspond to the actual numbering of the amino acid residues in the actual sequence.
h-NbBcII10FGLA:
QVQLVESGGGLVQPGGSLRLSCAASGGSEYSYSTFSLGWFRQAPGQGLEAVAAIASMGGLTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAAVRGYFMRLPSSHNFRYWGQGTLVTVSS
Note: underlined are FR1 to FR4 regions
In the present application, the term "loop region" generally refers to a turn of more than 5 amino acid residues, also commonly referred to as a loop, and generally refers to a pattern less region linking two conventional structures. They are usually located in solvent exposed areas of the protein surface and often play an important role, such as interaction with other biomolecules. The protein structure can be divided into four levels of a primary structure, a secondary structure, a tertiary structure, a quaternary structure and the like. The primary structure is the amino acid sequence that makes up the protein. Secondary structures generally refer to local regular and ordered structures, for example, α -helix, β -sheet structures are connected in series by loop regions (usually containing one or more corners) to form tertiary structures. The quaternary structure refers to a complex structure with specific functions formed by interaction of multiple protein subunits. The protein loop region is usually located on the surface of the protein and is an important participant in the processes of signal transmission, protein-ligand recognition and the like. For example, the loop region may be involved in the formation of active sites and binding sites for proteins, regulating the binding of antigens to immunoglobulins. For example: the position where the antibody binds to the antigen consists of six loop regions, and the length and amino acid sequence of the loop regions vary from antibody to antibody. If the loop region is linked to two beta strands in different directions (antiparallels), the loop-region is called hairpin loops, and the position on the antibody where the antigen binds is generally the loop.
In the present application, the term "disulfide bond" refers to a chemical covalent bond that exists in the tertiary structure of a protein, typically one or more crosslinks between polypeptide chains formed by oxidation of cysteine residues or between portions of a polypeptide chain. The R group of cysteine is a sulfhydryl (-SH) group, and under oxidizing conditions two different cysteine side chains can form a covalent bond between each other, called a disulfide (-S-S-). Disulfide bonds can be cross-linked within a protein or between two proteins, and have thermal and mechanical stability, and furthermore can be broken by reducing a reducing agent in a protein solution.
In the present application, the term "monoclonal antibody" generally refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies in the population are identical except for possible small amounts of natural mutations. Monoclonal antibodies are typically highly specific for a single antigenic site. Moreover, unlike conventional polyclonal antibody preparations (which typically have different antibodies directed against different determinants), each monoclonal antibody is directed against a single determinant on the antigen. In addition to their specificity, monoclonal antibodies have the advantage that they can be synthesized by hybridoma culture, uncontaminated by other immunoglobulins. The modifier "monoclonal" indicates the character of the antibody as obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, monoclonal antibodies for use herein can be prepared in hybridoma cells, or can be prepared by recombinant DNA methods.
The term "chimeric antibody" refers to an antibody comprising heavy and light chain variable region sequences from one species and constant region sequences from another species, e.g., an antibody having camelid heavy chain variable regions linked to human constant regions.
In the present application, the term "humanized antibody" generally refers to an antibody in which some or all of the amino acids outside the CDR regions of a non-human antibody (e.g., an alpaca antibody) are replaced with corresponding amino acids derived from a human immunoglobulin. Small additions, deletions, insertions, substitutions or modifications of amino acids in the CDR regions may also be permissible as long as they still retain the ability of the antibody to bind to a particular antigen. The humanized antibody may optionally comprise at least a portion of a human immunoglobulin constant region. "humanized antibodies" retain antigen specificity similar to the original antibody. "humanized" forms of non-human (e.g., alpaca) antibodies may be chimeric antibodies that minimally comprise sequences derived from non-human immunoglobulins. In some cases, CDR region residues in a human immunoglobulin (recipient antibody) can be replaced with CDR region residues from a non-human species (donor antibody) such as mouse, rat, rabbit or non-human primate having the desired properties, affinities and/or capabilities. In some cases, residues from the FR region of a human immunoglobulin may be replaced with corresponding non-human residues. In addition, humanized antibodies may comprise amino acid modifications that are not present in the recipient antibody or in the donor antibody. These modifications may be made in order to further improve the properties of the antibody, such as binding affinity.
In this application, the term "fully human antibody" generally refers to an antibody that is expressed by a genetically engineered antibody gene-deleted animal into which a human gene encoding the antibody has been transferred. All parts of the antibody (including the variable and constant regions of the antibody) are encoded by genes of human origin. The fully human antibody can greatly reduce the immune side reaction of the heterologous antibody to the human body. The method for obtaining fully human antibody in the field can be phage display technology, transgenic mouse technology, ribosome display technology, RNA-polypeptide technology and the like.
In the present application, the term "competition" when used in the context of antigen binding proteins that compete for the same epitope generally refers to competition between the antigen binding proteins as determined by an assay in which the antigen binding protein (e.g., antibody or immunologically functional fragment thereof) being tested prevents or inhibits (e.g., reduces) specific binding of a reference antigen binding protein (e.g., ligand or reference antibody) to a common antigen (e.g., HER2 or fragment thereof). Many types of competitive binding assays can be used to determine whether one antigen binding protein competes with another, for example: solid phase direct or indirect Radioimmunoassays (RIA), solid phase direct or indirect Enzyme Immunoassays (EIA), sandwich competition assays (see, e.g., stahli et al, 1983, methods in enzymology 9; solid phase direct biotin-avidin EIA (see, e.g., kirkland et al, 1986, J.Immunol.137, 3614-3619) solid phase direct labeling assay, solid phase direct labeling sandwich assay (see, e.g., harlow and Lane,1988, antibodies, A Laboratory Manual, cold Spring Harbor Press); direct labeling of RIA using an I-125 labeled solid phase (see, e.g., morel et al, 1988, mol. Immunol.25; solid phase direct biotin-avidin EIA (see, e.g., cheung et al, 1990, virology 176; and direct labeling RIA (Moldenhauer et al, 1990, scand. J. Immunol.32. Typically, such assays involve the use of purified antigen bound to a solid surface or a unit carrying either of these, an unlabeled test antigen binding protein and a labeled reference antigen binding protein. Competitive inhibition is measured by determining the amount of label bound to a solid surface or unit in the presence of the test antigen binding protein. Typically, the test antigen binding protein is present in excess. Antigen binding proteins identified by competition assays (competing antigen binding proteins) include antigen binding proteins that bind the same epitope as the reference antigen binding protein and antigen binding proteins that bind adjacent epitopes sufficiently close to the epitope bound by the reference antigen binding protein to undergo steric hindrance. Typically, when the competing antigen binding protein is present in excess, it inhibits (e.g., reduces) specific binding of the reference antigen binding protein to the common antigen by at least about 40-45%, about 45-50%, about 50-55%, about 55-60%, about 60-65%, about 65-70%, about 70-75%, or about 75% or more. In some cases, binding is inhibited by at least about 80-85%, about 85-90%, about 90-95%, about 95-97%, or about 97% or more.
In the present application, the term "sequence identity" generally refers to a nucleic acid or amino acid sequence in which two or more aligned sequences are identical when aligned using a sequence alignment program. The term "% sequence identity" as used herein generally refers to the level of nucleic acid or amino acid sequence identity between two or more aligned sequences when aligned using a sequence alignment program. Methods for assessing the degree of sequence identity between amino acids or nucleotides are known to those skilled in the art. For example, amino acid sequence identity is typically measured using sequence analysis software. For example, the BLAST program from the NCBI database can be used to determine identity. For the determination of sequence identity see, for example: computational Molecular Biology, lesk, a.m., ed., oxford University Press, new York,1988; biocomputing, information and Genome Projects, smith, D.W., ed., academic Press, new York,1993; computer Analysis of Sequence Data, part I, griffin, A.M., and Griffin, H.G., eds., humana Press, new Jersey,1994; sequence Analysis in Molecular Biology,20von Heinje, G., academic Press,1987 and Sequence Analysis Primer, gribskov, M.and Devereux, J., eds., M Stockton Press, new York,1991.
In the present application, amino acid residues will be represented according to the standard three-letter or one-letter amino acid code as is well known and agreed upon in the art. In comparing two amino acid sequences, the term "amino acid difference" generally refers to the specified number of amino acid residues at a position in the reference sequence compared to the other sequence, insertion, deletion or substitution. In some embodiments, the substitution is a conservative amino acid substitution, which refers to the replacement of an amino acid residue with another amino acid residue that is chemically similar in structure, and which has little or no effect on the function, activity, or other biological property of the polypeptide. Such conservative amino acid substitutions are well known in the art, for example conservative amino acid substitutions are those in which one amino acid within the following groups (i) - (v) is replaced with another amino acid residue within the same group: (i) a less aliphatic non-polar or weakly polar residue: ala, ser, thr, pro, and Gly; (ii) polar negatively charged residues and their (uncharged) amides: asp, asn, glu and Gln; (iii) polar positively charged residues: his, arg and Lys; (iv) larger aliphatic apolar residues: met, leu, ile, val, and Cys; and (v) aromatic residues: phe, tyr, and Trp. Particularly preferred conservative amino acid substitutions are as follows: ala substituted by Gly or Ser; arg is replaced by Lys; asn is replaced by Gln or His; asp substituted by Glu; cys is substituted with Ser; gln is substituted by Asn; glu is substituted with Asp; gly by Ala or Pro; his is substituted with Asn or Gln; ile is substituted by Leu or Val; leu is substituted by Ile or Val; lys is substituted with Arg, gln, or Glu; met is substituted by Leu, tyr or Ile; phe is substituted by Met, leu or Tyr; ser substituted by Thr; thr is substituted by Ser; trp is substituted by Tyr; tyr is substituted with Trp or Phe; val is substituted by Ile or Leu. In some embodiments, the substitution is a non-conservative amino acid substitution, e.g., ala is substituted with Asp, asn, glu, or Gin.
In the present application, the term "affinity" generally refers to the strength of the sum of non-covalent interactions between a single binding site of a molecule (e.g., a polypeptide or an antibody) and its binding partner (e.g., a target or an antigen). The affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (Kd). Affinity can be measured by common methods known in the art, such as surface plasmon resonance, and also includes those methods reported herein. A higher affinity of molecule X for its binding partner Y can be seen in lower Kd values and/or EC50 values.
In the present application, the term "isolated" generally refers to a molecule (e.g., an antibody, a nucleic acid, etc.) that is at least partially separated from other molecules with which it is normally associated in its native state.
The terms "polynucleotide", "nucleic acid", "nucleotide" and "oligonucleotide" are used interchangeably. They refer to a polymeric form of nucleotides of any length, or deoxyribonucleotides, ribonucleotides, or analogs thereof. Polynucleotides may have any three-dimensional structure and may perform any function, known or unknown. The following are non-limiting examples of polynucleotides: coding or non-coding regions of a gene or gene fragment, loci defined by linkage analysis, exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers. Polynucleotides may comprise modified nucleotides, such as methyl nucleotides and nucleotide analogs. Nucleotides, if present, may be modified before or after assembly of the polymer. The non-nucleotide component may interrupt the nucleotide sequence. The polynucleotide may be further modified after polymerization, such as by coupling with a labeling component.
In the present application, the term "vector" generally refers to a DNA or RNA molecule comprising a nucleotide sequence encoding a protein. A coding sequence or "coding nucleic acid sequence" may include initiation and termination signals operably linked to regulatory elements including a promoter and polyadenylation signals capable of directing expression in the cells of an individual to whom the nucleic acid molecule is administered. Examples include, but are not limited to, circular, linear, double-stranded, extrachromosomal DNA molecules (plasmids), cosmids (plasmids containing COS sequences from lambda phage), viral genomes comprising non-native nucleic acid sequences, and the like.
In the present application, the term "immunoconjugate" generally refers to a conjugate of an antibody or antibody fragment thereof linked to other active agents, such as chemotherapeutic agents, toxins, immunotherapeutic agents, radioactive elements, imaging probes, spectroscopic probes, and the like. The linkage may be a covalent bond, or a non-covalent interaction, such as by electrostatic force. A variety of linkers known in the art can be used to form immunoconjugates. The conjugate can deliver the additional agent to a target cell (e.g., a tumor cell) by specific binding of the antibody or antigen-binding fragment thereof to an antigen on the target cell. In addition, the immunoconjugate may be provided in the form of a fusion protein that may be expressed from a polynucleotide encoding the immunoconjugate.
In the present application, the term "chelating agent" generally refers to an organic molecule capable of forming a complex with a metal ion. Chelators are commonly used to label proteins or peptides. The end product of the metal ion conjugate is used for radioimmunoassay, radioimmunotherapy, magnetic resonance imaging, photodynamic therapy or other similar modalities. Non-limiting examples of chelating or complexing agents are DTPA (diethylenetriaminepentaacetic anhydride) and its derivatives, NOTA (1, 4, 7-triazacyclononane-N, N ', N "-triacetic acid) and its derivatives such as NODA-GA (NODAGA), maleimide-NODAGA, DOTA (1, 4,7, 10-tetraazacyclododecane-N, N ', N" ' -tetraacetic acid) (bound to radioactive metal ions) and its derivatives, TETA (1, 4,8, 11-tetraazacyclotetradecane-N, N ', N "' -tetraacetic acid) and its derivatives, DTTA (N- (p-isothiocyanatobenzyl) -diethylenetriamine-N, N ', N" ' -tetraacetic acid). These and other chelating agents are readily available from commercial sources.
In the present application, the term "detectable label" generally refers to a moiety having a detectable physical or chemical property, which label can produce a signal that can be detected by visual or instrumental means. Examples of labels for polypeptides include (but are not limited to) the following: radioisotopes or radionuclides, fluorescent labels (e.g., FITC, rhodamine (rhodamine), lanthanide phosphors), enzymatic labels (e.g., horseradish peroxidase, β -galactosidase, luciferase, alkaline phosphatase), chemiluminescence, biotin groups (which can be detected by labeled avidin (e.g., molecules containing streptavidin moieties) and fluorescent labels or enzymatic activity that can be detected by optical methods or calorimetry), and predetermined polypeptide epitopes recognized by secondary reporters (e.g., leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags).
In the present application, the term "pharmaceutically acceptable carrier" generally refers to one or more non-toxic materials that do not interfere with the effectiveness of the biological activity of the active ingredient. Such formulations may routinely contain salts, buffers, preservatives, compatible carriers, and optionally other therapeutic agents. Such pharmaceutically acceptable formulations may also contain compatible solid or liquid fillers, diluents or encapsulating substances suitable for administration to humans. Other contemplated carriers, excipients, and/or additives that may be used in the formulations described herein include: for example, flavoring agents, antimicrobial agents, sweeteners, antioxidants, antistatic agents, lipids, proteinaceous excipients (e.g., serum albumin, gelatin, casein), salt-forming counterions (e.g., sodium), and the like. These and additional known pharmaceutical carriers, excipients and/or additives suitable for use in The formulations described herein are known in The art, for example, as set forth in Remington's pharmaceutical sciences and practices (Remington: the Science & # x26; practice of Pharmacy), "21 st edition, lepidote Williams and Wilkins publishing company (Lippincott Williams & # x26; wilkins) (2005) and" physicians's desk Reference "(60 th edition, medical economic publications (Medical Economics), montmel (Montvale), new Jersey (2005). Pharmaceutically acceptable carriers may be routinely selected as appropriate for the desired or required mode of administration, solubility and/or stability.
In the present application, the term "administration (administer)" and similar terms are generally not limited to bodily administration, and suitable methods include in vitro, ex vivo, or in vivo methods. For example, any method of administration known to those skilled in the art for contacting a cell, organ or tissue with a composition may be employed. For example, the compounds may be introduced into the body of a subject in need of treatment by any route of introduction or delivery. In some embodiments, the compositions of the present application may be administered orally, topically, intranasally, intramuscularly, subcutaneously, intradermally, intrathecally, intraperitoneally, or transdermally.
In the present application, the term "contacting" generally means that two or more different types of substances are brought together in any order, in any manner, and for any length of time. The contacting can occur in vivo, ex vivo, or in vitro. In one embodiment, such contacting comprises direct injection of the cells by any method known in the art, such as microinjection. In another embodiment, the providing to the cell is indirect, e.g., by providing in a medium surrounding the cell, or administering to the subject, or by any route known in the art. In another embodiment, the term "contacting" means introducing a molecule of the invention into a subject receiving treatment and contacting the molecule with a cell in vivo. Each possibility represents a separate embodiment of the invention.
In the present application, the terms "ex vivo" and "in vitro" are interchangeable, and generally refer to activities performed in a controlled environment in cells, tissues and/or organs that have been removed from a subject.
In the present application, the term "diagnosing" generally refers to detecting a disease or condition, or determining the state or extent of a disease or condition. The term "diagnosing" may also include detecting a predisposition for a disease or condition, determining the therapeutic effect of a drug treatment, or predicting a response pattern to a drug treatment.
In the present application, the term "treatment" generally means: (i) Preventing the occurrence of a disease, disorder, or condition in a patient who may be predisposed to the disease, disorder, and/or condition, but has not yet been diagnosed as having the disease; (ii) Inhibiting, i.e., arresting the development of, the disease, disorder or condition; and (iii) ameliorating the disease, disorder, or condition, i.e., causing regression of the disease, disorder, and/or condition and/or symptoms associated with the disease, disorder, and/or condition.
In the present application, the terms "effective amount" or "effective dose" are used interchangeably and generally refer to an amount sufficient to achieve, or at least partially achieve, the desired therapeutic effect. The term "therapeutically effective dose" generally refers to an amount sufficient to cure or at least partially arrest the disease and its complications in a patient already suffering from the disease. The amount effective for such use will depend on the severity of the infection and the overall state of the patient's own immune system.
In the present application, the terms "tumor" and "cancer" are used interchangeably and generally refer to neoplastic or malignant cell growth. The tumor of the present application may be benign or malignant. The tumors of the present application may be solid or non-solid. Examples of cancer include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia or lymphoid malignancies. More specific examples of such cancers include, but are not limited to, squamous cell cancer (e.g., epithelial squamous cell cancer), lung cancer (including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, and squamous carcinoma of the lung), cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer (including gastrointestinal and gastrointestinal stromal cancer), pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, urinary tract cancer, hepatoma, breast cancer, colon cancer, rectal cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, anal carcinoma, penile carcinoma, melanoma, superficial diffuse melanoma, lentigo nevus melanoma, acromelanoma, melanoma, multiple myeloma and B-cell lymphoma, chronic Lymphocytic Leukemia (CLL), acute Lymphoblastic Leukemia (ALL), hairy cell leukemia, chronic myelogenous leukemia, and post-transplant lymphoproliferative disorder (ptphald), as well as associated with scarring (koospes), edema (such as associated with brain tumors) and proliferative brain (Meigs) cancer, and head and neck cancer. In certain embodiments, cancers suitable for treatment by the antibodies of the invention include breast cancer, colorectal cancer, rectal cancer, non-small cell lung cancer, glioblastoma, non-hodgkin's lymphoma (NHL), renal cell carcinoma, prostate cancer, liver cancer, pancreatic cancer, soft tissue sarcoma, kaposi's sarcoma, carcinoid carcinoma (carcinoid carcinosa), head and neck cancer, ovarian cancer, mesothelioma, and multiple myeloma. In some embodiments, the cancer is selected from: non-small cell lung cancer, glioblastoma, neuroblastoma, melanoma, breast cancer (e.g., triple negative breast cancer), gastric cancer, colorectal cancer (CRC), and hepatocellular carcinoma. Also, in some embodiments, the cancer is selected from: non-small cell lung cancer, colorectal cancer, glioblastoma and breast cancer (e.g., triple negative breast cancer), including metastatic forms of those cancers.
In the present application, the term "autoimmune disease" generally refers to a condition resulting from an autoimmune response. Autoimmune diseases are the result of inappropriate and excessive responses to self-antigens. Examples of autoimmune diseases include, but are not limited to, edison's disease, alopecia areata, ankylosing spondylitis, autoimmune hepatitis, autoimmune parotitis, crohn's disease, diabetes mellitus, graves 'disease, guillain-Barre syndrome, hashimoto's disease, hemolytic anemia, neurolysis, hemolytic anemia, autoimmune hepatitis, autoimmune parotitis, crohn's disease, diabetes mellitus, dystrophic epidermolysis bullosa, epididymitis, glomerulonephritis, graves' disease, guillain-Barr syndrome, hashimoto's disease, hemolytic anemia, neurolysis anemia systemic lupus erythematosus (systemic lupus erythematous), multiple sclerosis (multiple sclerosis), myasthenia gravis (myasthenia gravis), pemphigus vulgaris (pemphigus vulgaris), psoriasis (psoriasis), rheumatic fever (rhematic patient), rheumatoid arthritis (rhematic arthritis), sarcoidosis (sarcoidosis), scleroderma (scleroderma), sjogren's syndrome, spondyloarthritis (spinosynhymosis), thyroiditis (thyroiditis), vasculitis (vasculitis), typhoid fever (vitis), mucoadenoma, myxedema (myxedema), malignant epilepsy, ulcerative colitis (ulcerative colitis), and the like.
In the present application, the term "infectious disease" generally refers to an agent (such as a virus, fungus or bacterium) that is harmful to its host. In certain embodiments, a factor that is harmful to humans. "anti-infectious disease" means a therapeutic measure that prevents, ameliorates, or eradicates an infectious disease and/or its causative agent.
In the present application, the term "subject" generally refers to a human or non-human animal, including but not limited to cats, dogs, horses, pigs, cows, sheep, rabbits, mice, rats, monkeys, etc.
In the present application, the term "about" generally refers to a variation in the range of 0.5% -10% above or below the specified value, such as a variation in the range of about 0.5%, about 1%, about 1.5%, about 2%, about 2.5%, about 3%, about 3.5%, about 4%, about 4.5%, about 5%, about 5.5%, about 6%, about 6.5%, about 7%, about 7.5%, about 8%, about 8.5%, about 9%, about 9.5%, or about 10% above or below the specified value.
In this application, the terms "comprises," "comprising," and variations thereof, including "comprises," "comprising," and other variations thereof, are intended to cover a generic term for use herein, which comprises or includes other components, elements, values, steps, or the like.
In the present application, the term "substantially" generally refers to an inherent degree of uncertainty that may be attributed to any quantitative comparison, value, measurement, or other representation. The term "substantially" is also utilized herein to represent the degree by which a quantitative representation may vary from a stated reference without resulting in a change in the basic function of the subject matter at issue.
In this specification and the claims, the singular forms "a", "an" and "the" include plural referents unless the context clearly dictates otherwise. The terms "a" (or "an"), and the terms "one or more" and "at least one" may be used interchangeably herein. For example, a cell may refer to a single cell or a population of cells.
Detailed Description
Antigen binding proteins
In one aspect, the present application provides an antigen binding protein comprising a variable antigen binding domain (VHH) of a heavy chain antibody, wherein the VHH comprises one or more pairs of engineered cysteine residues, wherein each pair of the engineered cysteine residues independently comprises a cysteine residue at a first position and a cysteine residue at a second position, the cysteine residue at the first position and the cysteine residue at the second position being capable of pairing to form a disulfide bond; wherein at least one of the cysteine residue at the first position and the cysteine residue at the second position is mutated.
For example, the cysteine residue at the first position is native to the antigen binding protein, and the cysteine residue at the second position is mutated. For another example, the cysteine residue at the first position is mutated and the cysteine residue at the second position is self-contained by the antigen binding protein.
In certain embodiments, wherein the cysteine residue at the first position and the cysteine residue at the second position are both mutated.
In certain embodiments, wherein the disulfide bond is capable of forming a sulfhydryl group upon reduction by a reducing agent, wherein the sulfhydryl group allows the antigen binding protein to be conjugated to a payload at the first position and/or the second position. Reducing agents include, but are not limited to, tris (2-carboxyethyl) phosphine, mercaptoethanol, dithiothreitol, cysteine, reduced glutathione, and the like.
In certain embodiments, wherein the engineered cysteine residue does not substantially reduce the affinity of the antigen binding protein.
For example, an antigen binding protein comprising the engineered cysteine residue has an affinity for the antigen of interest that is about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, about 100% or more of that of the parent as compared to the parent.
In certain embodiments, wherein the first position and the second position are both located in the Framework Region (FR) of the VHH.
In some embodiments, neither the first location nor the second location is in a loop region of the VHH.
In certain embodiments, wherein neither the first location nor the second location is located in a Complementarity Determining Region (CDR) of the VHH.
In certain embodiments, wherein neither the first position nor the second position is adjacent to an amino acid residue of the internal disulfide bond of the VHH.
In certain embodiments, wherein the engineered cysteine does not pair with a self-contained cysteine residue of the antigen binding protein.
For example, the first position and the second position are located in the Framework Region (FR) of the VHH and neither the first position nor the second position is adjacent to an amino acid residue of the internal disulfide bond of the VHH.
In certain embodiments, wherein neither the first position nor the second position is adjacent to a cysteine residue carried by the VHH.
For example, the first and second positions are located in the Framework Region (FR) of the VHH, and neither the first nor second positions are adjacent to a cysteine residue carried by the VHH.
In the present application, the term "close to" generally means that the amino acid residues are spaced apart from C.beta. -C.beta.at a distance of about C.beta.In scope, the term "not close to" generally means that the spatial distance of an amino acid residue (C β -C β) is greater than about->The two cysteine residues are not close to each other and can not form disulfide bond pairing; the spatial distance of amino acid residues can be calculated predictively by Swiss-PdbViewer software.
For example, the first and second positions are located in the Framework Region (FR) of the VHH, and both the first and second positions have a cbp-cbp greater than about that of a cysteine residue carried by the VHH
In certain embodiments, wherein the cysteine at the first position and the cysteine at the second position have a C.beta. -C.beta.of no more thanThe spatial distance of amino acid residues can be calculated predictively by Swiss-PdbViewer software.
For example, the first position and the second position are located in the Framework Region (FR) of the VHH, and the Cys at the first position and the Cys at the second position have a C.beta. -C.beta.of no more than about
For another example, the first position and the second position are located in the Framework Region (FR) of the VHH, and both the first position and the second position have a cbeta-cbeta of greater than about the cysteine residue carried by the VHH And said cysteine at the first position is in contact with said the C beta-C beta of the cysteine in the second position does not exceed about->
In certain embodiments, wherein the cysteine at the first position and the cysteine at the second position are both located on the surface of the antigen binding protein.
Amino acid residues are distributed on the surface and in the inner core of the protein, the surface of the water-soluble protein comprises a plurality of polar amino acids, charged amino acids and non-polar amino acids, while the protein core mainly comprises non-polar amino acids, the non-polar amino acids of the protein are buried in the inner core during the folding process of the protein, and the rest amino acids are on the surface. In the present application, the term "antigen binding protein surface" generally refers to a region consisting of amino acid residues located on the surface of an antigen binding protein, for example, the region of the surface amino acid residues of the antigen binding protein may include a loop region, the N-terminus or the C-terminus. In some embodiments, whether an amino acid residue is located on the surface of an antigen binding protein can be distinguished by the relative solvent accessibility of the amino acid residue, e.g., an amino acid residue can be considered to be located on the surface of an antigen binding protein when the relative solvent accessibility (ASA%) of the amino acid residue is not less than about 20%; alternatively, amino acid residues may be considered to be located within the antigen binding protein when the relative solvent accessibility (ASA%) of the amino acid residues is less than about 20%. In this application, the term "internal disulfide bond" generally refers to a disulfide bond formed from an antibody itself bearing a cysteine in which at least one cysteine residue has solvent accessibility to ASA% < 20%. In the present application, the term "surface disulfide bond" generally means that the relative solvent accessibility (ASA%) of both cysteine residues that form a disulfide bond in an antigen binding protein is not less than about 20%, wherein at least one cysteine residue is engineered. Solvent accessibility of amino acid residues was predicted from http:// cib.cf.ocha.ac.jp/bitool/ASA/website or calculated by the Swiss-PdbViewer software.
In certain embodiments, the cysteine at the first position and the cysteine at the second position are capable of pairing to form a surface disulfide bond.
In certain embodiments, wherein the relative solvent accessibility (ASA%) of the amino acid residue at the first position to the amino acid residue at the second position is not less than about 20%; solvent accessibility of amino acid residues was predicted from http:// cib.cf.ocha.ac.jp/bitool/ASA/website or calculated by the Swiss-PdbViewer software.
