WO2016012623A1 - Lentiviral vectors for regulated expression of a chimeric antigen receptor molecule - Google Patents

Lentiviral vectors for regulated expression of a chimeric antigen receptor molecule Download PDF

Info

Publication number
WO2016012623A1
WO2016012623A1 PCT/EP2015/067090 EP2015067090W WO2016012623A1 WO 2016012623 A1 WO2016012623 A1 WO 2016012623A1 EP 2015067090 W EP2015067090 W EP 2015067090W WO 2016012623 A1 WO2016012623 A1 WO 2016012623A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
cells
vector
car
lentiviral
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2015/067090
Other languages
English (en)
French (fr)
Inventor
Sophie AGAUGUE
Lorenzo TIBALDI
Klervi EVEN-DESRUMAUX
Dmitry TRUBETSKOY
Franck Perez
Sebastian Amigorena
Cécile Bauche
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Centre National de la Recherche Scientifique CNRS
Universite Pierre et Marie Curie
Institut National de la Sante et de la Recherche Medicale INSERM
Institut Curie
Theravectys SA
Original Assignee
Centre National de la Recherche Scientifique CNRS
Universite Pierre et Marie Curie
Institut National de la Sante et de la Recherche Medicale INSERM
Institut Curie
Theravectys SA
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to US15/327,517 priority Critical patent/US10752668B2/en
Priority to CN202110939899.3A priority patent/CN113846062B/zh
Priority to HK18108178.7A priority patent/HK1248720B/zh
Priority to EP19159129.6A priority patent/EP3511413B1/en
Priority to JP2017524110A priority patent/JP6940406B2/ja
Priority to CA2956385A priority patent/CA2956385A1/en
Application filed by Centre National de la Recherche Scientifique CNRS, Universite Pierre et Marie Curie, Institut National de la Sante et de la Recherche Medicale INSERM, Institut Curie, Theravectys SA filed Critical Centre National de la Recherche Scientifique CNRS
Priority to CN201580051938.9A priority patent/CN107531800B/zh
Priority to EP15742027.4A priority patent/EP3172228B1/en
Publication of WO2016012623A1 publication Critical patent/WO2016012623A1/en
Anticipated expiration legal-status Critical
Priority to US16/931,986 priority patent/US20210009653A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/4203Receptors for growth factors
    • A61K40/4205Her-2/neu/ErbB2, Her-3/ErbB3 or Her 4/ ErbB4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/421Immunoglobulin superfamily
    • A61K40/4211CD19 or B4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0636T lymphocytes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0646Natural killers cells [NK], NKT cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/10Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the structure of the chimeric antigen receptor [CAR]
    • A61K2239/23On/off switch
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/20Fusion polypeptide containing a tag with affinity for a non-protein ligand
    • C07K2319/22Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a Strep-tag
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2799/00Uses of viruses
    • C12N2799/02Uses of viruses as vector
    • C12N2799/021Uses of viruses as vector for the expression of a heterologous nucleic acid
    • C12N2799/027Uses of viruses as vector for the expression of a heterologous nucleic acid where the vector is derived from a retrovirus