For example, the first position and the second position are located in the Framework Region (FR) of the VHH, the relative solvent accessibility (ASA%) of the amino acid residue at the first position to the amino acid residue at the second position is not less than about 20%, and the C β -C β of the cysteine at the first position and the cysteine at the second position is not more than about
For another example, the first position and the second position are located in the Framework Region (FR) of the VHH, the relative solvent accessibility (ASA%) of the amino acid residue at the first position to the amino acid residue at the second position is not less than about 20%, and the C β -C β of the cysteine residue at both the first position and the second position from the VHH is greater than about And said cysteine at a first position does not exceed about ++ C β -C β +>
In certain embodiments, wherein the first location and the second location are each independently selected from the following locations: 3. 7, 9, 11, 12, 13, 17, 23, 39, 41, 66, 68, 83, 84, 87, 8, 16, 18, 25, 42, 45, 81, 82a, 82b, 85, 108, 110, 111, and 113; wherein the first location and the second location are different; wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
For example, the first and second locations are each independently selected from the following locations: 3. 7, 9, 11, 12, 13, 17, 23, 39, 41, 66, 68, 83, 84, 87, 8, 16, 18, 25, 42, 45, 81, 82a, 82b, 85, 108, 110, 111, and 113; wherein the first location and the second location are different; wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering; the relative solvent accessibility (ASA%) of the amino acid residue at the first position to the amino acid residue at the second position is not less than about 20%, and the C β -C β of the cysteine at the first position to the cysteine at the second position is not more than about
In certain embodiments, wherein the first location is selected from: 3. 7, 9, 11, 12, 13, 17, 23, 39, 41, 66, 68, 83, 84, and 87; the second position is selected from: 8. 16, 18, 25, 42, 45, 81, 82a, 82b, 85, 108, 110, 111, and 113; the first and second positions are different; wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
For example, wherein the first position is selected from: 3. 7, 9, 11, 12, 13, 17, 23, 39, 41, 66, 68, 83, 84, and 87; the second position is selected from: 8. 16, 18, 25, 42, 45, 81, 82a, 82b, 85, 108, 110, 111 and 113; the first and second positions are different; wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering; the relative solvent accessibility (ASA%) of the amino acid residue at the first position to the amino acid residue at the second position is not less than about 20%, and the C β -C β of the cysteine at the first position to the cysteine at the second position is not more than about
In certain embodiments, wherein the combination of the first and second locations is selected from at least one of the following combinations: a) 66-82b; b) 3-25; c) 7-8; d) 84-113; e) 83-85; f) 68-81; g) 17-82a; h) 41-42; i) 9-108; j) 11 to 110; k) 87-111; l) 13 to 16; m) 12 to 18; n) 39-45; and o) 14 to 113; wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
In certain embodiments, wherein the combination of amino acid residues at the first position and amino acid residues at the second position is selected from at least one of the following combinations: a) 66 (R/E) -82b (S/N/R/T/D/Y); b) 3 (Q) -25 (S); c) 7 (S) -8 (G); d) 84 (A/P/M) -113 (S); e) 83 (K/R/Q/S/T/E) -85 (E/D); f) 68 (T/V/A) -81 (Q/E/N); g) 17 (S) -82a (N/L/D); h) 41 (P/A/R) -42 (G); i) 9 (G) -108 (L/Q/H); j) 11 (S/L) -110 (T); k) 87 (T/A/L) -111 (V/D); l) 13 (Q/R) -16 (G); m) 12 (V/G) -18 (L); n) 39 (Q) -45 (R/C/L/H); and o) 14 (P) -113 (S); wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering and the amino acid residues in brackets refer to the type of amino acid residue at that position before the antigen binding protein is not mutated.
In certain embodiments, wherein the VHH comprises 1, 2, 3 or 4 cysteine residues.
In certain embodiments, wherein said VHH comprises 2 pairs of cysteine residues, wherein the combination of said first and second positions in each pair of cysteine residues is selected from any two of the following combinations: a) 66-82b; b) 3-25; c) 7-8; d) 84-113; e) 83-85; f) 68-81; g) 17-82a; h) 41-42; i) 9-108; j) 11-110; k) 87-111; l) 13 to 16; m) 12 to 18; n) 39-45; and o) 14 to 113; wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
For example, wherein the VHH comprises 2 pairs of cysteine residues, wherein the combination of the first and second positions in each pair of cysteine residues may be selected from: 66-82b and 3-25;66-82b and 7-8;66-82b and 84-113;66-82b and 83-85;66-82b and 68-81;66-82b and 17-82a;66-82b and 41-42;66-82b and 9-108;66-82b and 11-110;66-82b and 87-111;66-82b and 13-16;66-82b and 12-18;66-82b and 39-45;3-25 and 7-8;3-25 and 84-113;3-25 and 83-85;3-25 and 68-81;3-25 and 17-82a;3-25 and 41-42;3-25 and 9-108;3-25 and 11-110;3-25 and 87-111;3-25 and 13-16;3-25 and 12-18;3-25 and 39-45;7-8 and 84-113;7-8 and 83-85;7-8 and 68-81;7-8 and 17-82a;7-8 and 41-42;7-8 and 9-108;7-8 and 11-110;7-8 and 87-111;7-8 and 13-16;7-8 and 12-18;7-8 and 39-45;84-113 and 83-85;84-113 and 68-81;84-113 and 17-82a;84-113 and 41-42;84-113 and 9-108;84-113 and 11-110;84-113 and 87-111;84-113 and 13-16;84-113 and 12-18;84-113 and 39-45;83-85 and 68-81;83-85 and 17-82a;83-85 and 41-42;83-85 and 9-108;83-85 and 11-110;83-85 and 87-111;83-85 and 13-16;83-85 and 12-18;83-85 and 39-45;68-81 and 17-82a;68-81 and 41-42;68-81 and 9-108;68-81 and 11-110;68-81 and 87-111;68-81 and 13-16;68-81 and 12-18;68-81 and 39-45;17-82a and 41-42;17-82a and 9-108;17-82a and 11-110;17-82a and 87-111;17-82a and 13-16;17-82a and 12-18;17-82a and 39-45;41-42 and 9-108;41-42 and 11-110;41-42 and 87-111;41-42 and 13-16;41-42 and 12-18;41-42 and 39-45;9-108 and 11-110;9-108 and 87-111;9-108 and 13-16;9-108 and 12-18;9-108 and 39-45;11-110 and 87-111;11-110 and 13-16;11-110 and 12-18;11-110 and 39-45;87-111 and 13-16;87-111 and 12-18;87-111 and 39-45;13-16 and 12-18;13-16 and 39-45; and 12-18 and 39-45; wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
In certain embodiments, wherein the VHH comprises 2 pairs of cysteine residues, wherein the combination of the first and second positions in each pair of cysteine residues is selected from any two of the following combinations: a) 66 (R/E) -82b (S/N/R/T/D/Y); b) 3 (Q) -25 (S); c) 7 (S) -8 (G); d) 84 (A/P/M) -113 (S); e) 83 (K/R/Q/S/T/E) -85 (E/D); f) 68 (T/V/A) -81 (Q/E/N); g) 17 (S) -82a (N/L/D); h) 41 (P/A/R) -42 (G); i) 9 (G) -108 (L/Q/H); j) 11 (S/L) -110 (T); k) 87 (T/A/L) -111 (V/D); l) 13 (Q/R) -16 (G); m) 12 (V/G) -18 (L); n) 39 (Q) -45 (R/C/L/H); and o) 14 (P) -113 (S); wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering and the amino acid residues in brackets refer to the type of amino acid residue at that position before the antigen binding protein is not mutated.
For example, wherein the VHH comprises 2 pairs of cysteine residues, wherein the combination of the first and second positions in each pair of cysteine residues may be selected from: 66 (R/E) -82b (S/N/R/T/D/Y) and 3 (Q) -25 (S); 66 (R/E) -82b (S/N/R/T/D/Y) and 7 (S) -8 (G); 66 (R/E) -82b (S/N/R/T/D/Y) and 84 (A/P/M) -113 (S); 66 (R/E) -82b (S/N/R/T/D/Y) and 83 (K/R/Q/S/T/E) -85 (E/D); 66 (R/E) -82b (S/N/R/T/D/Y) and 68 (T/V/A) -81 (Q/E/N); 66 (R/E) -82b (S/N/R/T/D/Y) and 17 (S) -82a (N/L/D); 66 (R/E) -82b (S/N/R/T/D/Y) and 41 (P/A/R) -42 (G); 66 (R/E) -82b (S/N/R/T/D/Y) and 9 (G) -108 (L/Q/H); 66 (R/E) -82b (S/N/R/T/D/Y) and 11 (S/L) -110 (T); 66 (R/E) -82b (S/N/R/T/D/Y) and 87 (T/A/L) -111 (V/D); 66 (R/E) -82b (S/N/R/T/D/Y) and 13 (Q/R) -16 (G); 66 (R/E) -82b (S/N/R/T/D/Y) and 12 (V/G) -18 (L); 66 (R/E) -82b (S/N/R/T/D/Y) and 39 (Q) -45 (R/C/L/H); 3 (Q) -25 (S) and 7 (S) -8 (G); 3 (Q) -25 (S) and 84 (A/P/M) -113 (S); 3 (Q) -25 (S) and 83 (K/R/Q/S/T/E) -85 (E/D); 3 (Q) -25 (S) and 68 (T/V/A) -81 (Q/E/N); 3 (Q) -25 (S) and 17 (S) -82a (N/L/D); 3 (Q) -25 (S) and 41 (P/A/R) -42 (G); 3 (Q) -25 (S) and 9 (G) -108 (L/Q/H); 3 (Q) -25 (S) and 11 (S/L) -110 (T); 3 (Q) -25 (S) and 87 (T/A/L) -111 (V/D); 3 (Q) -25 (S) and 13 (Q/R) -16 (G); 3 (Q) -25 (S) and 12 (V/G) -18 (L); 3 (Q) -25 (S) and 39 (Q) -45 (R/C/L/H); 7 (S) -8 (G) and 7 (S) -8 (G); 7 (S) -8 (G) and 84 (A/P/M) -113 (S); 7 (S) -8 (G) and 83 (K/R/Q/S/T/E) -85 (E/D); 7 (S) -8 (G) and 68 (T/V/A) -81 (Q/E/N); 7 (S) -8 (G) and 17 (S) -82a (N/L/D); 7 (S) -8 (G) and 41 (P/A/R) -42 (G); 7 (S) -8 (G) and 9 (G) -108 (L/Q/H); 7 (S) -8 (G) and 11 (S/L) -110 (T); 7 (S) -8 (G) and 87 (T/A/L) -111 (V/D); 7 (S) -8 (G) and 13 (Q/R) -16 (G); 7 (S) -8 (G) and 12 (V/G) -18 (L); 7 (S) -8 (G) and 39 (Q) -45 (R/C/L/H); 84 (A/P/M) -113 (S) and 83 (K/R/Q/S/T/E) -85 (E/D); 84 (A/P/M) -113 (S) and 68 (T/V/A) -81 (Q/E/N); 84 (A/P/M) -113 (S) and 17 (S) -82a (N/L/D); 84 (A/P/M) -113 (S) and 41 (P/A/R) -42 (G); 84 (A/P/M) -113 (S) and 9 (G) -108 (L/Q/H); 84 (A/P/M) -113 (S) and 11 (S/L) -110 (T); 84 (A/P/M) -113 (S) and 87 (T/A/L) -111 (V/D); 84 (A/P/M) -113 (S) and 13 (Q/R) -16 (G); 84 (A/P/M) -113 (S) and 12 (V/G) -18 (L); 84 (A/P/M) -113 (S) and 39 (Q) -45 (R/C/L/H); 83 (K/R/Q/S/T/E) -85 (E/D) and 68 (T/V/A) -81 (Q/E/N); 83 (K/R/Q/S/T/E) -85 (E/D) and 17 (S) -82a (N/L/D); 83 (K/R/Q/S/T/E) -85 (E/D) and 41 (P/A/R) -42 (G); 83 (K/R/Q/S/T/E) -85 (E/D) and 9 (G) -108 (L/Q/H); 83 (K/R/Q/S/T/E) -85 (E/D) and 11 (S/L) -110 (T); 83 (K/R/Q/S/T/E) -85 (E/D) and 87 (T/A/L) -111 (V/D); 83 (K/R/Q/S/T/E) -85 (E/D) and 13 (Q/R) -16 (G); 83 (K/R/Q/S/T/E) -85 (E/D) and 12 (V/G) -18 (L); 83 (K/R/Q/S/T/E) -85 (E/D) and 39 (Q) -45 (R/C/L/H); 68 (T/V/A) -81 (Q/E/N) and 17 (S) -82a (N/L/D); 68 (T/V/A) -81 (Q/E/N) and 41 (P/A/R) -42 (G); 68 (T/V/A) -81 (Q/E/N) and 9 (G) -108 (L/Q/H); 68 (T/V/A) -81 (Q/E/N) and 11 (S/L) -110 (T); 68 (T/V/A) -81 (Q/E/N) and 87 (T/A/L) -111 (V/D); 68 (T/V/A) -81 (Q/E/N) and 13 (Q/R) -16 (G); 68 (T/V/A) -81 (Q/E/N) and 12 (V/G) -18 (L); 68 (T/V/A) -81 (Q/E/N) and 39 (Q) -45 (R/C/L/H); 17 (S) -82a (N/L/D) and 41 (P/A/R) -42 (G); 17 (S) -82a (N/L/D) and 9 (G) -108 (L/Q/H); 17 (S) -82a (N/L/D) and 11 (S/L) -110 (T); 17 (S) -82a (N/L/D) and 87 (T/A/L) -111 (V/D); 17 (S) -82a (N/L/D) and 13 (Q/R) -16 (G); 17 (S) -82a (N/L/D) and 12 (V/G) -18 (L); 17 (S) -82a (N/L/D) and 39 (Q) -45 (R/C/L/H); 41 (P/A/R) -42 (G) and 9 (G) -108 (L/Q/H); 41 (P/A/R) -42 (G) and 11 (S/L) -110 (T); 41 (P/A/R) -42 (G) and 87 (T/A/L) -111 (V/D); 41 (P/A/R) -42 (G) and 13 (Q/R) -16 (G); 41 (P/A/R) -42 (G) and 12 (V/G) -18 (L); 41 (P/A/R) -42 (G) and 39 (Q) -45 (R/C/L/H); 9 (G) -108 (L/Q/H) and 11 (S/L) -110 (T); 9 (G) -108 (L/Q/H) and 87 (T/A/L) -111 (V/D); 9 (G) -108 (L/Q/H) and 13 (Q/R) -16 (G); 9 (G) -108 (L/Q/H) and 12 (V/G) -18 (L); 9 (G) -108 (L/Q/H) and 39 (Q) -45 (R/C/L/H); 11 (S/L) -110 (T) and 87 (T/A/L) -111 (V/D); 11 (S/L) -110 (T) and 13 (Q/R) -16 (G); 11 (S/L) -110 (T) and 12 (V/G) -18 (L); 11 (S/L) -110 (T) and 39 (Q) -45 (R/C/L/H); 87 (T/A/L) -111 (V/D) and 13 (Q/R) -16 (G); 87 (T/A/L) -111 (V/D) and 12 (V/G) -18 (L); 87 (T/A/L) -111 (V/D) and 39 (Q) -45 (R/C/L/H); 13 (Q/R) -16 (G) and 12 (V/G) -18 (L); 13 (Q/R) -16 (G) and 39 (Q) -45 (R/C/L/H); and 12 (V/G) -18 (L) and 39 (Q) -45 (R/C/L/H); wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering and the amino acid residues in brackets refer to the type of amino acid residue at that position before the antigen binding protein is not mutated.
For example, wherein the VHH may comprise 2 pairs of cysteine residues, wherein the combination of the first and second positions in each pair of cysteine residues may be selected from: a) 3-25 and 84-113; b) 7-8 and 3-25; c) 7-8 and 84-113; and d) 11-110 and 84-113; wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
For example, wherein the VHH may comprise 2 pairs of cysteine residues, wherein the combination of the first and second positions in each pair of cysteine residues may be selected from: a) 3 (Q) -25 (S) and 84 (A/P/M) -113 (S); b) 7 (S) -8 (G) and 3 (Q) -25 (S); c) 7 (S) -8 (G) and 84 (A/P/M) -113 (S); and d) 11 (S/L) -110 (T) and 84 (A/P/M) -113 (S); wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering and the amino acid residues in brackets refer to the type of amino acid residue at that position before the antigen binding protein is not mutated.
In certain embodiments, wherein the antigen binding protein comprises an antibody or antigen binding fragment thereof.
In certain embodiments, wherein the antibody or antigen binding fragment comprises a monoclonal antibody.
In certain embodiments, wherein the antibody or antigen-binding fragment thereof comprises a VHH antibody or a heavy chain antibody.
For example, the antigen binding protein may be a VHH antibody, the VHH comprising one or more pairs of engineered cysteine residues, wherein each pair of the engineered cysteine residues independently comprises a cysteine residue at a first position and a cysteine residue at a second position, the cysteine residue at the first position being capable of pairing to form a disulfide bond with the cysteine residue at the second position; wherein at least one of the cysteine residue at the first position and the cysteine residue at the second position is mutated; wherein the combination of the first and second locations is selected from at least one of the following combinations: a) 66-82b; b) 3-25; c) 7-8; d) 84-113; e) 83-85; f) 68-81; g) 17-82a; h) 41-42; i) 9-108; j) 11-110; k) 87-111; l) 13 to 16; m) 12 to 18; n) 39-45; and o) 14 to 113; wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
For example, the antigen binding protein may be a VHH antibody, the VHH comprising one or more pairs of engineered cysteine residues, wherein each pair of the engineered cysteine residues independently comprises a cysteine residue at a first position and a cysteine residue at a second position, the cysteine residue at the first position being capable of pairing to form a disulfide bond with the cysteine residue at the second position; wherein at least one of the cysteine residue at the first position and the cysteine residue at the second position is mutated; wherein the combination of the amino acid residue at the first position and the amino acid residue at the second position is selected from at least one of the following combinations: a) 66 (R/E) -82b (S/N/R/T/D/Y); b) 3 (Q) -25 (S); c) 7 (S) -8 (G); d) 84 (A/P/M) -113 (S); e) 83 (K/R/Q/S/T/E) -85 (E/D); f) 68 (T/V/A) -81 (Q/E/N); g) 17 (S) -82a (N/L/D); h) 41 (P/A/R) -42 (G); i) 9 (G) -108 (L/Q/H); j) 11 (S/L) -110 (T); k) 87 (T/A/L) -111 (V/D); l) 13 (Q/R) -16 (G); m) 12 (V/G) -18 (L); n) 39 (Q) -45 (R/C/L/H); and o) 14 (P) -113 (S); wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering and the amino acid residues in brackets refer to the type of amino acid residue at that position before the antigen binding protein is not mutated.
For example, the antigen binding protein may be a VHH antibody, the VHH comprising one or more pairs of engineered cysteine residues, wherein each pair of the engineered cysteine residues independently comprises a cysteine residue at a first position and a cysteine residue at a second position, the cysteine residue at the first position being capable of pairing to form a disulfide bond with the cysteine residue at the second position; wherein at least one of the cysteine residue at the first position and the cysteine residue at the second position is mutated; wherein said VHH may comprise 2 pairs of cysteine residues, wherein the combination of said first and second positions in each pair of cysteine residues is selected from the group consisting of: a) 3-25 and 84-113; b) 7-8 and 3-25; c) 7-8 and 84-113; and d) 11-110 and 84-113; wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering.
For example, the antigen binding protein may be a VHH antibody, the VHH comprising one or more pairs of engineered cysteine residues, wherein each pair of the engineered cysteine residues independently comprises a cysteine residue at a first position and a cysteine residue at a second position, the cysteine residue at the first position being capable of pairing to form a disulfide bond with the cysteine residue at the second position; wherein at least one of the cysteine residue at the first position and the cysteine residue at the second position is mutated; wherein the VHH comprises 2 pairs of cysteine residues, wherein the combination of the first and second positions in each pair of cysteine residues is selected from the group consisting of: a) 3 (Q) -25 (S) and 84 (A/P/M) -113 (S); b) 7 (S) -8 (G) and 3 (Q) -25 (S); c) 7 (S) -8 (G) and 84 (A/P/M) -113 (S); and d) 11 (S/L) -110 (T) and 84 (A/P/M) -113 (S); wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering and the amino acid residues in brackets refer to the type of amino acid residue at that position before the antigen binding protein is not mutated.
In certain embodiments, wherein the antibody or antigen-binding fragment comprises a chimeric antibody, a humanized antibody, and/or a fully human antibody.
In certain embodiments, wherein the antigen binding protein is a humanized VHH antibody or a fully human VHH antibody.
In certain embodiments, wherein the antigen binding protein specifically binds to a tumor antigen or a non-tumor antigen.
<xnotran> , CD19, BCMA, TSHR, CD171, CS-1, CLL-1, GD3, tn Ag, FLT3, CD38, CD123, CD44v6, B7H3, B7H4, KIT, IL-13Ra2, IL-11Ra, PSCA, PSMA, PRSS21, EGFR2, lewisY, CD24, PDGFR-beta, SSEA-4, MUC1, EGFR, NCAM, CAIX, LMP2, ephA2, GM1, sLe, GM3, TGS5, HMWMAA, FOLR1, FOLR2, TEM1/CD248, TEM7R, CLDN6, CLDN18.2, GPRC5D, CXORF61, CD97, CD179a, ALK, , PLAC1, globoH, NY-BR-1, UPK2, HAVCR1, ADRB3, PANX3, GPR20, LY6K, OR51E2, TAARP, WT1, ETV6-AML, SPA17, XAGE1, tie 2, MAD-CT-1, MAD-CT-2, FOSL1, hTERT, ML-IAP, ERG, NA17, PAX3, AR, B1, MYCN, rhoC, CYP1B1, BORIS, SART3, PAX5, OY-TES1, LCK, AKAP-4, SSX2, CD79a, CD79b, CD72, LAIR1, FCAR, LILRA2, CD300LF, CLEC12A, BST2, EMR2, LY75, GPC3, FCRL5, IGLL1, CD20, CD30, HER2, ROR1, TAAG72, CD22, CD33, GD2, gp100Tn, FAP, , EPCAM, CEA, IGF-1R, ephB2, , 17, CD32b, EGFRvIII, GPNMB, GPR64, HER3, LRP6, LYPD8, NKG2D, SLC34A2, SLC39A6, SLITRK6, GUCY2C, 5T4 / TACSTD2. </xnotran>
In certain embodiments, wherein the antigen binding protein comprises an anti-PD-L1 VHH antibody, an anti-HER 2 VHH antibody, or an anti-CD 8 α VHH antibody.
In another aspect, the present application provides a fusion polypeptide comprising an antigen binding protein described herein.
In the present application, the term "fusion protein" generally refers to a macromolecule formed by linking two different protein molecules by chemical and/or genetic fusion. The fusion protein can be an expression product obtained by recombining two genes by using a DNA recombination technology, and can also be a group of proteins for mediating the fusion of two cell plasma membranes. In the present application, the fusion protein may be a protein molecule having the above two-part domain, which is obtained by linking a gene of interest to the immunoglobulin Fc region or a variant fragment thereof gene at the gene level and expressing the protein molecule in eukaryotic or prokaryotic cells. In the present application, a fusion protein may comprise two polypeptide chains. In addition, fusion proteins can be produced by chemically linking two proteins.
anti-PD-L1
VHH antibodies
For example, the antigen binding protein may be an anti-PD-L1 VHH antibody, said VHH comprising one or more pairs of engineered cysteine residues, wherein each pair of said engineered cysteine residues independently comprises a cysteine residue at a first position and a cysteine residue at a second position, said cysteine residue at the first position being capable of pairing to form a disulfide bond with said cysteine residue at the second position; wherein at least one of the cysteine residue at the first position and the cysteine residue at the second position is mutated; wherein the combination of the first and second locations is selected from at least one of the following combinations: a) 66-82b; b) 3-25; c) 7-8; d) 84-113; e) 83-85; f) 68-81; g) 17-82a; h) 41-42; i) 9-108; j) 11-110; k) 87-111; l) 13 to 16; m) 12 to 18; n) 39-45; and o) 14 to 113; wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
For example, the antigen binding protein may be an anti-PD-L1 VHH antibody, said VHH comprising one or more pairs of engineered cysteine residues, wherein each pair of said engineered cysteine residues independently comprises a cysteine residue at a first position and a cysteine residue at a second position, said cysteine residue at the first position being capable of pairing to form a disulfide bond with said cysteine residue at the second position; wherein at least one of the cysteine residue at the first position and the cysteine residue at the second position is mutated; wherein the combination of the amino acid residue at the first position and the amino acid residue at the second position is selected from at least one of the following combinations: a) 66 (R/E) -82b (S/N/R/T/D/Y); b) 3 (Q) -25 (S); c) 7 (S) -8 (G); d) 84 (A/P/M) -113 (S); e) 83 (K/R/Q/S/T/E) -85 (E/D); f) 68 (T/V/A) -81 (Q/E/N); g) 17 (S) -82a (N/L/D); h) 41 (P/A/R) -42 (G); i) 9 (G) -108 (L/Q/H); j) 11 (S/L) -110 (T); k) 87 (T/A/L) -111 (V/D); l) 13 (Q/R) -16 (G); m) 12 (V/G) -18 (L); n) 39 (Q) -45 (R/C/L/H); and o) 14 (P) -113 (S); wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering and the amino acid residues in brackets refer to the type of amino acid residue at that position before the antigen binding protein is not mutated.
For example, the antigen binding protein may be an anti-PD-L1 VHH antibody, said VHH comprising two pairs of engineered cysteine residues, said cysteine residue at a first position being capable of pairing to form a disulfide bond with said cysteine residue at a second position; wherein at least one of the cysteine residue at the first position and the cysteine residue at the second position is mutated; wherein the combination of the first and second positions in each pair of cysteine residues is selected from: a) 3-25 and 84-113; b) 7-8 and 3-25; c) 7-8 and 84-113; and d) 11-110 and 84-113; wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
For example, the antigen binding protein may be an anti-PD-L1 VHH antibody, the VHH comprising two pairs of engineered cysteine residues, the cysteine residue at a first position being capable of pairing to form a disulfide bond with the cysteine residue at a second position; wherein the combination of the first and second positions in each pair of cysteine residues is selected from: a) 3 (Q) -25 (S) and 84 (A/P/M) -113 (S); b) 7 (S) -8 (G) and 3 (Q) -25 (S); c) 7 (S) -8 (G) and 84 (A/P/M) -113 (S); and d) 11 (S/L) -110 (T) and 84 (A/P/M) -113 (S); wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering and the amino acid residues in brackets refer to the type of amino acid residue at that position before the antigen binding protein is not mutated.
In certain embodiments, wherein the anti-PD-L1 VHH antibody comprises: CDR1 of the amino acid sequence shown in SEQ ID NO. 46, CDR2 of the amino acid sequence shown in SEQ ID NO. 47 and CDR3 of the amino acid sequence shown in SEQ ID NO. 48.
In another aspect, the present application provides an antigen binding protein that specifically binds PD-L1 comprising a variable antigen binding domain (VHH) of a heavy chain antibody, said VHH comprising a cysteine mutation compared to the sequence set forth in SEQ ID NO:49, the cysteine mutation position being selected from any one or more of the following: a) 66-82b; b) 3-25; c) 7-8; d) 84-113; e) 83-85; f) 68-81; g) 17-82a; h) 41-42; i) 9-108; j) 11-110; k) 87-111; l) 13 to 16; m) 12 to 18; n) 39-45; and o) 14-113; wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
In certain embodiments, the VHH comprises a cysteine mutation compared to the sequence set forth in SEQ ID No. 49, at a position selected from any one or more of: a) 66 (R/E) -82b (S/N/R/T/D/Y); b) 3 (Q) -25 (S); c) 7 (S) -8 (G); d) 84 (A/P/M) -113 (S); e) 83 (K/R/Q/S/T/E) -85 (E/D); f) 68 (T/V/A) -81 (Q/E/N); g) 17 (S) -82a (N/L/D); h) 41 (P/A/R) -42 (G); i) 9 (G) -108 (L/Q/H); j) 11 (S/L) -110 (T); k) 87 (T/A/L) -111 (V); l) 13 (Q/R) -16 (G); m) 12 (V/G) -18 (L); n) 39 (Q) -45 (R/C/L/H); and o) 14 (P) -113 (S); wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering and the amino acid residues in brackets refer to the type of amino acid residue at that position before the antigen binding protein is not mutated.
In certain embodiments, the VHH comprises two pairs of cysteine mutations compared to the sequence set forth in SEQ ID No. 49, wherein the combination of the first and second positions in each pair of cysteine pairings is selected from the group consisting of: a) 3-25 and 84-113; b) 7-8 and 3-25; c) 7-8 and 84-113; and d) 11-110 and 84-113; wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering.
In certain embodiments, the VHH comprises two pairs of cysteine mutations, a) 3 (Q) -25 (S) and 84 (A/P/M) -113 (S), as compared to the sequence set forth in SEQ ID NO: 49; b) 7 (S) -8 (G) and 3 (Q) -25 (S); c) 7 (S) -8 (G) and 84 (A/P/M) -113 (S); and d) 11 (S/L) -110 (T) and 84 (A/P/M) -113 (S); wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering and the amino acid residues in brackets refer to the type of amino acid residue at that position before the antigen binding protein is not mutated.
In certain embodiments, the variable domain may comprise an amino acid sequence having one, two, or three, or four, or five, or six, or seven, or eight, or nine, or ten, or eleven, or twelve, or thirteen, or fourteen, or fifteen, or sixteen, or seventeen, or eighteen, or nineteen, or twenty amino acid substitutions, deletions, or additions relative to the amino acid sequence set forth in any of SEQ ID NOs 50-63.
In certain embodiments, it comprises an amino acid sequence set forth in any one of SEQ ID NOs 50-63 or a sequence having at least about 90%,91%,92%,93%,94%,95%,96%,97%,98%,99%,99.1%,99.1%,99.2%,99.3%,99.4%,99.5%,99.6%,99.7%,99.8%, or 99.9% sequence identity to an amino acid sequence set forth in any one of SEQ ID NOs 50-63.
In certain embodiments, the amino acid sequence of the VHH may have one or several amino acid substitutions compared to the amino acid sequence of any one of SEQ ID NOs 50-63, and may include conservative and/or non-conservative substitutions. In some embodiments, the amino acid mutation can be in a CDR (e.g., a CDR1 region, a CDR2 region, or a CDR3 region) of the targeting moiety. In other embodiments, the amino acid change can be in a Framework Region (FR) of the targeting moiety (e.g., an FR1 region, an FR2 region, an FR3 region, or an FR4 region).
In certain embodiments, the substitution, deletion, or addition does not substantially reduce the ability of an anti-PD-L1 VHH antibody of the present application to specifically bind to PD-L1.
In another aspect, the present application provides an antigen binding protein that specifically binds PD-L1 comprising CDR1, CDR2 and CDR3 of a variable antigen binding domain (VHH) of a heavy chain antibody, wherein the amino acid sequence of the VHH is as set forth in any one of SEQ ID NOS: 50-63.
In another aspect, the present application provides an antigen binding protein that competes for binding to PD-L1 with an antigen binding protein described herein.
anti-HER 2
VHH antibodies
For example, the antigen binding protein may be an anti-HER 2 VHH antibody, said VHH comprising one or more pairs of engineered cysteine residues, wherein each pair of said engineered cysteine residues independently comprises a cysteine residue at a first position and a cysteine residue at a second position, said cysteine residue at the first position and said cysteine residue at the second position being capable of pairing to form a disulfide bond; wherein at least one of the cysteine residue at the first position and the cysteine residue at the second position is mutated; wherein the combination of the first and second locations is selected from at least one of the following combinations: a) 66-82b; b) 3-25; c) 7-8; d) 84-113; e) 83-85; f) 68-81; g) 17-82a; h) 41-42; i) 9-108; j) 11-110; k) 87-111; l) 13 to 16; m) 12 to 18; n) 39-45; and o) 14 to 113; wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
For example, the antigen binding protein may be an anti-HER 2 VHH antibody, said VHH comprising one or more pairs of engineered cysteine residues, wherein each pair of said engineered cysteine residues independently comprises a cysteine residue at a first position and a cysteine residue at a second position, said cysteine residue at the first position and said cysteine residue at the second position being capable of pairing to form a disulfide bond; wherein at least one of the cysteine residue at the first position and the cysteine residue at the second position is mutated; wherein the combination of the amino acid residue at the first position and the amino acid residue at the second position is selected from at least one of the following combinations: a) 66 (R/E) -82b (S/N/R/T/D/Y); b) 3 (Q) -25 (S); c) 7 (S) -8 (G); d) 84 (A/P/M) -113 (S); e) 83 (K/R/Q/S/T/E) -85 (E/D); f) 68 (T/V/A) -81 (Q/E/N); g) 17 (S) -82a (N/L/D); h) 41 (P/A/R) -42 (G); i) 9 (G) -108 (L/Q/H); j) 11 (S/L) -110 (T); k) 87 (T/A/L) -111 (V/D); l) 13 (Q/R) -16 (G); m) 12 (V/G) -18 (L); n) 39 (Q) -45 (R/C/L/H); and o) 14 (P) -113 (S); wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering and the amino acid residues in brackets refer to the type of amino acid residue at that position before the antigen binding protein is not mutated.
For example, the antigen binding protein may be an anti-HER 2 VHH antibody, said VHH comprising two pairs of engineered cysteine residues, the cysteine residue at a first position being capable of pairing to form a disulfide bond with the cysteine residue at a second position; wherein at least one of the cysteine residue at the first position and the cysteine residue at the second position is mutated; wherein the combination of the first and second positions in each pair of cysteine residues is selected from: a) 3-25 and 84-113; b) 7-8 and 3-25; c) 7-8 and 84-113; and d) 11-110 and 84-113; wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
For example, the antigen binding protein may be an anti-HER 2 VHH antibody, said VHH comprising two pairs of engineered cysteine residues, said cysteine residue at a first position being capable of pairing to form a disulfide bond with said cysteine residue at a second position; wherein the combination of the first and second positions in each pair of cysteine residues is selected from: a) 3 (Q) -25 (S) and 84 (A/P/M) -113 (S); b) 7 (S) -8 (G) and 3 (Q) -25 (S); c) 7 (S) -8 (G) and 84 (A/P/M) -113 (S); and d) 11 (S/L) -110 (T) and 84 (A/P/M) -113 (S); wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering and the amino acid residues in brackets refer to the type of amino acid residue at that position before the antigen binding protein is not mutated.
In certain embodiments, wherein the anti-HER 2 VHH antibody comprises:
i) CDR1 of the amino acid sequence shown as SEQ ID NO. 21, CDR2 of the amino acid sequence shown as SEQ ID NO. 22 and CDR3 of the amino acid sequence shown as SEQ ID NO. 23; or
ii) CDR1 of the amino acid sequence shown in SEQ ID NO. 64, CDR2 of the amino acid sequence shown in SEQ ID NO. 65 and CDR3 of the amino acid sequence shown in SEQ ID NO. 66.
In another aspect, the present application provides an antigen binding protein that specifically binds HER2 comprising a variable antigen binding domain (VHH) of a heavy chain antibody, said VHH comprising a cysteine mutation compared to the sequence shown in SEQ ID No. 24, at a position selected from any one or more of the following: a) 66-82b; b) 3-25; c) 7-8; d) 84-113; e) 83-85; f) 68-81; g) 17-82a; h) 41-42; i) 9-108; j) 11-110; k) 87-111; l) 13 to 16; m) 12 to 18; n) 39-45; and o) 14 to 113; wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
In certain embodiments, the VHH comprises a cysteine mutation compared to the sequence set forth in SEQ ID No. 24 at a position selected from any one or more of: a) 66 (R/E) -82b (S/N/R/T/D/Y); b) 3 (Q) -25 (S); c) 7 (S) -8 (G); d) 84 (A/P/M) -113 (S); e) 83 (K/R/Q/S/T/E) -85 (E/D); f) 68 (T/V/A) -81 (Q/E/N); g) 17 (S) -82a (N/L/D); h) 41 (P/A/R) -42 (G); i) 9 (G) -108 (L/Q/H); j) 11 (S/L) -110 (T); k) 87 (T/A/L) -111 (V); l) 13 (Q/R) -16 (G); m) 12 (V/G) -18 (L); n) 39 (Q) -45 (R/C/L/H); and o) 14 (P) -113 (S); wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering and the amino acid residues in brackets refer to the type of amino acid residue at that position before the antigen binding protein is not mutated.
In certain embodiments, the VHH comprises two pairs of cysteine mutations compared to the sequence set forth in SEQ ID No. 24, wherein the combination of the first and second positions in each pair of cysteine pairings is selected from the group consisting of: a) 3-25 and 84-113; b) 7-8 and 3-25; c) 7-8 and 84-113; and d) 11-110 and 84-113; wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
In certain embodiments, the VHH comprises two pairs of cysteine mutations, a) 3 (Q) -25 (S) and 84 (A/P/M) -113 (S), as compared to the sequence set forth in SEQ ID NO: 24; b) 7 (S) -8 (G) and 3 (Q) -25 (S); c) 7 (S) -8 (G) and 84 (A/P/M) -113 (S); and d) 11 (S/L) -110 (T) and 84 (A/P/M) -113 (S); wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering and the amino acid residues in brackets refer to the type of amino acid residue at that position before the antigen binding protein is not mutated.
In another aspect, the present application provides an antigen binding protein that specifically binds HER2 comprising a variable antigen binding domain (VHH) of a heavy chain antibody, said VHH comprising a cysteine mutation compared to the sequence shown in SEQ ID NO:67, the cysteine mutation position being selected from any one or more of the following: a) 66-82b; b) 3-25; c) 7-8; d) 84-113; e) 83-85; f) 68-81; g) 17-82a; h) 41-42; i) 9-108; j) 11-110; k) 87-111; l) 13 to 16; m) 12 to 18; n) 39-45; and o) 14 to 113; wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering.
In certain embodiments, the VHH comprises a cysteine mutation compared to the sequence set forth in SEQ ID NO 67 at a position selected from any one or more of: a) 66 (R/E) -82b (S/N/R/T/D/Y); b) 3 (Q) -25 (S); c) 7 (S) -8 (G); d) 84 (A/P/M) -113 (S); e) 83 (K/R/Q/S/T/E) -85 (E/D); f) 68 (T/V/A) -81 (Q/E/N); g) 17 (S) -82a (N/L/D); h) 41 (P/A/R) -42 (G); i) 9 (G) -108 (L/Q/H); j) 11 (S/L) -110 (T); k) 87 (T/A/L) -111 (V); l) 13 (Q/R) -16 (G); m) 12 (V/G) -18 (L); n) 39 (Q) -45 (R/C/L/H); and o) 14 (P) -113 (S); wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering and the amino acid residues in brackets refer to the type of amino acid residue at that position before the antigen binding protein is not mutated.
In certain embodiments, the VHH comprises two pairs of cysteine mutations compared to the sequence set forth in SEQ ID NO:67, wherein the combination of the first and second positions in each pair of cysteine pairings is selected from the group consisting of: a) 3-25 and 84-113; b) 7-8 and 3-25; c) 7-8 and 84-113; and d) 11-110 and 84-113; wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering.
In certain embodiments, the VHH comprises two pairs of cysteine mutations, a) 3 (Q) -25 (S) and 84 (A/P/M) -113 (S), as compared to the sequence set forth in SEQ ID NO: 67; b) 7 (S) -8 (G) and 3 (Q) -25 (S); c) 7 (S) -8 (G) and 84 (A/P/M) -113 (S); and d) 11 (S/L) -110 (T) and 84 (A/P/M) -113 (S); wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering and the amino acid residues in brackets refer to the type of amino acid residue at that position before the antigen binding protein is not mutated.
In certain embodiments, the variable domain may comprise an amino acid sequence having one, two, or three, or four, or five, or six, or seven, or eight, or nine, or ten, or eleven, or twelve, or thirteen, or fourteen, or fifteen, or sixteen, or seventeen, or eighteen, or nineteen, or twenty amino acid substitutions, deletions or additions relative to the amino acid sequence set forth in any of SEQ ID NOs 25-45, 68-84.
In certain embodiments, it comprises an amino acid sequence set forth in any of SEQ ID NOs 25-45, 68-83 or a sequence having at least about 90%,91%,92%,93%,94%,95%,96%,97%,98%,99%,99.1%,99.1%,99.2%,99.3%,99.4%,99.5%,99.6%,99.7%,99.8%, or 99.9% sequence identity to an amino acid sequence set forth in any of SEQ ID NOs 25-45, 68-83.
In certain embodiments, the amino acid sequence of the VHH may have one or several amino acid substitutions compared to the amino acid sequence of any one of SEQ ID NOs 25-45, 68-84, and may include conservative and/or non-conservative substitutions. In some embodiments, the amino acid mutation can be in a CDR (e.g., a CDR1 region, a CDR2 region, or a CDR3 region) of the targeting moiety. In other embodiments, the amino acid change can be in a Framework Region (FR) of the targeting moiety (e.g., an FR1 region, an FR2 region, an FR3 region, or an FR4 region).
In certain embodiments, the substitution, deletion, or addition does not substantially reduce the ability of an anti-HER 2 VHH antibody of the present application to specifically bind to HER2.
In another aspect, the present application provides an antigen binding protein that specifically binds HER2 comprising CDR1, CDR2 and CDR3 of a variable antigen binding domain (VHH) of a heavy chain antibody, wherein the amino acid sequence of said VHH is set forth in any one of SEQ ID NOs 25-45, 68-84.
In another aspect, the present application provides an antigen binding protein that competes for binding to HER2 with an antigen binding protein described herein.
anti-CD 8 alpha VHH antibodies
For example, the antigen binding protein may be an anti-CD 8 α VHH antibody, said VHH comprising one or more pairs of engineered cysteine residues, wherein each pair of said engineered cysteine residues independently comprises a cysteine residue at a first position and a cysteine residue at a second position, said cysteine residue at the first position and said cysteine residue at the second position being capable of pairing to form a disulfide bond; wherein at least one of the cysteine residue at the first position and the cysteine residue at the second position is mutated; wherein the combination of the first and second locations is selected from at least one of the following combinations: a) 66-82b; b) 3-25; c) 7-8; d) 84-113; e) 83-85; f) 68-81; g) 17-82a; h) 41-42; i) 9-108; j) 11-110; k) 87-111; l) 13 to 16; m) 12 to 18; n) 39-45; and o) 14-113; wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
For example, the antigen binding protein may be an anti-CD 8 α VHH antibody, said VHH comprising one or more pairs of engineered cysteine residues, wherein each pair of said engineered cysteine residues independently comprises a cysteine residue at a first position and a cysteine residue at a second position, said cysteine residue at the first position and said cysteine residue at the second position being capable of pairing to form a disulfide bond; wherein at least one of the cysteine residue at the first position and the cysteine residue at the second position is mutated; wherein the combination of the amino acid residue at the first position and the amino acid residue at the second position is selected from at least one of the following combinations: a) 66 (R/E) -82b (S/N/R/T/D/Y); b) 3 (Q) -25 (S); c) 7 (S) -8 (G); d) 84 (A/P/M) -113 (S); e) 83 (K/R/Q/S/T/E) -85 (E/D); f) 68 (T/V/A) -81 (Q/E/N); g) 17 (S) -82a (N/L/D); h) 41 (P/A/R) -42 (G); i) 9 (G) -108 (L/Q/H); j) 11 (S/L) -110 (T); k) 87 (T/A/L) -111 (V/D); l) 13 (Q/R) -16 (G); m) 12 (V/G) -18 (L); n) 39 (Q) -45 (R/C/L/H); and o) 14 (P) -113 (S); wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering and the amino acid residues in brackets refer to the type of amino acid residue at that position before the antigen binding protein is not mutated.
For example, the antigen binding protein may be an anti-CD 8 α VHH antibody, the VHH comprising two pairs of engineered cysteine residues, the cysteine residue at a first position being capable of pairing to form a disulfide bond with the cysteine residue at a second position; wherein at least one of the cysteine residue at the first position and the cysteine residue at the second position is mutated; wherein the combination of the first and second positions in each pair of cysteine residues is selected from: a) 3-25 and 84-113; b) 7-8 and 3-25; c) 7-8 and 84-113; and d) 11-110 and 84-113; wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
For example, the antigen binding protein may be an anti-CD 8 α VHH antibody, the VHH comprising two pairs of engineered cysteine residues, the cysteine residue at a first position being capable of pairing to form a disulfide bond with the cysteine residue at a second position; wherein the combination of the first and second positions in each pair of cysteine residues is selected from: a) 3 (Q) -25 (S) and 84 (A/P/M) -113 (S); b) 7 (S) -8 (G) and 3 (Q) -25 (S); c) 7 (S) -8 (G) and 84 (A/P/M) -113 (S); and d) 11 (S/L) -110 (T) and 84 (A/P/M) -113 (S); wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering and the amino acid residues in brackets refer to the type of amino acid residue at that position before the antigen binding protein is not mutated.
In certain embodiments, wherein the anti-CD 8 α VHH antibody comprises: CDR1 of the amino acid sequence shown in SEQ ID NO. 1, CDR2 of the amino acid sequence shown in SEQ ID NO. 2 and CDR3 of the amino acid sequence shown in SEQ ID NO. 3.
In another aspect, the present application provides an antigen binding protein that specifically binds CD8 α, comprising a variable antigen binding domain (VHH) of a heavy chain antibody, said VHH comprising a cysteine mutation compared to the sequence set forth in SEQ ID No. 4, at a position selected from any one or more of the following: a) 66-82b; b) 3-25; c) 7-8; d) 84-113; e) 83-85; f) 68-81; g) 17-82a; h) 41-42; i) 9-108; j) 11-110; k) 87-111; l) 13 to 16; m) 12 to 18; n) 39-45; and o) 14 to 113; wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering.
In certain embodiments, the VHH comprises a cysteine mutation compared to the sequence set forth in SEQ ID No. 4, at a position selected from any one or more of: a) 66 (R/E) -82b (S/N/R/T/D/Y); b) 3 (Q) -25 (S); c) 7 (S) -8 (G); d) 84 (A/P/M) -113 (S); e) 83 (K/R/Q/S/T/E) -85 (E/D); f) 68 (T/V/A) -81 (Q/E/N); g) 17 (S) -82a (N/L/D); h) 41 (P/A/R) -42 (G); i) 9 (G) -108 (L/Q/H); j) 11 (S/L) -110 (T); k) 87 (T/A/L) -111 (V); l) 13 (Q/R) -16 (G); m) 12 (V/G) -18 (L); n) 39 (Q) -45 (R/C/L/H); and o) 14 (P) -113 (S); wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering and the amino acid residues in brackets refer to the type of amino acid residue at that position before the antigen binding protein is not mutated.
In certain embodiments, the VHH comprises two pairs of cysteine mutations compared to the sequence set forth in SEQ ID No. 4, wherein the combination of the first and second positions in each pair of cysteine pairings is selected from the group consisting of: a) 3-25 and 84-113; b) 7-8 and 3-25; c) 7-8 and 84-113; and d) 11-110 and 84-113; wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
In certain embodiments, the VHH comprises two pairs of cysteine mutations, a) 3 (Q) -25 (S) and 84 (A/P/M) -113 (S), as compared to the sequence set forth in SEQ ID NO: 4; b) 7 (S) -8 (G) and 3 (Q) -25 (S); c) 7 (S) -8 (G) and 84 (A/P/M) -113 (S); and d) 11 (S/L) -110 (T) and 84 (A/P/M) -113 (S); wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering and the amino acid residues in brackets refer to the type of amino acid residue at that position before the antigen binding protein is not mutated.
In certain embodiments, the variable domain may comprise an amino acid sequence having one, two, or three, or four, or five, or six, or seven, or eight, or nine, or ten, or eleven, or twelve, or thirteen, or fourteen, or fifteen, or sixteen, or seventeen, or eighteen, or nineteen, or twenty amino acid substitutions, deletions or additions relative to the amino acid sequence set forth in any of SEQ ID NOs 5-18, 20.
In certain embodiments, it comprises an amino acid sequence set forth in any of SEQ ID NOs 5-18, 20 or a sequence having at least about 90%,91%,92%,93%,94%,95%,96%,97%,98%,99%,99.1%,99.1%, 99.1%,99.2%,99.3%,99.4%,99.5%,99.6%,99.7%,99.8% or 99.9% sequence identity to an amino acid sequence set forth in any of SEQ ID NOs 5-18, 20.
In certain embodiments, the amino acid sequence of the VHH may have one or several amino acid substitutions compared to the amino acid sequence of any one of SEQ ID NOs 5-18, 20, and may include conservative and/or non-conservative substitutions. In some embodiments, the amino acid mutation can be in a CDR (e.g., a CDR1 region, a CDR2 region, or a CDR3 region) of the targeting moiety. In other embodiments, the amino acid change can be in a Framework Region (FR) of the targeting moiety (e.g., an FR1 region, an FR2 region, an FR3 region, or an FR4 region).
In certain embodiments, the substitution, deletion, or addition does not substantially reduce the ability of an anti-PD-L1 VHH antibody of the present application to specifically bind to PD-L1.
In another aspect, the present application provides an antigen binding protein that specifically binds to CD8 a comprising CDR1, CDR2 and CDR3 of a variable antigen binding domain (VHH) of a heavy chain antibody, wherein the amino acid sequence of said VHH is as set forth in any one of SEQ ID NOs 50-63.
In another aspect, the present application provides an antigen binding protein that competes for binding to CD8 a with an antigen binding protein described herein.
Payload
In the present application, the term "payload" denotes any molecule or combination of molecules that can be conjugated to an antigen binding protein of the present application. The term "payload" also refers to a moiety whose biological activity requires delivery to and/or localization in a cell or tissue. Payloads include, but are not limited to, markers, chemotherapeutic agents, anti-angiogenic agents, cytotoxins (e.g., pseudomonas exotoxin, ricin, abrin, diphtheria toxin (diptheria toxin), etc.), cytokines, prodrugs, enzymes, growth factors, transcription factors, drugs, radionuclides, ligands, antibodies or fragments thereof, liposomes, nanoparticles, viral particles, cytokines, and the like.
In certain embodiments, wherein the payload comprises a detectable label.
In certain embodiments, wherein the detectable label is selected from the group consisting of: radionuclides, fluorescers, chemiluminescent agents, bioluminescent agents, paramagnetic ions and enzymes, and combinations thereof.
In certain embodiments, wherein the detectable label comprises a radionuclide. Radionuclides useful for conjugation may be those with energies between 20-4000KeV, including but not limited to 110 In、 111 In、 177 Lu、 18 F、 52 Fe、 62 Cu、 67 Cu、 67 Ga、 68 Ga、 68 Ge、 86 Y、 90 Y、 89 Zr、 94m Tc、 120 I、 123 I、 124 I、 125 I、 131 I、 154-158 Gd、 32 P、 11 C、 13 N、 15 O、 186 Re、 188 Re、 51 Mn、 52m Mn、 72 As、 75 Br、 76 Br、 82m Rb、 83 Sr or other gamma-, beta-, or positron emitters.
For example, the radionuclide may be 99m Tc、 177 Lu or 125 I。
In certain embodiments, wherein the antigen binding protein is conjugated directly or indirectly to the detectable label. Methods for conjugating a detectable label to a polypeptide are well known to those skilled in the art. For example, the antigen binding protein may be conjugated to the detectable label by a chelator.
In certain embodiments, wherein the radionuclide is suitable for medical imaging and/or therapy.
Fluorescers that can be used for conjugation include, but are not limited to, isothionine fluorescein, rhodamine, phycoerythrin, phycocyanin, allophycocyanin, o-phthaldehyde, and fluorescamine; chemiluminescent agents that may be used for conjugation include, but are not limited to, luminol, isoluminol, aromatic acridinium esters, imidazoles, acridinium salts, and oxalate esters; bioluminescent agents that may be used for conjugation include, but are not limited to, luciferin, luciferase, and aequorin. Paramagnetic ions that can be used for conjugation include, but are not limited to, chromium (III), manganese (II), iron (III), iron (II), cobalt (II), nickel (II), copper (II), neodymium (III), samarium (III), ytterbium (III), gadolinium (III), vanadium (II), terbium (III), dysprosium (III), holmium (III), and erbium (III), or are radiopaque materials such as dams, diatrizoate, ethiodide, gallium citrate, iocarmic acid, iodonatate, iododaramine, iodipamide, iopamoic acid, ioprotide, ioxadic acid, ioxofenac acid, iospiriaretic acid, iosulfotame, iophthalothiamide, iotisic acid, iothalamic acid, iotroxic acid, iopromic acid, meglumine, metridine, propidium iodide, and thallium oxide. Enzymes useful for conjugation include, but are not limited to, horseradish peroxidase and the like.
In certain embodiments, wherein the payload comprises a targeting moiety.
In certain embodiments, wherein the targeting moiety is selected from the group consisting of: proteins, nucleic acids, lipids, carbohydrates, and combinations thereof.
In certain embodiments, wherein the payload comprises a drug.
In certain embodiments, wherein the drug is selected from: an anti-cancer therapeutic agent, an anti-inflammatory therapeutic agent, an anti-infection therapeutic agent, an anesthetic therapeutic agent, a cytotoxic therapeutic agent, a radionuclide, an immunomodulator, a cell signal peptide, a growth factor, an enzyme, an oligonucleotide, a photoactive therapeutic agent, and any combination thereof.
In certain embodiments, wherein the anti-cancer therapeutic is selected from: cytostatics, cytotoxic nucleosides, tubulin binding agents, hormones and hormone antagonists, anti-angiogenic agents, enzyme inhibitors, gene modulators, proteasome inhibitors, pteridine, diyne, podophyllotoxin, auristatin, geldanamycin, calicheamicin, gramicin D, maytansine, neocarzinostatin, topotecan, taxanes, cytochalasin B, ethidium bromide, emetine, tinosporine, colchicine, dihydroxyanthracenedione, mitoxantrone, procaine, tetracaine, lidocaine, propranolol, puromycin, maytansine derivatives, anthracycline derivatives, bisphosphonate derivatives, leptomycin derivatives, desmosine derivatives, auristatin derivatives, duocarmycin derivatives, and any combination thereof.
In certain embodiments, the cytostatic agent is selected from: anthraquinone, DNA synthesis inhibitors, DNA-intercalators, DNA-RNA transcription regulators, ansamycinquinone, quinone derivatives, busulfan, ifosfamide, mechlorethamine, triazone, diazinon, carbazolquinone, indoloquinone E09, diazaspinyl-benzoquinone methyl DZQ, triethylenephosphoramide, nitrosourea compounds, and any combination thereof.
In certain embodiments, wherein the cytotoxic nucleoside is selected from the group consisting of: vidarabine, cytarabine, 5-fluorouracil, fludarabine, fluorouracil nucleoside, ftoracure, 6-mercaptopurine, and combinations of any of these.
In certain embodiments, wherein the tubulin-binding agent is selected from the group consisting of: paclitaxel, nocodazole, rhizoxin, dolastatin, colchicine, combretastatin, vinca alkaloids, and any combination thereof.
In certain embodiments, wherein the hormone and hormone antagonist are selected from the group consisting of: corticosteroids, progestins, estrogens, antiestrogens, androgens, aromatase inhibitors, 17- (allylamino) -17-demethoxygeldanamycin, 4-amino-I, 8-naphthalimide, apigenin, brefeldin A, cimetidine, dichloromethylene diphosphonic acid, leuprolide, luteinizing hormone releasing hormone, pifithrin-a, rapamycin, sex hormone binding globulin, thapsigargin, and any combination thereof.
In certain embodiments, wherein the anti-angiogenic agent is selected from the group consisting of: angiostatin K1-3, DL- α -difluoromethyl-ornithine, endostatin, fumagillin, genistein, minocycline, staurosporine, (+) -thalidomide, and any combination thereof.
In certain embodiments, wherein the enzyme inhibitor is selected from the group consisting of: s (+) -camptothecin, curcumin, (-) -deguelin, 5, 6-dichlorobenzene-imidazole I-beta-D-ribofuranoside, etoposide, formestane, fosstricin, hispidin, 2-imino-1-imidazolidineacetic acid, mevinolin, trichostatin A, tyrphostin AG 34, tyrphostin AG 879, and any combination thereof.
In certain embodiments, wherein the gene modulator is selected from the group consisting of: 5-aza-2' -deoxycytidine, 5-azacytidine, cholecalciferol, 4-hydroxyttamoxifen, melatonin, mifepristone, raloxifene, trans retinal, retinoic acid, 9-cis-retinoic acid, 13-cis-retinoic acid, retinol, tamoxifen, troglitazone, and any combination thereof.
In certain embodiments, wherein the radionuclide comprises 110 In、 111 In、 177 Lu、 18 F、 52 Fe、 62 Cu、 67 Cu、 67 Ga、 68 Ga、 68 Ge、 86 Y、 90 Y、 89 Zr、 94m Tc、 120 I、 123 I、 124 I、 125 I、 131 I、 154-158 Gd、 32 P、 11 C、 13 N、 15 O、 186 Re、 188 Re、 51 Mn、 52m Mn、 72 As、 75 Br、 76 Br、 82m Rb、 83 Sr or other gamma-, beta-, or positron emitters.
Connector
In this application, the terms "linker" and "linker" are used interchangeably and generally refer to any agent or molecule that connects an antigen binding protein to a payload. The linker forms a covalent or non-covalent bond with the antigen binding protein and the payload. The ideal linker may be any agent or molecule that remains stable, does not affect the functionality of the targeting polypeptide or pharmaceutically active moiety, or does not produce additional unwanted functions. The linker may be cleavable (cleavable) or non-cleavable (non-cleavable). Exemplary linkers include MC, MP, val-cit, ala-phe, PAB, SPP, SMCC, SIAB. In one embodiment, the linker is MC-vc-PAB.
The linker may comprise a cleavable unit (cleavable unit). In some such embodiments, the structure and/or sequence of the cleavable unit is selected such that it is cleavable under the action of an enzyme present at the target site (e.g., target cell). In other embodiments, cleavable units that are cleavable under changes in PH (e.g., labile to acids or bases), temperature, or radiation (e.g., labile to light) may also be used.
In some aspects, the cleavable unit is a peptide unit and is at least two amino acids long. Cleavage agents may include cathepsins B and D and plasmin (plasmins) (see, e.g., dubowchik and Walker,1999, pharm. Therapeutics 83. Most typically a cleavable unit that can be cleaved by an enzyme present in the cell, i.e., an enzyme cleavable linker. Thus the linker may be cleaved by intracellular peptidases (intracellular peptidases) or proteases, including lysosomal or endosomal proteases. For example, a linker that can be cleaved by the thiol-dependent protease cathepsin B, which is highly expressed in cancer tissues, can be used. (e.g., a linker comprising a phenylalanine-leucine peptide or a valine-citrullinated peptide or a valine-alanine peptide).
In one embodiment, wherein the linker comprises a cleavable unit that is cleaved by the action of an enzyme and a self-immolative group (self-immolative group) that releases the therapeutic agent after cleavage of the cleavable unit. In some embodiments, one end of the cleavable unit of the linker will be conjugated directly or indirectly to the therapeutic agent and the other end thereof will be conjugated directly or indirectly to the antibody. In some such embodiments, one end of the cleavable unit will be conjugated directly or indirectly (e.g., via a self-destructive or non-self-destructive spacer unit) to the therapeutic agent and the other end thereof will be conjugated directly or indirectly to the antibody via an extension unit (stretcher unit). An extension unit links the antibody to the remainder of the drug and/or drug linker. In one embodiment, the linkage between the antibody and the remainder of the drug and/or drug linker is through a maleimide group, for example through a maleimide hexanoyl linker. In some embodiments, the antibody will be linked to the drug via a disulfide (disulfide), such as the disulfide-linked maytansine conjugates SPDB-DM4 and SPP-DMI.
The linkage between the antibody and the linker can be through a number of different pathways, for example, through a thioether bond or through a disulfide bond. In one embodiment, the linkage between the VHH antibody and the linker is formed between a thiol group of a cysteine residue of the VHH antibody and a maleimide group of the linker. In some embodiments, the interchain bond of the antibody is converted to a free thiol group prior to reaction with the functional group of the linker. In some embodiments, a cysteine residue is introduced into the mutation site of the FR region of the VHH antibody and reacted with the linker.
For example, preferred linkers for modifying an antibody or antibody fragment to produce a disulfide-linked conjugate are N-succinimidyl 4- (2-pyridyldithio) valerate (SPP), N-succinimidyl 4_ (2-pyridyldithio) butyrate (STOB), or N-succinimidyl 4- (2-pyridyldithio) -2-sulfobutyrate (sulfonic acid-STOB).
For example, preferred linkers for modifying antibodies or antibody fragments to produce thioether-linked conjugates are 4- (maleimidomethyl) cyclohexanecarboxylic acid N-succinimidyl ester (SMCC), 4- (maleimidomethyl) cyclohexanecarboxylic acid N-succinimidyl ester Sulfonate (SMCC), 4- (iodoacetyl) -aminobenzoic acid N-succinimidyl ester (SIAB).
In certain embodiments, wherein the linker comprises a chelating agent.
For example, the chelating agent may be selected from DTPA, EDTA, NOTA, DOTA, TRAP, TETA, NETA, CB-TE2A, cyclen, cyclam, bispidine, TACN, ATSM, sarar, amBaSar, MAG3, MAG2, HYNIC, DADT, EC, NS3, H2dedpa, HBED, DFO, PEPA or HEHA and derivatives thereof.