Definitions

  • the present invention is in the field of recombinant vaccine technology and relates to improvements of lentiviral vectors, which can be used as therapeutic and prophylactic vaccines.
  • the vectors provide improved induction of immune responses over other vectors.
  • LTRs long terminal repeats
  • IR or att sites the inverted repeats required for integration
  • packaging sequence ⁇ the packaging sequence ⁇
  • transport RNA-binding site primer binding site, PBS
  • some additional sequences involved in reverse transcription the repeat R within the LTRs, and the polypurine tracts, PPT, necessary for plus strand initiation.
  • the gag, pol, and env genes are generally entirely deleted and replaced with an expression cassette.
  • Retroviral vectors deriving from lentivirus genomes have emerged as promising tools for both gene therapy and immunotherapy purposes, because they exhibit several advantages over other viral systems.
  • lentiviral vectors themselves are not toxic and, unlike other retroviruses, lentiviruses are capable of transducing non-dividing cells, in particular dendritic cells (He et al. 2007, Expert Rev vaccines, 6(6):913-24), allowing antigen presentation through the endogenous pathway.
  • Lentiviruses are linked by similarities in genetic composition, molecular mechanisms of replication and biological interactions with their hosts. They are best known as agents of slow disease syndromes that begin insidiously after prolonged periods of subclinical infection and progress slowly; thus, they are referred to as the "slow" viruses (Narayan et al., 1989, J Gen Virol, 70(7): 1617-39). They have the same basic organization as all retroviruses but are more complex due to the presence of accessory genes (e.g., vif, vpr, vpu, nef, tat, and rev), which play key roles in lentiviral replication in vivo.
  • accessory genes e.g., vif, vpr, vpu, nef, tat, and rev
  • Lentiviruses represent a genus of slow viruses of the Retroviridae family, which includes the human immunodeficiency viruses (HIV), the simian immunodeficiency virus (SIV), the equine infectious encephalitis virus (EIAV), the caprine arthritis encephalitis virus (CAEV), the bovine immunodeficiency virus (BIV), and the feline immunodeficiency virus (FIV).
  • Lentiviruses can persist indefinitely in their hosts and replicate continuously at variable rates during the course of the lifelong infection. Persistent replication of the viruses in their hosts depends on their ability to circumvent host defenses.
  • Dendritic cells are of primary importance for antigen presentation because they constitute the main class of antigen presenting cells (APCs) whose primary function is to present antigens and initiate an immune response.
  • APCs antigen presenting cells
  • MHCs major histocompatibility complex proteins
  • the vectors routinely contain strong constitutive promoters containing enhancers, such as the CMV promoter. Michelini et al., Vaccine 27(34):4622-29 (2009); Karwacz et al., J. Virol. 83(7):30943103 (2009); Negri et al., Molecular Therapy 15(9): 1716-23 (2007); and Buffa et al., J. General Virology 87:1625-1634 (2006).
  • enhancers such as the CMV promoter.
  • Lentiviral vectors have been improved in their safety by removal of the LTR U3 sequence, resulting in "self-inactivating" vectors that are entirely devoid of viral promoter and enhancer sequences originally present within the LTRs.
  • the lentiviral particles which contain lentiviral vectors, can be produced by recombinant technology upon transient transfection of cells, for example HEK 293T human cultured cells, by different DNA plasmids:
  • a packaging plasmid which expresses at least the Gag, Pol Rev, Tat and, in some cases, structural and enzymatic proteins necessary for the packaging of the transfer construct;
  • VSV.G glycoprotein of vesicular stomatitis virus
  • MHC major histocompatibility antigen-presenting cells
  • the lentiviral particle vectors may also be continuously produced by cells by stably inserting the packaging genes, the proviral coding DNA, and the envelope gene into the cellular genome. This allows the continuous production of lentiviral particle vectors by the cells without the need for transient transfection.
  • a combination of these procedures can be used, with some of the DNAs/plasmids integrated into the cellular genome and others provided by transient transfection.
  • Non-integrating lentiviral vectors have been designed to mitigate the risks of potential oncogenesis linked to insertional mutagenesis events, particularly for vaccination purposes.
  • Examples of non-integrating lentiviral vectors are provided in Coutant et al., PLOS ONE 7(1 1 ):e48644 (2102), Karwacz et al., J. Virol. 83(7):3094- 3103 (2009), Negri et al., Molecular Therapy 15(9): 1716-1723 (2007); Hu et al., Vaccine 28:6675-6683 (2010). Consequently, it has been reported that a non-integrating lentiviral vector system can mitigate the potential risk of insertional mutagenesis as compared to an integrating system. Hu et al., Vaccine 28:6675-6683 (2010).
  • Enhancers are cis-acting sequences, which can act as transcriptional activators at a distance.
  • MHC class II promoter was found not to provide sufficient transgene expression in DCs, when administered intravenously.
  • lentiviral vectors including MHC class II promoters did not provoke an immune reaction in immunocompetent C57BL/6 mice, in contrast to the immune responses observed with CMV promoters/enhancers.
  • integration and persistent transgene expression were observed after injection in mice, the lentiviral vectors transcribed through MHC class II promoters failed to stimulate an antigen- specific CD8+ cytotoxic T-lymphocyte response, even after vaccination boost.
  • the authors of these studies therefore concluded that the use of MHC class II promoters was of interest only for applications where persistence of expression is sought as in gene replacement therapy, but not in the context of immunotherapy.
  • MHC class II promoters are expressed poorly in most cell types.
  • the MHC class II promoter is not an adequate promoter for lentiviral vectors for induction of an immune response against an antigen via IV injection.
  • the dectin-2 promoter is expressed poorly in most cell types and appears to contain an enhancer.
  • the dectin-2 promoter is not a good promoter for lentiviral vectors for safety reasons.
  • lentiviral vectors provide effective expression of the transgene that elicits a desired specific immune response. This requires that the expression is at a high level in APCs, such as dendritic cells.
  • the cells transduced by the lentiviral vectors are eliminated by the immune response to provide a higher degree of safety. That is, the immune response generated against the transgene can elicit an immune response in the host sufficient to eliminate the cells that are transduced by the lentiviral vectors.
  • the elimination of transduced cells eliminates the persistence of the lentiviral vector in the host, and possible secondary effects of the vector. In order for the transduced cells to be eliminated, expression is required in non-dendritic cells at a level that allows elimination by the immune response. Thus, appropriate expression of an antigen is desirable.
  • the promoter should maximize immune stimulation through the key cells (i.e., dendritic cells) involved in the activation of na ' ive and memory T cells, and should minimize the risk of insertional mutagenesis and genotoxicity in stem cells, leading to malignancies.
  • the promoter should have sufficiently high activity in dendritic and other cells, but not contain an enhancer.
  • viral promoters such as the CMV promoter, are not ideal because of the presence of strong enhancers.
  • CARs Chimeric antigen receptors
  • CARs engage molecules that do not require peptide processing or HLA expression to be recognized.
  • CARs have been shown to have T cell-proliferating and activating potential on their own, including chimeric molecules between CDS- ⁇ or Fc receptor ⁇ and CD8, CD4, CD25 or CD16.
  • the antigen-binding parts of the CARs generally are either scFv's derived from antibodies, Fab's selected from libraries, or natural receptor ligands. Han EQ et al.; J Hematol Oncol, 6:47, 2013.
  • CARs have been generated against many different cell surface molecules, including CD19, HER2, GD2, PSMA, and many are in clinical trials. Davila et al., Oncolmmunology 1 :9, 1577-1583; 2012. The most promising clinical outcomes of CARs have been in patients treated with autologous CAR-modified T cells targeting CD19. Maus MV et al.; 123(17): 2625-35, 2014.
  • the invention encompasses nucleic acid molecules and vectors encoding CARs and methods of making and using the nucleic acid molecules and vectors.
  • the invention encompasses a chimeric antigen receptor comprising a binding domain; a transmembrane domain; a hook-binding domain, preferably comprising a streptavidin-binding peptide; and an activation domain comprising a T cell activating fragment of at least 100 amino acids of SEQ ID NO:3; SEQ ID NO:4; SEQ ID NO:5; SEQ ID NO:6, SEQ ID NO:7, or SEQ ID NO:8, SEQ ID NO:33, or SEQ ID NO:34.
  • the invention encompasses a lentiviral vector expressing a chimeric antigen receptor comprising a binding domain; a transmembrane domain; a hook-binding domain comprising a streptavidin-binding peptide; and an activation domain comprising a T cell activating fragment of at least 100 amino acids of SEQ ID NO:3; SEQ ID NO:4; SEQ ID NO:5; SEQ ID NO:6, SEQ ID NO:7, or SEQ ID NO:8, SEQ ID NO:33, or SEQ ID NO:34.
  • the invention encompasses a nucleic acid vector encoding a chimeric antigen receptor comprising a binding domain; a transmembrane domain; a hook-binding domain, preferably comprising a streptavidin-binding peptide; and an activation domain comprising a T cell activating fragment of at least 100 amino acids of SEQ ID NO:3; SEQ ID NO:4; SEQ ID NO:5; SEQ ID NO:6, SEQ ID NO:7, or SEQ ID NO:8, SEQ ID NO:33, or SEQ ID NO:34.
  • invention encompasses a lentiviral vector particle encoding a chimeric antigen receptor comprising a binding domain; a transmembrane domain; a hook-binding domain, preferably comprising a streptavidin-binding peptide; and an activation domain comprising a T cell activating fragment of at least 100 amino acids of SEQ ID NO:3; SEQ ID NO:4; SEQ ID NO:5; SEQ ID NO:6, SEQ ID NO:7, or SEQ ID NO:8, SEQ ID NO:33, or SEQ ID NO:34.
  • the chimeric antigen receptor or the lentiviral vector or the nucleic acid vector or the lentiviral vector particle comprises a single-chain Fv antibody or a single-domain antibodies (i.e., nanobody).
  • the vector encodes a hook comprising the amino acid sequence of SEQ ID NO:31 or SEQ ID NO:32.
  • the vector comprises a p2-microglobulin, Ubi, EF1 a, MHCI, or MHCII promoter.
  • the vector is a DNA.
  • the lentiviral vector particle comprises a vesicular stomatitis virus glycoprotein. In one embodiment, the lentiviral vector particle comprises HIV-1 subtype D Gag and Pol proteins. [38] In one embodiment, the invention encompasses an isolated cell comprising a vector of the invention.
  • the invention encompasses the use of the chimeric antigen receptor or the lentiviral vector or the nucleic acid vector or the lentiviral vector particle of any of the invention for inducing an immune response in a human.
  • the invention encompasses a method for inducing an immune response in a human comprising administering the lentiviral vector particle or cells transduced by the lentiviral vector particle encoding a chimeric antigen receptor to a human and, optionally, subsequently administering biotin to the human.
  • the chimeric antigen receptor or the lentiviral vector or the nucleic acid vector comprises the nucleotide sequence of any of SEQ ID NO:45, SEQ ID NO:47, or SEQ ID NO:49. In some embodiments, the chimeric antigen receptor receptor comprises the amino acid sequence of any of SEQ ID NO:46, SEQ ID NO:48, or SEQ ID NO:50.
  • the lentiviral vector or the nucleic acid vector further encodes the amino acid sequence of SEQ ID NO:42 or comprises the nucleic acid sequence of SEQ ID NO:43 and/or SEQ ID NO:44.
  • Figure 1 depicts GFP expression in HEK 293T and BDCM cells from lentivectors with the indicated promoters.
  • Figure 3A-C depict expression of a CAR in T cells from various lentivectors with human ubiquitin, MHC class I, MHC class II, and ⁇ 2 microglobulin (P2m) promoters.
  • Figure 4 depicts titers with a pseudotyping vector encoding a codon- optimized VSV-G protein fused to Hook-streptavidin with a dose escalation of hook- streptavidin encoding vector and +/- biotin.
  • FIG. 5A-B depict structure and expression of CAR-RUSH.
  • CAR-RUSH are second generation CARs displaying 4-1 BB and CD3zeta intracellular domains.
  • the peculiarity of CAR-RUSH resides in the presence of a SBP (Streptavidin Binding Protein) region allowing the interaction with a HOOK protein coupled to streptavidin and, consequently, the retention in the endoplasmic reticulum.
  • SBP Streptavidin Binding Protein
  • SBP1 , SBP2 and SBP3 consists in the position of the SBP region, which has been placed between the transmembrane domain and 4-1 BB, or between 4-1 BB and CD3zeta, or at the C-terminus, respectively.
  • FIG. 6A-B depict expression and behavior of CAR-RUSH constructs following co-transduction with a lentivector encoding a HOOK-streptavidin, and biotin treatment.
  • Cells were co-transduced with a lentivector encoding a HOOK-streptavidin (MOI 5) and a lentivector encoding a CAR-SBP (MOI 5), corresponding to a final total MOI of 10.
  • Biotin was added at the time of co-transduction and cells were analysed at day 3 post-transduction.
  • Figure 7A-B depict expression and behavior of CAR-RUSH bicistronic constructs. Percentage and MFI showing median fluorescence intensity of CAR-positive T lymphocytes analysed by FACS. Cells were transduced at a MOI of 10 (A) or 30 (B) and analysed at day 3 post-transduction. Biotin was added at the time of transduction. The percentage and the MFI values reported in the histograms were obtained by substracting values from untransduced cells, corresponding to the background.
  • SBP1 - CD19 and SBP3-CD19 CAR-RUSH constructs showed expression at the cellular surface only upon addition of biotin in the culture medium, suggesting that CAR-RUSH were specifically retained by the HOOK-streptavidin protein in absence of biotin and that, following biotin delivery, the RUSH regulation system induced their trafficking towards and their expression on the plasma membrane.
  • SBP1 -CD19 and SBP3-CD19 CAR-RUSH constructs showed expression at the cellular surface upon addition of biotin in the culture medium.
  • SBP1 - CD19 showed slight expression at the cellular surface.
  • CAR- RUSH were considered as largely retained by the HOOK streptavidin protein in the absence of biotin.
  • the biotin delivery induced their trafficking towards, and their expression on the plasma membrane.
  • FIG. 8A-B depict CAR-RUSH system switch evaluation (OFF/ON).
  • Purified T cells were transduced at day 0 with lentivectors encoding the CAR-RUSH system and biotin was added or not at the same time.
  • T cells were analyzed by flow cytometry for the expression of CARs at the T cell surface.
  • CAR-RUSH constructs were transduced at a MOI of 10 or 20, biotin was added at the same time and T cells were analysed for CAR expression at the cellular surface at day 3 post-transduction.
  • Figure 9A-D depict CAR-RUSH system switch evaluation (OFF/ON/OFF).
  • T cells were transduced at day 0 with lentivectors encoding the CAR-RUSH system and biotin was added or not at the same time.
  • a set of wells was analysed by flow cytometry for the expression of CARs in both the presence and absence of biotin.
  • Other sets of wells were washed and put back in culture with or without biotin, in order to monitor the ability of CAR-positive cells to switch the expression of CAR off.
  • T cells were then analysed for CAR expression at the T cell surface at day 7.
  • Percentage (A) and MFI showing median fluorescence intensity (B) of CAR-positive T lymphocytes analysed by FACS and derived from healthy donor 32.
  • CAR-RUSH constructs were transduced at a MOI of 10 and analysed for CAR expression at the cellular surface at day 7 post-transduction following the re-addition or not of biotin at day 3. As shown in A), a low percentage of CAR-positive T cells was detected. Biotin induced CAR-RUSH expression at the extracellular surface for both CAR-SBP2 and CAR-SBP3 and, in particular for CAR-SBP3, CAR expression was also re-induced following washing and biotin re-addition at day 3. Percentage (C) and MFI showing median fluorescence intensity (D) of CAR-positive T lymphocytes analysed by FACS and derived from healthy donor 31.
  • CAR-RUSH constructs were transduced at a MOI of 20 and analysed for CAR expression at the cellular surface at day 7 post- transduction following the re-addition or not of biotin at day 3. All three CAR-RUSH tested showed a low percentage of CAR-positive cells. In addition, at exception of CAR- SBP1 which showed CAR expression both in the presence and absence of biotin, CAR- RUSH were exclusively expressed in the conditions in which biotin was added at day 0 and/or at day 7.
  • Figure 10A-C depicts the amino acid and nucleotide sequences of CAR- CD19 2nd generation and its constituents.
  • Figure 1 1 depicts the structure of the bicistronic HOOK streptavidin-IRES- CAR-SBP-CD19 2nd generation constructs.
  • CARs chimeric antigen receptors
  • a kidney cell line and a dendritic cell line were transduced with lentiviral vectors expressing green fluorescent protein (GFP) from various promoters. It was found that the human EF1 a promoter was the strongest promoter in the dendritic cell line BDCM (Fig. 1 ). This promoter was also very strong in the kidney cell line 293T. Cell-specific expression of various promoters was analyzed using the data sets at biogps.org (Fig.2).
  • CAR-CD19 lentivectors with the SBP at various positions between the intracellular domains were evaluated in presence of the Hook-Streptavidin.
  • Human T- cells were co-transduced with a lentivector expressing the CAR-CD19-SBP and with a lentivector expressing the Hook-streptavidin and the percentage of transduced cells and MFI were evaluated before or after addition of biotin. It was found that the Hook- streptavidin and the CAR-CD19-SBP can be co-expressed in human T-cells.
  • Hook-streptavidin could retain the CAR-CD19-SBP in the endoplasmic reticulum of the T-cells and the addition of biotin in the media induced the release of the CAR-CD19 and its expression at the surface of the cells (Figure 6).
  • Hook-streptavidin could retain the CAR-CD19-SBP in the endoplasmic reticulum of the T-cells, regardless of its position.
  • Addition of biotin in the media induced the release of the CAR-CD19 and its expression at the surface of the cells, regardless of its position ( Figure 7).
  • the present invention encompasses lentiviral vectors encoding a CAR, and their use for the induction of immune responses in a host, especially a human.
  • in vitro refers to events that occur in an artificial environment, e.g., in a test tube or reaction vessel, in cell culture, in a Petri dish, etc., rather than within an organism (e.g., animal, plant, or microbe).
  • the term “in vivo” refers to events that occur within an organism (e.g., animal, plant, or microbe).
  • the term “isolated” refers to a substance or entity that has been (1 ) separated from at least some of the components with which it was associated when initially produced (whether in nature or in an experimental setting), and (2) produced, prepared, and/or manufactured by the hand of man. Isolated substances and/or entities may be separated from at least about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or more of the other components with which they were initially associated.
  • isolated agents are more than about 80%, about 85%, about 90%, about 91 %, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% pure.
  • a substance is "pure" if it is substantially free of other components.
  • isolated products of this invention including isolated nucleic acids, proteins, polypeptides, and antibodies are not products of nature (i.e., "non-naturally occurring”). Rather, the "isolated” nucleic acids, proteins, polypeptides, and antibodies of this invention are “man-made” products.
  • the “isolated” products of this invention can be “markedly different” or “significantly different” from products of nature.
  • the isolated nucleic acids may be purified, recombinant, synthetic, labeled, and/or attached to a solid substrate. Such nucleic acids can be markedly different or significantly different than nucleic acids that occur in nature.
  • the "isolated" proteins, polypeptides, and antibodies of this invention may be purified, recombinant, synthetic, labeled, and/or attached to a solid substrate.
  • Such proteins, polypeptides, and antibodies can be markedly different or significantly different from proteins, polypeptides, and antibodies that occur in nature.
  • peptide refers to a short polypeptide, e.g., one that typically contains less than about 50 amino acids and more typically less than about 30 amino acids.
  • the term as used herein encompasses analogs and mimetics that mimic structural and thus biological function.
  • polypeptide encompasses both naturally-occurring and non- naturally occurring proteins, and fragments, mutants, derivatives and analogs thereof.
  • a polypeptide may be monomeric or polymeric. Further, a polypeptide may comprise a number of different domains each of which has one or more distinct activities. For the avoidance of doubt, a "polypeptide" may be any length greater two amino acids.
  • isolated protein or "isolated polypeptide” is a protein or polypeptide that by virtue of its origin or source of derivation (1 ) is not associated with naturally associated components that accompany it in its native state, (2) exists in a purity not found in nature, where purity can be adjudged with respect to the presence of other cellular material (e.g., is free of other proteins from the same species) (3) is expressed by a cell from a different species, or (4) does not occur in nature (e.g., it is a fragment of a polypeptide found in nature or it includes amino acid analogs or derivatives not found in nature or linkages other than standard peptide bonds).
  • polypeptide that is chemically synthesized or synthesized in a cellular system different from the cell from which it naturally originates will be “isolated” from its naturally associated components.
  • a polypeptide or protein may also be rendered substantially free of naturally associated components by isolation, using protein purification techniques well known in the art.
  • isolated does not necessarily require that the protein, polypeptide, peptide or oligopeptide so described has been physically removed from a cell in which it was synthesized.
  • the protein or polypeptide can be purified.
  • the purified protein or polypeptide is more than 50%, 75%, 85%, 90%, 95%, 97%, 98%, or 99% pure.