Immunoconjugates
In another aspect, the present application provides an immunoconjugate comprising an antigen binding protein as described herein, a payload, and a linker linking the payload to the antigen binding protein.
In certain embodiments, the immunoconjugate has the structure shown in formula I:
VHH-(L-D) n (I)
wherein L is a linker; d is a payload; n is any number from 1 to 8; for example, n may be any integer of 1 to 8. Also for example, n can be 1, 2, 3, 4, 5, 6, 7, or 8.
In certain embodiments, the VHH comprises the amino acid sequence set forth in any one of SEQ ID NOs 5-18, 20, 25-45, 50-63, 68-95 or a sequence having at least about 90%,91%,92%,93%,94%,95%,96%,97%,98%,99%,99.1%,99.1%,99.2%,99.3%,99.4%,99.5%,99.6%,99.7%,99.8% or 99.9% sequence identity to the amino acid sequence set forth in any one of SEQ ID NOs 5-18, 20, 25-45, 50-63, 68-95.
In certain embodiments, wherein the VHH is attached to the linker through a thiol group of a cysteine at the first position and/or a thiol group of a cysteine at the second position.
In certain embodiments, the surface disulfide bond formed by pairing a cysteine residue at a first position with a cysteine residue at a second position in the VHH is reduced to form a free cysteine, the free cysteine comprising a thiol group, and the linker is attached to the thiol group.
In certain embodiments, wherein the linker comprises a cleavable (cleavable) or non-cleavable (non-cleavable).
In certain embodiments, wherein the linker is selected from the group consisting of: 6-Maleimidocaproyl (MC), maleimidopropanoyl (MP), valine-citrulline (val-cit), alanine-phenylalanine (alaphe), p-aminobenzyloxycarbonyl (PAB), N-succinimidyl 4- (2-pyridylthio) pentanoate (SPP), N-succinimidyl 4- (N-maleimidomethyl) cyclohexane-1-carboxylate (SMCC), (N-succinimidyl 4-iodo-acetyl) aminobenzoate (SIAB), SPDB, hydrazone, maleimidocaproyl and 6-maleimidocaproyl-valine-citrulline-p-aminobenzoyloxycarbonyl (MC-vc-PAB); or a branched linker comprising a peptide chain and derived from o-hydroxy p-aminobenzyl alcohol, wherein the peptide chain is linked to a benzene ring through a p-amino group, the payload is linked to a benzene ring through a benzyl alcohol moiety, and the antigen binding protein is linked to a benzene ring through an o-hydroxy group.
In certain embodiments, wherein the linker comprises a chelating agent.
In certain embodiments, wherein the chelator is selected from DTPA, EDTA, NOTA, DOTA, TRAP, TETA, NETA, CB-TE2A, cyclen, cyclam, bispidine, TACN, ATSM, sarAr, amBaSar, MAG3, MAG2, HYNIC, DADT, EC, NS3, H2dedpa, HBED, DFO, PEPA, or HEHA and derivatives thereof.
In another aspect, the present application provides an immunoconjugate comprising an anti-PD-L1 VHH antibody described herein, a payload, and a linker linking the payload to the antigen binding protein.
In certain embodiments, the immunoconjugate has the structure shown in formula I:
VHH-(L-D) n (I)
wherein L is a linker; d is a payload; n is any number from 1 to 8; for example, n may be any integer of 1 to 8. For another example, n may be 2, 4, 6, or 8.
In certain embodiments, the VHH comprises the amino acid sequence set forth in any one of SEQ ID NOs 50-63 or a sequence having at least about 90%,91%,92%,93%,94%,95%,96%,97%,98%,99%,99.1%,99.1%,99.2%,99.3%,99.4%,99.5%,99.6%,99.7%,99.8% or 99.9% sequence identity to the amino acid sequence set forth in any one of SEQ ID NOs 5-18, 20, 25-45, 50-63, 68-95.
In another aspect, the present application provides an immunoconjugate comprising an anti-HER 2 VHH antibody described herein, a payload, and a linker linking the payload to the antigen binding protein.
In certain embodiments, the immunoconjugate has the structure shown in formula I:
VHH-(L-D) n (I)
wherein L is a linker; d is a payload; n is any number from 1 to 8; for example, n may be any integer of 1 to 8. Also for example, n may be 2, 4, 6, or 8.
In certain embodiments, the VHH comprises the amino acid sequence set forth in any one of SEQ ID NOs 25-45, 68-95 or a sequence having at least about 90%,91%,92%,93%,94%,95%,96%,97%,98%,99%,99.1%,99.1%,99.2%,99.3%,99.4%,99.5%,99.6%,99.7%,99.8% or 99.9% sequence identity to the amino acid sequence set forth in any one of SEQ ID NOs 25-45, 68-95.
In another aspect, the present application provides an immunoconjugate comprising an anti-CD 8 α VHH antibody described herein, a payload, and a linker linking the payload to the antigen binding protein.
In certain embodiments, the immunoconjugate has the structure shown in formula I:
VHH-(L-D) n (I)
Wherein L is a linker; d is a payload; n is any number from 1 to 8; for example, n may be any integer of 1 to 8. Also for example, n may be 2, 4, 6, or 8.
In certain embodiments, wherein the VHH comprises an amino acid sequence set forth in any one of SEQ ID NOs 5-18, 20 or a sequence having at least about 90%,91%,92%,93%,94%,95%,96%,97%,98%,99%,99.1%,99.1%, 99.1%,99.2%,99.3%,99.4%,99.5%,99.6%,99.7%,99.8%, or 99.9% sequence identity to an amino acid sequence set forth in any one of SEQ ID NOs 5-18, 20.
In another aspect, the present application provides a method of a conjugate described herein, the method comprising: the antigen binding proteins described herein are conjugated to a payload.
In certain embodiments, the method comprises: reacting at least one pair of cysteines of the antigen binding protein with the linker-payload intermediate to form an antigen binding protein-payload conjugate:
VHH-(L-D)n(I)
wherein L is a linker; d is a payload; n is any number from 1 to 8; for example, n may be any integer of 1 to 8. For another example, n may be 2, 4, 6, or 8.
In some embodiments, wherein the method comprises: i) Reducing open disulfide bonds formed by paired cysteines in the antigen binding protein to form free cysteines; ii) linking the sulfhydryl group of the free cysteine to a linker to form an antigen binding protein-payload conjugate.
In another aspect, the present application provides a method for preparing a radionuclide of the present application, e.g. 177 A method of Lu-labeled immunoconjugate comprising 1) conjugating an antigen binding protein of the present application with a chelator to generate a conjugate precursor of the antigen binding protein and chelator; and 2) reacting the conjugate precursor of step 1) with a radionuclide such as 177 Lu, whereby radionuclides such as 177 Lu labels the antigen binding proteins of the present application by chelation by a chelator.
In some embodiments, the chelator is DOTA, and the precursor conjugate of the antigen binding protein and DOTA is generated in step 1) by reacting the antigen binding protein with p-SCN-Bn-DOTA or p-NH 2-Bn-DOTA.
The application may also employ IODO-BEADS solid phase labelling with radionuclides such as 125 I labels the antigen binding proteins described herein.
Nucleic acids, vectors and cells
In another aspect, the present application provides an isolated nucleic acid molecule or molecules encoding an antigen binding protein described herein.
In another aspect, the present application provides a vector comprising a nucleic acid molecule as described herein.
In another aspect, the present application provides a cell comprising a nucleic acid molecule as described herein or a vector as described herein.
Nucleic acids encoding the antigen binding proteins of the present application can be incorporated (linked) into vectors, which can be introduced into host cells by transfection, transformation, or transduction techniques. For example, a nucleic acid encoding a HER2 binding polypeptide of the application can be introduced into a host cell by retroviral transduction. In one embodiment, the host cell is eukaryotic, such as a Chinese Hamster Ovary (CHO) cell or lymphoid cell (e.g., Y0, NS0, sp20 cell). In one embodiment, the host cell is prokaryotic, such as an E.coli cell.
In another aspect, the present application provides a method of making an antigen binding protein as described herein, comprising culturing a cell as described herein under conditions that allow expression of the HER2 binding polypeptide.
The specific expression and purification conditions will vary depending on the expression system employed. For example, if a gene is expressed in E.coli, it is first cloned into an expression vector by placing the engineered gene downstream of a suitable bacterial promoter, such as Trp or Tac, and a prokaryotic signal sequence. In another example, if the engineered gene is to be expressed in eukaryotic cells, such as CHO cells, it is first inserted into an expression vector containing, for example, the appropriate eukaryotic promoter, secretion signal, enhancer, and various introns. The gene vector may be introduced into the host cell using transfection, transformation or transduction techniques.
In certain embodiments, the method further comprises recovering the antigen binding protein expressed by the cell.
In certain embodiments, the method further comprises purifying and/or modifying the antigen binding protein.
The antigen binding proteins of the present application may also be expressed in vivo, e.g., in a patient. For example, in certain embodiments, an antigen binding protein of the present application can be administered in the form of a nucleic acid encoding an antigen binding protein of the present application. The nucleic acid may be DNA or RNA. In some embodiments, the antigen binding proteins of the present application are encoded by modified mrnas, i.e., mrnas comprising one or more modified nucleotides. In some embodiments, the present application relates to gene therapy vectors comprising the modified mRNA. In some embodiments, the present application relates to gene therapy methods comprising said gene therapy vectors. In certain embodiments, the nucleic acid is in the form of an oncolytic virus, such as an adenovirus, reovirus, measles, herpes simplex, newcastle disease virus, or vaccinia.
In another aspect, the present application provides a method of making an antigen binding protein described herein, the method comprising:
i) Site-directed mutagenesis of a nucleic acid sequence of a parent antibody, wherein the mutagenesis comprises substitution of one or more pairs of amino acid residues with cysteine residues; wherein each pair of said cysteine residues comprises a cysteine residue at a first position and a cysteine residue at a second position, said cysteine residue at the first position being capable of pairing with said cysteine residue at the second position to form a disulfide bond; and
ii) expressing the antigen binding protein.
Modification of the amino acid sequence can be achieved using any technique known in the art, such as site-directed mutagenesis or PCR-based mutagenesis. Such techniques are described, for example, in the following documents: sambrook et al, molecular Cloning, A Laboratory Manual, cold Spring Harbor Press, plainview, N.Y.,1989; and Ausubel et al, current Protocols in Molecular Biology, john Wiley & Sons, new York, N.Y.,1989.
In certain embodiments, wherein the method further comprises recovering the antigen binding protein.
In certain embodiments, wherein the method further comprises purifying the antigen binding protein.
In certain embodiments, wherein the mutagenesis further comprises affinity optimization of the antibody after substitution with a cysteine residue.
In another aspect, the present application provides a method of making an antigen binding protein described herein, the method comprising: comprising culturing the cells described herein under conditions that allow expression of the antigen binding protein.
Composition comprising a metal oxide and a metal oxide
Any of the compositions described herein can be administered to a subject as a component of a composition comprising a pharmaceutically acceptable carrier. Such compositions may optionally comprise suitable amounts of pharmaceutically acceptable excipients in order to provide a form for suitable administration.
Pharmaceutical excipients can be liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. The pharmaceutical excipient may be, for example, physiological saline, gum arabic, gelatin, starch paste, talc, keratin, colloidal silica, urea, and the like. In addition, auxiliaries, stabilizers, thickeners, lubricants and colorants may be used. In one embodiment, the pharmaceutically acceptable excipient is sterile when administered to a subject. When any of the agents described herein are administered intravenously, water is a useful excipient. Physiological saline solutions and aqueous dextrose and glycerol solutions may also be employed as liquid excipients, particularly for injectable solutions. Suitable pharmaceutical excipients also include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like. Further examples of suitable Pharmaceutical excipients are described in Remington's Pharmaceutical Sciences 1447-1676 (Alfonso R.Gennaro eds., 19 th edition, 1995), which is incorporated by reference herein.
The present application includes various formulation forms of the described compositions (and/or other therapeutic agents). Any of the inventive compositions (and/or other therapeutic agents) described herein can be in the form of a solution, suspension, emulsion, drop, tablet, pill, pellet, capsule, liquid-containing capsule, gelatin capsule, powder, sustained release formulation, suppository, emulsion, aerosol, spray, suspension, lyophilized powder, frozen suspension, dried powder, or any other suitable form. In one embodiment, the composition is in the form of a capsule. In another embodiment, the composition is in the form of a lozenge. In another embodiment, the composition is formulated in the form of a soft gel capsule. In another embodiment, the composition is formulated in the form of a gelatin capsule. In another embodiment, the composition is formulated as a liquid.
Any of the compositions described herein are formulated according to conventional procedures to be suitable for the mode of administration described herein.
Routes of administration include, for example: oral, intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, sublingual, intranasal, intracerebral, intrathecal, transdermal, rectal, by inhalation or topical. Administration may be local or systemic. In some embodiments, the administering is effected orally. In another embodiment, the administration is by parenteral injection. The mode of administration may be left to the discretion of the physician and will depend in part on the site of the medical condition.
In certain embodiments, the composition comprises an antigen binding protein described herein or an immunoconjugate described herein, which composition is a detection agent or a therapeutic agent.
In certain embodiments, wherein the detection agent is an agent for detecting a tumor antigen.
In certain embodiments, wherein the detection agent is a contrast agent.
In certain embodiments, wherein the contrast agent is a contrast agent for detecting a tumor antigen. For example, the contrast agent may be an ECT contrast agent. As another example, the ECT contrast agent may include a SPECT contrast agent or a PET contrast agent.
In certain embodiments, wherein the therapeutic agent is for treating a tumor.
Use of
In another aspect, the present application provides a method of inhibiting cell proliferation comprising contacting a cell with an effective amount of an antigen binding protein described herein, a conjugate described herein, or a pharmaceutical composition described herein.
In certain embodiments, the contacting is performed in vivo or in vitro.
In another aspect, the present application provides a method of inhibiting cell proliferation comprising exposing cells in a cell culture medium to an antigen binding protein described herein, a conjugate described herein, or a pharmaceutical composition described herein.
In certain embodiments, the cell comprises a mammalian cell.
In certain embodiments, the cell comprises a tumor cell.
In another aspect, the present application provides a method of detecting, preventing and/or treating a tumor or other disease comprising administering to a subject in need thereof an antigen binding protein described herein, a conjugate described herein or a pharmaceutical composition described herein.
In certain embodiments, wherein the tumor comprises a solid tumor and a non-solid tumor.
In certain embodiments, wherein the tumor is selected from any one or more of the group consisting of: lymphoma, multiple myeloma, breast cancer, ovarian cancer, kidney cancer, endometrial cancer, melanoma, pancreatic cancer, lung cancer, gastric cancer, liver cancer, mesothelioma, esophageal cancer, head and neck cancer, cholangiocarcinoma, gallbladder cancer, bladder cancer, thymus cancer, and colorectal cancer.
In certain embodiments, the method further comprises administering to the subject an additional therapy or drug.
In certain embodiments, wherein the additional therapy is selected from the group consisting of: chemotherapy, radiation therapy, miRNA, and oligonucleotides.
In another aspect, the present application provides the use of an antigen binding protein as described herein, an immunoconjugate as described herein and/or a pharmaceutical composition as described herein for the preparation of a medicament for the treatment of a tumor or other disease.
In another aspect, the present application provides the use of an antigen binding protein as described herein, an immunoconjugate as described herein and/or a pharmaceutical composition as described herein in combination with other therapies or drugs in the manufacture of a medicament for the treatment of tumors or other diseases.
In certain embodiments, wherein the additional therapy is selected from the group consisting of: chemotherapy, radiation therapy, miRNA, and oligonucleotides.
In certain embodiments, wherein the tumor comprises a solid tumor and a non-solid tumor.
In certain embodiments, wherein the tumor is selected from any one or more of the group consisting of: lymphoma, multiple myeloma, breast cancer, ovarian cancer, kidney cancer, endometrial cancer, melanoma, pancreatic cancer, lung cancer, gastric cancer, liver cancer, mesothelioma, esophageal cancer, head and neck cancer, cholangiocarcinoma, gallbladder cancer, bladder cancer, thymus cancer, and colorectal cancer.
In another aspect, the present application provides a method of detecting a specific target for non-disease diagnostic purposes comprising the use of an antigen binding protein as described herein, an immunoconjugate as described herein and/or a pharmaceutical composition as described herein.
In another aspect, the present application provides a kit comprising an antigen binding protein as described herein, an immunoconjugate as described herein and/or a pharmaceutical composition as described herein, and optionally instructions for use.
In another aspect, the present application provides a kit comprising an antigen binding protein as described herein, an immunoconjugate as described herein and/or a pharmaceutical composition as described herein, and optionally an administration device.
Method
In another aspect, the present application provides a method for screening a nanobody site-directed conjugation site, the method comprising: screening for amino acid residue pairing in VHH at C.beta. -C.beta.In range (e.g., about +)>About->About->About +>About->About->About->About->About->About->About->About->About +>About->AboutAbout->About->About->About->About->Or lower).
In certain embodiments, the method further comprises excluding amino acid residues having ASA% less than about 20% (e.g., about 19%, about 18%, about 17%, about 16%, about 15%, about 14%, about 13%, about 12%, about 11%, about 10% or less) relative solvent accessibility.
In certain embodiments, the spatial distance and/or solvent accessibility of amino acid residues therein is calculated as predicted according to Swiss-PdbViewer software.
In certain embodiments, the method further comprises excluding amino acid residues located in the CDR regions, or loop regions, or near the internal disulfide bonds of the single domain antibody of the VHH.
In certain embodiments, the method further comprises homology modeling the VHH prior to screening for amino acid residue pairing.
In some embodiments, the homology modeling is calculated using modeler 9 software.
In certain embodiments, the method comprises:
1) Performing homologous modeling on the VHH;
2) Screening for amino acid residue pairing in VHH at C.beta. -C.beta.Combinations within the ranges;
3) Excluding amino acid residues having ASA% less than about 20% relative solvent accessibility;
4) Amino acid residues located in the CDR regions of VHH, or loop regions, or near the internal disulfide bonds of single domain antibodies were excluded.
The present application also provides the following embodiments:
1. an antigen binding protein comprising a variable antigen binding domain (VHH) of a heavy chain antibody, wherein the VHH comprises one or more pairs of engineered cysteine residues, wherein each pair of the engineered cysteine residues independently comprises a cysteine residue at a first position and a cysteine residue at a second position, the cysteine residue at the first position and the cysteine residue at the second position being capable of pairing to form a disulfide bond; wherein at least one of the cysteine residue at the first position and the cysteine residue at the second position is mutated.
2. The antigen binding protein of embodiment 1, wherein the cysteine residue at the first position and the cysteine residue at the second position are both mutated.
3. The antigen binding protein of any one of embodiments 1-2, wherein the disulfide bond is capable of forming a sulfhydryl group upon reduction by a reducing agent, wherein the sulfhydryl group allows the antigen binding protein to be conjugated to a payload at the first location and/or the second location.
4. The antigen binding protein of any one of embodiments 1-3, wherein the engineered cysteine residue does not reduce the affinity of the antigen binding protein.
5. The antigen binding protein of embodiment 4, wherein the engineered cysteine residue does not pair with a cysteine residue carried by the antigen binding protein itself.
6. The antigen binding protein of any one of embodiments 1-5, wherein both the first position and the second position are located in the Framework Region (FR) of the VHH.
7. The antigen binding protein of any one of embodiments 1-6, wherein neither said first location nor said second location is located in a Complementarity Determining Region (CDR) of said VHH.
8. The antigen binding protein of any one of embodiments 1-7, wherein the cysteine residue at the first position and the cysteine residue at the second position have a C β -C β of no more than about
9. The antigen binding protein of any one of embodiments 1-8, wherein the relative solvent accessibility (ASA%) of the amino acid residue at the first position to the amino acid residue at the second position is not less than about 20%.
10. The antigen binding protein of any one of embodiments 1-9, wherein the first and second positions are each independently selected from the following positions: 3. 7, 9, 11, 12, 13, 17, 23, 39, 41, 66, 68, 83, 84, 87, 8, 16, 18, 25, 42, 45, 81, 82a, 82b, 85, 108, 110, 111, and 113; wherein the first location and the second location are different; wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
11. The antigen binding protein of any one of embodiments 1-10, wherein the first position is selected from the group consisting of: 3. 7, 9, 11, 12, 13, 17, 23, 39, 41, 66, 68, 83, 84, and 87; the second position is selected from: 8. 16, 18, 25, 42, 45, 81, 82a, 82b, 85, 108, 110, 111 and 113; the first and second positions are different; wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
12. The antigen binding protein of any one of embodiments 1-11, wherein the combination of the first and second positions is selected from at least one of the following combinations:
p)66-82b;
q)3-25;
r)7-8;
s)84-113;
t)83-85;
u)68-81;
v)17-82a;
w)41-42;
x)9-108;
y)11-110;
z)87-111;
aa)13-16;
bb)12-18;
cc) 39-45; and
dd)14-113
wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
13. The antigen binding protein according to any one of embodiments 1-12, wherein the combination of the amino acid residue at the first position and the amino acid residue at the second position is selected from at least one of the following combinations:
a)66(R/E)-82b(S/N/R/T/D/Y);
b)3(Q)-25(S);
c)7(S)-8(G);
d)84(A/P/M)-113(S);
e)83(K/R/Q/S/T/E)-85(E/D);
f)68(T/V/A)-81(Q/E/N);
g)17(S)-82a(N/L/D);
h)41(P/A/R)-42(G);
i)9(G)-108(L/Q/H);
j)11(S/L)-110(T);
k)87(T/A/L)-111(V/D);
l)13(Q/R)-16(G);
m)12(V/G)-18(L);
n) 39 (Q) -45 (R/C/L/H); and
o)14(P)-113(S)。
wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
14. The antigen binding protein of any one of embodiments 1-13, wherein said VHH comprises 1, 2, 3, or 4 cysteine residues.
15. The antigen binding protein according to any one of embodiments 1-14, wherein said VHH comprises 2 pairs of cysteine residues, wherein the combination of said first and second positions in each pair of cysteine residues is selected from any two of the following combinations:
a)66-82b;
b)3-25;
c)7-8;
d)84-113;
e)83-85;
f)68-81;
g)17-82a;
h)41-42;
i)9-108;
j)11-110;
k)87-111;
l)13-16;
m)12-18;
n) 39-45; and
o)14-113。
wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
16. The antigen binding protein according to any one of embodiments 1-15, wherein said VHH comprises 2 pairs of cysteine residues, wherein the combination of said first and second positions in each pair of cysteine residues is selected from any two of the following combinations:
a)66(R/E)-82b(S/N/R/T/D/Y);
b)3(Q)-25(S);
c)7(S)-8(G);
d)84(A/P/M)-113(S);
e)83(K/R/Q/S/T/E)-85(E/D);
f)68(T/V/A)-81(Q/E/N);
g)17(S)-82a(N/L/D);
h)41(P/A/R)-42(G);
i)9(G)-108(L/Q/H);
j)11(S/L)-110(T);
k)87(T/A/L)-111(V/D);
l)13(Q/R)-16(G);
m)12(V/G)-18(L);
n) 39 (Q) -45 (R/C/L/H); and
o)14(P)-113(S)。
wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering.
17. The antigen binding protein according to any one of embodiments 1-16, wherein said VHH comprises 2 pairs of cysteine residues, wherein the combination of said first and second positions in each pair of cysteine residues is selected from the group consisting of:
a) 3-25 and 84-113;
b) 7-8 and 3-25;
c) 7-8 and 84-113; and
d) 11-110 and 84-113;
wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
18. The antigen binding protein according to any one of embodiments 1-17, wherein said VHH comprises 2 pairs of cysteine residues, wherein the combination of said first and second positions in each pair of cysteine residues is selected from the group consisting of:
a) 3 (Q) -25 (S) and 84 (A/P/M) -113 (S);
b) 7 (S) -8 (G) and 3 (Q) -25 (S);
c) 7 (S) -8 (G) and 84 (A/P/M) -113 (S); and
d) 11 (S/L) -110 (T) and 84 (A/P/M) -113 (S);
wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
19. The antigen binding protein of any one of embodiments 1-18, wherein the antigen binding protein comprises an antibody or antigen binding fragment thereof.
20. The antigen binding protein of embodiment 19, wherein said antibody comprises a monoclonal antibody.
21. The antigen binding protein of any one of embodiments 19-20, wherein said antibody or antigen binding fragment thereof comprises a single domain antibody or a heavy chain antibody.
22. The antigen binding protein of any one of embodiments 19-21, wherein said antibody or antigen binding fragment comprises a chimeric antibody, a humanized antibody, and/or a fully human antibody.
23. The antigen binding protein of any one of embodiments 1-22, wherein said antigen binding protein is a humanized VHH antibody or a fully human VHH antibody.
24. The antigen binding protein of any one of embodiments 1-23, wherein said antigen binding protein specifically binds to a tumor antigen or a non-tumor antigen.
25. <xnotran> 24 , CD19, BCMA, TSHR, CD171, CS-1, CLL-1, GD3, tn Ag, FLT3, CD38, CD123, CD44v6, B7H3, B7H4, KIT, IL-13Ra2, IL-11Ra, PSCA, PSMA, PRSS21, EGFR2, lewisY, CD24, PDGFR-beta, SSEA-4, MUC1, EGFR, NCAM, CAIX, LMP2, ephA2, GM1, sLe, GM3, TGS5, HMWMAA, FOLR1, FOLR2, TEM1/CD248, TEM7R, CLDN6, CLDN18.2, GPRC5D, CXORF61, CD97, CD179a, ALK, , PLAC1, globoH, NY-BR-1, UPK2, HAVCR1, ADRB3, PANX3, GPR20, LY6K, OR51E2, TAARP, WT1, ETV6-AML, SPA17, XAGE1, tie 2, MAD-CT-1, MAD-CT-2, FOSL1, hTERT, ML-IAP, ERG, NA17, PAX3, AR, B1, MYCN, rhoC, CYP1B1, BORIS, SART3, PAX5, OY-TES1, LCK, AKAP-4, SSX2, CD79a, CD79b, CD72, LAIR1, FCAR, LILRA2, CD300LF, CLEC12A, BST2, EMR2, LY75, GPC3, FCRL5, IGLL1, CD20, CD30, HER2, ROR1, TAAG72, CD22, CD33, GD2, gp100Tn, FAP, , EPCAM, CEA, IGF-1R, ephB2, , 17, CD32b, EGFRvIII, GPNMB, GPR64, HER3, LRP6, LYPD8, NKG2D, SLC34A2, SLC39A6, SLITRK6, GUCY2C, 5T4 / TACSTD2. </xnotran>
26. The antigen binding protein of any one of embodiments 1-25, wherein said antigen binding protein comprises an anti-PD-L1 VHH antibody, an anti-HER 2 VHH antibody, or an anti-CD 8 VHH antibody.
27. The antigen binding protein of any one of embodiment 26, wherein the anti-PD-L1 VHH antibody comprises: CDR1 of the amino acid sequence shown in SEQ ID NO. 46, CDR2 of the amino acid sequence shown in SEQ ID NO. 47 and CDR3 of the amino acid sequence shown in SEQ ID NO. 48.
28. The antigen binding protein of any one of embodiment 26, wherein the anti-HER 2 VHH antibody comprises: i) CDR1 of the amino acid sequence shown as SEQ ID NO. 21, CDR2 of the amino acid sequence shown as SEQ ID NO. 22 and CDR3 of the amino acid sequence shown as SEQ ID NO. 23; or ii) CDR1 of the amino acid sequence shown in SEQ ID NO. 64, CDR2 of the amino acid sequence shown in SEQ ID NO. 65 and CDR3 of the amino acid sequence shown in SEQ ID NO. 66.
29. The antigen binding protein of any one of embodiment 26, wherein the anti-CD 8 α VHH antibody comprises: CDR1 of the amino acid sequence shown in SEQ ID NO. 1, CDR2 of the amino acid sequence shown in SEQ ID NO. 2 and CDR3 of the amino acid sequence shown in SEQ ID NO. 3.
30. An antigen binding protein that specifically binds to PD-L1 comprising a variable antigen binding domain (VHH) of a heavy chain antibody, said VHH comprising a cysteine mutation compared to the sequence set forth in SEQ ID NO:49 at a position selected from any one or more of the following:
a)66-82b;
b)3-25;
c)7-8;
d)84-113;
e)83-85;
f)68-81;
g)17-82a;
h)41-42;
i)9-108;
j)11-110;
k)87-111;
l)13-16;
m)12-18;
n) 39-45; and
o)14-113;
wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
31. The antigen binding protein of embodiment 30, wherein said VHH comprises a cysteine mutation at a position selected from any one or more of the following:
a)66(R/E)-82b(S/N/R/T/D/Y);
b)3(Q)-25(S);
c)7(S)-8(G);
d)84(A/P/M)-113(S);
e)83(K/R/Q/S/T/E)-85(E/D);
f)68(T/V/A)-81(Q/E/N);
g)17(S)-82a(N/L/D);
h)41(P/A/R)-42(G);
i)9(G)-108(L/Q/H);
j)11(S/L)-110(T);
k)87(T/A/L)-111(V);
l)13(Q/R)-16(G);
m)12(V/G)-18(L);
n) 39 (Q) -45 (R/C/L/H); and
o)14(P)-113(S)
wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
32. The antigen binding protein of any one of embodiments 30-31, comprising the amino acid sequence of any one of SEQ ID NOs 50-63.
33. An antigen binding protein that specifically binds PD-L1 comprising CDR1, CDR2 and CDR3 in the variable antigen binding domain (VHH) of a heavy chain antibody, wherein the amino acid sequence of said VHH is set forth in any one of SEQ ID NOS: 50-63.
34. An antigen binding protein that competes for binding to PD-L1 with the antigen binding protein of any one of embodiments 30-33.
35. An antigen binding protein that specifically binds to CD8 a comprising a variable antigen binding domain (VHH) of a heavy chain antibody, said VHH comprising a cysteine mutation compared to the sequence set forth in SEQ ID No. 4, the cysteine mutation position being selected from any one or more of the following:
a)66-82b;
b)3-25;
c)7-8;
d)84-113;
e)83-85;
f)68-81;
g)17-82a;
h)41-42;
i)9-108;
j)11-110;
k)87-111;
l)13-16;
m)12-18;
n) 39-45; and
o)14-113;
wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering.
36. The antigen binding protein of embodiment 35, wherein said VHH comprises a cysteine mutation compared to the sequence set forth in SEQ ID No. 4 at a position selected from any one or more of the following:
a)66(R/E)-82b(S/N/R/T/D/Y);
b)3(Q)-25(S);
c)7(S)-8(G);
d)84(A/P/M)-113(S);
e)83(K/R/Q/S/T/E)-85(E/D);
f)68(T/V/A)-81(Q/E/N);
g)17(S)-82a(N/L/D);
h)41(P/A/R)-42(G);
i)9(G)-108(L/Q);
j)11(S/L)-110(T);
k)87(T/A/L)-111(V);
l)13(Q/R)-16(G);
m)12(V/G)-18(L);
n) 39 (Q) -45 (R/C/L/H); and
o)14(P)-113(S);
wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering.
37. The antigen binding protein of embodiment 36, comprising the amino acid sequence of any one of SEQ ID NOs 5-18, 20.
38. An antigen binding protein that specifically binds to CD8 a comprising CDR1, CDR2 and CDR3 in the variable antigen binding domain (VHH) of a heavy chain antibody, wherein the amino acid sequence of said VHH is as set forth in any one of SEQ ID NOs 5-18, 20.
39. An antigen binding protein that competes for binding to CD8 a with the antigen binding protein of any one of embodiments 35-38.
40. An antigen binding protein that specifically binds to HER2 comprising a variable antigen binding domain (VHH) of a heavy chain antibody, said VHH comprising a cysteine mutation compared to the sequence set forth in SEQ ID NO:24 or 67 at a position selected from any one or more of the group consisting of:
a)66-82b;
b)3-25;
c)7-8;
d)84-113;
e)83-85;
f)68-81;
g)17-82a;
h)41-42;
i)9-108;
j)11-110;
k)87-111;
l)13-16;
m)12-18;
n) 39-45; and
o)14-113;
wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering.
41. The antigen binding protein of embodiment 40, wherein said VHH comprises a cysteine mutation compared to the sequence set forth in SEQ ID NO. 24 or 67 at a position selected from any one or more of the following:
a)66(R/E)-82b(S/N/R/T/D/Y);
b)3(Q)-25(S);
c)7(S)-8(G);
d)84(A/P/M)-113(S);
e)83(K/R/Q/S/T/E)-85(E/D);
f)68(T/V/A)-81(Q/E/N);
g)17(S)-82a(N/L/D);
h)41(P/A/R)-42(G);
i)9(G)-108(L/Q/H);
j)11(S/L)-110(T);
k)87(T/A/L)-111(V);
l)13(Q/R)-16(G);
m)12(V/G)-18(L);
n) 39 (Q) -45 (R/C/L/H); and
o)14(P)-113(S);
wherein the numbers refer to the amino acid residue positions of the VHH as defined by Kabat numbering.
42. The antigen binding protein of embodiments 40-41, comprising the amino acid sequence of any one of SEQ ID NOs 25-45, 68-83.
43. The antigen binding protein of embodiment 42, said VHH further being affinity optimized compared to the amino acid sequence of any one of SEQ ID NO 68-83.
44. The antigen binding protein of embodiment 42, comprising the amino acid sequence of any one of SEQ ID NOs 84-94.
45. An antigen binding protein that specifically binds HER2 comprising CDR1, CDR2 and CDR3 in the variable antigen binding domain (VHH) of a heavy chain antibody, wherein the amino acid sequence of said VHH is as set forth in any one of SEQ ID NOs: 25-45, 68-95.
46. An antigen binding protein that competes for binding to HER2 with the antigen binding protein of any one of embodiments 40-45.
47. A fusion polypeptide comprising the antigen binding protein of any one of embodiments 1-46.
48. An immunoconjugate comprising the antigen binding protein of any one of embodiments 1-46, a payload, and a linker linking the payload to the antigen binding protein.
49. The immunoconjugate according to embodiment 48, having the structure of formula I:
VHH-(L-D) n (I)
wherein L is a linker; d is a payload; n is any number from 1 to 8.
50. The immunoconjugate according to any one of embodiments 48 to 49, wherein said VHH comprises the amino acid sequence set forth in any one of SEQ ID NOs 5-18, 20, 25-45, 50-63, 68-95.
51. The immunoconjugate according to any one of embodiments 48-50, wherein said VHH is linked to said linker by a cysteine residue at a first position and/or a cysteine residue at a second position.
52. The immunoconjugate according to any one of embodiments 48-51, wherein the surface disulfide bond formed by pairing a cysteine residue at a first position with a cysteine residue at a second position in said VHH is reduced to form a free cysteine, said free cysteine comprising a thiol group, said linker being linked to a thiol group.
53. The immunoconjugate of any one of embodiments 48-52, wherein said linker comprises cleavable or non-cleavable.
54. The immunoconjugate according to any one of embodiments 48-53, wherein said linker is selected from the group consisting of: 6-Maleimidocaproyl (MC), maleimidopropanoyl (MP), valine-citrulline (val-cit), alanine-phenylalanine (alaphe), p-aminobenzyloxycarbonyl (PAB), N-succinimidyl 4- (2-pyridylthio) pentanoate (SPP), N-succinimidyl 4- (N-maleimidomethyl) cyclohexane-1-carboxylate (SMCC), (N-succinimidyl 4-iodo-acetyl) aminobenzoate (SIAB),), SPDB, hydrazone, maleimidocaproyl and 6-maleimidocaproyl-valine-citrulline-p-aminobenzyloxycarbonyl (MC-vc-PAB); or a branched linker comprising a peptide chain and derived from o-hydroxy p-aminobenzyl alcohol, wherein the peptide chain is linked to a benzene ring through a p-amino group, the payload is linked to a benzene ring through a benzyl alcohol moiety, and the antigen binding protein is linked to a benzene ring through an o-hydroxy group.
55. The immunoconjugate of any one of embodiments 48-54, wherein said linker comprises a chelator.
56. The immunoconjugate according to embodiment 55, wherein the chelator is selected from DTPA, EDTA, NOTA, DOTA, TRAP, TETA, NETA, CB-TE2A, cyclen, cyclam, bispidine, TACN, ATSM, sarar, amBaSar, MAG3, MAG2, HYNIC, DADT, EC, NS3, H2dedpa, HBED, DFO, PEPA or HEHA and derivatives thereof.
57. The immunoconjugate of any one of embodiments 48-56, wherein said payload comprises a detectable label.
58. The immunoconjugate according to embodiment 57, wherein the detectable label is selected from the group consisting of: radionuclides, fluorescers, chemiluminescers, bioluminescent agents, paramagnetic ions and enzymes, and combinations thereof.
59. The immunoconjugate according to embodiment 58, wherein the detectable label comprises a radionuclide.
60. The immunoconjugate according to embodiment 59, wherein the radionuclide comprises 110 In、 111 In、 177 Lu、 18 F、 52 Fe、 62 Cu、 67 Cu、 67 Ga、 68 Ga、 68 Ge、 86 Y、 90 Y、 89 Zr、 94m Tc、 120 I、 123 I、 124 I、 125 I、 131 I、 154- 158 Gd、 32 P、 11 C、 13 N、 15 O、 186 Re、 188 Re、 51 Mn、 52m Mn、 72 As、 75 Br、 76 Br、 82m Rb、 83 Sr or other gamma-, beta-, or positron emitters.
61. The immunoconjugate according to any one of embodiments 57-60, wherein said radionuclide is linked to said antigen binding protein by a chelator.
62. The immunoconjugate of any one of embodiments 48-56, wherein said payload comprises a targeting moiety.
63. The immunoconjugate according to embodiment 62, wherein the targeting moiety is selected from the group consisting of: proteins, nucleic acids, lipids, carbohydrates, and combinations thereof.
64. The immunoconjugate of any one of embodiments 48-56, wherein said payload comprises a drug.
65. The immunoconjugate according to embodiment 64, wherein the drug is selected from the group consisting of: an anti-cancer therapeutic agent, an anti-inflammatory therapeutic agent, an anti-infection therapeutic agent, an anesthetic therapeutic agent, a cytotoxic therapeutic agent, a radionuclide, an immunomodulator, a cell signal peptide, a growth factor, an enzyme, an oligonucleotide, a photoactive therapeutic agent, and any combination thereof.
66. The immunoconjugate according to embodiment 65, wherein said anti-cancer therapeutic is selected from the group consisting of: cytostatics, cytotoxic nucleosides, tubulin binding agents, hormones and hormone antagonists, anti-angiogenic agents, enzyme inhibitors, gene modulators, proteasome inhibitors, pteridine, diyne, podophyllotoxin, auristatin, geldanamycin, calicheamicin, gramicin D, maytansine, neocarzinostatin, topotecan, taxanes, cytochalasin B, ethidium bromide, emetine, tinosporine, colchicine, dihydroxyanthracenedione, mitoxantrone, procaine, tetracaine, lidocaine, propranolol, puromycin, maytansine derivatives, anthracycline derivatives, bisphosphonate derivatives, tenmycin derivatives, streptomelanin derivatives, auristatin derivatives, duocarmycin derivatives, and any combination thereof.
67. The immunoconjugate according to any one of embodiments 65-66, wherein the cytostatic agent is selected from: anthraquinone, DNA synthesis inhibitors, DNA-intercalators, DNA-RNA transcription regulators, ansamycinquinone, quinone derivatives, busulfan, ifosfamide, mechlorethamine, triazone, diazinon, carbazolquinone, indoloquinone E09, diazaspinyl-benzoquinone methyl DZQ, triethylenephosphoramide, nitrosourea compounds, and any combination thereof.
68. The immunoconjugate according to any one of embodiments 65-67, wherein said cytotoxic nucleoside is selected from the group consisting of: vidarabine, cytarabine, 5-fluorouracil, fludarabine, fluorouracil nucleoside, ftoracure, 6-mercaptopurine, and combinations of any of these.
69. The immunoconjugate according to any one of embodiments 65-68, wherein said tubulin-binding agent is selected from the group consisting of: paclitaxel, nocodazole, rhizoxin, dolastatin, colchicine, combretastatin, vinca alkaloids, and any combination thereof.
70. The immunoconjugate according to any one of embodiments 65-69, wherein the hormone and hormone antagonist are selected from the group consisting of: corticosteroids, progestins, estrogens, antiestrogens, androgens, aromatase inhibitors, 17- (allylamino) -17-demethoxygeldanamycin, 4-amino-I, 8-naphthalimide, apigenin, brefeldin A, cimetidine, dichloromethylene diphosphonic acid, leuprolide, luteinizing hormone releasing hormone, pifithrin-a, rapamycin, sex hormone binding globulin, thapsigargin, and any combination thereof.
71. The immunoconjugate according to any one of embodiments 65-70, wherein the anti-angiogenic agent is selected from the group consisting of: angiostatin K1-3, DL- α -difluoromethyl-ornithine, endostatin, fumagillin, genistein, minocycline, staurosporine, (+) -thalidomide, and any combination thereof.
72. The immunoconjugate according to any one of embodiments 65-71, wherein the enzyme inhibitor is selected from the group consisting of: s (+) -camptothecin, curcumin, (-) -deguelin, 5, 6-dichlorobenzene-imidazole I-beta-D-ribofuranoside, etoposide, formestane, fosstricin, hispidin, 2-imino-1-imidazolidineacetic acid, mevinolin, trichostatin A, tyrphostin AG 34, tyrphostin AG 879, and any combination thereof.
73. The immunoconjugate according to any one of embodiments 65-72, wherein the gene modulator is selected from the group consisting of: 5-aza-2' -deoxycytidine, 5-azacytidine, cholecalciferol, 4-hydroxyttamoxifen, melatonin, mifepristone, raloxifene, trans retinal, retinoic acid, 9-cis-retinoic acid, 13-cis-retinoic acid, retinol, tamoxifen, troglitazone, and any combination thereof.
74. The immunoconjugate according to any one of embodiments 65-73, wherein saidThe radionuclide comprises 110 In、 111 In、 177 Lu、 18 F、 52 Fe、 62 Cu、 67 Cu、 67 Ga、 68 Ga、 68 Ge、 86 Y、 90 Y、 89 Zr、 94m Tc、 120 I、 123 I、 124 I、 125 I、 131 I、 154-158 Gd、 32 P、 11 C、 13 N、 15 O、 186 Re、 188 Re、 51 Mn、 52m Mn、 72 As、 75 Br、 76 Br、 82m Rb、 83 Sr or other gamma-, beta-, or positron emitters.
75. The immunoconjugate according to any one of embodiments 49-74, wherein said n is any integer from 1 to 8.
76. The immunoconjugate according to any one of embodiments 49-75, wherein said n is 2, 4, 6, or 8.
77. A pharmaceutical composition comprising an antigen binding protein of any one of embodiments 1-46 or a conjugate of any one of embodiments 48-76, or a pharmaceutically acceptable salt thereof, and optionally a pharmaceutically acceptable carrier.
78. An isolated nucleic acid molecule comprising a polynucleotide encoding an antigen binding protein of any one of embodiments 1-46 or a fusion protein of embodiment 47.
79. A vector comprising the nucleic acid molecule of embodiment 78.
80. A cell comprising the nucleic acid molecule of embodiment 78 and/or the vector of embodiment 79.
81. A method of making an antigen binding protein of any one of embodiments 1-46, the method comprising:
i) Site-directed mutagenesis of a nucleic acid sequence of a parent antibody, wherein the mutagenesis comprises substitution of one or more pairs of amino acid residues with cysteine residues; wherein each pair of said cysteine residues comprises a cysteine residue at a first position and a cysteine residue at a second position, said cysteine residue at the first position and said cysteine residue at the second position being capable of pairing to form a disulfide bond; and
ii) expressing the antigen binding protein.
82. The method of embodiment 81, wherein the method further comprises recovering the antigen binding protein.
83. The method of embodiment 82, wherein the method further comprises purifying the antigen binding protein.
84. The method of embodiment 83, wherein the mutagenesis further comprises affinity optimization of the antibody after substitution with a cysteine residue.
85. A method of making an antigen binding protein of any one of embodiments 1-46, the method comprising: comprising culturing the cell of embodiment 80 under conditions that allow expression of the antigen binding protein.
86. A method of making a conjugate of any of embodiments 48-76, the method comprising: conjugating an antigen binding protein of any one of embodiments 1-46 to a payload.
87. The method of embodiment 86, comprising: reacting at least one pair of cysteines of the antigen binding protein with the linker-payload intermediate to form an antigen binding protein-payload conjugate:
VHH-(L-D)n (I)
wherein L is a linker; d is a payload; n is any number from 1 to 8.
88. The method of embodiment 87, wherein n is any integer from 1 to 8.
89. The method of embodiment 88, wherein n is 2, 4, 6, or 8.
90. The method of embodiment 86, wherein the method comprises: i) Reducing open disulfide bonds formed by paired cysteine residues in the antigen binding protein to form free cysteines; ii) reacting the thiol group of the free cysteine with a linker-payload intermediate to form an antigen binding protein-payload conjugate.
91. The method of embodiment 90, wherein the method comprises:
i) Reducing open a disulfide bond formed by paired cysteine residues in the antigen binding protein to form free cysteines;
ii) linking the sulfhydryl group of the free cysteine to a linker to form an antigen binding protein-linker intermediate;
iii) Conjugating the antigen binding protein-linker intermediate to a payload to form an antigen binding protein-payload conjugate.
92. A method of inhibiting cell proliferation comprising contacting a cell with an effective amount of an antigen binding protein of any one of embodiments 1-46, a conjugate of any one of embodiments 48-76, or a pharmaceutical composition of embodiment 77.
93. The method of embodiment 92, wherein the contacting is performed in vivo or in vitro.
94. The method of embodiment 92, comprising including said contacting in a culture medium.
95. The method of embodiments 92-94, wherein the cell comprises a mammalian cell.
96. The method of embodiments 92-95, wherein the cell comprises a tumor cell.
97. A method of detecting, preventing and/or treating a tumor or other disease comprising administering to a subject in need thereof an antigen binding protein of any one of embodiments 1-46, a conjugate of any one of embodiments 48-76, or a pharmaceutical composition of embodiment 77.
98. The method of embodiment 97, wherein the tumor comprises a solid tumor and a non-solid tumor.
99. The method of embodiment 98, wherein the tumor is selected from any one or more of the group consisting of: lymphoma, multiple myeloma, breast cancer, ovarian cancer, kidney cancer, endometrial cancer, melanoma, pancreatic cancer, lung cancer, gastric cancer, liver cancer, mesothelioma, esophageal cancer, head and neck cancer, cholangiocarcinoma, gallbladder cancer, bladder cancer, thymus cancer, cervical cancer, brain cancer, prostate cancer, glioblastoma, squamous cell carcinoma, testicular cancer, nasopharyngeal cancer, and colorectal cancer.
100. The method of any one of embodiments 97-99, further comprising administering to the subject an additional therapy or drug.
101. The method of embodiment 100, wherein the other therapy is selected from the group consisting of: chemotherapy, radiation therapy, miRNA, and oligonucleotides.
102. The method of embodiment 97, wherein the other disease comprises an autoimmune disease or an infectious disease.
103. Use of the antigen binding protein of any one of embodiments 1-46, the conjugate of any one of embodiments 48-76, or the pharmaceutical composition of embodiment 77 for the preparation of a medicament for the treatment of a tumor or other disease.
104. Use of the antigen binding protein of any one of embodiments 1-46, the conjugate of any one of embodiments 48-76, or the pharmaceutical composition of embodiment 77 in combination with other therapies or drugs for the preparation of a medicament for the treatment of a tumor or other disease.
105. The use according to embodiment 104, wherein the other therapy is selected from the group consisting of: chemotherapy, radiation therapy, miRNA, and oligonucleotides.
106. The use of any one of embodiments 103-105, wherein the tumor comprises a solid tumor and a non-solid tumor.
107. The use of embodiment 106, wherein the tumor is selected from any one or more of the group consisting of: lymphoma, multiple myeloma, breast cancer, ovarian cancer, kidney cancer, endometrial cancer, melanoma, pancreatic cancer, lung cancer, gastric cancer, liver cancer, mesothelioma, esophageal cancer, head and neck cancer, cholangiocarcinoma, gallbladder cancer, bladder cancer, thymus cancer, cervical cancer, brain cancer, prostate cancer, glioblastoma, squamous cell carcinoma, testicular cancer, nasopharyngeal cancer, and colorectal cancer.
108. The use according to any one of embodiments 103-107, wherein the other disease comprises an autoimmune disease or an infectious disease.
109. A method of detecting a specific target for non-disease diagnostic purposes comprising using an antigen binding protein of any one of embodiments 1-46, a conjugate of any one of embodiments 48-76, or a pharmaceutical composition of embodiment 77.
110. A kit comprising an antigen binding protein of any one of embodiments 1-46, a conjugate of any one of embodiments 48-76, or a pharmaceutical composition of embodiment 77, and optionally instructions for use.
111. A kit comprising an antigen binding protein of any one of embodiments 1-46, a conjugate of any one of embodiments 48-76, or a pharmaceutical composition of embodiment 77, and optionally an administration device.
112. A method of screening for nanobody site-directed conjugation sites, the method comprising: screening for amino acid residues in VHH at about C.beta. -C.beta.Combinations within the range.
113. The method of embodiment 112, further comprising excluding amino acid residues having ASA% less than about 20% relative solvent accessibility.
114. The method according to any one of embodiments 112 to 113, wherein the spatial distance and/or solvent accessibility of amino acid residues is calculated predictively according to the Swiss-PdbViewer software.
115. The method of any one of embodiments 112-114, further comprising excluding amino acid residues located in CDR regions, or loop regions, or near the internal disulfide bond of VHH.
116. The method according to any one of embodiments 112-115, further comprising homology modeling of VHHs prior to screening for amino acid residues.
117. The method of embodiment 116 wherein the homologous modeling is computed using modeler 9 software.
118. The method of any of embodiments 112-117, comprising:
1) Performing homologous modeling on the VHH;
2) Screening for amino acid residues in VHH at about C.beta. -C.beta.Combinations within the ranges;
3) Excluding amino acid residues having ASA% less than about 20% relative solvent accessibility;
4) Amino acid residues located in the CDR regions of the VHH, or in the loop regions, or near the internal disulfide bonds of the VHH are excluded.
Without wishing to be bound by any theory, the following examples are only intended to illustrate the antigen binding proteins, preparation methods and uses, etc. of the present application, and are not intended to limit the scope of the invention of the present application.
Examples
As shown in FIG. 1, referring to the multiple sequence alignment data of Mitcell for 90 multiple single domain antibody sequences in PDB database, it was found that single domain antibodies are highly conserved in FR1, FR2, FR3 and FR4, with most amino acid positions being conserved to more than 80%, i.e., the sequences of the framework regions of single domain antibodies are highly conserved (Mitchell LS, colwell LJ. Comprehensive analysis of nanobody sequence and structure data. Proteins.2018 Jul;86 (7): 697-706.Doi
PDB modeling is carried out on the target nano antibody, and amino acid on the surface of the antibody is found through analysis of the model. These surface-located amino acids were analyzed, amino acids located in the CDR regions were excluded (CDR region amino acids may influence activity), and amino acids located in the FR regions (see FR region amino acid conservation analysis in the above figure) were retained. Theoretically, these amino acids can be substituted by cysteine and paired with each other to form disulfide bonds on the surface of the antibody, as long as the space distance is appropriate. When the coupling is needed, the corresponding reducing agent is used for reduction to open the disulfide bond, and the corresponding substance is coupled, so that the DAR value of the antibody coupled by the method is an even number theoretically. Can be represented by the general formula:
VHH-(L-D) n
Wherein: VHH represents an antibody in which the surface amino acids of the FR region of the antibody are substituted with one or more cysteines; l is a small molecule linker; d is a drug that needs to be attached to an antibody, including but not limited to toxins, radionuclides, affinity ligands, and the like; n is the number of couplings and can be 2, 4, 6 and 8 (theoretically even).
The nano antibody related by the invention is randomly selected, in order to ensure the universality of a designed platform, three antibodies of three target points are randomly selected for verification, different micromolecular linkers and medicines (toxins or radionuclides) are coupled, and an in-vitro verification experiment is simultaneously carried out, so that the affinity of the nano antibody before and after the nano antibody is substituted by cysteine (a parent antibody and the modified antibody) is not obviously changed, the molecular weight of the modified antibody is consistent with the theory, and the surface disulfide bond is formed after the amino acid on the surface of an FR region is substituted by the cysteine. And simultaneously, carrying out affinity detection on the antibodies before and after coupling so as to ensure that the affinity of the coupled antibodies is not lost, and the method can be used for subsequent corresponding treatment or diagnosis and the like, and detecting the molecular weight of the coupled antibodies by using mass spectrometry so as to calculate the actual coupled DAR and the like.
The analysis method comprises the following steps:
amino acid residue pairing of single domain antibodies that can be engineered to facilitate disulfide bond formation can be found by the following several steps.
1. C37H,109, H2 and H1 are respectively subjected to homologous modeling, and Modeller9 is adopted by homologous modeling software.
2. All resolutions in the protein PDB database were less thanThe disulfide bond in the three-dimensional data is used as a prediction model, and all amino acid residues are paired to form C beta-C beta in the three-dimensional structure data of nano antibodies such as C37H,109, H2, H1 and the likeAll within the range are potential disulfide bond-forming combinations, the closer the distance theoretically, the easier it is to form disulfide bond pairings (Dombkowski A, crippen G M. Disufide recognition in an optimized cleaving potential [ J ]].Protein engineering,2000,13 (10):679-689.). And obtaining potential disulfide bond pairing through model prediction. The spatial distance of amino acid residues can be calculated predictively by Swiss-PdbViewer software.
3. And calculating the relative solvent accessibility (relative solvent accessibility) of the amino acids excluding fully masked amino acid residues based on the three-dimensional structure of the protein, theoretically ASA% less than 20% of the amino acids with relative solvent accessibility being non-fully exposed or non-exposed amino acids (Savojardo C, manfredi M, martelli P L, et al. Solvent accessibility of the remaining hydrophobic amino acids in humans: from protein structures to protein sequences [ J ]. Primers in molecular biology, 2021, 626363..
Solvent accessibility was either predicted according to http:// cib. Cf. Ocha. Ac. Jp/bitool/ASA/website or predicted by Swiss-PdbViewer software.
4. Finally, the final mutable amino acid pair is selected based on the structural and functional interaction of its single domain antibody. Specifically, these surface amino acids are analyzed for their position in the antibody sequence, excluding amino acid residues located in the CDR regions (which affect antibody antigen binding), or loop regions (which affect protein stability), of the antibody near the internal disulfide bonds of the single domain antibody. The newly engineered amino acid pairing residues should not participate (distint from) and not interfere with antigen binding, nor mismatch with the cysteines involved in disulfide bond formation.
5. Theoretically, the nano antibody is obtained by calculating that the ASA% value of the solvent accessibility of the amino acids in the FR region is more than or equal to 20%, the spatial position is proper, and the amino acid residues C beta-C beta for pairing are inMutations may be made to allow for disulfide bond pairing.
1. Sequence analysis and construction
1.1. Analysis of mutable sites
In order to analyze whether the mutation sites have universality, three antibodies (C37H, 109 and H2) of three targets (CD 8 alpha, PD-L1 and Her 2) are respectively selected for PDB modeling, amino acids on the surface of the antibodies are found (if the mutation amino acids are positioned in the antibodies, the reduction-coupling cannot be carried out on the mutation amino acids at a later stage), and the positions of the amino acids on the surface in the antibody sequences are analyzed, if the mutation sites are positioned in CDR regions, loop regions and the like of the antibodies, the biological activity of the antibodies can be influenced after mutation, if the mutation sites are too close to self-carrying disulfide bonds of the antibodies, mismatching is easy to occur in the expression process, and the like. By comprehensively analyzing the factors, the three antibodies respectively select some sites for mutation.
1.1.1 predictive analysis of the C37H antibody against the CD 8. Alpha. Target
PDB modeling was performed on the C37H antibody sequence, and analysis predicted that the C37H antibody itself had a total of 63 amino acids available for cysteine mutation. The specific sequence of C37H and the C β -C β distance between 63 pairs of sites at which mutations can be analyzed are as follows:
C37H:
QVQLVESGGGLVQPGGSLRLSCAASGLTFSDYAIGWFRQAPGKEREGISCIRIYDGNTYYADSVKGRFTISRDNSKNHVYLQMNSLRAEDTAVYYCAAGSYYSCSVYPAYDLDYWGKGTLVTVSS
among them, underlined portions indicate antibody CDR regions.