  • a purified protein that is more than 50% (etc.) pure means a purified protein sample containing less than 50% (etc.) other proteins.
  • a sample of a protein comprising can be 99% pure if it contains less than 1 % contaminating host cell proteins.
  • polypeptide fragment refers to a polypeptide that has a deletion, e.g., an amino-terminal and/or carboxy-terminal deletion compared to a full-length polypeptide, such as a naturally occurring protein.
  • the polypeptide fragment is a contiguous sequence in which the amino acid sequence of the fragment is identical to the corresponding positions in the naturally-occurring sequence. Fragments typically are at least 5, 6, 7, 8, 9 or 10 amino acids long, or at least 12, 14, 16 or 18 amino acids long, or at least 20 amino acids long, or at least 25, 30, 35, 40 or 45, amino acids, or at least 50 or 60 amino acids long, or at least 70 amino acids long, or at least 100 amino acids long.
  • fusion protein refers to a polypeptide comprising a polypeptide or fragment coupled to heterologous amino acid sequences. Fusion proteins are useful because they can be constructed to contain two or more desired functional elements that can be from two or more different proteins.
  • a fusion protein comprises at least 10 contiguous amino acids from a polypeptide of interest, or at least 20 or 30 amino acids, or at least 40, 50 or 60 amino acids, or at least 75, 100 or 125 amino acids.
  • the heterologous polypeptide included within the fusion protein is usually at least 6 amino acids in length, or at least 8 amino acids in length, or at least 15, 20, or 25 amino acids in length.
  • Fusions that include larger polypeptides, such as an IgG Fc region, and even entire proteins, such as the green fluorescent protein (“GFP") chromophore-containing proteins, have particular utility. Fusion proteins can be produced recombinantly by constructing a nucleic acid sequence which encodes the polypeptide or a fragment thereof in frame with a nucleic acid sequence encoding a different protein or peptide and then expressing the fusion protein. Alternatively, a fusion protein can be produced chemically by crosslinking the polypeptide or a fragment thereof to another protein.
  • GFP green fluorescent protein
  • recombinant may refer to a biomolecule, e.g., a gene or protein, or to an organism.
  • the term “recombinant” may be used in reference to cloned DNA isolates, chemically synthesized polynucleotides, or polynucleotides that are biologically synthesized by heterologous systems, as well as proteins or polypeptides and/or RNAs encoded by such nucleic acids.
  • a "recombinant" nucleic acid is a nucleic acid linked to a nucleotide or polynucleotide to which it is not linked in nature.
  • a “recombinant” protein or polypeptide may be (1 ) a protein or polypeptide linked to an amino acid or polypeptide to which it is not linked in nature; and/or (2) a protein or polypeptide made by transcription and/or translation of a recombinant nucleic acid.
  • a protein synthesized by a microorganism is recombinant, for example, if it is synthesized from an mRNA synthesized from a recombinant nucleic acid present in the cell.
  • a “recombinant” cell is a cell comprising a "recombinant” biomolecule.
  • a T cell that comprises a "recombinant” nucleic acid is a "recombinant” cell.
  • nucleic acid refers to a polymeric form of nucleotides of at least 10 bases in length.
  • the term includes DNA molecules (e.g., cDNA or genomic or synthetic DNA) and RNA molecules (e.g., mRNA or synthetic RNA), as well as analogs of DNA or RNA containing non-natural nucleotide analogs, non-native internucleoside bonds, or both.
  • the nucleic acid can be in any topological conformation.
  • the nucleic acid can be single-stranded, double-stranded, triple-stranded, quadruplexed, partially double-stranded, branched, hairpinned, circular, or in a padlocked conformation.
  • the nucleic acid also referred to as polynucleotides
  • Such modifications include, for example, labels, methylation, substitution of one or more of the naturally occurring nucleotides with an analog, internucleotide modifications such as uncharged linkages (e.g., methyl phosphonates, phosphotriesters, phosphoramidates, carbamates, etc.), charged linkages (e.g., phosphorothioates, phosphorodithioates, etc.), pendent moieties (e.g., polypeptides), intercalators (e.g., acridine, psoralen, etc.), chelators, alkylators, and modified linkages (e.g., alpha anomeric nucleic acids, etc.) Also included are synthetic molecules that mimic polynucleotides in their ability to bind to a designated sequence via hydrogen bonding and other chemical interactions.
  • internucleotide modifications such as uncharged linkages (e.g., methyl phosphonates, phosphotriesters, phosphoramidates, carb
  • Such molecules are known in the art and include, for example, those in which peptide linkages substitute for phosphate linkages in the backbone of the molecule.
  • Other modifications can include, for example, analogs in which the ribose ring contains a bridging moiety or other structure such as the modifications found in "locked" nucleic acids.
  • RNA, DNA or a mixed polymer is one created outside of a cell, for example one synthesized chemically.
  • nucleic acid fragment refers to a nucleic acid sequence that has a deletion, e.g., a 5'-terminal or 3'-terminal deletion compared to a full-length reference nucleotide sequence.
  • the nucleic acid fragment is a contiguous sequence in which the nucleotide sequence of the fragment is identical to the corresponding positions in the naturally-occurring sequence.
  • fragments are at least 10, 15, 20, or 25 nucleotides long, or at least 20, 30, 40, 50, 60, 70, 80, 90, 100, 1 10, 120, 130, 140, or 150 nucleotides long.
  • a fragment of a nucleic acid sequence is a fragment of an open reading frame sequence.
  • such a fragment encodes a polypeptide fragment (as defined herein) of the protein encoded by the open reading frame nucleotide sequence.
  • the nucleic acid can be purified.
  • the purified nucleic acid is more than 50%, 75%, 85%, 90%, 95%, 97%, 98%, or 99% pure.
  • a purified nucleic acid that is at least 50% pure means a purified nucleic acid sample containing less than 50% other nucleic acids.
  • a sample of a plasmid can be at least 99% pure if it contains less than 1 % contaminating bacterial DNA.
  • an endogenous nucleic acid sequence in the genome of an organism is deemed "recombinant” herein if a heterologous sequence is placed adjacent to the endogenous nucleic acid sequence.
  • a heterologous sequence is a sequence that is not naturally adjacent to the endogenous nucleic acid sequence, whether or not the heterologous sequence is itself endogenous (originating from the same host cell or progeny thereof) or exogenous (originating from a different host cell or progeny thereof).
  • a promoter sequence can be substituted (e.g., by homologous recombination) for the native promoter of a gene in the genome of a host cell, such that this gene has an altered expression pattern.
  • This gene would now become “recombinant” because it is separated from at least some of the sequences that naturally flank it.
  • a nucleic acid is also considered “recombinant” if it contains any modifications that do not naturally occur to the corresponding nucleic acid in a genome.
  • an endogenous coding sequence is considered “recombinant” if it contains an insertion, deletion or a point mutation introduced artificially, e.g., by human intervention.
  • a "recombinant nucleic acid” also includes a nucleic acid integrated into a host cell chromosome at a heterologous site and a nucleic acid construct present as an episome.
  • the phrase "degenerate variant" of a reference nucleic acid sequence encompasses nucleic acid sequences that can be translated, according to the standard genetic code, to provide an amino acid sequence identical to that translated from the reference nucleic acid sequence.
  • the term "degenerate oligonucleotide” or “degenerate primer” is used to signify an oligonucleotide capable of hybridizing with target nucleic acid sequences that are not necessarily identical in sequence but that are homologous to one another within one or more particular segments.
  • sequence identity refers to the residues in the two sequences which are the same when aligned for maximum correspondence.
  • the length of sequence identity comparison may be over a stretch of at least about nine nucleotides, usually at least about 20 nucleotides, more usually at least about 24 nucleotides, typically at least about 28 nucleotides, more typically at least about 32, and even more typically at least about 36 or more nucleotides.
  • polynucleotide sequences can be compared using FASTA, Gap or Bestfit, which are programs in Wisconsin Package Version 10.0, Genetics Computer Group (GCG), Madison, Wis.
  • FASTA provides alignments and percent sequence identity of the regions of the best overlap between the query and search sequences. Pearson, Methods Enzymol. 183:63- 98 (1990).
  • percent sequence identity between nucleic acid sequences can be determined using FASTA with its default parameters (a word size of 6 and the NOPAM factor for the scoring matrix) or using Gap with its default parameters as provided in GCG Version 6.1 , herein incorporated by reference.
  • sequences can be compared using the computer program, BLAST (Altschul et al., J. Mol.
  • an "expression control sequence” refers to polynucleotide sequences which affect the expression of coding sequences to which they are operatively linked.
  • Expression control sequences are sequences which control the transcription, post-transcriptional events and translation of nucleic acid sequences.
  • Expression control sequences include appropriate transcription initiation, termination, promoter and enhancer sequences; efficient RNA processing signals such as splicing and polyadenylation signals; sequences that stabilize cytoplasmic mRNA; sequences that enhance translation efficiency (e.g., ribosome binding sites); sequences that enhance protein stability; and when desired, sequences that enhance protein secretion.
  • the nature of such control sequences differs depending upon the host organism; in prokaryotes, such control sequences generally include promoter, ribosomal binding site, and transcription termination sequence.
  • control sequences is intended to encompass, at a minimum, any component whose presence is essential for expression, and can also encompass an additional component whose presence is advantageous, for example, leader sequences and fusion partner sequences.
  • operatively linked or “operably linked” expression control sequences refers to a linkage in which the expression control sequence is contiguous with the gene of interest to control the gene of interest, as well as expression control sequences that act in trans or at a distance to control the gene of interest.
  • a "vector” is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
  • a vector is a "plasmid,” which generally refers to a circular double stranded DNA loop into which additional DNA segments may be ligated, but also includes linear double- stranded molecules such as those resulting from amplification by the polymerase chain reaction (PCR) or from treatment of a circular plasmid with a restriction enzyme.
  • PCR polymerase chain reaction
  • Other vectors include cosmids, bacterial artificial chromosomes (BAC) and yeast artificial chromosomes (YAC).
  • vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., vectors having an origin of replication which functions in the host cell). Other vectors can be integrated into the genome of a host cell upon introduction into the host cell, and are thereby replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as "recombinant expression vectors" (or simply "expression vectors").
  • the integrating cosmid vector pYUB412 is an example of a "vector”.
  • recombinant host cell (or simply “recombinant cell” or “host cell”), as used herein, is intended to refer to a cell into which a recombinant nucleic acid such as a recombinant vector has been introduced.
  • the word "cell” is replaced by a name specifying a type of cell.
  • a “recombinant microorganism” is a recombinant host cell that is a microorganism host cell. It should be understood that such terms are intended to refer not only to the particular subject cell but to the progeny of such a cell.
  • a recombinant host cell may be an isolated cell or cell line grown in culture or may be a cell which resides in a living tissue or organism.
  • the term "mammal” refers to any member of the taxonomic class mammalia, including placental mammals and marsupial mammals.
  • “mammal” includes humans, primates, livestock, and laboratory mammals.
  • Exemplary mammals include a rodent, a mouse, a rat, a rabbit, a dog, a cat, a sheep, a horse, a goat, a llama, cattle, a primate, a pig, and any other mammal.
  • the mammal is at least one of a transgenic mammal, a genetically-engineered mammal, and a cloned mammal.
  • the invention encompasses a chimeric antigen receptor (CAR) comprising an extracellular antigen-binding domain (binding domain), a hinge and transmembrane domain (transmembrane domain); a hook-binding domain; and an intracellular signaling domain (activation domain).
  • CAR chimeric antigen receptor
  • the CAR can contain one, two, three, or more of each of these domains.
  • the invention encompasses individually all possible combinations of the specific polypeptides and fragments thereof recited herein.
  • the invention encompasses CARs comprising a hook-binding domain.
  • a "hook-binding domain” is a domain that reversibly binds directly or indirectly to a "hook” protein inside of the cell, which binding prevents the CAR from exiting the endoplasmic reticulum (ER) or Golgi under appropriate conditions.
  • the hook-binding domain comprises a streptavidin- binding peptide (SBP), which can bind to a hook protein that bears the core streptavidin.
  • SBP streptavidin- binding peptide
  • Biotin causes the release of the CAR containing the hook-binding domain from the hook by out-competing the SBP. The CAR can then move to the cell membrane.
  • RUSH retention using selective hooks
  • the hook-binding domain comprises the amino acid sequence: MDEKTTGWRGGHWEGLAGELEQLRARLEHHPQGQREP (SEQ ID NO:1 ) or is encoded by the nucleic acid sequence:
  • the FKBPF-K506 binding domain 12 can be used with FKBP-rapamycin associated protein (FRAP) as the hook.
  • FKBPI2 FKBPF-K506 binding domain 12
  • FRAP FKBP-rapamycin associated protein
  • the interaction occurs only in the presence of rapamycin or analogues thereof that are able to mediate the interaction between FKBP12 and FRAP and can be, in particular, selected from the group consisting of FKI012, FK-CsA, and rapamycin.
  • the hook-binding domain is located in the intracytoplasmic region of the CAR.
  • the hook-binding domain is located in other positions, i.e., in all the junctions between the different intracytoplamsic elements (e.g., between the transmembrane region and the first co-stimulation element) or between the different co-stimulation elements.
  • the invention comprises CARs containing a binding domain that comprises an antibody that binds specifically to a human polypeptide.
  • antibody is meant to include polyclonal antibodies, monoclonal antibodies, fragments thereof, such as F(ab')2 and Fab fragments, single-chain variable fragments (scFvs), single-domain antibody fragments (VHHs or Nanobodies, preferably camelid), and bivalent and trivalent antibody fragments (diabodies and triabodies).
  • the antibody is a single-chain Fv antibody or a nanobody.
  • the antibody is monospecific. In one embodiment, the antibody is multispecific for 2, 3, or 4 polypeptides. Preferably, the antibody is bispecific.
  • Antibodies can be synthetic, monoclonal, or polyclonal and can be made by techniques well known in the art. Such antibodies specifically bind to human proteins via the antigen-binding sites of the antibody (as opposed to non-specific binding). Human proteins, polypeptide fragments, and peptides can be employed as immunogens in producing antibodies immunoreactive therewith. The human proteins, polypeptides, and peptides contain antigenic determinants or epitopes that elicit the formation of antibodies.
  • These antigenic determinants or epitopes can be either linear or conformational (discontinuous).
  • Linear epitopes are composed of a single section of amino acids of the polypeptide, while conformational or discontinuous epitopes are composed of amino acids sections from different regions of the polypeptide chain that are brought into close proximity upon protein folding (C. A. Janeway, Jr. and P. Travers, Immuno Biology 3:9 (Garland Publishing Inc., 2nd ed. 1996)).
  • the number of epitopes available is quite numerous; however, due to the conformation of the protein and steric hindrance, the number of antibodies that actually bind to the epitopes is less than the number of available epitopes (C. A. Janeway, Jr. and P. Travers, Immuno Biology 2:14 (Garland Publishing Inc., 2nd ed. 1996)).
  • Epitopes can be identified by any of the methods known in the art.
  • one aspect of the present invention relates to the antigenic epitopes of human proteins.
  • Such epitopes are useful for raising antibodies, in particular monoclonal antibodies, as described in detail below.
  • Antibodies are defined to be specifically binding if they bind human proteins or polypeptides with a Ka of greater than or equal to about 10 7 M ⁇ 1 . Affinities of binding partners or antibodies can be readily determined using conventional techniques, for example those described by Scatchard et al., Ann. N.Y. Acad. Sci., 51 :660 (1949).
  • Polyclonal antibodies can be readily generated from a variety of sources, for example, horses, cows, goats, sheep, dogs, chickens, rabbits, mice, or rats, using procedures that are well known in the art.
  • a purified human protein or polypeptide that is appropriately conjugated is administered to the host animal typically through parenteral injection.
  • the immunogenicity can be enhanced through the use of an adjuvant, for example, Freund's complete or incomplete adjuvant.
  • small samples of serum are collected and tested for reactivity to human proteins or polypeptides.
  • Examples of various assays useful for such determination include those described in Antibodies: A Laboratory Manual, Harlow and Lane (eds.), Cold Spring Harbor Laboratory Press, 1988; as well as procedures, such as countercurrent immuno-electrophoresis (CIEP), radioimmunoassay, radio- immunoprecipitation, enzyme-linked immunosorbent assays (ELISA), dot blot assays, and sandwich assays. See U.S. Pat. Nos. 4,376,1 10 and 4,486,530.
  • Monoclonal antibodies can be readily prepared using well known procedures. See, for example, the procedures described in U.S. Pat. Nos. RE 32,01 1 , 4,902,614, 4,543,439, and 4,41 1 ,993; Monoclonal Antibodies, Hybridomas: A New Dimension in Biological Analyses, Plenum Press, Kennett, McKeam, and Bechtol (eds.), 1980.
  • the host animals such as mice
  • Mouse sera are then assayed by conventional dot blot technique or antibody capture (ABC) to determine which animal is best to fuse.
  • ABSC antibody capture
  • mice are given an intravenous boost of the human protein or polypeptide.
  • Mice are later sacrificed and spleen cells fused with commercially available myeloma cells, such as Ag8.653 (ATCC), following established protocols.
  • ATCC Ag8.653
  • the myeloma cells are washed several times in media and fused to mouse spleen cells at a ratio of about three spleen cells to one myeloma cell.
  • the fusing agent can be any suitable agent used in the art, for example, polyethylene glycol (PEG). Fusion is plated out into plates containing media that allows for the selective growth of the fused cells. The fused cells can then be allowed to grow for approximately eight days. Supernatants from resultant hybridomas are collected and added to a plate that is first coated with goat anti-mouse Ig. Following washes, a label, such as a labeled human protein or polypeptide, is added to each well followed by incubation. Positive wells can be subsequently detected. Positive clones can be grown in bulk culture and supernatants are subsequently purified over a Protein A column (Pharmacia).
  • PEG polyethylene glycol
  • the monoclonal antibodies of the invention can be produced using alternative techniques, such as those described by Alting-Mees et al., "Monoclonal Antibody Expression Libraries: A Rapid Alternative to Hybridomas", Strategies in Molecular Biology 3: 1 -9 (1990), which is incorporated herein by reference.
  • binding partners can be constructed using recombinant DNA techniques to incorporate the variable regions of a gene that encodes a specific binding antibody. Such a technique is described in Larrick et al., Biotechnology, 7:394 (1989).
  • Antigen-binding fragments of such antibodies which can be produced by conventional techniques, are also encompassed by the present invention.
  • fragments include, but are not limited to, Fab and F(ab')2 fragments.
  • Antibody fragments and derivatives produced by genetic engineering techniques are also provided.
  • the monoclonal antibodies of the present invention include chimeric antibodies, e.g., humanized versions of murine monoclonal antibodies.
  • humanized antibodies can be prepared by known techniques, and offer the advantage of reduced immunogenicity when the antibodies are administered to humans.
  • a humanized monoclonal antibody comprises the variable region of a murine antibody (or just the antigen binding site thereof) and a constant region derived from a human antibody.
  • a humanized antibody fragment can comprise the antigen binding site of a murine monoclonal antibody and a variable region fragment (lacking the antigen-binding site) derived from a human antibody.
  • Antibodies produced by genetic engineering methods such as chimeric and humanized monoclonal antibodies, comprising both human and non-human portions, which can be made using standard recombinant DNA techniques, can be used.
  • Such chimeric and humanized monoclonal antibodies can be produced by genetic engineering using standard DNA techniques known in the art, for example using methods described in Robinson et al. International Publication No. WO 87/02671 ; Akira, et al. European Patent Application 0184187; Taniguchi, M., European Patent Application 0171496; Morrison et al. European Patent Application 0173494; Neuberger et al. PCT International Publication No. WO 86/01533; Cabilly et al. U.S.
  • An immunoglobulin library can be expressed by a population of display packages, preferably derived from filamentous phage, to form an antibody display library.
  • Examples of methods and reagents particularly amenable for use in generating antibody display library can be found in, for example, Ladner et al. U.S. Pat. No. 5,223,409; Kang et al. PCT publication WO 92/18619; Dower et al. PCT publication WO 91/17271 ; Winter et al. PCT publication WO 92/20791 ; Markland et al. PCT publication WO 92/15679; Breitling et al.
  • the antibody library is screened to identify and isolate packages that express an antibody that binds a human protein or polypeptide.
  • a display package e.g., filamentous phage
  • the primary screening of the library involves panning with an immobilized human protein or polypeptide and display packages expressing antibodies that bind immobilized human protein or polypeptide are selected.
  • the invention encompasses a CAR comprising an activation domain comprising CDS- ⁇ or Fc receptor ⁇ amino acid sequences. Sadelain et al., Cancer Discov. 2013 April; 3(4): 388-398, which is hereby incorporated by reference.
  • the invention further encompasses a CAR comprising an activation domain comprising a ⁇ 3- ⁇ chain and the cytoplasmic domain of a costimulatory receptor such as CD28, 4- 1 BB (CD137), DAP 10, OX40 (CD134), ICOS, CD27, or CD40L. Id.
  • the CAR comprises a fragment of at least 50, 60, 70, 80, 90,100, 1 10, 120, 150, or 200 amino acids of at least one of the following amino acid sequences having T-cell activating activity.
  • MIHLGHILFL LLLPVAAAQT TPGERSSLPA FYPGTSGSCS GCGSLSLPLL AGLVAADAVA SLLIVGAVFL CARPRRSPAQ EDGKVYINMP GRG
  • CD40L (CD154):
  • CAR comprises a fragment of at least 20, 30, 40, 50, 60, 70, 80, 90,100, 1 10, 120, 150, or 200 amino acids that shares at least than 90%, preferably more than 95%, more preferably more than 99% identity with the amino acid sequence of SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ I D NO:7, SEQ ID NO:8, SEQ ID NO:33, or SEQ ID NO:34.
  • the activation domain of the CAR comprises one, two, three, or more fragments of at least 20, 30, 40, 50, 60, 70, 80, 90, 100, 1 10, 120, 150, or 200 amino acids that share at least than 90%, preferably more than 95%, more preferably more than 99% identity with the amino acid sequence of SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:33, or SEQ ID NO:34.
  • the invention encompasses a CAR comprising a transmembrane (TM) domain, preferably a fragment of at least 20, 30, 40, 50, 60, 70, 80, 90, 100, 1 10, 120, 150, or 200 amino acids, most preferably of at least one of CD28, CD3z, CD8, CD4, FcRy, TM regions.
  • the CAR can be purified.
  • the purified CAR is more than 50%, 75%, 85%, 90%, 95%, 97%, 98%, or 99% pure.
  • a purified CAR that is more than 50% (etc.) pure means a purified CAR sample containing less than 50% (etc.) other proteins.
  • a sample of a recombinant CAR purified from a host cell can be 99% pure if it contains less than 1 % contaminating host cell proteins.
  • the CAR encodes the amino acid sequence of any of SEQ ID NO:46, SEQ ID NO:48, or SEQ ID NO:50.
  • Particularly preferred CARs include those encoding any of the constituents of the CAR depicted in Figure 1 1 , including signal sequence, CD19 ScFv, CD8 hinge, transmembrane domain, 4-1 BB, and/or CD3z sequences.
  • Other preferred CARs include those encoding any of the constituents of the CARs of SEQ ID NOs:44-50.
  • Particularly preferred CARs have the CD19 ScFv domain replaced by another binding region.
  • the invention encompasses nucleic acids encoding a CAR.
  • the nucleic acid can be single-stranded or double-stranded.
  • the nucleic acid can be an RNA or DNA molecule.
  • Preferred nucleic acids encode an amino acid sequence of at least one of the SEQ ID NOs detailed herein.
  • the invention encompasses an isolated nucleic acid of the invention inserted into a vector.
  • the nucleic acid sequence comprises the nucleic acid sequence of SEQ ID NO:2. In one embodiment the nucleic acid sequence comprises one or more of the following nucleic acid sequences:
  • HA TAG TATCCGTACGACGTACCAGACTACGCA (SEQ ID NO:37).
  • Preferred nucleic acids are of at least 50, 60, 70, 80, 90,100, 1 10, 120,
  • the nucleic acid can be purified.
  • the purified nucleic acid is more than 50%, 75%, 85%, 90%, 95%, 97%, 98%, or 99% pure.
  • a purified nucleic acid that is more than 50% pure means a purified nucleic acid sample containing less than 50% other nucleic acids.
  • a sample of a plasmid purified from a host bacteria can be 99% pure if it contains less than 1 % contaminating bacterial DNA.
  • nucleic acids include the following: CAR_CD19 2 Nd generation: 1518bp
  • nucleic acids include those comprising or encoding any of the constituents of the CAR depicted in Figure 9, including signal sequence, CD19 ScFv, CD8 hinge,transmembrane domain, 4-1 BB, and/or CD3z sequences.
  • nucleic acids include those comprising or encoding any of the constituents of the CARs of SEQ ID NOs:45-50.
  • the nucleic acid comprises a hook operably-linked to a promoter, preferably UBC or ⁇ 2 ⁇ , and a CAR comprising a hook-binding protein, operably-linked to an IRES.
  • the hook is a streptavidin protein, preferably core Streptavidin, and the hook-binding protein is a streptavidin- binding protein.
  • the invention encompasses vectors encoding a CAR and a hook-binding domain.
  • Preferred vectors comprise a nucleic acid sequence or encode an amino acid sequence of at least one of the SEQ ID NOs detailed herein.
  • the vector can further encode a "hook.”
  • a "hook” is a protein that prevents a CAR containing a hook-binding domain from exiting the endoplasmic reticulum (ER) or Golgi by reversibly binding, directly or indirectly, the hook-binding domain within the
  • the retention can take place in the lumen of the ER or at its cytoplasmic face, depending on the topology of the protein and the orientation of tagging with the interaction domains. Boncompain et al., Current Protocols in Cell Biology 15.19.1 - 15.19.16, December 2012, which is hereby incorporated by reference.
  • the hook for the ER comprises a mutant of stromal interaction molecule 1 (STIM1 -NN; a type I protein) that localizes in the ER but that cannot bind microtubules, an isoform of the human invariant chain of the major histocompatibility complex (li; a type II protein) that has an N-terminal arginine-based motif; or a C-terminal ER retention signal (Lys-Asp-Glu-Leu; KDEL).
  • STIM1 -NN mutant of stromal interaction molecule 1
  • li a type II protein
  • a C-terminal ER retention signal Li-Asp-Glu-Leu
  • the hook can be fused to a core Streptavidin in their luminal or cytoplasmic domain depending on the hook-binding protein. Id. at Fig. 1 .
  • the hook for the Golgi can be Golgin-84 to be used as a cytoplasmic Golgi hook. Id.
  • the hook comprises a Streptavidin protein sequence, most preferably core Streptavidin.
  • a Streptavidin protein sequence most preferably core Streptavidin.
  • the hook comprises one of the following Streptavidin protein sequences:
  • the hook is encoded by the following nucleotide sequence: ATGCACCGGAGGAGATCACGCTCTTGTAGGGAGGACCAGAAACCTGTCACCGGTG ACCCTAGCAAAGACTCAAAAGCTCAGGTGTCCGCTGCCGAGGCTGGCATTACTGG AACATGGTACAATCAGCTCGGGAGCACCTTTATTGTGACTGCTGGAGCCGATGGA GCCCTCACCGGAACATACGAATCTGCTGTGGGAAACGCCGAATCACGGTACGTCC TCACTGGCCGATACGATAGTGCCCCTGCCACCGACGGATCTGGGACTGCCCTGG GATGGACTGTCGCTTGGAAAAACAACTACCGGAATGCTCATTCTGCCACAACATGG AGTGGACAGTACGTGGGAGGCGCTGAGGCTAGAATCAATACACAGTGGCTGCTCA CATCTGGCACAACCGAGGCAAATGCTTGGAAATCCACCCTGGTGGGACATGACAC ATTCACCAAAGTGAAACCCTCCGCCGCTTCAATCGATGCCCTGG
  • the glycine at aa 49 of SEQ ID NO:31 or SEQ ID NO:32 is replaced with a bulkier residue (e.g., threonine) to reduces the biotin binding affinity without affecting the SBP binding affinity.
  • a bulkier residue e.g., threonine
  • Another mutation can also be introduced to further favor SBP binding over biotin (mutation S27A).
  • the vector comprises a hook operably-linked to a promoter, preferably UBC or ⁇ 2 ⁇ , and a CAR comprising a hook-binding protein, operably-linked to an IRES.
  • a preferred IRES nucleotide sequence is: GCCCCTCTCCCTCCCCCCCCCCTAACGTTACTGGCCGAAGCCGCTTGGAATAAGG CCGGTGTGCGTTTGTCTATATGTTATTTTCCACCATATTGCCGTCTTTTGGCAATGT GAGGGCCCGGAAACCTGGCCCTGTCTTCTTGACGAGCATTCCTAGGGGTCTTTCC CCTCTCGCCAAAGGAATGCAAGGTCTGTTGAATGTCGTGAAGGAAGCAGTTCCTCTCT GGAAGCTTCTTGAAGACAAACAACGTCTGTAGCGACCCTTTGCAGGCAGCGGAAC CCCCCACCTGGCGACAGGTGCCTCTGCGGCCAAAAGCCACGTGTATAAGATACAC CTGCAAAGGCGGCACAACCCCAGTGCCACGTTGTGAGTTGGATAGTTGTGGAAAG AGTCAAATGGCTCTCCTCAAGCGTATTCAACAAGGGGCTGAAGGATGCCCAGAAG GTACGCCATTGTATGGGATCTGATCTGGGGCCTCGGTGCACAT
  • the hook is a streptavidin protein, preferably core Streptavidin, and the hook-binding protein is a streptavidin-binding protein.
  • Preferred vectors are lentivectors comprising any of the following nucleotide or amino acid sequences:
  • the vector can be an expression vector.
  • the vector can be a plasmid vector.
  • the vector is a lentiviral vector.
  • a "lentiviral vector” means a non- replicating vector for the transduction of a host cell with a transgene comprising cis- acting lentiviral RNA or DNA sequences, and requiring lentiviral proteins (e.g., Gag, Pol, and/or Env) that are provided in trans.
  • the lentiviral vector lacks expression of functional Gag, Pol, and Env proteins.
  • the lentiviral vector may be present in the form of an RNA or DNA molecule, depending on the stage of production or development of said retroviral vectors.
  • the lentiviral vector can be in the form of a recombinant DNA molecule, such as a plasmid.
  • the lentiviral vector can be in the form of a lentiviral vector particle, such as an RNA molecule(s) within a complex of lentiviral and other proteins.
  • lentiviral particle vectors which correspond to modified or recombinant lentivirus particles, comprise a genome which is composed of two copies of single-stranded RNA. These RNA sequences can be obtained by transcription from a double-stranded DNA sequence inserted into a host cell genome (proviral vector DNA) or can be obtained from the transient expression of plasmid DNA (plasmid vector DNA) in a transformed host cell.
  • the lentiviral vector particles have the capacity for integration.
  • they contain a functional integrase protein.
  • Non-integrating vector particles have one or more mutations that eliminate most or all of the integrating capacity of the lentiviral vector particles.
  • a non-integrating vector particle can contain mutation(s) in the integrase encoded by the lentiviral pol gene that cause a reduction in integrating capacity.
  • an integrating vector particle comprises a functional integrase protein that does not contain any mutations that eliminate most or all of the integrating capacity of the lentiviral vector particles.
  • Lentiviral vectors derive from lentiviruses, in particular human immunodeficiency virus (HIV-1 or HIV-2), simian immunodeficiency virus (SIV), equine infectious encephalitis virus (EIAV), caprine arthritis encephalitis virus (CAEV), bovine immunodeficiency virus (BIV) and feline immunodeficiency virus (FIV), which are modified to remove genetic determinants involved in pathogenicity and introduce new determinants useful for obtaining therapeutic effects.
  • HSV-1 or HIV-2 human immunodeficiency virus
  • SIV simian immunodeficiency virus
  • EIAV equine infectious encephalitis virus
  • CAEV caprine arthritis encephalitis virus
  • BIV bovine immunodeficiency virus
  • FV feline immunodeficiency virus
  • trans-acting sequences e.g., gag, pol, tat, rev, and env genes
  • CTS central termination sequence
  • the invention encompasses a lentiviral vector comprising a central polypurine tract and central termination sequence referred to as cPPT/CTS sequence as described, in particular, in the European patent application EP 2 169 073.
  • LTRs long terminal repeats
  • Vectors may be obtained by mutating the LTR sequences, for instance, in domain U3 of said LTR (AU3) (Miyoshi H et al, 1998, J Virol. 72(10):8150-7; Zufferey et al., 1998, J V/ro/ 72(12):9873-80).
  • the vector does not contain an enhancer.
  • the invention encompasses a lentiviral vector comprising LTR sequences, preferably with a mutated U3 region (AU3) removing promoter and enhancer sequences in the 3' LTR.
  • AU3 mutated U3 region
  • the packaging sequence ⁇ (psi) can also be incorporated to help the encapsidation of the polynucleotide sequence into the vector particles (Kessler et al., 2007, Leukemia, 21 (9): 1859-74; Paschen et al., 2004, Cancer Immunol Immunother 12(6): 196-203).
  • the invention encompasses a lentiviral vector comprising a lentiviral packaging sequence ⁇ (psi).
  • the invention can also be advantageously included in the lentiviral vector polynucleotide sequence of the present invention, to obtain a more stable expression of the transgene in vivo.
  • WPRE Element
  • the invention encompasses a lentiviral vector comprising a PBS.
  • the invention encompasses a lentiviral vector comprising a WPRE and/or an IRES.
  • the lentiviral vector comprises at least one cPPT/CTS sequence, one ⁇ sequence, one (preferably 2) LTR sequence, and an expression cassette including a transgene under the transcriptional control of a ⁇ 2 ⁇ or class I MHC promoter.
  • the invention encompasses the use of promoters to drive high expression of CARs from lentivectors in T cells, preferably human T cells.
  • Preferred promoters are human ubiquitin, MHC class I, MHC class II, and ⁇ 2 microglobulin ( ⁇ 2 ⁇ ) promoters.
  • the promoter drives high expression in antigen presenting cells, including dendritic cells.
  • the promoter lacks an enhancer element to avoid insertional effects.
  • the promoter is not a CMV promoter/enhancer.
  • the promoter is not a dectin-2 or MHCII promoter.
  • HLA-A2 (MHC I):
  • a sequence of the human p2-microglobulin promoter is shown below: aacatcacgagactctaagaaaaggaaactgaaaacgggaaagtccctctctaacctggcac tgcgtcgctggcttggagacaggtgacggtccctgcgggccttgtcctgattggctgggcacgc gtttaatataagtggaggcgtcgcgctggcgggcattcctgaagctgacagcattcgggccgag (SEQ ID NO: 14) .
  • the lentiviral vector comprises a ⁇ 2 ⁇ , Ubi, MHCII, or MHC class I promoter.
  • the MHC class I promoter is an HLA-A2 promoter, an HLA-B7 promoter, an HLA-Cw5 promoter, an HLA-F, or an HLA-E promoter.
  • the promoter sequence comprises a polynucleotide sequence that shares more than 90%, preferably more than 95%, more preferably more than 99% identity with the promoter sequence of SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:1 1 , SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:38, or SEQ ID NO:41.
  • the expression of the promoter in BDCA+ dendritic cells is at least 10, 12, 15, 20, 25, 30, 35, 40, 50, or 60 times the expression of that promoter in skeletal muscle cells.
  • the invention encompasses lentiviral vector particles comprising a lentiviral vector that comprises a dendritic cell-specific promoter directing expression of a microbial or tumor antigen, wherein the lentiviral vector particles exhibit higher expression of the antigen in BDCM cells than in HEK 293 T cells.
  • the invention encompasses lentiviral vectors containing a promoter that does not contain an enhancer.
  • the invention encompasses the insertion of an MHC Class I (MHCI), Ubi,
  • an "MHC Class I (MHCI) promoter” or “ ⁇ 2 microglobulin promoter” or “MHC Class II (MHCII)” or “human ubiquitin promoter” includes a naturally occurring or synthetic MHC Class I promoter or ⁇ 2 microglobulin promoter or MHC Class II promoter or human ubiquitin promoter.
  • MHC Class I promoter does not include a ⁇ 2 ⁇ promoter.
  • the lentiviral vector particles comprising the promoter exhibit higher expression in BDCM cells than in HEK 293 T cells.
  • the promoter can be a naturally occurring promoter.
  • naturally occurring promoters are the human p2m, HLA-A2, HLA-B7, HLA-Cw5, HLA-E, HLA-F, HLA-DRa, and ubiquitin gene promoters.
  • MHC Major Histocompatibility Complex
  • MHC class I proteins have been widely studied and described for many years, their genes are well characterized and detectable using sequence comparison tools, such as the BLAST method (Altschul, S.F. et al. (1990). Basic local alignment search tool. J. Mol. Biol. 215(3):403-410).
  • BLAST method Altschul, S.F. et al. (1990). Basic local alignment search tool. J. Mol. Biol. 215(3):403-410.
  • the promoters of the invention can contain further regulatory elements, such as one or more Sp1 and ETs binding sites.
  • the MHC class I promoter contains 2 Sp1 binding sites and 1 Ets binding site.
  • Ap1 and/or Ap2 sites are further contained in the promoter.
  • Preferred promoters are naturally occurring human ⁇ 2 ⁇ , HLA-A2, HLA-B7, HLA-Cw5, HLA-E and HLA-F promoters.
  • Promoters can also be synthetic. Synthetic promoters include promoters that are synthesized using molecular biological techniques to assemble the individual components of a promoter or that are derived from naturally occurring promoters using molecular biological techniques.
  • the synthetic promoter comprises a polynucleotide sequence that shares more than 90%, preferably more than 95%, more preferably more than 99% identity, or 100% with the promoter sequence of a ⁇ 2 ⁇ , Ubi, MHC class II, or MHC class I gene promoter (e.g., SEQ ID NOs: 9-14, 38, or 41 ).
  • MHC class genes are usually mediated by two major regulatory elements: Interferon stimulated response element (ISRE) and the SXY module (encompassing the W/S, X1X2/Site a and Y/enhancer B regulatory elements). See Van den Elsen, Immunogenetics (1998) 48:208-21 1.
  • ISRE Interferon stimulated response element
  • SXY module encompassing the W/S, X1X2/Site a and Y/enhancer B regulatory elements.
  • These regulatory promoter elements are localized in a region extending approximately from nucleotides -220 to -95 upstream of the transcription initiation site. They mediate tissue-specific and cytokine-induced transcription of MHC class I genes.
  • the ISRE of MHC class I gene promoters generally contains binding sites for interferon regulatory factor (IRF) family members. It is thus a property of MHC class I promoters to bind to interferon regulatory factor (IRF) family members. This may be verified, for example, by gel shift assays.
  • IRF interferon regulatory factor
  • enhancer A containing binding sites for nuclear transcription factor ⁇ (NF- ⁇ )
  • NF- ⁇ nuclear transcription factor ⁇
  • MHC class I promoters In addition to ISRE, MHC class I promoters generally share another set of conserved upstream sequence motifs, consisting of three regulatory elements: the S or W box, the X1/CREX2 boxes or site a, and the Y box or enhancer B, which together are termed the SXY module.
  • This SXY module is generally cooperatively bound by a multiprotein complex containing regulatory factor X (RFX; consisting of RFX5, RFXB/ANK and RFXAP), cAMP response element binding protein (CREB)/activating transcription factor (ATF), and nuclear factor Y (NFY), which acts as an enhanceosome driving transactivation of these genes. It is thus a property of MHC class I promoters to bind to these factors. This may be verified, for example, by gel shift assays.
  • MHC class II promoters do not display enhancer A nor ISRE elements (Van den Elsen, P.J. et al, 1998, Immunogenetics. 48:208-221 ).
  • RFX and CIITA in MHC class II gene regulation have been found of crucial importance as illustrated by studies with cell lines established from patients with the bare lymphocyte syndrome (BLS), a severe combined immunodeficiency due to mutations in one of the RFX subunits or CIITA (DeSandro, A. et al., 1999, Am J Hum Genet, 65:279- 286).
  • the invention encompasses a method comprising inserting a promoter of the invention, particularly a ⁇ 2 ⁇ , Ubi, MHC class II, or MHC class I promoter, into a lentiviral vector to direct expression of a CAR of the invention.
  • the method can further comprise inserting any of the other nucleic acid elements mentioned herein, such as a DNA flap sequence.
  • the invention encompasses cells, particularly cells of the immune system, comprising vectors and lentiviral vector particles encoding a CAR of the invention.
  • the cells are T cells, including ⁇ and ⁇ cells, or NK cells.
  • the cell contains the vector integrated into the cellular genome.
  • the cell contains the vector transiently expressing the CAR.
  • the cell produces lentiviral vector particles encoding the CAR.
  • the invention encompasses a cell line, a population of cells, or a cell culture comprising vectors and lentiviral vector particles encoding the CAR.
  • the present invention provides a method for producing a lentiviral vector particle.
  • a lentiviral vector particle (or lentiviral particle vector) comprises a lentiviral vector in association with viral proteins.
  • the vector is preferably an integrating vector.
  • the lentiviral vector particles encode a CAR of the invention.
  • the lentiviral vector particle comprises HIV-1 Gag and Pol proteins.
  • the lentiviral vector particle comprises subtype D, especially HIV-1 NDK, Gag and Pol proteins.
  • the lentivector particles are obtained in a host cell transformed with a DNA plasmid.
  • Such a DNA plasmid can comprise:
  • KanR antibiotic resistance gene
  • lentiviral vector comprising at least one nucleic acid encoding a CAR transcriptionally linked to a ⁇ 2 ⁇ , Ubi, MHC class II, or MHC class I promoter.
  • Such a method allows producing a recombinant vector particle according to the invention, comprising the following steps of:
  • a packaging plasmid vector containing viral DNA sequences encoding at least structural and polymerase (+ integrase) activities of a retrovirus (preferably lentivirus);
  • a retrovirus preferably lentivirus
  • packaging plasmids are described in the art (Dull et al., 1998, J Virol, 72(1 1 ):8463-71 ; Zufferey et al., 1998, J Virol 72(12):9873-80).
  • iii) culturing said transfected host cell in order to obtain expression and packaging of said lentiviral vector into lentiviral vector particles; and iv) harvesting the lentiviral vector particles resulting from the expression and packaging of step iii) in said cultured host cells.
  • pseudotype the obtained retroviral particles i.e. to add or replace specific particle envelope proteins.
  • this may be advantageous to have different envelope proteins in order to distinguish the recombinant particle from natural particles or from other recombinant particles.
  • pseudotyped particle vectors are more likely to escape the immune system, when this latter already developed immunity against lentiviruses. This is particularly helpful when successive injections of similar particle vectors are required for immunizing a patient against a disease.
  • the host cell can be further transfected with one or several envelope DNA plasmid(s) encoding viral envelope protein(s), preferably a VSV-G envelope protein.
  • An appropriate host cell is preferably a human cultured cell line as, for example, a HEK cell line.
  • the method for producing the vector particle is carried out in a host cell, which genome has been stably transformed with one or more of the following components: a lentiviral vector DNA sequence, the packaging genes, and the envelope gene.
  • a lentiviral vector DNA sequence may be regarded as being similar to a proviral vector according to the invention, comprising an additional promoter to allow the transcription of the vector sequence and improve the particle production rate.
  • the host cell is further modified to be able to produce viral particle in a culture medium in a continuous manner, without the entire cells swelling or dying.
  • a culture medium in a continuous manner, without the entire cells swelling or dying.