63 pairs of amino acids at specific positions which can undergo disulfide bond mutation
S49-I69 | A33-Y97 | V2-L27 | V63-F67 |
V12-L18 | Q39-R45 | I52a-R71 | S96-D101 |
Y59-K64 | I51-I69 | A33-S100a | R38-I48 |
R38-A88 | F29-N76 | E6-C92 | S17-N82a |
I34-V78 | C50-V100b | I48-V63 | I51-T57 |
E6-T107 | L82c-V111 | Y32-W103 | T28-D31 |
V2-Y102 | L82c-D90 | M82-L82c | F29-N73 |
A40-A88 | A33-V100b | A93-W103 | R71-V78 |
R52-S100a | Y32-A94 | R66-S82b | F67-M82 |
Y52b-Y97 | T87-V111 | R38-Y90 | R52-Y97 |
A33-R52 | V100b-Y100f | A93-L100h | A84-S113 |
F37-R45 | Q3-S25 | S7-G8 | R83-E85 |
G9-L120 | L11-T110 | Q13-G16 | T68-Q81 |
Q3-G26 | L4-G104 | G8-G9 | G9-G10 |
G9-T107 | G10-L11 | S7-S21 | V12-G16 |
G15-G16 | G16-S17 | A40-K43 |
Note: amino acid positions were named with reference to the Universal humanized Nanobody framework h-NbBcII10FGLA numbering (KABAT)
Note: amino acid positions are named by referring to a universal humanized nano antibody framework h-NbBcII10FGLA number (KABAT), 63 pairs of mutable sites are analyzed, amino acids existing on the surface of the antibody are selected, the mutable sites are not located in a CDR region or a loop region of the antibody, the solvent accessibility of the mutable amino acids is theoretically more than or equal to 20%, and the self-carrying disulfide bond of the antibody is not involved. Finally, 14 pairs of sites which can be mutated are selected, and the specific mutated sequences are as follows:
(1)C37H-Q13-G16:
QVQLVESGGGLVCPGCSLRLSCAASGLTFSDYAIGWFRQAPGKEREGISCIRIYDGNTYYADSVKGRFTISRDNSKNHVYLQMNSLRAEDTAVYYCAAGSYYSCSVYPAYDLDYWGKGTLVTVSS
(2)C37H-T68-Q81:
QVQLVESGGGLVQPGGSLRLSCAASGLTFSDYAIGWFRQAPGKEREGISCIRIYDGNTYYADSVKGRFCISRDNSKNHVYLCMNSLRAEDTAVYYCAAGSYYSCSVYPAYDLDYWGKGTLVTVSS
(3)C37H-Q39-R45:
QVQLVESGGGLVQPGGSLRLSCAASGLTFSDYAIGWFRCAPGKECEGISCIRIYDGNTYYADSVKGRFTISRDNSKNHVYLQMNSLRAEDTAVYYCAAGSYYSCSVYPAYDLDYWGKGTLVTVSS
(4)C37H-V12-L18:
QVQLVESGGGLCQPGGSCRLSCAASGLTFSDYAIGWFRQAPGKEREGISCIRIYDGNTYYADSVKGRFTISRDNSKNHVYLQMNSLRAEDTAVYYCAAGSYYSCSVYPAYDLDYWGKGTLVTVSS
(5)C37H-R66-S82b:
QVQLVESGGGLVQPGGSLRLSCAASGLTFSDYAIGWFRQAPGKEREGISCIRIYDGNTYYADSVKGCFTISRDNSKNHVYLQMNCLRAEDTAVYYCAAGSYYSCSVYPAYDLDYWGKGTLVTVSS
(6)C37H-S17-N82a:
QVQLVESGGGLVQPGGCLRLSCAASGLTFSDYAIGWFRQAPGKEREGISCIRIYDGNTYYADSVKGRFTISRDNSKNHVYLQMCSLRAEDTAVYYCAAGSYYSCSVYPAYDLDYWGKGTLVTVSS
(7)C37H-Q3-S25:
QVCLVESGGGLVQPGGSLRLSCAACGLTFSDYAIGWFRQAPGKEREGISCIRIYDGNTYYADSVKGRFTISRDNSKNHVYLQMNSLRAEDTAVYYCAAGSYYSCSVYPAYDLDYWGKGTLVTVSS
(8)C37H-G9-L108:
QVQLVESGCGLVQPGGSLRLSCAASGLTFSDYAIGWFRQAPGKEREGISCIRIYDGNTYYADSVKGRFTISRDNSKNHVYLQMNSLRAEDTAVYYCAAGSYYSCSVYPAYDLDYWGKGTCVTVSS
(9)C37H-E6-T107:
QVQLVCSGGGLVQPGGSLRLSCAASGLTFSDYAIGWFRQAPGKEREGISCIRIYDGNTYYADSVKGRFTISRDNSKNHVYLQMNSLRAEDTAVYYCAAGSYYSCSVYPAYDLDYWGKGCLVTVSS
(10)C37H-A84-S113:
QVQLVESGGGLVQPGGSLRLSCAASGLTFSDYAIGWFRQAPGKEREGISCIRIYDGNTYYADSVKGRFTISRDNSKNHVYLQMNSLRCEDTAVYYCAAGSYYSCSVYPAYDLDYWGKGTLVTVSC
(11)C37H-S7-G8:
QVQLVECCGGLVQPGGSLRLSCAASGLTFSDYAIGWFRQAPGKEREGISCIRIYDGNTYYADSVKGRFTISRDNSKNHVYLQMNSLRAEDTAVYYCAAGSYYSCSVYPAYDLDYWGKGTLVTVSS
(12)C37H-R83-E85:
QVQLVESGGGLVQPGGSLRLSCAASGLTFSDYAIGWFRQAPGKEREGISCIRIYDGNTYYADSVKGRFTISRDNSKNHVYLQMNSLCACDTAVYYCAAGSYYSCSVYPAYDLDYWGKGTLVTVSS
(13)C37H-L11-T110:
QVQLVESGGGCVQPGGSLRLSCAASGLTFSDYAIGWFRQAPGKEREGISCIRIYDGNTYYADSVKGRFTISRDNSKNHVYLQMNSLRAEDTAVYYCAAGSYYSCSVYPAYDLDYWGKGTLVCVSS
(14)C37H-T87-V111:
QVQLVESGGGLVQPGGSLRLSCAASGLTFSDYAIGWFRQAPGKEREGISCIRIYDGNTYYADSVKGRFTISRDNSKNHVYLQMNSLRAEDCAVYYCAAGSYYSCSVYPAYDLDYWGKGTLVTCSS
(15)C37H-Q3-G26:
QVCLVESGGGLVQPGGSLRLSCAASCLTFSDYAIGWFRQAPGKEREGISCIRIYDGNTYYADSVKGRFTISRDNSKNHVYLQMNSLRAEDTAVYYCAAGSYYSCSVYPAYDLDYWGKGTLVTVSS
in this case, the underlined region indicates the mutation site.
1.1.2 predictive analysis of H2 antibodies against Her2 targets
PDB modeling was performed on H2 antibody sequences, and analysis predicted that the H2 antibody itself had 64 pairs of amino acids available for cysteine mutation. The specific sequence of H2 and the C beta-C beta distance between 64 pairs of sites which can be mutated and the pairable sites are shown as follows:
H2:
QLQLVESGGGLVQPGGSLRLSCAASGFTLDYYAIGWFRQAPGKEREGVSCITSGGSTDYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAASHYGLRVGTLCPETYEYDYWGQGTQVTVSS
In these, the underlined parts indicate the antibody CDR regions.
64 pairs of amino acids at specific positions that can undergo disulfide bond mutation
A33-V100a | A33-R100 | R38-V48 | L4-Y102 |
S49-I69 | L2-F27 | T57-I69 | F37-R45 |
E6-T107 | R71-V78 | P41-G42 | V63-F67 |
R38-A88 | S17-N82a | T68-Q81 | M82-L82c |
T52-R100 | R66-S82b | A24-L29 | R19-Q81 |
Y59-K64 | Y32-A94 | D30-N73 | L29-N76 |
L82c-V111 | T87-V111 | R38-Y90 | I51-T57 |
Y32-S95 | P14-G15 | A33-S52a | H96-D101 |
A40-A88 | V100a-L100d | A93-H96 | H96-L99 |
I51-I69 | D58-R100 | T52-V100a | L82c-D86 |
L2-Y102 | S21-T77 | Q39-R45 | A23-T77 |
F37-V48 | V5-A23 | N82a-S82b | Q3-S25 |
S7-G8 | P84-S113 | K83-E85 | G9-Q108 |
L11-T110 | Q13-G16 | L12-V18 | G42-K43 |
Y91-G106 | W103-G104 | G104-Q105 | Q105-G106 |
G8-S21 | A24-N76 | D72-K75 | K75-T77 |
Note: amino acid positions were named with reference to the Universal humanized Nanobody framework h-NbBcII10FGLA numbering (KABAT)
Note: amino acid positions were named with reference to the Universal humanized Nanobody framework h-NbBcII10FGLA numbering (KABAT)
And analyzing 64 pairs of mutable sites, and selecting amino acids on the surface of the antibody, wherein the mutable sites are not positioned in a CDR region or a loop region of the antibody, and the self-carrying disulfide bond of the antibody is not involved. The solvent accessibility of the mutant amino acid is equal to or more than 20% theoretically, 20 pairs of sites which can be mutated are finally selected, and the specific mutated sequences are as follows:
(1)H2-Q39-R45:
QLQLVESGGGLVQPGGSLRLSCAASGFTLDYYAIGWFRCAPGKECEGVSCITSGGSTDYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAASHYGLRVGTLCPETYEYDYWGQGTQVTVSS
(2)H2-R66-S82b:
QLQLVESGGGLVQPGGSLRLSCAASGFTLDYYAIGWFRQAPGKEREGVSCITSGGSTDYADSVKGCFTISRDNAKNTVYLQMNCLKPEDTAVYYCAASHYGLRVGTLCPETYEYDYWGQGTQVTVSS
(3)H2-Q3-S25:
QLCLVESGGGLVQPGGSLRLSCAACGFTLDYYAIGWFRQAPGKEREGVSCITSGGSTDYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAASHYGLRVGTLCPETYEYDYWGQGTQVTVSS
(4)H2-S7-G8:
QLQLVECCGGLVQPGGSLRLSCAASGFTLDYYAIGWFRQAPGKEREGVSCITSGGSTDYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAASHYGLRVGTLCPETYEYDYWGQGTQVTVSS
(5)H2-P84-S113:
QLQLVESGGGLVQPGGSLRLSCAASGFTLDYYAIGWFRQAPGKEREGVSCITSGGSTDYADSVKGRFTISRDNAKNTVYLQMNSLKCEDTAVYYCAASHYGLRVGTLCPETYEYDYWGQGTQVTVSC
(6)H2-K83-E85:
QLQLVESGGGLVQPGGSLRLSCAASGFTLDYYAIGWFRQAPGKEREGVSCITSGGSTDYADSVKGRFTISRDNAKNTVYLQMNSLCPCDTAVYYCAASHYGLRVGTLCPETYEYDYWGQGTQVTVSS
(7)H2-G9-Q108:
QLQLVESGCGLVQPGGSLRLSCAASGFTLDYYAIGWFRQAPGKEREGVSCITSGGSTDYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAASHYGLRVGTLCPETYEYDYWGQGTCVTVSS
(8)H2-T68-Q81:
QLQLVESGGGLVQPGGSLRLSCAASGFTLDYYAIGWFRQAPGKEREGVSCITSGGSTDYADSVKGRFCISRDNAKNTVYLCMNSLKPEDTAVYYCAASHYGLRVGTLCPETYEYDYWGQGTQVTVSS
(9)H2-L11-T110:
QLQLVESGGGCVQPGGSLRLSCAASGFTLDYYAIGWFRQAPGKEREGVSCITSGGSTDYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAASHYGLRVGTLCPETYEYDYWGQGTQVCVSS
(10)H2-S17-N82a:
QLQLVESGGGLVQPGGCLRLSCAASGFTLDYYAIGWFRQAPGKEREGVSCITSGGSTDYADSVKGRFTISRDNAKNTVYLQMCSLKPEDTAVYYCAASHYGLRVGTLCPETYEYDYWGQGTQVTVSS
(11)H2-T87-V111:
QLQLVESGGGLVQPGGSLRLSCAASGFTLDYYAIGWFRQAPGKEREGVSCITSGGSTDYADSVKGRFTISRDNAKNTVYLQMNSLKPEDCAVYYCAASHYGLRVGTLCPETYEYDYWGQGTQVTCSS
(12)H2-E6-T107:
QLQLVCSGGGLVQPGGSLRLSCAASGFTLDYYAIGWFRQAPGKEREGVSCITSGGSTDYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAASHYGLRVGTLCPETYEYDYWGQGCQVTVSS
(13)H2-Q13-G16:
QLQLVESGGGLVCPGCSLRLSCAASGFTLDYYAIGWFRQAPGKEREGVSCITSGGSTDYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAASHYGLRVGTLCPETYEYDYWGQGTQVTVSS
(14)H2-V12-L18:
QLQLVESGGGLCQPGGSCRLSCAASGFTLDYYAIGWFRQAPGKEREGVSCITSGGSTDYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAASHYGLRVGTLCPETYEYDYWGQGTQVTVSS
(15)H2-N82a-S82b:
QLQLVESGGGLVQPGGSLRLSCAASGFTLDYYAIGWFRQAPGKEREGVSCITSGGSTDYADSVKGRFTISRDNAKNTVYLQMCCLKPEDTAVYYCAASHYGLRVGTLCPETYEYDYWGQGTQVTVSS
(16)H2-P41-G42:
QLQLVESGGGLVQPGGSLRLSCAASGFTLDYYAIGWFRQCCGKEREGVSCITSGGSTDYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAASHYGLRVGTLCPETYEYDYWGQGTQVTVSS
(17)H2-P14-G15:
QLQLVESGGGLVQCCGSLRLSCAASGFTLDYYAIGWFRQAPGKEREGVSCITSGGSTDYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAASHYGLRVGTLCPETYEYDYWGQGTQVTVSS
(18)H2-V5-A23:
QLQLCESGGGLVQPGGSLRLSCCASGFTLDYYAIGWFRQAPGKEREGVSCITSGGSTDYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAASHYGLRVGTLCPETYEYDYWGQGTQVTVSS
(19)H2-A23-T77:
QLQLVESGGGLVQPGGSLRLSCCASGFTLDYYAIGWFRQAPGKEREGVSCITSGGSTDYADSVKGRFTISRDNAKNCVYLQMNSLKPEDTAVYYCAASHYGLRVGTLCPETYEYDYWGQGTQVTVSS
(20)H2-R19-Q81:
QLQLVESGGGLVQPGGSLCLSCAASGFTLDYYAIGWFRQAPGKEREGVSCITSGGSTDYADSVKGRFTISRDNAKNTVYLCMNSLKPEDTAVYYCAASHYGLRVGTLCPETYEYDYWGQGTQVTVSS
in this case, the underlined region indicates the mutation site.
1.1.3 predictive analysis of the 109 antibody against the PD-L1 target
PDB modeling was performed on the 109 antibody sequence, and analysis predicted that the 109 antibody itself had 59 pairs of amino acids available for cysteine mutation. 109, and 59 pairs of sites that can be mutated and the distance between the mateable sites, C β -C β, are as follows:
109:
QVQLQESGGGSVQAGGSLRLSCTASGFSLDDSDMGWYRQARGNVCQLVSTIASDRSTYYTPSVKGRFTISHDRAKNTIYLQMNSLKPEDTAVYYCAAAPRLAYTTAMTCEGDFAYWGQGTQVTVSS
among them, underlined portions indicate antibody CDR regions.
59 specific positions of amino acids which can be subjected to disulfide bond mutation
Note: amino acid positions are named by referring to the numbering of a universal humanized nano antibody framework h-NbBcII10FGLA
Note: amino acid positions are named by referring to the numbering of a universal humanized nano antibody framework h-NbBcII10FGLA
And analyzing the 59 pairs of mutable sites, selecting amino acids on the surface of the antibody, wherein the mutable sites are not positioned in a CDR region or a loop region of the antibody, the solvent accessibility of the mutable amino acids is not less than 20% theoretically, and the self-carrying disulfide bonds of the antibody are not involved. Finally, 14 pairs of sites which can be mutated are selected, and the specific mutated sequences are as follows:
(1)109-R66-S82b:
QVQLQESGGGSVQAGGSLRLSCTASGFSLDDSDMGWYRQARGNVCQLVSTIASDRSTYYTPSVKGCFTISHDRAKNTIYLQMNCLKPEDTAVYYCAAAPRLAYTTAMTCEGDFAYWGQGTQVTVSS
(2)109-Q3-S25:
QVCLQESGGGSVQAGGSLRLSCTACGFSLDDSDMGWYRQARGNVCQLVSTIASDRSTYYTPSVKGRFTISHDRAKNTIYLQMNSLKPEDTAVYYCAAAPRLAYTTAMTCEGDFAYWGQGTQVTVSS
(3)109-S7-G8:
QVQLQECCGGSVQAGGSLRLSCTASGFSLDDSDMGWYRQARGNVCQLVSTIASDRSTYYTPSVKGRFTISHDRAKNTIYLQMNSLKPEDTAVYYCAAAPRLAYTTAMTCEGDFAYWGQGTQVTVSS
(4)109-P84-S113:
QVQLQESGGGSVQAGGSLRLSCTASGFSLDDSDMGWYRQARGNVCQLVSTIASDRSTYYTPSVKGRFTISHDRAKNTIYLQMNSLKCEDTAVYYCAAAPRLAYTTAMTCEGDFAYWGQGTQVTVSC
(5)109-K83-E85:
QVQLQESGGGSVQAGGSLRLSCTASGFSLDDSDMGWYRQARGNVCQLVSTIASDRSTYYTPSVKGRFTISHDRAKNTIYLQMNSLCPCDTAVYYCAAAPRLAYTTAMTCEGDFAYWGQGTQVTVSS
(6)109-G9-Q108:
QVQLQESGCGSVQAGGSLRLSCTASGFSLDDSDMGWYRQARGNVCQLVSTIASDRSTYYTPSVKGRFTISHDRAKNTIYLQMNSLKPEDTAVYYCAAAPRLAYTTAMTCEGDFAYWGQGTCVTVSS
(7)109-S11-T110:
QVQLQESGGGCVQAGGSLRLSCTASGFSLDDSDMGWYRQARGNVCQLVSTIASDRSTYYTPSVKGRFTISHDRAKNTIYLQMNSLKPEDTAVYYCAAAPRLAYTTAMTCEGDFAYWGQGTQVCVSS
(8)109-T87-V111:
QVQLQESGGGSVQAGGSLRLSCTASGFSLDDSDMGWYRQARGNVCQLVSTIASDRSTYYTPSVKGRFTISHDRAKNTIYLQMNSLKPEDCAVYYCAAAPRLAYTTAMTCEGDFAYWGQGTQVTCSS
(9)109-E6-T107:
QVQLQCSGGGSVQAGGSLRLSCTASGFSLDDSDMGWYRQARGNVCQLVSTIASDRSTYYTPSVKGRFTISHDRAKNTIYLQMNSLKPEDTAVYYCAAAPRLAYTTAMTCEGDFAYWGQGCQVTVSS
(10)109-Q13-G16:
QVQLQESGGGSVCAGCSLRLSCTASGFSLDDSDMGWYRQARGNVCQLVSTIASDRSTYYTPSVKGRFTISHDRAKNTIYLQMNSLKPEDTAVYYCAAAPRLAYTTAMTCEGDFAYWGQGTQVTVSS
(11)109-V12-L18:
QVQLQESGGGSCQAGGSCRLSCTASGFSLDDSDMGWYRQARGNVCQLVSTIASDRSTYYTPSVKGRFTISHDRAKNTIYLQMNSLKPEDTAVYYCAAAPRLAYTTAMTCEGDFAYWGQGTQVTVSS
(12)109-T68-Q81:
QVQLQESGGGSVQAGGSLRLSCTASGFSLDDSDMGWYRQARGNVCQLVSTIASDRSTYYTPSVKGRFCISHDRAKNTIYLCMNSLKPEDTAVYYCAAAPRLAYTTAMTCEGDFAYWGQGTQVTVSS
(13)109-S17-N82a:
QVQLQESGGGSVQAGGCLRLSCTASGFSLDDSDMGWYRQARGNVCQLVSTIASDRSTYYTPSVKGRFTISHDRAKNTIYLQMCSLKPEDTAVYYCAAAPRLAYTTAMTCEGDFAYWGQGTQVTVSS
(14)109-R41-G42:
QVQLQESGGGSVQAGGSLRLSCTASGFSLDDSDMGWYRQACCNVCQLVSTIASDRSTYYTPSVKGRFTISHDRAKNTIYLQMNSLKPEDTAVYYCAAAPRLAYTTAMTCEGDFAYWGQGTQVTVSS
in which the underlined section marks the mutation site.
1.2. Analysis summarizes all amino acid positions located in the FR region that may be subject to mutation pairing
Analysis of three representative antibodies against the three targets selected above, along with analysis of other nanobody sequences (sequences not disclosed in this patent), resulted in the amino acid positions listed in table 1 in the FR region of the antibody that could be mutated to cysteine and disulfide-paired. In theory, all amino acids located in the FR region can undergo disulfide bond pairing, with only the steric positions being appropriate. If it is considered that the disulfide bond formed after mutation is located on the surface of the antibody to facilitate reduction, conjugation, etc., the solvent accessibility of the amino acid selected for mutation should be not less than 20%. The ASA% values for the amino acids in the FR region of the nanobody are shown in Table 2.
TABLE 1 amino acids that can be mutated and paired in the FR regions of Nanobody
3(Q)-25(S) | 39(Q)-45(R/C/L/H) |
7(S)-8(G) | 41(P/R/A)-42(G) |
9(G)-108(Q/L/H) | 66(R/E)-82b(S/N/T/R/D/Y) |
11(L/S)-110(T) | 68(T/V/A)-81(Q/E/N) |
12(V/G)-18(L) | 83(R/K/Q/S/T/E)-85(E/D) |
13(Q/R)-16(G) | 84(M/P/A)-113(S) |
14(A/P/S)-113(S) | 87(T/A/L)-111(V/D) |
17(S)-82a(N/L/D) |
TABLE 2 amino acid solvent accessibility ASA% in the FR region of the Nanobody%
FR region amino acid solvent accessibility analysis is carried out on three representative nano antibodies of three targets, and the universality is found, for example, if the solvent accessibility of a certain amino acid in one nano antibody is less than 20%, the solvent accessibility of the amino acid at the same site in other nano antibodies is also less than 20% in a large probability, so that theoretically, the amino acid capable of combined mutation can be obtained through the value of the solvent accessibility ASA% and the spatial distance of the amino acid.
1.3. Plasmid construction of antibody for confirming mutation site
Through early analysis of three antibodies related to three targets, C37H antibody co-selection 14 of the CD8 alpha target is used for constructing a mutant antibody, H2 antibody co-selection 20 of the Her2 target is used for constructing the mutant antibody, and antibody 109 co-selection 14 of the PD-L1 target is used for constructing the antibody. Corresponding primers are respectively designed aiming at the mutation sites of the mutated antibodies, the nucleotide sequences of the antibodies are amplified by PCR by taking antibody bacteria liquid before mutation as a template, and then the antibodies are respectively cloned into PSNA008 [ pCDNA4 (Invitrogen, cat V86220) ] vectors, and the correctness of the obtained target clone gene sequences is determined by gene sequence determination, so that the subsequent experiments are promoted.
2. Mutant antibody expression and in vitro characterization
2.1. Production of post-mutation antibody proteins using mammalian cells
And subcloning a coding sequence of the single-domain antibody obtained by correct sequencing analysis into an expression vector, and transfecting HEK293 cells for antibody expression. Diluting the recombinant expression plasmid with Freestyle293 medium and adding PEI (Polyethylenimine) solution required for transformation, adding the plasmid/PEI mixture separately to the HEK293 cell suspension, standing at 37 deg.C, 8% CO 2 Cultivation at 90 rpm. After four hours, the cells were supplemented with EX293 medium and cultured at 110 rpm. The next day VPA was added. After 6-7 days of culture, transient expression culture supernatant is collected and purified by corresponding fillers. Finally obtaining the antibody protein with the purity of more than 90 percent.
2.2. Detection of post-mutation antibody affinity by ELISA method
2.2.1 detection of binding of antibodies to CD8 alpha antigen after C37H mutation
The CD8 alpha-Fc protein is obtained by HEK293 transient expression and proteinA affinity chromatography purification. The resulting CD 8. Alpha. -Fc protein was diluted to 5ug/mL,100 uL/well was added to the ELISA plate, and coated overnight at 4 ℃. Discard the coating night the next day, add Blocking Buffer (3% BSA) for Blocking, add sample after Blocking, dilute each antibody after C37H control and mutation to 50ug/mL with 1ng/mL C37-chs in 1% BSA, dilute to 11 concentrations in 4-fold gradient, react at 37 ℃ for 1 hour. After washing, rb pAb to 6 × His tag (HRP) was added, diluted 10000-fold with 1% BSA, and reacted at 37 ℃ for 1 hour. After washing, a developing solution is added, and the absorption value is read at the wavelength of 450 nm. Data processing and mapping analysis are carried out by using software SotfMaxPro 6.5.1, a binding curve and an EC50 value of the antibody to CD8 alpha are obtained through four-parameter fitting, and the affinity capacity of the modified antibody to the CD8 alpha is reflected by taking the EC50 value of the C37H antibody before modification as a standard.
TABLE 3 ELISA results for CD8 alpha binding of sequences after C37H engineering
Name (R) | EC50(ng/mL) | Relative Activity (%) |
C37H (Standard) | 60.68 | 100 |
C37H-Q3-S25 | 93.03 | 66 |
C37H-S7-G8 | 50.34 | 122 |
C37H-E6-T107 | 86.85 | 71 |
C37H (Standard) | 64.92 | 100 |
C37H-Q39-R45 | 80.26 | 86 |
C37H-Q13-G16 | 62.48 | 103 |
C37H-V12-L18 | 64.43 | 99 |
C37H (Standard) | 77.64 | 100 |
C37H-R66-S82b | 76.53 | 96 |
C37H-A84-S113 | 67.36 | 121 |
C37H-R83-E85 | 84.03 | 95 |
C37H (Standard) | 57.02 | 100 |
C37H-T87-V111 | 52.43 | 108 |
C37H-Q3-G26 | 117 | 48 |
C37H (Standard) | 5.094 | 100 |
C37H-L11-T110 | 3.133 | 163 |
C37H (Standard) | 9.389 | 100 |
C37H-G9-L108 | 8.376 | 121.1 |
Note: ELISA detection only has partial data result, and target protein is not obtained due to too low expression level of the antibody after partial modification in the expression process
2.2.2 detection of binding of antibodies to Her2 antigen after H2 mutagenesis
The Her2-Fc protein is obtained by HEK293 transient expression and proteinA affinity chromatography purification. The resulting Her2-Fc protein was diluted to 1ug/mL,100 uL/well added to the ELISA plate and coated overnight at 4 ℃. The coating solution was discarded the next day, blocking was performed by adding Blocking Buffer (3% BSA), the sample was added after Blocking, and each of the H2 control and the post-mutation antibody was diluted to 50ug/mL with 20ng/mL H2-chs in 1% BSA, and 3-fold gradient dilution was performed to 11 concentrations, and the reaction was performed at 37 ℃ for 1 hour. After washing, rb pAb to 6 × His tag (HRP) was added, diluted 10000-fold with 1% BSA, and reacted at 37 ℃ for 1 hour. After washing, a developing solution is added, and the absorption value is read at the wavelength of 450 nm. Data processing and mapping analysis are carried out by using software SotfMaxPro 6.5.1, a binding curve and an EC50 value of the antibody to Her2 are obtained through four-parameter fitting, and the affinity of the modified antibody to Her2 is reflected by taking the EC50 value of the H2 antibody before modification as a standard.
TABLE 4 ELISA results for Her2 binding of sequences after H2 engineering
Name (R) | EC50(ng/mL) | Relative Activity (%) |
H2 (Standard sample) | 92.69 | 100 |
H2-Q39-R45 | 509.1 | 18.2 |
H2-L11-T110 | 57.59 | 160.9 |
H2 (Standard sample) | 128.7 | 100 |
H2-T87-V111 | 106.6 | 120.7 |
H2-E6-T107 | 104.4 | 123.3 |
H2-Q13-G16 | 119.6 | 107.7 |
H2 (Standard sample) | 114.0 | 100 |
H2-P41-G42 | 95.85 | 118.9 |
H2-P14-G15 | 77.06 | 147.9 |
H2-A23-T77 | 76.53 | 148.9 |
H2 (Standard sample) | 933.4 | 100 |
H2-K83-E85 | 888.9 | 105 |
H2-P84-S113 | 613.1 | 152.2 |
H2-R66-S82b | 1514 | 61.6 |
H2 (Standard sample) | 90.16 | 100 |
H2-V12-L18 | 104.4 | 86.4 |
H2-G9-Q108 | 61.48 | 146.7 |
H2-Q3-S25 | 127.7 | 70.6 |
H2 (Standard sample) | 96.81 | 100 |
H2-S7-G8 | 141.7 | 68.3 |
Note: ELISA detection only has partial data result, and because the expression level of the antibody is too low after partial modification in the expression process, the target protein is not obtained
2.2.3 detection of binding of 109 mutated antibody to PD-L1 antigen
The PD-L1-Fc protein is obtained by HEK293 transient expression and proteinA affinity chromatography purification. The resulting PD-L1-Fc protein was diluted to 0.5ug/mL,50 uL/well was added to the ELISA plate, and coated overnight at 4 ℃. The coating solution was discarded the next day, blocking was performed by adding Blocking Buffer (3% BSA), the sample was added after Blocking, 109 control and after mutation, each antibody was diluted to 80ug/mL with 0.05ug/mL 109-chs in 1% BSA, diluted to 12 concentrations by 3-fold gradient, and reacted at 37 ℃ for 2 hours. After washing, rb pAb to 6 × His tag (HRP) was added, diluted 10000-fold with 1% BSA, and reacted at 37 ℃ for 1 hour. After washing, a developing solution is added, and the absorption value is read at the wavelength of 450 nm. Data processing and mapping analysis are carried out by using software SotfMaxPro 6.5.1, a binding curve and an EC50 value of the antibody to PD-L1 are obtained through four-parameter fitting, and the affinity capability of the modified antibody to PD-L1 is reflected by taking the EC50 value of the 109 antibody before modification as a standard.
TABLE 5 ELISA results for PD-L1 binding of the engineered antibodies
Name (R) | EC50(ng/mL) | Relative Activity (%) |
109 (Standard sample) | 548.7 | 100 |
109-K83-E85 | 709.1 | 77.4 |
109-P84-S113 | 514.4 | 106.7 |
109-V12-L18 | 581.3 | 94.4 |
109 (Standard sample) | 499.0 | 100 |
109-Q13-G16 | 505.8 | 98.7 |
109-R66-S82b | 950.5 | 52.5 |
109-S7-G8 | 434.6 | 114.8 |
109 (Standard sample) | 429.4 | 100 |
109-Q3-S25 | 313.7 | 136.9 |
109 (Standard sample) | 600.9 | 100 |
109-G9-Q108 | 811.1 | 74.1 |
109-S11-T110 | 443.4 | 135.5 |
109-T87-V111 | 473.7 | 126.8 |
Note: ELISA detection only has partial data result, and because the expression level of the antibody is too low after partial modification in the expression process, the target protein is not obtained
Through ELISA affinity detection of the modified antibodies of the three target points, the results show that the affinity of most of the modified antibodies of the three target points is not obviously reduced compared with that of the antibodies before modification, which indicates that the modified antibodies still keep good combination with the corresponding target point antigens, and also laterally proves that the selected mutation sites are representative, thereby providing a powerful basis for the application of cysteine mutation platforms on the surfaces of the antibodies.
2.3. SEC-HPLC and SDS-PAGE methods are adopted to detect the purity of the mutated antibody
The antibody was adjusted to an appropriate concentration with 1 XPBS (pH 7.4) and purity was checked by SEC-HPLC and SDS-PAGE, respectively. The detection methods of the related modified antibodies of the three targets are the same. SEC-HPLC adopts a chromatographic column of BioCoreSEC-150 to carry out detection, a protective column with corresponding specification is required to be matched, automatic integration is carried out according to a peak pattern diagram after the detection is finished, manual integration is carried out if the conditions of low separation degree or baseline disorder and the like occur, and after blank is deducted, the purity of the sample is calculated by an area normalization method (A%).