  • One may refer to Strang et ai, 2005, J Virol 79(3): 1 165-71 ; Relander ef a/., 2005, Mol Ther 1 1 (3):452-9; Stewart et ai, 2009, Gene Ther, 16(6):805- 14; and Stuart et ai, 201 1 , Hum gene Ther, with respect to such techniques for producing viral particles.
  • An object of the present invention consists of a host cell transformed with a lentiviral particle vector.
  • the lentiviral particle vectors can comprise the following elements, as previously defined: - cPPT/CTS polynucleotide sequence; and
  • nucleic acid encoding a CAR under control of a ⁇ 2 ⁇ , Ubi, or MHCI promoter, and optionally one of the additional elements described above.
  • the lentivector particles are in a dose of 10 6 , 2 x 10 6 , 5x 10 6 , 10 7 , 2 x 10 7 , 5 x 10 7 , 10 8 , 2 x 10 8 , 5 x 10 8 , or 10 9 TU.
  • the present invention encompasses methods for expressing a CAR in a cell, preferably in T cells, and preferably in expanded T cells.
  • the method comprises transducing a cell with a lentiviral vector or lentiviral particle vector of the invention under conditions that allow the expression of the CAR, and preferably expanding the T cells.
  • the cells are preferably mammalian cells, particularly human cells. Particularly preferred are human non-dividing cells.
  • the cells are primary T cells or NK cells.
  • the method can further comprise harvesting or isolating the CAR.
  • the lentiviral vector or lentiviral particle vector preferably comprises a promoter of the invention.
  • the method comprises treating the cells with biotin to release the CAR from the hook.
  • the cells are treated with biotin at an initial concentration of, at least, 0.2, 0.4, 0.8. 1.6, 2.5, 5, 10, 20, 40, or 80 ⁇ .
  • the invention encompasses a method for expressing a CAR comprising inserting a ⁇ 2 ⁇ , Ubi, or MHCI promoter into a lentiviral vector such that it direct the expression of a nucleic acid encoding a CAR and transducing a cell, preferably a T or NK cell, with the vector containing the promoter, and optionally, treating the cell with biotin at an initial concentration of, at least, 0.2, 0.4, 0.8. 1.6, 2.5, 5, 10, 20, 40, or 80 ⁇ .
  • the present invention further relates to the use of the lentiviral vectors according to the invention, especially in the form of lentiviral vector particles, for the preparation of therapeutic compositions or vaccines which are capable of inducing or contributing to the occurrence or improvement of an immunological reaction with the CAR encoded by the vectors.
  • the invention encompasses methods of administration of a lentiviral vector (or "lentivector") to a human.
  • the lentivector particle is an integrating lentivector particle, comprising a functional integrase protein.
  • Preferred modes of administration include reinfusion of the modified T cells, preferably intravenously or intra-articular administration, most preferably intra- tumoral administration.
  • the invention comprises a method for inducing an immune response in a human comprising administering lentiviral vector particles comprising a functional integrase protein and a lentiviral vector to T or NK cells and administering the modified cells to a human; wherein the integrating lentiviral vector comprises a promoter directing expression of a CAR; and generating immunological reaction with the CAR.
  • the invention can also be used in treatment protocols against tumors and cancers and especially could be used in protocols for immunotherapy or vaccination therapy against cancers and tumors.
  • the invention further relates to an immunogenic composition comprising a lentiviral vector as previously defined.
  • the immunogenic compositions of the invention preferably contain cPPT and CTS sequences in the vector and vector particles to induce or to stimulate the nuclear import of the vector genome in the target cells.
  • the vector comprises a CAR and regulatory signals of retrotranscription, expression and encapsidation of retroviral or retroviral-like origin.
  • the lentiviral vectors according to the invention have the ability to redirect the specificity and function of T lymphocytes and/or other immune cells. They can rapidly generate T cells targeted to a specific tumor antigen or an antigen relevant in other pathologies like auto-immune diseases.
  • the lentiviral vectors of the invention can be used in methods of treatment and methods of inducing an immune response comprising administering the lentiviral vector to a cell, preferably a T or NK cell, administering the cell to a host, and generating a specific immune response that redirects the specificity and function of T lymphocytes and/or other immune cells.
  • a particular advantage of the immunogenic compositions of the invention is that they can be used to redirect the specificity and function of T lymphocytes and other immune cells against multiple antigens against which the CAR in the vector or vector particles are directed.
  • the invention encompasses a composition that could be used in therapeutic vaccination protocols.
  • the invention encompasses a composition for administration to a human comprising lentiviral vector particles comprising a functional integrase protein and a lentiviral vector; wherein the DNA of the lentiviral vector comprises a promoter directing expression of an amino acid comprising or consisting of a CAR.
  • the invention encompasses administering, preferably via intramuscular administration, a lentiviral vector, or cells transduced by the lentiviral vector, encoding a chimeric antigen receptor comprising a binding domain; a transmembrane domain; a hook-binding domain, preferably comprising a streptavidin- binding peptide; and an activation domain comprising a T cell activating fragment of at least 100 amino acids of SEQ ID NO:3; SEQ ID NO:4; SEQ ID NO:5; SEQ ID NO:6, SEQ ID NO:7, or SEQ ID NO:8, SEQ ID NO:33, or SEQ ID NO:34 to a human.
  • the lentiviral vector further comprises a hook, preferably comprising a streptavidin protein, most preferably comprising the amino acid sequence of SEQ ID NO:32, SEQ ID NO:33, or a mutant thereof having a mutation of the Glycine at amino acid 49, preferably to threonine.
  • the hook-binding domain comprises the amino acid sequence of SEQ ID NO:1 or is encoded by the nucleic acid sequence of SEQ ID NO:2.
  • the method can further comprise administering biotin to the human to release the CAR from the ER or Golgi.
  • the biotin is administered at an initial concentration of at least, 0.2, 0.4, 0.8. 1.6, 3.2, 5, 10, 20, 40, or 80 ⁇ .
  • PCR amplification of the proviral region of the pTRIPAU3-CMV-GFP(15) was performed using direct (5'-CTTACTAGTTGGAAGGGCTAATTCACTCCCAAC-3'; SEQ ID NO: 15) and reverse (5 '-CATTCTAG AACTGCTAG AG ATTTTCCACACTG-3 ' ; SEQ ID NO:16) oligonucleotides encompassing respectively the Spel and Xbal restriction sites.
  • the resulting fragment was digested and cloned between the Spel and Xbal sites of the pVAX-1 plasmid (Invitrogen, Lifetech) from which the Mlul site have been deleted.
  • the resulting plasmid was named pFLAP-CMV-GFP.
  • the SV40 sequence was amplified by PCR from the pTRIPAU3-CMV-GFP plasmid (using the 5'- TACCCCGGGCCATGGCCTCCAAAAAAGCCTCCTCACTACTTC-3' (SEQ ID NO: 17) and 5'-ACTCCCGGGTAATTTTTTTTATTTATGCAGAGGCCGAGGCCGCC-3' (SEQ ID NO: 18) oligonucleotides), and cloned into the Pml1 site of the pFLAP-CMV-GFP, the resulting plasmid being then named pFLAP-CMV-GFP-SV.
  • the CMV promoter was amplified with direct (5'-TACACGCGTGGAGTTCCGCGTTACATAACTTACGG-3'; SEQ ID NO: 19) and reverse (5'- CGTGGATCCGATCGCGGTGTCTTCTATGGAGGTCAAAAC-3'; SEQ ID NO:20) oligonucleotides encompassing the Mlul and BamHI sites, respectively.
  • the resulting fragment was cloned back between the Mlul and BamHI sites of the pFlap-CMV-GFP- SV allowing the easy replacement of the promoters inside the lentiviral vectors.
  • the promoter was then amplified by PCR from HEK 293T cells DNA with 5'- GCCGGCGCGCCGAGAAACCCTGCAGGGAATTCCC-3' (SEQ ID NO:21 ) and 5'- CGTGGATCCGATCGCTCGGCCCGAATGCTGTCAGCTTCAGG-3' (SEQ ID NO:22) for the P2m promoter and cloned between the Mlul and BamH1 sites of pFLAP-CMV- GFP-SV to create pFlap-p2m-SV.
  • the amplified ⁇ 2 ⁇ promoter sequence is the following
  • pFlap-p2m-GFP-SV can be digested by BamHI and Xhol, and a DNA linker containing a Multiple Cloning Site (MCS, carrying Sail, Sacll, Ndel, AscI and Nhel restriction sites) can be cloned between those sites, in place of the GFP gene to allow insertion of a nucleic acid sequence encoding the CAR.
  • MCS Multiple Cloning Site
  • the packaging plasmid pTHV-GP-N was constructed by amplifying the
  • HIV-1 NDK genome by PCR using the following oligonucleotides with 5'- atgcatgcgtcgacctcgagttaatcctcatcctgtctacttgccac-3' (SEQ ID NO:24) and 5'- gcatgcatcggccggggcggcgactgGTgagagGCCACCatgggtgcgagagcgtcagtattaag-3' (SEQ ID NO:25)).
  • the resulting fragment has been digested by Eagl and Sail restriction enzymes and inserted in the p8.74 packaging plasmid (15) from which the Eag1 -Sall fragment had been previously removed.
  • Pseudotyping plasmids were generated by synthesizing the codon optimized genes corresponding to the vesicular stomatitis virus Indiana (GenBank #CAX62728.1 ), New Jersey GenBank #CAX62729.1 ) and Cocal (GenBank # CAX62731 .1 ) strains. Those genes were then digested with EcoR1 and BamHI and cloned between the corresponding restriction sites of the pVAX1 plasmid (Invitrogen, Lifetech).
  • the plasmids can produced using Nucleobond Xtra Maxi EF column according to manufacturer's instructions (Macherey Nagel).
  • Vectors can be produced by transient calcium- phosphate transfection of HEK 293T as previously described (25).
  • HEK 293T human embryonic kidney cell line, ATCC CRL-1 1268, (Graham et al. 1977) cells were maintained in Dubelcco's modified Eagle's medium (DMEM/ High modified, Hyclone) supplemented with 10% fetal bovine serum (FBS, PAA), 1 % L-Glutamine (Eurobio), 1 % Penicillin-Streptomycin (Gibco by Life technologies) and 1 % Sodium Pyruvate (Gibco by Life technologies).).
  • the cell line was kept in an incubator with humidified atmosphere of 5% CO 2 at 37°C.
  • the lentiviral vectors were produced by transient transfection of HEK 293T cells using a standard calcium phosphate precipitation protocol.
  • HEK 293T cells were seeded at 7x10 6 cells in 10cm 2 Tissue Culture Dish (BD Falcon) in 10mL of complete culture medium and maintained 24h in an incubator with humidified atmosphere of 5% C0 2 at 37°C to adhere.
  • the medium was replaced 24 h after transfection by 7mL of harvest medium without serum and the viral supernatant was harvested after an additional 24h, and clarified by centrifugation 5min. at 2500rpm.
  • the harvest clarified bulk (210mL) is then treated 30min. with DNase (Roche) in the presence of MgC (Sigma Aldrich) to avoid residual transfection DNA, and ultraconcentrated by centrifugation 1 h at 22000rpm, 4°C.
  • HEK 293T cells are seeded in 6-well plates (BD Falcon) in culture medium and incubated for 4 h at 37°C, 5% C02 in moist atmosphere. Cells are transduced with 3 successive dilutions of lentiviral vector. 72h post-incubation, cells are harvested and transduced HEK 293T cell pellets are produced. Total genomic DNA from transduced cell-pellets is extracted using a method based on QIAGEN QIAamp DNA mini kit handbook. Proviral quantification is performed using Taqman qPCR.
  • the amplification is performed with the Master Mix (Fermentas Thermo Scientific), the Flap A (CCCAAGAACCCAAGGAACA; SEQ ID NO:26) and Flap S (AGACAA GATAGAGGAAGAGCAAAAC; SEQ ID NO:27) primers and LENTI TM probe (6FAM- AACCATTAGGAGTAGCACCCACCAAGG-BBQ; SEQ ID NO:52).
  • Lentiviral vectors were generated encoding CARs.
  • the CAR CD19 2nd and 3rd generation sequences (SEQ ID NO:39 and SEQ ID NO:40) were purchased from GeneArt (Lifetech), and cloned replacing the GFP gene between BamHI and Xhol restrictions sites of the pFlap-AU3-p2m-GFP, pFlap-AU3-HLA-A2-GFP, pFlap-AU3- HLA-DRa-GFP or pFlap-AU3-UBC-GFP, depending of the required promoter.
  • CARs were generated as a fusion protein with SBP at 3 different positions.
  • the lentiviral vectors were further modified to contain a hook for the ER fused to a core Streptavidin protein.
  • the promoter was an ⁇ 2 ⁇ promoter.
  • lentiviral vectors will be used in in vitro and animal models of cancer.
  • Biotin will be administered at 40 ⁇ (with a titration of higher and lower concentrations) initial concentration to test for release from the ER.
  • migration of the CAR to the surface of the cell (GFP in place of the binding domain or between the signal sequence and the binding domain) will be analyzed in vitro.
  • animal models mice and rats
  • CAR-T cells evaluation of the migration at the surface of cells (GFP) from the animal.
  • Both "second generation” CAR (2 intra cytoplasmic activating domains) and “third generation” CAR (3 intra cytoplasmic activating domains) constructs will be generated containing a hook-binding domain (SBP). Initially, the binding domains evaluated will be anti-CD19, anti-PDL-1 , anti-PD1 , anti-hedgehog, anti-CD123, and anti- CD123/CD33.
  • SBP hook-binding domain
  • CARMIN 1 .0 development of lentiviral vectors coding for CAR of the second (containing the CD3_ and the 4-1 BB cosignaling domains) and third generations (containing the CD3_, the CD28 and the 4-1 BB domains) directed against CD19 (for CD19+ leukemias and lymphomas), LMP-1 and -2 (for EBV-induced leukemias).
  • the lentiviral vectors allow optimal expression of CAR in T cells and the impact on the efficacy of CAR-T cells is under investigation. Hematological malignancies can be used as a benchmark.
  • CARMIN 2.0 development of a switchable on/off system which is based on a W protein anchored to the membrane of the endoplasmic reticulum (ER) through a hook, and its binding partner Y introduced into the CAR structure.
  • the interaction between the X-hook (e.g., Streptavidin) and the Y (e.g., Streptavidin-Binding Protein)- CAR allows the CAR retention inside the ER.
  • the addition of a Z protein e.g., Biotin
  • the release of the CAR will stop with Z exhaustion (or antagonist) and remaining cells can be easily reactivated through reintroduction of the Z inducer.
  • Hook and CAR are vectorized in one lentivector and can be used in clinics (b2m-HOOK-l RES-CAR). Evaluations can be performed in vitro both on immortalized cells (HEK293T, Jurkat, HeLa) and on primary cells (T-cells). This system will increase safety of CAR-T cells.
  • a switchable CD19-CAR system can be evaluated in vitro for expression and in vivo for efficacy.
  • PBMC Peripheral blood mononuclear cells
  • PBMC washing CD3+ T cells were purified by negative magnetic selection (ie unwanted cells were magnetically labelled while T cells were left untouched) using the Pan T Cell Isolation Kit (Miltenyi). This step is required to obtain a highly purified T cell population. According to the yield obtained after this step of isolation, 10 7 to 10 8 T cells were cultured at 2,5x10 6 /ml in an optimized serum-free cell culture medium developed for the cultivation and expansion of human T cells (TexMACS medium, Miltenyi). These T cells are activated by the T cell Activation/Expansion kit from Miltenyi.
  • the kit consists of anti-biotin MACSiBead Particles and biotinylated antibodies against human CD2, CD3 and CD28.
  • Anti-biotin MACSiBead Particles loaded with biotinylated antibodies are used to mimic antigen- presenting cells and to activate T cells.
  • An optimal activation of T cells is accomplished by using one loaded anti-biotin MACSiBead Particle per two cells. T cells are activated for 3 days. Transduction of activated T cells was then performed at a MOI of 4 which means that 1 T cell is incubated with 4 transduction units of lentiviral particles.
  • CAR expression was assessed by flow cytometry 48 or 72h lentiviral particle addition, by staining the murine CD19-binding domain with a biotinylated goat anti-mouse IgG followed by streptavidin conjugated to phycoerythrin. T cell subpopulations were characterized by CD3, CD4 and CD8 staining. This allowed specific detection of the CAR on the surface of T cells. The whole process was performed with the TexMACS medium allowing survival and expansion of T cells.
  • PBMC Peripheral Blood Mononuclear Cells
  • Ficoll Lymphocyte Separation Medium, Eurobio
  • T cells were then purified from PBMC by magnetic isolation using the Pan T cell isolation kit (Miltenyi). T cells were separated according to the manufacturer's instructions.
  • T cells were put in culture at a concentration of 2,5x106 cells/ml in TexMACS medium (Miltenyi) at 37°C / 5%CO2 and activated 3 days by the T cell activation/expansion kit (anti-CD2/-CD3/-CD28 nanoparticles prepared according the manufacturer's instructions) from Miltenyi at a bead:T cell ratio of 1 :2. After activation, T cells were harvested, counted and put in culture in TexMACS medium in 24 well-plates at 37°C / 5% CO2. Transduction was performed by adding directly into wells lentiviral vectors at different MOI.
  • the different lentiviral vectors tested were: (i) the 2nd generation anti- CD19 CAR containing the 4-1 BB and the CD3zeta intracellular domains; (ii) the same vector containing the streptavidin binding protein at three different positions (CAR- SBP1 , CAR-SBP2, CAR-SBP3).
  • (MOI x number of cells (in millions) / concentration of vector (transduction unit/ml)) x 1000.
  • Human recombinant IL-2 (Miltenyi) was added the day of the transduction at 50 Ill/ml.
  • transduced T cells were harvested, washed extensively with DPBS 1 X and immunostaining of molecules of interest was performed in 96 well-plates.
  • T cells were first incubated with a viability dye (Fixable Viability Dye, eBiosciences) conjugated to eFluor 780 and incubated 30 minutes at 4°C. The incubation was performed in azide- free and protein-free DPBS1X. Cells were then washed with DPBS 1X and then incubated with a biotinylated Goat anti-mouse IgG (Fab')2 (Jackson ImmunoResearch) for 30 minutes a 4°C.
  • Fab' biotinylated Goat anti-mouse IgG
  • Example 7 Expression and behaviour of CAR-RUSH constructs following co- transduction with a lentivector encoding a HOOK-streptavidin, and biotin treatment
  • PBMC Peripheral Blood Mononuclear Cells
  • Ficoll Lymphocyte Separation Medium, Eurobio
  • T cells were then purified from PBMC by magnetic isolation using the Pan T cell isolation kit (Miltenyi). T cells were separated according to the manufacturer's instructions. T cells were put in culture at a concentration of 2,5x10 6 cells/ml in TexMACS medium (Miltenyi) at 37°C / 5%CC>2 and activated 3 days by the T cell activation/expansion kit (anti-CD2/- CD3/-CD28 nanoparticles prepared according the manufacturer's instructions) from Miltenyi at a bead:T cell ratio of 1 :2.
  • T cells were harvested, counted and put in culture in TexMACS medium in 24 well-plates at 37°C / 5% C0 2 .
  • Co-transduction was performed by adding directly into wells lentiviral vectors at different MOI.
  • the two lentiviral vectors tested were: (i) a hook-streptavidin vector and (ii) the 2nd generation anti-CD19 CAR containing the 4-1 BB and the CD3zeta intracellular domains with the streptavidin binding protein at three different positions (CAR-SBP1 , CAR-SBP2 and CAR-SBP3).
  • transduced T cells were harvested, washed extensively with DPBS 1X and immunostaining of molecules of interest was performed in 96 well-plates.
  • T cells were first incubated with a viability dye (Fixable Viability Dye, eBiosciences) conjugated to eFluor 780 and incubated 30 minutes at 4°C. The incubation was performed in azide-free and protein-free DPBS1X. Cells were then washed with DPBS 1X and then incubated with a biotinylated Goat anti-mouse IgG (Fab')2 (Jackson ImmunoResearch) for 30 minutes a 4°C.
  • Fab' biotinylated Goat anti-mouse IgG
  • PBMC Peripheral Blood Mononuclear Cells
  • Ficoll Lymphocyte Separation Medium, Eurobio
  • T cells were then purified from PBMC by magnetic isolation using the Pan T cell isolation kit (Miltenyi). T cells were separated according to the manufacturer's instructions.
  • T cells were put in culture at a concentration of 2,5x106 cells/ml in TexMACS medium (Miltenyi) at 37°C / 5%CO2 and activated 3 days by the T cell activation/expansion kit (anti-CD2/-CD3/-CD28 nanoparticles prepared according the manufacturer's instructions) from Miltenyi at a bead:T cell ratio of 1 :2.
  • T cell activation/expansion kit anti-CD2/-CD3/-CD28 nanoparticles prepared according the manufacturer's instructions
  • T cells were harvested, counted and put in culture in TexMACS medium in 24 well-plates at 37°C / 5% CO2. Transduction was performed by adding directly into wells lentiviral vectors at different MOI.
  • the different lentiviral vectors tested were ; (i) the "classical" 2nd generation anti-CD19 CAR; (ii) three constructions containing the hook-streptavidin, an IRES and the 2nd generation anti- CD19 CAR containing the 4-1 BB and the CD3zeta intracellular domains with the streptavidin binding protein at three different positions (hook-IRES-CAR-SBP1 , hook- IRES-CAR-SBP2, hook-IRES-CAR-SBP3).
  • T cells were harvested, washed extensively with DPBS 1X and immunostaining of molecules of interest was performed in 96 well- plates.
  • T cells were first incubated with a viability dye (Fixable Viability Dye, eBiosciences) conjugated to eFluor 780 and incubated 30 minutes at 4°C. The incubation was performed in azide-free and protein-free DPBS1X. Cells were then washed with DPBS 1 X and then incubated with a biotinylated Goat anti-mouse IgG (Fab')2 (Jackson ImmunoResearch) for 30 minutes at 4°C.
  • Fab' biotinylated Goat anti-mouse IgG
  • PBMC Peripheral Blood Mononuclear Cells
  • Ficoll Lymphocyte Separation Medium, Eurobio
  • T cells were then purified from PBMC by magnetic isolation using the Pan T cell isolation kit (Miltenyi). T cells were separated according to the manufacturer's instructions. T cells were put in culture at a concentration of 2,5x10 6 cells/ml in TexMACS medium (Miltenyi) at 37°C / 5%C02 and activated 3 days by the T cell activation/expansion kit (anti-CD2/- CD3/-CD28 nanoparticles prepared according the manufacturer's instructions) from Miltenyi at a bead:T cell ratio of 1 :2.
  • T cells were harvested, counted and put in culture in TexMACS medium in 24 well-plates at 37°C / 5% CO 2 .
  • Transduction was performed by adding directly into wells lentiviral vectors at different MOI.
  • the different lentiviral vectors tested were ; (i) the "classical" 2nd generation anti-CD19 CAR; (ii) three constructions containing the hook-streptavidin, an IRES and the 2nd generation anti- CD19 CAR containing the 4-1 BB and the CD3zeta intracellular domains with the streptavidin binding protein at three different positions (hook-IRES-CAR-SBP1 , hook- IRES-CAR-SBP2, hook-IRES-CAR-SBP3).
  • transduced T cells were harvested, washed extensively with DPBS 1 X and immunostaining of molecules of interest was performed in 96 well-plates.
  • T cells were first incubated with a viability dye (Fixable Viability Dye, eBiosciences) conjugated to eFluor 780 and incubated 30 minutes at 4°C. The incubation was performed in azide-free and protein-free DPBS1 X. Cells were then washed with DPBS 1X and then incubated with a biotinylated Goat anti-mouse IgG (Fab')2 (Jackson ImmunoResearch) for 30 minutes at 4°C.
  • Fab' biotinylated Goat anti-mouse IgG