SDS-PAGE detection samples were treated with a non-returning buffer (containing no reducing agent) for the purpose of antibody (monomer) purity detection. The preparation method comprises the steps of selecting prefabricated gel (M00719) with 15% of Kinry concentration, loading about 10ug of each sample, dyeing the gel with Coomassie brilliant blue dyeing solution after the gel is run, and decolorizing until the bands are clearly visible. And finally, analyzing a target band and a miscellaneous band of the same antibody respectively by using related software to obtain an IntDen value of each band, wherein the percentage of the IntDen values of the target band in all the bands is the monomer purity of the antibody. Because the IntDen value of each band is obtained after manually framing the band, the method may have certain errors, but does not influence the analysis on whether a polymer is formed in the antibody re-expression process. Meanwhile, the comprehensive comparison can be carried out by referring to the result of SEC-HPLC.
The results are shown in tables 5-7, which directly show the percentage of each antibody monomer, e.g., the presence of a polymer, which can be removed during downstream purification.
TABLE 6 SEC-HPLC and SDS-PAGE detection of monomer purity of C37H engineered antibodies
TABLE 7 SEC-HPLC and SDS-PAGE detection of H2 engineered antibody monomer purity
Name of antibody | Percent monomer (SEC-HPLC) | Percent monomer (SDS-PAGE) |
H2-Q39-R45 | 100% | 100% |
H2-R66-S82b | 100% | 100% |
H2-S7-G8 | 100% | 100% |
H2-P84-S113 | 100% | 53% |
H2-T87-V111 | 100% | 100% |
H2-E6-T107 | 100% | 100% |
H2-Q13-G16 | 100% | 100% |
H2-P41-G42 | 98.63% | 100% |
H2-P14-G15 | 97.48% | 100% |
H2-A23-T77 | 100% | 100% |
H2-V12-L18 | 100% | 100% |
H2-K83-E85 | 68% | 64% |
H2-G9-Q108 | 48% | 53% |
H2-Q3-S25 | 57% | 50.4% |
H2-L11-T110 | 47% | 57% |
TABLE 8 SEC-HPLC and SDS-PAGE detection 109 engineered antibody monomer purity
The SEC-HPLC and SDS-PAGE are respectively carried out on the modified antibodies of the three targets to detect the purity (monomer content) of the antibodies, and the results show that most of the modified antibodies of the three targets exist in a monomer form after expression, and individual antibodies form polymers in the expression process (can be optimally removed in the later purification process). Lays a foundation for the smooth operation of the antibody post-coupling process and the application of the surface cysteine mutation platform.
2.4. Detection of antibody expression level after mutation
The expression amount detection adopts one-step affinity purification, and then the expression amount of the antibody is evaluated by calculating the obtained protein amount and the purified sample volume. Transient transfection expression of each antibody was consistent with the method mentioned in 2.1. After transient conversion, cell culture supernatant is collected and subjected to one-step affinity purification through protein A, the eluted target protein is subjected to A280 light absorption value detection, the extinction coefficient of each corresponding modified antibody is divided, the final antibody concentration is obtained, and the final protein amount is calculated through respective elution volumes, so that the expression amount of each antibody is evaluated. Because the cell state may be different at each transient transformation and there is some error in the purification process, the expression level will fluctuate in a small range, which is a normal phenomenon, and the antibody with low expression level can be improved by the late transient transformation optimization. Tables 9-11 show the expression levels (calculated as the results of one-shot purification) of the respective modified antibodies.
TABLE 9 expression levels of each of the modified antibodies of C37H
Name of antibody | Amount of expression (mg/L) | Name of antibody | Amount of expression (mg/L) |
C37H-V12-L18 | 10.8 | C37H-Q13-G16 | 12.4 |
C37H-A84-S113 | 8.4 | C37H-Q3-S25 | 3.4 |
C37H-E6-T107 | 2.2 | C37H-Q3-G26 | 3.0 |
C37H-S7-G8 | 5.1 | C37H-R83-E85 | 2.0 |
C37H-R66-S82b | 9.2 | C37H-G9-L108 | 0.9 |
C37H-T87-V111 | 4.1 | C37H-Q39-R45 | 57 |
C37H-L11-T110 | 4.4 |
TABLE 10 109 expression levels of each of the engineered antibodies
TABLE 11 expression levels of each of the engineered antibodies to H2
Name of antibody | Amount of expression (mg/L) | Name of antibody | Amount of expression (mg/L) |
H2-Q39-R45 | 22.2 | H2-P41-G42 | 15.5 |
H2-R66-S82b | 16.4 | H2-P14-G15 | 5.4 |
H2-S7-G8 | 30.8 | H2-A23-T77 | 11.2 |
H2-P84-S113 | 9.7 | H2-V12-L18 | 5.3 |
H2-L11-T110 | 30.7 | H2-K83-E85 | 3.9 |
H2-T87-V111 | 10.1 | H2-G9-L108 | 28.3 |
H2-E6-T107 | 3.7 | H2-Q3-S25 | 26.8 |
H2-Q13-G16 | 22.8 |
2.5. Mass spectrometric characterisation of post-mutation antibody molecular weight
Because the surface amino acids selected by each antibody form corresponding disulfide bonds after cysteine mutation, and in order to detect whether the disulfide bonds are mismatched in the pairing process, each antibody adopts a mass spectrometry method to detect the complete molecular weight, and the actually measured molecular weight is compared with the theoretical molecular weight to evaluate whether the disulfide bonds are mismatched in the forming process. The actual molecular weight is matched with the theoretical molecular weight, so the specific results are not shown in detail.
2.6. Analysis of degree of solvent Exposure in mutant site ASA%
To further explore the effect of different amino acids on disulfide bond formation after mutation, we calculated the ratio of exposure of each mutated amino acid to the accessible surface of the protein solvent by correlation software, with 20% as the boundary, the higher the ASA%, the higher the exposure and the lower the degree of deregulation. And the amino acid with high exposure degree is selected for mutation, so that the disulfide bond on the surface of the antibody is more easily formed theoretically, and the reduction and the like in the later coupling process are facilitated.
2.7. Summary of in vitro characterization results of mutant antibodies
Through analysis of in vitro characterization results of each mutant antibody, the content of antibody monomers after mutation is defined to be more than or equal to 95%, the biological activity (relative activity) is more than or equal to 70%, the expression amount is more than or equal to 5mg/L, the solvent exposure degree ASA% is more than or equal to 20%, the measured molecular weight is consistent with the theoretical molecular weight, if the above criteria are met, the mutant antibody is a preferred antibody, the mutant site is a preferred site, otherwise, the mutant antibody is not an optimal antibody or an optimal mutant site. The specific results are shown in tables 12-14.
TABLE 12 summary of in vitro characterization results for each of the modified antibodies of C37H
Note: a marks the standard to reach the set standard, B marks the standard to not reach the set standard, C marks the poor characterization result
TABLE 13 summary of in vitro characterization results for each of the engineered antibodies
Note: a marks the standard to reach the set standard, B marks the standard to not reach the set standard, C marks the poor characterization result
TABLE 14 summary of in vitro characterization results for each of the engineered antibodies for H2
Note: a marks the standard to reach the set standard, B marks the standard to not reach the set standard, C marks the poor characterization result
The results show that most of the in vitro characterization results of the mutated antibodies can reach the set standard, the individual characterization results (such as expression quantity, monomer content and the like) of part of the mutated antibodies can not reach the set standard, and the related processes can be optimized and improved in the later period. The versatility and operability of the amino acid sites we have chosen are also reflected laterally.
3. Mutant antibody conjugation and characterization
"chelating agent", also referred to herein as a conjugated small molecule linker, generally refers to an organic molecule capable of forming a complex with a metal ion. Chelators are commonly used to label proteins or peptides. The end product of the metal ion conjugate is used for radioimmunoassay, radioimmunotherapy, magnetic resonance imaging, photodynamic therapy or other similar modalities. Chelating agents are of many kinds, such as DTPA (diethylenetriamine pentaacetic anhydride) and its derivatives, NOTA (1, 4, 7-triazacyclononane-N, N ', N "-triacetic acid) and its derivatives such as NODA-GA (NODAGA), maleimide-NODAA, DOTA (1, 4,7, 10-tetraazacyclododecane-N, N ', N", N ' "-tetraacetic acid) (binding radioactive metal ions) and its derivatives, TETA (1, 4,8, 11-tetraazacyclotetradecane-N, N ', N", N ' "-tetraacetic acid) and its derivatives, DTTA (N- (p-isothiocyanatobenzyl) -diethylenetriamine-N, N ', N", N ' "-tetraacetic acid). These and other chelating agents are readily available from commercial sources. The chelating agent for antibody coupling is conventional and universal, and has no other special modification. In addition, in addition to the selection of organic molecules capable of forming complexes with metal ions for conjugation, the present invention also selects covalent linkers (linkers) and cytotoxic small molecule loads (planoads) commonly used for ADC (Antibody-drug conjugates) drugs for conjugation, such as GGFG-DXD, CLA-SN38, or the like, based on GGFG tetrapeptide linkers. Wherein DXD and SN38 are topoisomerase I inhibitors.
3.1C 37H mutant conjugation and characterization
3.1.1 C37H mutant coupled NODA-GA
According to the reasons of affinity detection and antibody self-expression amount of the modified antibody in the early stage, the antibody protein after partial C37H mutation is selected to be uniformly mixed with TCEP (tris (2-carboxyethyl) phosphine) reducing agent in a molar ratio of 1.
3.1.2 Characterization detection of C37H mutant after coupling NODA-GA
And respectively carrying out ELISA (enzyme-linked immuno sorbent assay) affinity detection on the coupled antibodies to determine that the coupled antibodies do not lose biological activity. SEC-HPLC is used for determining whether the coupled antibody exists in a monomer form, and LC-MS and RP-SPLE are used for detecting the molecular weight of the coupled antibody, so as to calculate the DAR value of the coupled antibody, whether the coupling is successful and the like. The specific detection results are as follows:
TABLE 15 ELISA detection of CD8 alpha binding of antibodies after NODA-GA conjugation
TABLE 16 LC-MS detection of antibody molecular weight and DAR value after NODA-GA coupling
TABLE 17 detection of antibody coupling ratio and monomer ratio after NODA-GA coupling by RP-HPLC and SEC-HPLC
3.1.3 Summary of characterization results after C37H mutant coupling to NODA-GA
By analyzing the characterization result of the coupled antibody, the evaluation standard of the coupled antibody is defined as that the proportion of unconjugated protein is less than or equal to 10 percent, the proportion of DAR2/4 after coupling is more than or equal to 50 percent, the coupling rate is more than or equal to 90 percent, the proportion of monomers after coupling is more than or equal to 90 percent, and the biological activity of the coupled antibody is more than or equal to 70 percent (compared with that before coupling), and if the above standards are met, the mutation site of the antibody is the preferred site, the disulfide bond after mutation can be reduced and opened, and the antibody after reduction can be completely coupled.
TABLE 18 summary of characterization results after conjugation of various engineered antibodies to NODA-GA for C37H
Note: the mark A is up to the set standard, the mark B is not up to the set standard, and the mark C is poor in characterization result
Wherein, the two antibodies of the E6-T107 and T87-V111 combination can normally form disulfide bonds after mutation and carry out conventional transient expression to obtain proteins, which indicates that the spatial positions of the two E6-T107 and T87-V111 combinations are proper, so that disulfide bonds can be formed after mutation. However, the data after coupling is poor, the affinity after E6-T119 coupling is reduced by one time, and the coupling rate of T87-V111 is lower and is between 30% and 40% (from Table 2, the solvent accessibility ASA% of E6 and V111 is less than 20%). From this, it is understood that if the antibody after modification is subjected to further operations such as coupling, the spatial distance of the amino acids and the degree of exposure of the amino acids (solvent accessibility) should satisfy the requirements.
3.1.4 C37H mutant coupling GGFG-Dxd
According to the characterization result of a coupling small molecule chelating agent NODA-GA, the self affinity and the protein expression quantity of the modified antibody and other conditions, antibody protein after partial C37H mutation is selected to be uniformly mixed with TCEP (tris (2-carboxyethyl) phosphine) reducing agent in a molar ratio of 1.
3.1.5 Characterization and detection of C37H mutant after coupling GGFG-Dxd
And respectively carrying out ELISA affinity detection on the coupled antibodies to determine that the coupled antibodies do not lose biological activity. And simultaneously performing RP-HPLC and SEC-HPLC to detect the coupling rate and the monomer ratio of the coupled antibody, and detecting the molecular weight of the coupled antibody by LC-MS to calculate the DAR value of the coupled antibody, whether the coupling is successful or not and the like. The specific detection results are as follows:
TABLE 19 ELISA for detection of binding of antibodies to CD8 alpha after conjugation to GGFG-Dxd
TABLE 20 LC-MS measurement of antibody molecular weight and DAR value following GGFG-Dxd conjugation
TABLE 21 RP-HPLC and SEC-HPLC for detecting antibody coupling GGFG-Dxd rate and monomer ratio
Name of antibody | Coupling Rate% (RP-HPLC) | Percent monomer (SEC-HPLC) |
C37H-Q3-S25 | 33.57 | 58.18 |
C37H-L11-T110 | 65.06 | 85.01 |
3.1.6 Characterization of binding summary after C37H mutant conjugation to GGFG-Dxd
By analyzing the characterization result of the coupled antibody, the evaluation standard of the coupled antibody is defined as that the proportion of unconjugated protein is less than or equal to 10 percent, the proportion of DAR2/4 after coupling is more than or equal to 50 percent, the coupling rate is more than or equal to 90 percent, the proportion of monomers after coupling is more than or equal to 90 percent, and the biological activity of the coupled antibody is more than or equal to 70 percent (compared with that before coupling), and if the above standards are met, the mutation site of the antibody is the preferred site, the disulfide bond after mutation can be reduced and opened, and the antibody after reduction can be completely coupled.
TABLE 22 summary of characterization results after conjugation of C37H modified antibodies to GGFG-Dxd
Note: the mark A is up to the set standard, the mark B is not up to the set standard, and the mark C is poor in characterization result
The results of the combined ELISA and LC-MS data show that most of the mutant antibodies meeting the conditions have no loss of biological activity or basically remain in a reasonable controllable range compared with the mutant antibodies before coupling after coupling, most of the mutant antibodies can be successfully coupled with two small molecules (NODAGA or GGFG-Dxd) by analyzing the molecular weight of the antibodies before and after coupling, and the partially incompletely coupled antibodies (the mixture of naked antibodies and DAR1 or DAR2 antibodies exists at the same time) can be completely coupled into DAR2 antibodies after deeply optimizing the coupling conditions.
3.2 H2 mutant coupling and characterization
3.2.1 H2 mutant coupling Mal-DOTA
According to the reasons of affinity detection and antibody self-expression amount of the modified antibody in the early stage, the antibody protein after partial H2 mutation is selected to be uniformly mixed with TCEP (tris (2-carboxyethyl) phosphine) reducing agent in a molar ratio of 1.
3.2.2 Characterization detection after coupling of H2 mutant with Mal-DOTA
And respectively carrying out ELISA (enzyme-linked immuno sorbent assay) affinity detection on the coupled antibodies to determine that the coupled antibodies do not lose biological activity. And (3) analyzing and evaluating the coupling rate of the coupled antibody and the existence of a polymer of the coupled antibody by PR-HPLC and SEC-HPLC detection, and detecting the molecular weight of the coupled antibody by LC-MS so as to calculate the DAR value of the coupled antibody, the success of coupling and the like. The specific detection results are as follows:
TABLE 23 ELISA detection of Her2 binding of antibody after conjugation to Mal-DOTA
Name (R) | EC50(ng/mL) | Relative Activity (%) |
H2-R66-S82b (Standard) | 31.71 | 100 |
DOTA-H2-R66-S82b | 74.35 | 42.6 |
H2-Q3-S25 (Standard) | 37.10 | 100 |
DOTA-H2-Q3-S25 | 26.59 | 139.5 |
H2-S7-G8 (Standard) | 55.29 | 100 |
DOTA-H2-S7-G8 | 60.92 | 90.8 |
H2-P84-S113 (Standard) | 5.972 | 100 |
DOTA-H2-P84-S113 | 19.67 | 30.4 |
H2-K83-E85 (Standard) | 11.06 | 100 |
DOTA-H2-K83-E85 | 23.07 | 47.9 |
H2-L11-T110 (Standard) | 35.94 | 100 |
DOTA-H2-L11-T110 | 29.94 | 120.0 |
H2-V12-L18 (Standard) | 12.67 | 100 |
DOTA-H2-V12-L18 | 25.74 | 49.2 |
H2-G9-Q108 (Standard) | 25.89 | 100 |
DOTA-H2-G9-Q108 | 19.88 | 130.2 |
H2-T87-V111 (Standard sample) | 11.77 | 100 |
DOTA-H2-T87-V111 | 26.55 | 44.3 |
H2-E6-T107 (Standard) | 29.16 | 100 |
DOTA-H2-E6-T107 | 15.93 | 183 |
H2-Q13-G16 (Standard) | 14.7 | 100 |
DOTA-H2-Q13-G16 | 24.25 | 60.6 |
H2-Q39-R45 (Standard) | 13.21 | 100 |
DOTA-H2-Q39-R45 | 11.44 | 115.5 |
TABLE 24 LC-MS detection of antibody molecular weight and DAR value after Mal-DOTA coupling
TABLE 25 detection of antibody coupling ratio and monomer ratio after Mal-DOTA coupling by RP-HPLC and SEC-HPLC
Name of antibody | Coupling Rate% (RP-HPLC) | Percent monomer (SEC-HPLC) |
H2-V12- |
0 | 100 |
H2-P84-S113 | 100 | 100 |
H2-E6-T107 | 13.5 | 77.15 |
H2-S7-G8 | 100 | 100 |
H2-R66-S82b | 100 | 92.8 |
H2-T87-V111 | 61.2 | 59.8 |
H2-Q13-G16 | 68 | 66.3 |
H2-Q3-S25 | 97.1 | 83.5 |
H2-L11-T110 | 100 | 89.2 |
H2-K83-E85 | 100 | 100 |
H2-G9-Q108 | 47.7 | 47.7 |
H2-Q39-R45 | 22 | 77.8 |
3.2.3 Summary of characterization results after coupling of H2 mutant to Mal-DOTA
By analyzing the characterization results of the coupled antibody, the results of the coupling of the H2 mutated antibody to Mal-DOTA are analyzed and summarized, the evaluation basis is 3.1.3, and the specific characterization evaluation results are shown in the following table.
TABLE 26 summary of characterization results after conjugation of each of the engineered antibodies to Mal-DOTA for H2
Note: the mark A is up to the set standard, the mark B is not up to the set standard, and the mark C is poor in characterization result
Like the C37H mutant antibody, the two antibodies of the E6-T107 and T87-V111 combination can normally form disulfide bonds after mutation and carry out conventional transient expression to obtain proteins, which indicates that the two mutant combinations of E6-T107 and T87-V111 have proper spatial positions, so that disulfide bonds can be formed after mutation. However, the data after coupling is poor, the E6-T119 coupling rate is low, only about 13%, and the affinity after T87-V111 coupling is reduced by about 60% (see that ASA% < 20% of solvent accessibility of E6 and V111 in Table 2). Again, if the modified antibody needs further coupling and other operations, the spatial distance of the amino acid and the exposure degree (solvent accessibility) of the amino acid should meet the requirements.
3.2.4 H2 mutant coupling GGFG-Dxd
According to the characterization result of a coupled small molecule chelating agent Mal-DOTA, the affinity and protein expression quantity of the modified antibody, and the like, antibody protein after partial H2 mutation is selected to be uniformly mixed with TCEP (tris (2-carboxyethyl) phosphine) reducing agent in a molar ratio of 1.
3.2.5 Characterization detection of H2 mutant after coupling GGFG-Dxd
And respectively carrying out ELISA affinity detection on the coupled antibodies to determine that the coupled antibodies do not lose biological activity. And (3) analyzing and evaluating the coupling rate of the coupled antibody and the existence of a polymer of the coupled antibody by PR-HPLC and SEC-HPLC detection, and detecting the molecular weight of the coupled antibody by LC-MS so as to calculate the DAR value of the coupled antibody, the success of coupling and the like. The specific detection results are as follows:
TABLE 27 ELISA detection of Her2 binding of antibodies after conjugation to GGFG-Dxd
TABLE 28 LC-MS detection of antibody molecular weight and DAR value after coupling to GGFG-Dxd
TABLE 29 detection of antibody coupling ratio and monomer content after coupling of GGFG-Dxd by RP-HPLC and SEC-HPLC
Name of antibody | Coupling Rate% (RP-HPLC) | Percent monomer (SEC-HPLC) |
H2-S7-G8 | 51.68 | 100 |
H2-P84- |
0 | 92.79 |
H2-G9-Q108 | 72.8 | 51.2 |
H2-K83-E85 | 77 | 100 |
H2-L11-T110 | 89.33 | 88.15 |
H2-Q3-S25 | 77.5 | 83.2 |
H2-R66-S82b | 100 | 100 |
3.2.6 Summary of characterization results of H2 mutant coupled to GGFG-Dxd
By analyzing the characterization results of the coupled antibody, the results of the coupling of the H2 mutated antibody to GGFG-Dxd are analyzed and summarized, the evaluation is according to reference 3.1.3, and the specific characterization evaluation results are shown in the following table.
TABLE 30 summary of characterization results after conjugation of each modified antibody of H2 to GGFG-Dxd
Note: the mark A is up to the set standard, the mark B is not up to the set standard, and the mark C is poor in characterization result
The results of the data of ELISA, RP-HPLC, SEC-HPLC and LC-MS are integrated, so that most of the mutant antibodies have no loss of biological activity or basically remain in a reasonable and controllable range compared with the mutant antibodies before and after coupling, and most of the mutant antibodies can be successfully coupled with two small molecules (DOTA or GGFG-Dxd) by analyzing the molecular weight and the coupling rate of the antibodies before and after coupling, and the partially incompletely coupled antibodies (the mixture of naked antibodies and DAR1 or DAR2 antibodies exists at the same time) are considered to be completely coupled into the DAR2 antibodies after deeply optimizing the coupling conditions, so that the data of the part of the data are temporarily not reflected in the patent.
3.3.109 mutant conjugation and characterization
3.3.1 109 mutant conjugation GGFG-Dxd
According to the reasons of affinity detection and antibody self-expression amount of the modified antibody in the early stage, the antibody protein after mutation of the selection part 109 is uniformly mixed with TCEP (tris (2-carboxyethyl) phosphine) reducing agent in a molar ratio of 1.
3.3.2 109 mutant coupling GGFG-Dxd post characterization detection
And respectively carrying out ELISA affinity detection on the coupled antibodies to determine that the coupled antibodies do not lose biological activity. And detecting the coupling efficiency of the antibody and the monomer proportion of the coupled antibody by RP-HPLC and SEC-HPLC, and detecting the molecular weight of the coupled antibody by LC-MS so as to calculate the DAR value of the coupled antibody, whether the coupling is successful or not and the like. The specific detection results are as follows:
TABLE 31 ELISA for detection of binding of antibodies to PD-L1 after conjugation to GGFG-Dxd
Name (R) | EC50(ng/mL) | Relative Activity (%) |
109-Q3-25 | 91.35 | 100 |
Dxd-GGFG-109-Q3-S25 | 17.98 | 376.9 |
109-S11-T110 | 77.69 | 100 |
Dxd-GGFG-109-S11-T110 | 33.66 | 146.5 |
TABLE 32 LC-MS detection of antibody molecular weight and DAR value after coupling to GGFG-Dxd
TABLE 33 detection of antibody coupling ratio and monomer content after coupling of GGFG-Dxd by RP-HPLC and SEC-HPLC
Name of antibody | Coupling Rate% (RP-HPLC) | Percent monomer (SEC-HPLC) |
109-Q3-S25 | 60.27 | 59.6 |
109-S11-T110 | 74.43 | 68.17 |
3.3.3 Summary of characterization results after 109 mutant coupling to GGFG-Dxd
By analyzing the characterization results of the coupled antibody, the results of the coupling of the 109 mutant antibody to GGFG-Dxd are analyzed and summarized, the evaluation is according to reference 3.1.3, and the specific characterization evaluation results are shown in the following table.
TABLE 34 summary of characterization results after conjugation of each modified antibody to GGFG-Dxd
Note: the mark A is up to the set standard, the mark B is not up to the set standard, and the mark C is poor in characterization result
Surface cysteine transformation of relevant sites is carried out on three antibodies of three targets, affinity detection is carried out on the transformed antibodies, and the detection result shows that the affinity of most of the transformed antibodies has no obvious change compared with that before the transformation. Meanwhile, the coupling of a related metal chelator to the modified antibody and the coupling of an ADC-related linker-cytotoxic small molecule are respectively carried out, and a series of characterization detections are carried out on the coupled antibody, so that the fact that the affinity of most of the antibody is not obviously changed after the coupling, and the antibody can be coupled with 2 small molecule linkers (DAR 2) is found, and the expected result is consistent, and the initial assumption and the purpose of the invention can be realized.
4. Analysis of Universal mutation sites
Through analyzing three antibody mutation sites of three targets and corresponding experimental data after mutation, some mutation sites are found to be simultaneously suitable for three antibodies, and relevant detection after mutation and relevant characterization results after coupling are ideal, and the sites can be speculated to be suitable for site-specific coupling modification of a conventional nano antibody (the mutation sites summarized in the patent are most commonly used amino acids which can be replaced by cysteine, and the surface amino acids which are positioned in an FR region can be replaced by cysteine to form a new antibody according to a general formula), namely the antibody surface cysteine site-specific coupling technology. After cysteine mutation is carried out on the site, the affinity of the site is not obviously changed before mutation, coupling can be successfully carried out no matter coupling nuclide marker-related small molecule linker or coupling ADC drug-related linker and cytotoxin, and the affinity of the site is not obviously changed after coupling.
The framework regions of three selected nanobodies are divided and numbered by referring to a universal humanized nanobody framework h-NbBcII10FGLA (PDB number is 3 eak), and the universal sites which can be subjected to cysteine mutation are obtained as follows:
TABLE 35 Nanobody Universal site numbering
According to the previous experimental results, 15 pairs of amino acids located in the nano antibody frame region are selected, and the amino acids located on the surface of the nano antibody can be subjected to cysteine modification to form disulfide bonds. To facilitate surface-directed coupling. The method not only solves the problems that the DAR value of the conventional random coupling is not uniform, the process is responsible for and easily influences the biological activity, but also solves the problems that the DAR value of the end fixed-point coupling is low, a polymer is easily formed and the like, can improve the DAR value and can not influence the biological activity of the coupled antibody on the premise that the DAR value is controllable, and the process is relatively simple and controllable and the like. Provides a powerful foundation for the nanometer antibody to enter the fields of ADC, PDC, RDC and the like.
5. Universal mutation site validation
In order to verify the universality of the selected mutation sites again, and by utilizing the method, not only the transformation of the DAR2 antibody can be carried out, but also the construction of the DAR4 antibody can be carried out, so that another nano antibody H1-AN-TS of the Her2 target is selected for carrying out the transformation of the DAR2 and DAR4 antibodies, and meanwhile, the DAR4 antibody transformation is carried out again by using the C37H antibody of the CD8 alpha target and the H2 and H1-AN-TS antibodies of the Her2 target. Since the specific experimental methods of construction, expression, coupling, etc. have been introduced in the foregoing, only the corresponding detection and characterization results will be described in this section.
DAR4 antibody mutation by C37H and corresponding detection result
5.1.1 post-mutation sequence and ELISA detection results
According to the previous experimental results and the analysis of universal sites, 3 (Q) -25 (S) and 84 (A/P/M) -113 (S) are selected for combined mutation, the specific numbers of the corresponding C37H antibodies are Q3-S25 and A84-S113, and the specific sequences after mutation are as follows:
C37H-A84-S113+Q3-S25:
QVCLVESGGGLVQPGGSLRLSCAACGLTFSDYAIGWFRQAPGKEREGISCIRIYDGNTYYADSVKGRFTISRDNSKNHVYLQMNSLRCEDTAVYYCAAGSYYSCSVYPAYDLDYWGKGTLVTVSC
note: the mutation sites are underlined
And performing corresponding construction, expression and purification after mutation to obtain a corresponding target protein, performing ELISA detection, and verifying the affinity condition of the mutated antibody, wherein the specific detection result is as follows:
TABLE 36 ELISA detection of C37H DAR4 mutant antibody affinity
Name (R) | EC50(ng/mL) | Relative Activity (%) |
C37H (Standard sample)) | 51.06 | 100 |
C37H-A84-S113+Q3-S25 | 60.22 | 84.8 |
As can be seen from the ELISA detection results, the affinity of the antibody after modification is not obviously different from that before modification.
5.1.2 conjugation and characterization of C37H DAR4 antibodies
Mixing C37H-A84-S113+ Q3-S25 and TCEP according to a molar ratio of 1:10, mixing, reacting at 37 ℃ for 2h, dissolving NODA-GA in PBS, and mixing the reduced C37H-A84-S113+ Q3-S25 and NODA-GA according to a molar ratio of 1:20, mixing evenly, and reacting at 37 ℃ for 2h. And (3) after ultrafiltration, changing the solution to remove unconjugated small molecules, and simultaneously carrying out characterization on the conjugated antibody by ELISA and LC-MS, wherein the specific detection result is as follows:
TABLE 37 ELISA detection of affinity after C37H-A84-S113+ Q3-S25 coupling
Name (R) | EC50(ng/mL) | Relative Activity (%) |
C37H-A84-S113+ Q3-S25 (Standard) | 60.22 | 100 |
NODA-GA-C37H-A84-S113+Q3-S25 | 52.06 | 157 |
TABLE 38 LC-MS detection of DAR values after C37H-A84-S113+ Q3-S25 coupling
TABLE 39 RP-HPLC and SEC-HPLC detection of C37H-A84-S113+ Q3-S25 coupling ratio and monomer ratio
Name of antibody | Coupling Rate% (RP-HPLC) | Percent monomer (SEC-HPLC) |
C37H-A84-S113+Q3-S25 | 94.04 | 100 |
Based on the C37H antibody, two pairs of mutable universal sites are selected to be combined to construct the DAR4 antibody, the affinity of the antibody after mutation is not obviously different from that before mutation, the C37H-A84-S113+ Q3-S25 antibody after mutation is coupled and characterized, and the result shows that the antibody after mutation can be completely coupled with 4 small molecule linkers, the coupling rate is high, the antibody after coupling basically exists in a monomer form, and the affinity after coupling is not influenced.