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Biomedical Technology (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biotechnology (AREA)
  • Wood Science & Technology (AREA)
  • Epidemiology (AREA)
  • Biochemistry (AREA)
  • Cell Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Hematology (AREA)
  • General Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Developmental Biology & Embryology (AREA)
  • Virology (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
PCT/EP2015/067090 2014-07-25 2015-07-24 Lentiviral vectors for regulated expression of a chimeric antigen receptor molecule Ceased WO2016012623A1 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
CN202110939899.3A CN113846062B (zh) 2014-07-25 2015-07-24 用于嵌合抗原受体分子的调控表达的慢病毒载体
HK18108178.7A HK1248720B (zh) 2014-07-25 2015-07-24 用於嵌合抗原受体分子的调控表达的慢病毒载体
EP19159129.6A EP3511413B1 (en) 2014-07-25 2015-07-24 Lentiviral vectors for regulated expression of a chimeric antigen receptor molecule
JP2017524110A JP6940406B2 (ja) 2014-07-25 2015-07-24 キメラ抗原レセプター分子の制御的発現のためのレンチウイルスベクター
CA2956385A CA2956385A1 (en) 2014-07-25 2015-07-24 Lentiviral vectors for regulated expression of a chimeric antigen receptor molecule
US15/327,517 US10752668B2 (en) 2014-07-25 2015-07-24 Lentiviral vectors for regulated expression of a chimeric antigen receptor molecule
CN201580051938.9A CN107531800B (zh) 2014-07-25 2015-07-24 用于嵌合抗原受体分子的调控表达的慢病毒载体
EP15742027.4A EP3172228B1 (en) 2014-07-25 2015-07-24 Lentiviral vectors for regulated expression of a chimeric antigen receptor molecule
US16/931,986 US20210009653A1 (en) 2014-07-25 2020-07-17 Lentiviral vectors for regulated expression of a chimeric antigen receptor molecule

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US201462028889P 2014-07-25 2014-07-25
US62028889 2014-07-25
US201562155811P 2015-05-01 2015-05-01
US62155811 2015-05-01
EP15306036 2015-06-29
EP15306036.3 2015-06-29

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/327,517 A-371-Of-International US10752668B2 (en) 2014-07-25 2015-07-24 Lentiviral vectors for regulated expression of a chimeric antigen receptor molecule
US16/931,986 Continuation US20210009653A1 (en) 2014-07-25 2020-07-17 Lentiviral vectors for regulated expression of a chimeric antigen receptor molecule

Publications (1)

Publication Number Publication Date
WO2016012623A1 true WO2016012623A1 (en) 2016-01-28

Family

ID=53514131

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2015/067090 Ceased WO2016012623A1 (en) 2014-07-25 2015-07-24 Lentiviral vectors for regulated expression of a chimeric antigen receptor molecule

Country Status (6)

Country Link
US (2) US10752668B2 (enExample)
EP (2) EP3172228B1 (enExample)
JP (3) JP6940406B2 (enExample)
CN (2) CN113846062B (enExample)
CA (1) CA2956385A1 (enExample)
WO (1) WO2016012623A1 (enExample)

Cited By (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017180587A3 (en) * 2016-04-11 2017-12-14 Obsidian Therapeutics, Inc. Regulated biocircuit systems
CN108276493A (zh) * 2016-12-30 2018-07-13 南京传奇生物科技有限公司 一种新型嵌合抗原受体及其应用
WO2019077164A1 (en) 2017-10-20 2019-04-25 Institut Curie CROCHET FUSION PROTEIN FOR REGULATING THE CELLULAR TRAFFIC OF A TARGET PROTEIN
WO2019077165A1 (en) 2017-10-20 2019-04-25 Institut Curie DAP10 / 12-BASED CHIMERIC ANTIGENIC RECEPTORS (CAR) ADAPTED FOR RUSH
WO2019087151A1 (en) 2017-11-03 2019-05-09 Sorrento Therapeutics, Inc. Cd38-directed chimeric antigen receptor constructs
WO2019145796A2 (en) 2018-01-17 2019-08-01 Aratinga Bio Tnp Polymer-encapsulated viral vectors for genetic therapy
EP3549597A1 (en) * 2018-04-06 2019-10-09 Heinrich-Heine-Universität Düsseldorf Synthetic signalling constructs and its use
WO2019199689A1 (en) * 2018-04-09 2019-10-17 The Trustees Of The University Of Pennsylvania Methods and compositions comprising a viral vector for expression of a transgene and an effector
WO2021069915A1 (en) * 2019-10-09 2021-04-15 Autolus Limited Engineered immune cell
US11058725B2 (en) 2019-09-10 2021-07-13 Obsidian Therapeutics, Inc. CA2 compositions and methods for tunable regulation
WO2022101482A1 (en) 2020-11-13 2022-05-19 Honing Biosciences Means and methods for regulating intracellular trafficking of secretory or cell membrane-anchored proteins of interest
IT202100011576A1 (it) * 2021-05-06 2022-11-06 Univ Degli Studi Padova Nuova sequenza promotore per terapia genica
WO2023084094A1 (en) 2021-11-15 2023-05-19 Theravectys Lentiviral vectors for expression of human papillomavirus (hpv) antigens and its implementation in the treatment of hpv induced cancers
WO2024023135A1 (en) 2022-07-27 2024-02-01 Theravectys Lentiviral vectors for expression of human papillomavirus (hpv) antigens and its implementation in the treatment of hpv induced cancers
US12071474B2 (en) 2017-05-01 2024-08-27 The Trustees Of The University Of Pennsylvania Monoclonal antibodies against alpha-synuclein fibrils
EP4208175A4 (en) * 2020-09-01 2025-05-07 The Trustees of The University of Pennsylvania IMPROVED GENERATION OF T-CELL TRANSDUCING LENTIVIRAL VECTORS USING A COCAL ENVELOPE
EP4624494A1 (en) 2024-03-29 2025-10-01 Institut Curie Her2 single domain antibody and uses thereof
WO2026020171A2 (en) 2024-07-19 2026-01-22 Aera Therapeutics, Inc. Chimeric antigen receptor constructs

Families Citing this family (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2013124474A2 (en) 2012-02-23 2013-08-29 Stage Cell Therapeutics Gmbh Chromatographic isolation of cells and other complex biological materials
EP3365453A2 (en) * 2015-10-22 2018-08-29 Juno Therapeutics GmbH Methods, kits, agents and apparatuses for transduction
EP4647493A3 (en) 2017-04-27 2026-01-14 Juno Therapeutics, Inc. Oligomeric particle reagents and methods of use thereof
WO2019200056A2 (en) * 2018-04-12 2019-10-17 Vivo-Til Therapeutics Inc. Viral vectors and packaging cell lines
CA3108657A1 (en) 2018-08-09 2020-02-13 Juno Therapeutics, Inc. Processes for generating engineered cells and compositions thereof
US12522660B2 (en) 2018-10-31 2026-01-13 C3S2 Gmbh Methods for selection and stimulation of cells and apparatus for same
WO2021009263A1 (en) 2019-07-16 2021-01-21 INSERM (Institut National de la Santé et de la Recherche Médicale) Antibodies having specificity for cd38 and uses thereof
US20230085724A1 (en) 2020-03-05 2023-03-23 Neotx Therapeutics Ltd. Methods and compositions for treating cancer with immune cells
AU2022267891A1 (en) * 2021-04-27 2023-11-09 Novartis Ag Viral vector production system
WO2023230471A2 (en) * 2022-05-23 2023-11-30 The General Hospital Corporation Methods and compositions for immune cell crispr screens
US20250025165A1 (en) 2023-07-21 2025-01-23 Cilag Gmbh International Systems and subsystems for articulating a surgical instrument