5.2.H2 DAR4 antibody mutation and corresponding detection results
5.2.1 post-mutation sequence and ELISA test results
Randomly selecting universal sites 3 (Q) -25 (S) and 7 (S) -8 (G) for combined mutation, wherein specific numbers corresponding to the H2 antibody are Q3-S25 and S7-G8, and specific sequences after mutation are as follows:
H2-S7-G8+Q3-S25:
QLCLVECCGGLVQPGGSLRLSCAACGFTLDYYAIGWFRQAPGKEREGVSCITSGGSTDYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAASHYGLRVGTLCPETYEYDYWGQGTQVTVSS
note: the mutation sites are underlined
And performing corresponding construction, expression and purification after mutation to obtain a corresponding target protein, performing ELISA detection, and verifying the affinity condition of the mutated antibody, wherein the specific detection result is as follows:
TABLE 40 ELISA detection of H2 DAR4 mutant antibody affinity
As can be seen from the ELISA detection results, the affinity of the antibody after modification is not obviously different from that before modification.
5.1.2 coupling and characterization of H2 DAR4 antibodies
Mixing H2-S7-G8+ Q3-S25 and TCEP according to a molar ratio of 1:10, uniformly mixing, reacting at 37 ℃ for 2H, and mixing the reduced H2-S7-G8+ Q3-S25 and Mal-DOTA according to the molar ratio of 1:20, mixing evenly, and reacting at 37 ℃ for 2h. And (3) ultrafiltering and replacing the solution into 0.25M sodium acetate solution, and performing detection ELISA and LC-MS characterization on the coupled antibody, wherein the specific detection result is as follows:
TABLE 41 ELISA detection of affinity after H2-S7-G8+ Q3-S25 coupling
Name (R) | EC50(ng/mL) | Relative Activity (%) |
H2-S7-G8+ Q3-S25 (Standard) | 21.36 | 100 |
DOTA-H2-S7-G8+Q3-S25 | 65.45 | 32.6 |
TABLE 42 detection of DAR values after H2-S7-G8+ Q3-S25 coupling by LC-MS
TABLE 43 detection of H2-S7-G8+ Q3-S25 coupling ratio and monomer ratio by RP-HPLC and SEC-HPLC
According to ELISA detection results, the affinity of the antibody after coupling is slightly reduced compared with that before coupling, RP-HPLC and SEC-HPLC show that coupling is complete and all monomers are obtained after coupling, and LC-MS shows that the antibody is successfully coupled with 4 DOTA small molecules and coupling is complete.
5.3.H1-AN-TS DAR2 and DAR4 antibody mutation and corresponding detection result
Based on H1-AN-TS antibody, universal sites 11 (S/L) -110 (T), 7 (S) -8 (G), 3 (Q) -25 (S), 83 (K/R/Q/S/T/E) -85 (E/D), 84 (A/P/M) -113 (S) and 41 (A/P/R) -42 (G), 14 (P) -113 (S) sites are selected to carry out a pair of disulfide bond modification (DAR 2 antibody), and based on the constructed DAR2 antibody, two pairs of disulfide bond modification (DAR 4 antibody) are carried out by mutually combining and pairing, wherein the specific numbering and antibody sequence before and after the related H1-AN-TS mutation are as follows:
H1-AN-TS:
QLQLVESGGGLVQPGGSLRLSCAASSSIFSVNNMGWYRQAAGEQRELVASISRLGTTNYKDSVKGRVTISRDDAKSTVYLQMNSLKPEDTAVYYCNTDPPWGDDPFERSASWGQGTQVTVSS
wherein the CDR regions are underlined
H1-L11-T110:
QLQLVESGGGCVQPGGSLRLSCAASSSIFSVNNMGWYRQAAGEQRELVASISRLGTTNYKDSVKGRVTISRDDAKSTVYLQMNSLKPEDTAVYYCNTDPPWGDDPFERSASWGQGTQVCVSS
H1-Q3-S25:
QLCLVESGGGLVQPGGSLRLSCAACSSIFSVNNMGWYRQAAGEQRELVASISRLGTTNYKDSVKGRVTISRDDAKSTVYLQMNSLKPEDTAVYYCNTDPPWGDDPFERSASWGQGTQVTVSS
H1-S7-G8:
QLQLVECCGGLVQPGGSLRLSCAASSSIFSVNNMGWYRQAAGEQRELVASISRLGTTNYKDSVKGRVTISRDDAKSTVYLQMNSLKPEDTAVYYCNTDPPWGDDPFERSASWGQGTQVTVSS
H1-P84-S113:
QLQLVESGGGLVQPGGSLRLSCAASSSIFSVNNMGWYRQAAGEQRELVASISRLGTTNYKDSVKGRVTISRDDAKSTVYLQMNSLKCEDTAVYYCNTDPPWGDDPFERSASWGQGTQVTVSC
H1-K83-E85:
QLQLVESGGGLVQPGGSLRLSCAASSSIFSVNNMGWYRQAAGEQRELVASISRLGTTNYKDSVKGRVTISRDDAKSTVYLQMNSLCPCDTAVYYCNTDPPWGDDPFERSASWGQGTQVTVSS
H1-A41-G42:
QLQLVESGGGLVQPGGSLRLSCAASSSIFSVNNMGWYRQACCEQRELVASISRLGTTNYKDSVKGRVTISRDDAKSTVYLQMNSLKPEDTAVYYCNTDPPWGDDPFERSASWGQGTQVTVSS
H1-L11-T110+R66-S82b:
QLQLVESGGGCVQPGGSLRLSCAASSSIFSVNNMGWYRQAAGEQRELVASISRLGTTNYKDSVKGCVTISRDDAKSTVYLQMNCLKPEDTAVYYCNTDPPWGDDPFERSASWGQGTQVCVSS
H1-L11-T110+Q3-S25:
QLCLVESGGGCVQPGGSLRLSCAACSSIFSVNNMGWYRQAAGEQRELVASISRLGTTNYKDSVKGRVTISRDDAKSTVYLQMNSLKPEDTAVYYCNTDPPWGDDPFERSASWGQGTQVCVSS
H1-L11-T110+P84-S113:
QLQLVESGGGCVQPGGSLRLSCAASSSIFSVNNMGWYRQAAGEQRELVASISRLGTTNYKDSVKGRVTISRDDAKSTVYLQMNSLKCEDTAVYYCNTDPPWGDDPFERSASWGQGTQVCVSC
H1-L11-T110+K83-E85:
QLQLVESGGGCVQPGGSLRLSCAASSSIFSVNNMGWYRQAAGEQRELVASISRLGTTNYKDSVKGRVTISRDDAKSTVYLQMNSLCPCDTAVYYCNTDPPWGDDPFERSASWGQGTQVCVSS
H1-L11-T110+A41-G42:
QLQLVESGGGCVQPGGSLRLSCAASSSIFSVNNMGWYRQACCEQRELVASISRLGTTNYKDSVKGRVTISRDDAKSTVYLQMNSLKPEDTAVYYCNTDPPWGDDPFERSASWGQGTQVCVSS
H1-L11-T119+S7-G8:
QLQLVECCGGCVQPGGSLRLSCAASSSIFSVNNMGWYRQAAGEQRELVASISRLGTTNYKDSVKGRVTISRDDAKSTVYLQMNSLKPEDTAVYYCNTDPPWGDDPFERSASWGQGTQVCVSS
H1-S7-G8+P84-S113:
QLQLVECCGGLVQPGGSLRLSCAASSSIFSVNNMGWYRQAAGEQRELVASISRLGTTNYKDSVKGRVTISRDDAKSTVYLQMNSLKCEDTAVYYCNTDPPWGDDPFERSASWGQGTQVTVSC
H1-Q3-S25+S7-G8:
QLCLVECCGGLVQPGGSLRLSCAACSSIFSVNNMGWYRQAAGEQRELVASISRLGTTNYKDSVKGRVTISRDDAKSTVYLQMNSLKPEDTAVYYCNTDPPWGDDPFERSASWGQGTQVTVSS
H1-K83-E85+Q3-S25:
QLCLVESGGGLVQPGGSLRLSCAACSSIFSVNNMGWYRQAAGEQRELVASISRLGTTNYKDSVKGRVTISRDDAKSTVYLQMNSLCPCDTAVYYCNTDPPWGDDPFERSASWGQGTQVTVSS
H1-Q3-S25+P84-S113:
QLCLVESGGGLVQPGGSLRLSCAACSSIFSVNNMGWYRQAAGEQRELVASISRLGTTNYKDSVKGRVTISRDDAKSTVYLQMNSLKCEDTAVYYCNTDPPWGDDPFERSASWGQGTQVTVSC
H1-L11-T110+P14-S113:
QLQLVESGGGCVQCGGSLRLSCAASSSIFSVNNMGWYRQAAGEQRELVASISRLGTTNYKDSVKGRVTISRDDAKSTVYLQMNSLKPEDTAVYYCNTDPPWGDDPFERSASWGQGTQVCVSC
Note: the mutation sites are underlined
Performing corresponding construction, expression and purification after mutation to obtain corresponding target protein, then performing ELISA to detect antibody affinity after mutation, SEC-HPLC and SDS-PAGE to detect monomer expression, and simultaneously verifying antibody expression amount after mutation, wherein the specific detection results are as follows:
TABLE 44 ELISA detection of H1-AN-TS DAR2/4 mutant antibody affinity
TABLE 45 SEC-HPLC and SDS-PAGE detection of H1-AN-TS DAR2/4 mutant antibody monomer ratio
TABLE 46 expression level of each of the mutated antibodies H1-AN-TS DAR2/4
Name of antibody | Amount of expression (mg/L) | Name of antibody | Amount of expression (mg/L) |
H1-Q3-S25 | 74.2 | H1-L11-T110+P84-S113 | 112 |
H1-S7-G8 | 41.6 | H1-L11-T110+K83-E85 | 25 |
H1-P84-S113 | 58.6 | H1-L11-T110+A41-G42 | 18.2 |
HI-K83-E85 | 19.2 | H1-S7-G8+P84-S113 | 51 |
H1-L11-T110 | 20.8 | H1-Q3-S25+P84-S113 | 21.6 |
H1-A41-G42 | 58.7 | H1-Q3-S25+S7-G8 | 1.84 |
H1-L11-T110+R66-S82b | 90 | H1-L11-T110+S7-G8 | 18 |
H1-L11-T110+Q3-S25 | 56 | H1-K83-E85+Q3-S25 | 4 |
The mutation site solvent exposure degree ASA% is still predicted through a website or software, the molecular weight is estimated to be whether the theoretical molecular weight is consistent with the actually detected molecular weight through mass spectrum detection, other characterization results of the mutated antibody are analyzed, the results of the H1 mutated antibody are analyzed and summarized, the evaluation basis refers to 2.7, and the specific characterization evaluation results are shown in the following table.
TABLE 47 summary of in vitro characterization results for each of the engineered antibodies for H1
Note: the mark A is up to the set standard, the mark B is not up to the set standard, and the mark C is poor in characterization result
Selecting DAR4 antibodies with relatively high DAR2 and DAR4 affinities for coupling (in order to not affect the coupling effect, if the antibody has a polymer, a monomer can be obtained by purification optimization firstly) and corresponding characterization, and mixing H1-L11-T110, H1-S7-G8 and H1-P84-S113 with TCEP according to the molar ratio of 1:5, uniformly mixing H1-L11-T110+ P84-S113 and H1-S7-G8+ P84-L113 with TCEP according to a molar ratio of 1:10, uniformly mixing, reacting at 37 ℃ for 2h, and mixing the reduced DAR2 and DAR4 with DOTA-Mal according to the molar ratio of 1:20, mixing evenly, and reacting at 37 ℃ for 2h. And (3) ultrafiltering and changing the solution into 0.25M sodium acetate solution, and subjecting the coupled antibody to detection ELISA, RP-HPLC, SEC-HPLC and LC-MS for characterization, wherein the specific detection results are as follows:
TABLE 48 ELISA detection of affinity after H1-DAR2/DAR4 coupling
Name (R) | EC50(ng/mL) | Relative Activity (%) |
H1-L11-T110 (Standard) | 35.04 | 100 |
DOTA-H1-L11-T110 | 57.13 | 61.3 |
H1-S7-G8 (Standard) | 43.4 | 100 |
DOTA-H1-S7-G8 | 63.83 | 68 |
H1-P84-S113 (Standard) | 53.04 | 100 |
DOTA-H1-P84-S113 | 66.52 | 79.7 |
H1-L11-T110+ P84-S113 (Standard) | 117.6 | 100 |
DOTA-H1-L11-T110+P84-S113 | 135.2 | 87 |
H1-S7-G8+ P84-S113 (Standard) | 85.31 | 100 |
DOTA-H1-S7-G8+P84-S113 | 145.4 | 58.7 |
TABLE 49 LC-MS detection of DAR value after H1-DAR2/DAR4 coupling
TABLE 50 detection of H1-DAR2/DAR4 coupling ratio and monomer condition by RP-HPLC and SEC-HPLC
By analyzing the characterization results of the coupled antibody, the results of the coupling of the H1 mutated antibody to Mal-DOTA are analyzed and summarized, the evaluation basis is 3.1.3, and the specific characterization evaluation results are shown in the following table.
TABLE 51 summary of characterization results after conjugation of each of the engineered antibodies to Mal-DOTA for H1
Note: the mark A is up to the set standard, the mark B is not up to the set standard, and the mark C is poor in characterization result
Another antibody H1-AN-TS selected for Her2 antigen was used for mutation site validation, we performed not only for the DAR2 site but also for the DAR4 site. According to the in vitro characterization of the mutated naked antibody and the characterization results of the coupled antibody, the selected site has universality and can be theoretically applied to the modification of any nano antibody, all the characterization results after modification are in line with expectations, the reduced antibody can be completely coupled with a corresponding small molecule linker to improve a corresponding DAR value, and all the characterization results of the coupled antibody are in line with expectations.
5.4. Affinity optimization for H1-DAR2/4 engineered antibodies
As can be seen from the in vitro characterization data before and after the mutation of H1-DAR2/4 and after the coupling of the antibody after the mutation, the modified antibody basically accords with the expectation from the aspects of affinity, expression quantity, coupling condition and the like. But we believe that by further sequence optimization, affinity also has room for improvement, and thus will have better effect on later stage antibodies, whether applied to targeting or therapy, so I chose to try optimization with the department H1-DAR2/4 antibody. The specific optimized sequence is as follows:
H1-L11-T110-SA:
QLQLVESGGGCVQPGGSLRLSCAASSSIFSVNNMGWYRQAAGEQRELVASISRLGTTNYKDSVKGRVTISRDDAKSTVYLQMNSLKPEDTAVYYCNTDPPWGDDPFERSASWGQGTQVCVSSSA
H1-P84-S113-SA:
QLQLVESGGGLVQPGGSLRLSCAASSSIFSVNNMGWYRQAAGEQRELVASISRLGTTNYKDSVKGRVTISRDDAKSTVYLQMNSLKCEDTAVYYCNTDPPWGDDPFERSASWGQGTQVTVSCSA
H1-P84-S113-GS:
QLQLVESGGGLVQPGGSLRLSCAASSSIFSVNNMGWYRQAAGEQRELVASISRLGTTNYKDSVKGRVTISRDDAKSTVYLQMNSLKCEDTAVYYCNTDPPWGDDPFERSASWGQGTQVTVSCGS
H1-L11-T110+P84-S113-14A:
QLQLVESGGGCVQAGGSLRLSCAASSSIFSVNNMGWYRQAAGEQRELVASISRLGTTNYKDSVKGRVTISRDDAKSTVYLQMNSLKCEDTAVYYCNTDPPWGDDPFERSASWGQGTQVCVSC
H1-L11-T110+P84-S113-A:
QLQLVESGGGCVQPGGSLRLSCAASSSIFSVNNMGWYRQAAGEQRELVASISRLGTTNYKDSVKGRVTISRDDAKSTVYLQMNSLKCEDTAVYYCNTDPPWGDDPFERSASWGQGTQVCVSCA
H1-L11-T110+P84-S113-GS:
QLQLVESGGGCVQPGGSLRLSCAASSSIFSVNNMGWYRQAAGEQRELVASISRLGTTNYKDSVKGRVTISRDDAKSTVYLQMNSLKCEDTAVYYCNTDPPWGDDPFERSASWGQGTQVCVSCGS
H1-L11-T110+P84-S113-K:
QLQLVESGGGCVQPGGSLRLSCAASSSIFSVNNMGWYRQAAGEQRELVASISRLGTTNYKDSVKGRVTISRDDAKSTVYLQMNSLKCEDTAVYYCNTDPPWGDDPFERSASWGQGTQVCVKC
H1-S7-G8+P84-S113-SA:
QLQLVECCGGLVQPGGSLRLSCAASSSIFSVNNMGWYRQAAGEQRELVASISRLGTTNYKDSVKGRVTISRDDAKSTVYLQMNSLKCEDTAVYYCNTDPPWGDDPFERSASWGQGTQVTVSCSA
H1-S7-G8+P84-S113-K:
QLQLVECCGGLVQPGGSLRLSCAASSSIFSVNNMGWYRQAAGEQRELVASISRLGTTNYKDSVKGRVTISRDDAKSTVYLQMNSLKCEDTAVYYCNTDPPWGDDPFERSASWGQGTQVTVKC
H1-S7-G8+P84-S113-GS:
QLQLVECCGGLVQPGGSLRLSCAASSSIFSVNNMGWYRQAAGEQRELVASISRLGTTNYKDSVKGRVTISRDDAKSTVYLQMNSLKCEDTAVYYCNTDPPWGDDPFERSASWGQGTQVTVSCGS
H1-L11-T110+P14-S113-K
QLQLVESGGGCVQCGGSLRLSCAASSSIFSVNNMGWYRQAAGEQRELVASISRLGTTNYKDSVKGRVTISRDDAKSTVYLQMNSLKPEDTAVYYCNTDPPWGDDPFERSASWGQGTQVCVKC
Note: the mutation sites are underlined
Performing corresponding construction, expression and purification after optimization to obtain corresponding target protein, performing ELISA detection on the optimized antibody affinity, SEC-HPLC and SDS-PAGE detection monomer expression conditions, and verifying the mutated antibody expression quantity and the like, wherein the specific detection results are as follows:
TABLE 52 ELISA detection of H1-DAR2/4 optimized antibody affinities
TABLE 53 SEC-HPLC and SDS-PAGE detection of antibody monomer ratio after H1-DAR2/4 optimization
Name of antibody | Percent monomer (SEC-HPLC) | Percent monomer (SDC-PAGE) |
H1-L11-T110-SA | 42 | 19.1 |
H1-P84-S113-SA | 100 | 100 |
H1-P84-S113-GS | 100 | 100 |
H1-L11-T110+P84-S113-14A | 42.73 | 30.65 |
H1-L11-T110-P84-S113-A | 41.1 | 23.95 |
H1-L11-T110+P84-S113-GS | 37.93 | 21.04 |
H1-L11-T110+P83-S113-K | 74.68 | 35.05 |
H1-L11-T119+P14-S113-K | 61.42 | 45.9 |
H1-S7-G8+P84-S113-GS | 100 | 99.15 |
H1-S7-G8+P87-S113-SA | 100 | 100 |
H1-S7-G8+P87-S122-K | 100 | 99.14 |
TABLE 54 expression level of antibody after optimization of H1-DAR2/4
From each characterization result after optimization, the affinity of most antibodies after optimization is obviously improved compared with that before modification, and the expression level can be stably or partially improved compared with that before modification, which shows that even after the surface fixed-point coupling mutation modification is carried out on the nano antibody, the modified antibody can be further optimized according to the specific requirements of subsequent experiments, so as to achieve the expected result.
Through a series of mutation and verification experiments on different antibodies with different targets, a common universal site on the surface of the nano antibody, which can be used for cysteine mutation, is found and summarized. Theoretically, as long as the amino acid is positioned in the FR region, the accessibility of the amino acid solvent is more than or equal to 20 percent, and the spatial position is proper, the amino acid solvent can be mutated to form a disulfide bond and form an access site. This universal site can also be subjected to combinatorial mutation to give DAR4 or even DAR6 antibodies. The invention solves many disadvantages of random coupling and end fixed point coupling of nano antibody, provides a method with simple process, high DAR value and no influence on biological activity, combines the advantages of small molecular weight and strong penetrating power of nano antibody itself, and is believed to be widely applied to various treatment fields in the future.
Claims (10)
1. An antigen binding protein comprising a variable antigen binding domain (VHH) of a heavy chain antibody, wherein the VHH comprises one or more pairs of engineered cysteine residues, wherein each pair of the engineered cysteine residues independently comprises a cysteine residue at a first position and a cysteine residue at a second position, the cysteine residue at the first position and the cysteine residue at the second position being capable of pairing to form a disulfide bond; wherein at least one of the cysteine residue at the first position and the cysteine residue at the second position is mutated.
2. The antigen binding protein of claim 1, wherein the cysteine residue at the first position and the cysteine residue at the second position are both mutated.
3. The antigen binding protein of any one of claims 1-2, wherein the disulfide bond is capable of forming a sulfhydryl group upon reduction by a reducing agent, wherein the sulfhydryl group allows the antigen binding protein to be conjugated to a payload at the first position and/or the second position.
5. The antigen binding protein of any one of claims 1-4, wherein the relative solvent accessibility (ASA%) of the amino acid residue at the first position to the amino acid residue at the second position is not less than about 20%.
6. The antigen binding protein of any one of claims 1-5, wherein the combination of the first and second positions is selected from at least one of the following combinations:
a)66-82b;
b)3-25;
c)7-8;
d)84-113;
e)83-85;
f)68-81;
g)17-82a;
h)41-42;
i)9-108;
j)11-110;
k)87-111;
l)13-16;
m)12-18;
n) 39-45; and
o)14-113
wherein the numbers refer to amino acid residue positions of the VHH as defined by Kabat numbering.
7. The antigen binding protein of any one of claims 1 to 6, wherein the antigen binding protein is a humanized VHH antibody or a fully human VHH antibody.
8. The antigen binding protein of any one of claims 1-7, wherein the antigen binding protein specifically binds to a tumor antigen or a non-tumor antigen.
9. A fusion polypeptide comprising the antigen binding protein of any one of claims 1-8.
10. An immunoconjugate comprising the antigen binding protein of any one of claims 1-8, a payload, and a linker connecting the payload to the antigen binding protein.
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202211197665.7A CN115850449A (en) | 2022-09-29 | 2022-09-29 | Antibodies and conjugates |
PCT/CN2023/121915 WO2024067670A1 (en) | 2022-09-29 | 2023-09-27 | Antibody and conjugate |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202211197665.7A CN115850449A (en) | 2022-09-29 | 2022-09-29 | Antibodies and conjugates |
Publications (1)
Publication Number | Publication Date |
---|---|
CN115850449A true CN115850449A (en) | 2023-03-28 |
Family
ID=85661245
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202211197665.7A Pending CN115850449A (en) | 2022-09-29 | 2022-09-29 | Antibodies and conjugates |
Country Status (2)
Country | Link |
---|---|
CN (1) | CN115850449A (en) |
WO (1) | WO2024067670A1 (en) |
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN117198390A (en) * | 2023-09-08 | 2023-12-08 | 中国科学院广州生物医药与健康研究院 | Preparation method of SLC (SLC) membrane protein complex by designing and modifying disulfide bond crosslinking site |
WO2024067670A1 (en) * | 2022-09-29 | 2024-04-04 | 苏州智核生物医药科技有限公司 | Antibody and conjugate |
Citations (8)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20110033378A1 (en) * | 2008-01-18 | 2011-02-10 | Medlmmune, Llc. | Cysteine Engineered Antibodies For Site-Specific Conjugation |
US20120164068A1 (en) * | 2009-07-03 | 2012-06-28 | Peter John Hudson | Immuno-conjugates and methods for producing them |
US20120171115A1 (en) * | 2009-12-23 | 2012-07-05 | Avipep Pty Limited | Immuno-conjugates and methods for producing them |
US20160130358A1 (en) * | 2014-09-12 | 2016-05-12 | Genentech, Inc. | Cysteine engineered antibodies and conjugates |
CN111675762A (en) * | 2019-03-11 | 2020-09-18 | 凯惠科技发展(上海)有限公司 | Cysteine-containing antibody, drug conjugate and application thereof |
CN113164621A (en) * | 2020-12-08 | 2021-07-23 | 和铂医药(上海)有限责任公司 | Protein-drug conjugates and site-directed conjugation methods |
CN113509562A (en) * | 2021-04-22 | 2021-10-19 | 苏州智核生物医药科技有限公司 | Formulations comprising PD-L1 binding polypeptide compositions and methods of making the same |
US20220175947A1 (en) * | 2017-02-28 | 2022-06-09 | Seagen Inc. | Cysteine mutated antibodies for conjugation |
Family Cites Families (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN115850449A (en) * | 2022-09-29 | 2023-03-28 | 苏州智核生物医药科技有限公司 | Antibodies and conjugates |
-
2022
- 2022-09-29 CN CN202211197665.7A patent/CN115850449A/en active Pending
-
2023
- 2023-09-27 WO PCT/CN2023/121915 patent/WO2024067670A1/en unknown
Patent Citations (8)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20110033378A1 (en) * | 2008-01-18 | 2011-02-10 | Medlmmune, Llc. | Cysteine Engineered Antibodies For Site-Specific Conjugation |
US20120164068A1 (en) * | 2009-07-03 | 2012-06-28 | Peter John Hudson | Immuno-conjugates and methods for producing them |
US20120171115A1 (en) * | 2009-12-23 | 2012-07-05 | Avipep Pty Limited | Immuno-conjugates and methods for producing them |
US20160130358A1 (en) * | 2014-09-12 | 2016-05-12 | Genentech, Inc. | Cysteine engineered antibodies and conjugates |
US20220175947A1 (en) * | 2017-02-28 | 2022-06-09 | Seagen Inc. | Cysteine mutated antibodies for conjugation |
CN111675762A (en) * | 2019-03-11 | 2020-09-18 | 凯惠科技发展(上海)有限公司 | Cysteine-containing antibody, drug conjugate and application thereof |
CN113164621A (en) * | 2020-12-08 | 2021-07-23 | 和铂医药(上海)有限责任公司 | Protein-drug conjugates and site-directed conjugation methods |
CN113509562A (en) * | 2021-04-22 | 2021-10-19 | 苏州智核生物医药科技有限公司 | Formulations comprising PD-L1 binding polypeptide compositions and methods of making the same |
Non-Patent Citations (2)
Title |
---|
李明莹: "定点偶联技术在抗体药物偶联物中的应用", 《药学进展》, vol. 45, no. 3, pages 180 - 187 * |
陈虎: "基于定点偶联技术的抗体药物偶联物的临床研究进展与挑战", 《药学进展》, vol. 45, no. 3, pages 167 - 179 * |
Cited By (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2024067670A1 (en) * | 2022-09-29 | 2024-04-04 | 苏州智核生物医药科技有限公司 | Antibody and conjugate |
CN117198390A (en) * | 2023-09-08 | 2023-12-08 | 中国科学院广州生物医药与健康研究院 | Preparation method of SLC (SLC) membrane protein complex by designing and modifying disulfide bond crosslinking site |
CN117198390B (en) * | 2023-09-08 | 2024-03-12 | 中国科学院广州生物医药与健康研究院 | Preparation method of SLC (SLC) membrane protein complex by designing and modifying disulfide bond crosslinking site |
Also Published As
Publication number | Publication date |
---|---|
WO2024067670A1 (en) | 2024-04-04 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CA2088367C (en) | Tri- and tetra-valent monospecific antigen-binding proteins | |
WO2024067670A1 (en) | Antibody and conjugate | |
ES2708124T3 (en) | Procedure for preparing heteromultimeric molecules | |
US7067131B2 (en) | Methods for using anti-MUC18 antibodies | |
US6924360B2 (en) | Antibodies against the MUC18 antigen | |
US6511663B1 (en) | Tri- and tetra-valent monospecific antigen-binding proteins | |
US7090844B2 (en) | Use of antibodies against the MUC18 antigen | |
CN108473590B (en) | Therapeutic molecules | |
JP5919604B2 (en) | Anti-pancreatic cancer antibody | |
US11517632B2 (en) | Anti-Her2 single chain antibody and coding sequence and use thereof | |
CA2925915C (en) | Anti-epcam antibodies and methods of use | |
US11198738B2 (en) | Therapeutic antibodies and uses thereof | |
CN109485726B (en) | Application of radiolabeled anti-nano antibody in prognosis and diagnosis of cancer | |
KR101820029B1 (en) | Radio-labelled antibody fragments for use in the prevention and/or treatment of cancer | |
WO2022268225A1 (en) | CD8α BINDING POLYPEPTIDE AND USE THEREOF | |
Khawli et al. | Comparison of recombinant derivatives of chimeric TNT-3 antibody for the radioimaging of solid tumors | |
TW202116808A (en) | Polypeptide complex for conjugation and use thereof | |
EP4309677A1 (en) | Pd-l1 and tlr7 double-targeting nanobody coupling drug and use thereof in anti-tumor | |
WO2022174809A1 (en) | Anti-cldn18.2 antibody conjugates | |
WO2023165142A1 (en) | Her2 binding polypeptide and use thereof | |
WO2024051383A1 (en) | Anti-trop2 antibody, conjugate comprising said antibody, and use thereof | |
US20230190968A1 (en) | Anti-cd38 single-domain antibodies in disease monitoring and treatment | |
CN117430708A (en) | anti-Claudin18.2 antibody | |
WO2021229104A1 (en) | Anti-cd38 single-domain antibodies in disease monitoring and treatment | |
CN117384292A (en) | 68 Preparation method and application of Ga-marked Trop2 immune PET imaging probe |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
REG | Reference to a national code |
Ref country code: HK Ref legal event code: DE Ref document number: 40090582 Country of ref document: HK |