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010142785A1 (en) * 2009-06-11 2010-12-16 Institut Curie Methods and kits for regulating intracellular trafficking of a target protein
US20130071414A1 (en) * 2011-04-27 2013-03-21 Gianpietro Dotti Engineered cd19-specific t lymphocytes that coexpress il-15 and an inducible caspase-9 based suicide gene for the treatment of b-cell malignancies
WO2015095895A1 (en) * 2013-12-20 2015-06-25 Fred Hutchinson Cancer Research Center Tagged chimeric effector molecules and receptors thereof

Family Cites Families (43)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4376110A (en) 1980-08-04 1983-03-08 Hybritech, Incorporated Immunometric assays using monoclonal antibodies
US4486530A (en) 1980-08-04 1984-12-04 Hybritech Incorporated Immunometric assays using monoclonal antibodies
US4411993A (en) 1981-04-29 1983-10-25 Steven Gillis Hybridoma antibody which inhibits interleukin 2 activity
USRE32011E (en) 1981-12-14 1985-10-22 Scripps Clinic And Research Foundation Ultrapurification of factor VIII using monoclonal antibodies
US4543439A (en) 1982-12-13 1985-09-24 Massachusetts Institute Of Technology Production and use of monoclonal antibodies to phosphotyrosine-containing proteins
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
JPS6147500A (ja) 1984-08-15 1986-03-07 Res Dev Corp Of Japan キメラモノクロ−ナル抗体及びその製造法
EP0173494A3 (en) 1984-08-27 1987-11-25 The Board Of Trustees Of The Leland Stanford Junior University Chimeric receptors by dna splicing and expression
GB8422238D0 (en) 1984-09-03 1984-10-10 Neuberger M S Chimeric proteins
US4902614A (en) 1984-12-03 1990-02-20 Teijin Limited Monoclonal antibody to human protein C
JPS61134325A (ja) 1984-12-04 1986-06-21 Teijin Ltd ハイブリツド抗体遺伝子の発現方法
JPS63501765A (ja) 1985-11-01 1988-07-21 インタ−ナショナル、ジェネティック、エンジニアリング インコ−ポレ−テッド 抗体遺伝子のモジュ−ル組立体、それにより産生された抗体及び用途
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
EP1541682A3 (en) 1988-09-02 2005-07-06 Dyax Corp. Generation and selection of recombinant varied binding proteins
US5223409A (en) 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
US5427908A (en) 1990-05-01 1995-06-27 Affymax Technologies N.V. Recombinant library screening methods
JPH06508511A (ja) 1990-07-10 1994-09-29 ケンブリッジ アンティボディー テクノロジー リミティド 特異的な結合ペアーの構成員の製造方法
GB9015198D0 (en) 1990-07-10 1990-08-29 Brien Caroline J O Binding substance
ES2108048T3 (es) 1990-08-29 1997-12-16 Genpharm Int Produccion y utilizacion de animales inferiores transgenicos capaces de producir anticuerpos heterologos.
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
DE69129154T2 (de) 1990-12-03 1998-08-20 Genentech, Inc., South San Francisco, Calif. Verfahren zur anreicherung von proteinvarianten mit geänderten bindungseigenschaften
DE69233769D1 (de) 1991-03-01 2009-09-24 Dyax Corp Chimäres Protein mit Mikroprotein mit zwei oder mehr Disulfidbindungen und Ausgestaltungen davon
ATE414768T1 (de) 1991-04-10 2008-12-15 Scripps Research Inst Bibliotheken heterodimerer rezeptoren mittels phagemiden
DE4122599C2 (de) 1991-07-08 1993-11-11 Deutsches Krebsforsch Phagemid zum Screenen von Antikörpern
DE4135543A1 (de) 1991-10-28 1993-04-29 Boehringer Mannheim Gmbh Rekombinantes core-streptavidin
KR20010083890A (ko) * 1998-10-05 2001-09-03 에드워드 에이. 맥더모트, 주니어 암 관련 항원 및 그의 용도
DE69941703D1 (de) 1999-10-11 2010-01-07 Pasteur Institut Lentivirale Vektoren für die Herstellung von immunotherapeutischen Zusammensetzungen
US6841359B2 (en) * 2000-10-31 2005-01-11 The General Hospital Corporation Streptavidin-binding peptides and uses thereof
US7754208B2 (en) * 2001-01-17 2010-07-13 Trubion Pharmaceuticals, Inc. Binding domain-immunoglobulin fusion proteins
JP2005507236A (ja) * 2001-04-03 2005-03-17 キュラジェン コーポレイション 抗原性ポリペプチドに結合する新規抗体、抗原をコードする核酸、および使用方法
WO2003076669A1 (es) * 2002-03-08 2003-09-18 Cueros Industrializados Del Bajio Proceso para la incorporación de particulas termoestables a cuero o piel
US20050032173A1 (en) 2003-08-05 2005-02-10 Mauricio Rojas Fusion proteins with a membrane translocating sequence and methods of using same to inhibit an immune response
US20130266551A1 (en) * 2003-11-05 2013-10-10 St. Jude Children's Research Hospital, Inc. Chimeric receptors with 4-1bb stimulatory signaling domain
WO2006084388A1 (en) * 2005-02-11 2006-08-17 Uti Limited Partnership Monomeric streptavidin muteins
JP2009529917A (ja) * 2006-03-22 2009-08-27 ヴァイラル ロジック システムズ テクノロジー コーポレーション 標的ポリペプチドの同定方法および免疫学的疾患の治療のためのその使用
US7994317B2 (en) 2006-11-03 2011-08-09 GlaxoSmithKline, LLC sEH inhibitors and their use
EP2147683A1 (en) 2008-07-25 2010-01-27 DKFZ Deutsches Krebsforschungszentrum Construct and method for the internalization of cargo molecules into a cell
WO2012082841A2 (en) * 2010-12-14 2012-06-21 University Of Maryland, Baltimore Universal anti-tag chimeric antigen receptor-expressing t cells and methods of treating cancer
KR20140029446A (ko) * 2011-04-15 2014-03-10 컴퓨젠 엘티디. 면역 관련 장애 및 암의 치료를 위한 폴리펩티드 및 폴리뉴클레오티드, 및 이들의 용도
AU2013222288A1 (en) * 2012-02-22 2014-08-14 The Trustees Of The University Of Pennsylvania Use of ICOS-based CARs to enhance antitumor activity and CAR persistence
KR102264290B1 (ko) * 2012-08-20 2021-06-10 프레드 헛친슨 켄서 리서치 센터 세포 면역요법을 위한 방법 및 조성물
AU2013329186B2 (en) * 2012-10-10 2019-02-14 Sangamo Therapeutics, Inc. T cell modifying compounds and uses thereof
IL295616A (en) * 2015-07-31 2022-10-01 Us Health Adapted cells and treatment methods

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010142785A1 (en) * 2009-06-11 2010-12-16 Institut Curie Methods and kits for regulating intracellular trafficking of a target protein
US20130071414A1 (en) * 2011-04-27 2013-03-21 Gianpietro Dotti Engineered cd19-specific t lymphocytes that coexpress il-15 and an inducible caspase-9 based suicide gene for the treatment of b-cell malignancies
WO2015095895A1 (en) * 2013-12-20 2015-06-25 Fred Hutchinson Cancer Research Center Tagged chimeric effector molecules and receptors thereof

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
GAELLE BONCOMPAIN ET AL: "Synchronization of secretory protein traffic in populations of cells", NATURE METHODS, vol. 9, no. 5, 12 March 2012 (2012-03-12), pages 493 - 498, XP055213526, ISSN: 1548-7091, DOI: 10.1038/nmeth.1928 *
M. SADELAIN ET AL: "The Basic Principles of Chimeric Antigen Receptor Design", CANCER DISCOVERY, vol. 3, no. 4, 1 April 2013 (2013-04-01), pages 388 - 398, XP055133523, ISSN: 2159-8274, DOI: 10.1158/2159-8290.CD-12-0548 *

Cited By (26)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11446398B2 (en) 2016-04-11 2022-09-20 Obsidian Therapeutics, Inc. Regulated biocircuit systems
WO2017180587A3 (en) * 2016-04-11 2017-12-14 Obsidian Therapeutics, Inc. Regulated biocircuit systems
CN108276493A (zh) * 2016-12-30 2018-07-13 南京传奇生物科技有限公司 一种新型嵌合抗原受体及其应用
EP3564266A4 (en) * 2016-12-30 2020-11-18 Nanjing Legend Biotech Co., Ltd. NEW CHIMERA RECEIVER OF ANTIGEN AND CORRESPONDING USE
CN108276493B (zh) * 2016-12-30 2023-11-14 南京传奇生物科技有限公司 一种嵌合抗原受体及其应用
US11564945B2 (en) 2016-12-30 2023-01-31 Nanjing Legend Biotech Co., Ltd. Chimeric antigen receptor and use thereof
US12071474B2 (en) 2017-05-01 2024-08-27 The Trustees Of The University Of Pennsylvania Monoclonal antibodies against alpha-synuclein fibrils
WO2019077164A1 (en) 2017-10-20 2019-04-25 Institut Curie CROCHET FUSION PROTEIN FOR REGULATING THE CELLULAR TRAFFIC OF A TARGET PROTEIN
WO2019077165A1 (en) 2017-10-20 2019-04-25 Institut Curie DAP10 / 12-BASED CHIMERIC ANTIGENIC RECEPTORS (CAR) ADAPTED FOR RUSH
US12252517B2 (en) 2017-10-20 2025-03-18 Institut Curie Hook fusion protein for regulating the cellular trafficking of a target protein
WO2019087151A1 (en) 2017-11-03 2019-05-09 Sorrento Therapeutics, Inc. Cd38-directed chimeric antigen receptor constructs
WO2019145796A2 (en) 2018-01-17 2019-08-01 Aratinga Bio Tnp Polymer-encapsulated viral vectors for genetic therapy
EP3549597A1 (en) * 2018-04-06 2019-10-09 Heinrich-Heine-Universität Düsseldorf Synthetic signalling constructs and its use
WO2019193197A1 (en) * 2018-04-06 2019-10-10 Heinrich-Heine-Universität Düsseldorf Synthetic signaling constructs and its use
WO2019199689A1 (en) * 2018-04-09 2019-10-17 The Trustees Of The University Of Pennsylvania Methods and compositions comprising a viral vector for expression of a transgene and an effector
US11058725B2 (en) 2019-09-10 2021-07-13 Obsidian Therapeutics, Inc. CA2 compositions and methods for tunable regulation
WO2021069915A1 (en) * 2019-10-09 2021-04-15 Autolus Limited Engineered immune cell
EP4208175A4 (en) * 2020-09-01 2025-05-07 The Trustees of The University of Pennsylvania IMPROVED GENERATION OF T-CELL TRANSDUCING LENTIVIRAL VECTORS USING A COCAL ENVELOPE
WO2022101482A1 (en) 2020-11-13 2022-05-19 Honing Biosciences Means and methods for regulating intracellular trafficking of secretory or cell membrane-anchored proteins of interest
WO2022234445A1 (en) * 2021-05-06 2022-11-10 Università Degli Studi Di Padova New promoter sequence for gene therapy
IT202100011576A1 (it) * 2021-05-06 2022-11-06 Univ Degli Studi Padova Nuova sequenza promotore per terapia genica
WO2023084094A1 (en) 2021-11-15 2023-05-19 Theravectys Lentiviral vectors for expression of human papillomavirus (hpv) antigens and its implementation in the treatment of hpv induced cancers
WO2024023135A1 (en) 2022-07-27 2024-02-01 Theravectys Lentiviral vectors for expression of human papillomavirus (hpv) antigens and its implementation in the treatment of hpv induced cancers
EP4624494A1 (en) 2024-03-29 2025-10-01 Institut Curie Her2 single domain antibody and uses thereof
WO2025202462A1 (en) 2024-03-29 2025-10-02 Institut Curie Her2 single domain antibody and uses thereof
WO2026020171A2 (en) 2024-07-19 2026-01-22 Aera Therapeutics, Inc. Chimeric antigen receptor constructs

Also Published As

Publication number Publication date
JP6940406B2 (ja) 2021-09-29
HK1248720A1 (zh) 2018-10-19
JP2017528158A (ja) 2017-09-28
JP7341110B2 (ja) 2023-09-08
EP3511413B1 (en) 2022-09-07
US20170166623A1 (en) 2017-06-15
CA2956385A1 (en) 2016-01-28
EP3172228A1 (en) 2017-05-31
CN113846062B (zh) 2025-02-21
CN113846062A (zh) 2021-12-28
US20210009653A1 (en) 2021-01-14
JP2023113656A (ja) 2023-08-16
CN107531800A (zh) 2018-01-02
CN107531800B (zh) 2021-08-10
EP3172228B1 (en) 2019-02-27
JP2021019590A (ja) 2021-02-18
EP3511413A1 (en) 2019-07-17
US10752668B2 (en) 2020-08-25

Similar Documents

Publication Publication Date Title
JP7341110B2 (ja) キメラ抗原レセプター分子の制御的発現のためのレンチウイルスベクター
AU2019279084B2 (en) Diverse antigen binding domains, novel platforms and other enhancements for cellular therapy
US11649284B2 (en) Cancer gene therapy targeting CD47
CN110526983B (zh) 改良型抗cd19 car-t细胞
US20240101616A1 (en) Dap10/12 based cars adapted for rush
CN113913379A (zh) T淋巴细胞及其应用
AU2022310862A1 (en) Engineered t cell receptors fused to binding domains from antibodies
US12252517B2 (en) Hook fusion protein for regulating the cellular trafficking of a target protein
US20230174622A1 (en) Epidermal growth factor receptor
CN115925910A (zh) 经修饰的hiv-1用于产生完全人抗体的用途
JP2017506222A (ja) ヒトtリンパ向性ウイルス1型に対する免疫応答を生成するためのレンチウイルスベクター
CN110526987A (zh) 靶向cd133的嵌合抗原受体、嵌合抗原受体t细胞及其制备方法和应用
KR20230002681A (ko) 대형 아데노바이러스 페이로드의 통합
HK1248720B (zh) 用於嵌合抗原受体分子的调控表达的慢病毒载体
RU2841311C1 (ru) Неоантигены, экспрессируемые при множественной миеломе, и их применение
Ward Novel fusion protein-expressing lentiviral vectors ameliorate collagen induced arthritis

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15742027

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 15327517

Country of ref document: US

REEP Request for entry into the european phase

Ref document number: 2015742027

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2015742027

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2017524110

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2956385

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE