WO2015193326A1 - Methods of treating ttp with immunoglobulin single variable domains and uses thereof - Google Patents
Methods of treating ttp with immunoglobulin single variable domains and uses thereof Download PDFInfo
- Publication number
- WO2015193326A1 WO2015193326A1 PCT/EP2015/063493 EP2015063493W WO2015193326A1 WO 2015193326 A1 WO2015193326 A1 WO 2015193326A1 EP 2015063493 W EP2015063493 W EP 2015063493W WO 2015193326 A1 WO2015193326 A1 WO 2015193326A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- polypeptide
- vwf
- amino acid
- ttp
- human
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/36—Blood coagulation or fibrinolysis factors
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/36—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against blood coagulation factors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
- A61K9/0021—Intradermal administration, e.g. through microneedle arrays or needleless injectors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/02—Antithrombotic agents; Anticoagulants; Platelet aggregation inhibitors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/04—Antihaemorrhagics; Procoagulants; Haemostatic agents; Antifibrinolytic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/567—Framework region [FR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
Definitions
- the present invention is based on the finding that administration of polypeptides comprising at least one Immunoglobulin single variable domain against vWF to human TTP patients provides a significant decrease in the time to response and less complications.
- the invention provides a polypeptide comprising at least one immunoglobulin single variable domain (ISVD) against von Willebrand Factor (vWF) for use in treating a vWF-related disease in a human in need thereof.
- ISVD immunoglobulin single variable domain
- vWF von Willebrand Factor
- the invention further relates to dosage unit forms, kits and medical uses for treating TTP.
- the multimeric plasma protein von Willebrand Factor (vWF) is essential for recruiting circulating platelets to the damaged vessel wall upon vascular injury. This recruitment is mediated through binding of the vWF Al-domain with the platelet receptor glycoprotein GPIb-IX-V.
- ultra-large multimers or ultra-large vWF (ULvWF).
- ADAMTS13 ultra-large vWF
- the GPIb-IX-V platelet receptor binding site in the Al domain is cryptic and will not spontaneously react with platelets.
- a conformational activation of the GPIb-IX-V platelet receptor binding site in the Al domain is triggered by immobilisation or under conditions of shear stress resulting in platelet adhesion and subsequently in thrombus formation.
- Thrombotic thrombocytopenic purpura is a rare and life-threatening disease of the blood coagulation system, in which accumulation of ULvWF multimers has been implicated, leading to an increased risk of thrombus formation in small blood vessels due to excessive platelet aggregation.
- the condition is characterised by systemic platelet aggregation in the microcirculation, producing fluctuating ischaemia in many organs. If sustained, this may cause tissue infarction, associated with profound thrombocytopenia and erythrocyte fragmentation.
- ULvWF multimers have the natural ability to spontaneously interact with the platelet receptor GPIb- IX-V.
- ULvWF multimers are immediately processed into regular sized vWF multimers via cleavage by the vWF protease ADAMTS13.
- ADAMTS13 activity was found to be severely deficient in hereditary TTP as well as acquired idiopathic TTP, The majority of patients with TTP have autoantibodies against ADA TS13 resulting in impaired processing of the UlvWF multimers.
- the Al domain of the ULvWF is constitutively active and readily interacting with the GPIb-IX-V platelet receptor. This eventually results in formation of the characteristic blood clots found in the TTP patient population.
- PE Plasma Exchange
- transfusion provides replacement ADAMTS13 and removes antibodies against the enzyme, thus progressively leading to a normalisation of ULvWF processing.
- PEX Plasma Exchange
- this treatment requires multiple exchanges and transfusions over many days, during which time there is no direct pharmacological targeting of the active process of ULvWF-mediated platelet aggregation.
- Immunoglobulin single variable domains (ISVDs) against vWF have been described in, for example WO 2004/015425, WO2004/062551, WO2006/074947, WO2006/122825, WO2009/115614 and WO2011/Q67160.
- ISVDs against vWF avidly bind to multimeric vWF, thereby blocking the Interaction of any sizes and activation stages of multimeric vWF with the GPIb-IX-V platelet receptor.
- the interaction of ALX 0081 with vWF is highly specific and it does not interact with human blood cells or platelets.
- its interference with the platelet GPIb-IX-V receptor is selective through the binding of the vWF Al domain and it does not affect the capacity of vWF to interact with fibrillar collagens or with collagen type VI.
- ISVDs against vWF e.g. ALX 0081 ⁇ do not affect the activity of the (remaining) vWF-protease ADAMTS13, nor do they interfere with the binding of FVIII to vWF.
- polypeptides comprising at least one ISVD against vWF such as ALX 0081
- polypeptides comprising at least one ISVD against vWF such as ALX 0081
- the present invention is based on the unexpected finding that the administration of polypeptides comprising at least one ISVD against vWF to human TTP patients provides a decrease of 2 days in the time-to-response, objectified by a recovery of platelets ⁇ 150,000/ ⁇ , Platelet count increase is a sign of diminished pathological platelet aggregation, thereby decreasing the thrombotic process initiated by the platelet-vWF complexes characteristic of this disease.
- the present clinical study with TTP patients also demonstrates that the polypeptides of the present invention ⁇ e.g. ALX 0081) are well tolerated agents and, in particular, that the potential for the risk of bleeding appears to be present but low and manageable.
- the currently available data demonstrate, therefore, that the reduction in PE and transfusion and their associated complications are achieved without significant adverse effects from the use of the polypeptides of the invention itself. This represents a dear safety benefit for the use of the polypeptides of the invention in the treatment of patients with TTP.
- polypeptides comprising at least one ISVD against vWF provides an unexpectedly decreased time-to-response, a sustained and prolonged effect, reduced exacerbations, reduced hospitalization, reduced morbidity, reduced deaths and/or a reduced number of PEs.
- the current therapy of TTP with PE and transfusion provides replacement ADAMTS13 and removes antibodies against the enzyme, thus progressively leading to a normalisation of U LvWF processing.
- this treatment requires multiple exchanges and transfusions over many days, during which time there is no direct pharmacological targeting of the active process of ULvWF-mediated platelet aggregation.
- polypeptides of the present invention do not interfere with the enzyme replaced by plasma transfusion. It has been demonstrated that the polypeptides of the invention (e.g. ALX 0081) can be utilized, in combination with PE and transfusion, to directly inhibit the continuing formation of smalt thrombi and platelet consumption in the microvasculature. This permits more rapid control of the underlying thrombotic process and accompanying platelet consumption, with the benefits of a reduced degree of ischaemic and haemorrhagic complications. It also results in a more rapid clinical recovery and less morbidity with a shorter period and reduced number of PEs and transfusions.
- ALX 0081 e.g. ALX 0081
- PE and transfusion are currently regarded as the standard treatment in the management of TTP (Scully et al. BrJ.Haem. 2012; 158:323-335), the procedures carry the risk of significant complications.
- the PE procedure requires high fluid volumes and flow rates necessitating the use of central venous dual lumen haemodialysis catheters.
- Complications from the procedure include haemorrhage from catheter insertion, sepsis, catheter thrombosis, pneumothorax, fluid overload, hypoxia and hypotension (Fontana ef al. Semin.Hematol. 2004; 41: 48-59; George J. Intensive Care Med. 2007; 22: 82-91; Howard ef al. Transfusion 2006; 46: 154-156; Rizvi et al. Transfusion 2000; 40: 896-901; Nguyen et al. Transfusion 2009; 49: 392-394). Anaphylactoid reactions complicate 0.25% to 0.5% of procedures (Aliford ef ai 2003 supra; George 2007 supra).
- the infusion of plasma containing blood products can cause a non-infective TRALI.
- This condition is recognized as one of the most frequent causes of transfusion-related fatalities with an incidence estimated to be 0.02% to 0.05% per plasma containing unit with a daily average of 17 plasma units, the daily risk can be calculated to a range of 0.34% to 0.85%.
- Most patients with TTP require multiple PEs and transfusions.
- Patients with acute idiopathic TTP require daily treatments, and an average of approximately 16 treatments is required to achieve remission (Allford et al. 2003 supra). In refractory cases the frequency of treatment may be increased to twice-daily (Allford et al. 2003 supra).
- the present invention provides methods for treating or alleviating vWF-related diseases in a subject by administering to the subject a polypeptide comprising at least one ISVD against vWF, wherein the amount of the polypeptide administered is effective to reduce the time-to-response, to reduce exacerbations, to reduce hospitalization, to reduce ischemia, to reduce the death toll and/or to reduce the number of required PEs.
- the present invention provides specific dose ranges and dosing schedules for the polypeptides of the invention that result in one or more of these effects on vWF-related disease.
- the invention provides pharmacologically active agents, compositions, methods and/or dosing schedules that have certain advantages compared to the agents, compositions, methods and/or dosing schedules that are currently used and/or known in the art, including the requirement to less frequently give PE.
- the present invention provides a polypeptide comprising at least one immunoglobulin single variable domain (ISVD) against von Wiilebrand Factor (vWF) for use in treating a vWF-related disease in a human in need thereof, comprising administering to said human a first dose of 1-80 mg, such as 5-40 mg, preferably 10 mg of said polypeptide.
- ISVD immunoglobulin single variable domain
- vWF von Wiilebrand Factor
- the present invention provides a polypeptide as described herein, wherein said administering said polypeptide is followed within 5 min to 8 h by performing a first Plasma Exchange (PE).
- PE Plasma Exchange
- the present invention provides a polypeptide as described herein, wherein said administering of said first dose is preceded by performing a preceded Plasma Exchange (PE), preferably within 36h, such as within 32h, 30h, 28h, 26h, 24h, 22h, 20h, 18h, 16h, 14h, 12h, lOh, 8h, for instance within 7h, 6h, 5h, 4h, 3h, 3h, Ih, 45 min, 30 min, 20 min, 15 min, 10 min or even 5 min of said first PE.
- PE Plasma Exchange
- the present invention provides a polypeptide as described herein, wherein said first PE is followed by administering a second dose of 1-80 mg, such as 5-40 mg, preferably 10 mg, of said polypeptide, preferably by subcutaneous injection, preferably within 1-80 min, more preferably within 30 min of said first PE.
- a second dose of 1-80 mg, such as 5-40 mg, preferably 10 mg, of said polypeptide preferably by subcutaneous injection, preferably within 1-80 min, more preferably within 30 min of said first PE.
- the present invention provides a polypeptide as described herein, wherein said preceded PE is performed within 36h, preferably 32, 30, 28, 26, 24, 22, 20, 18, or 16h, preferably about 24h of said first PE,
- the present invention provides a polypeptide as described herein, wherein said polypeptide is administered parenterally, preferably by subcutaneous, intraperitoneal, intravenous or intra- muscular injection, preferably by an intravenous (i.v.) bolus push injection.
- parenterally preferably by subcutaneous, intraperitoneal, intravenous or intra- muscular injection, preferably by an intravenous (i.v.) bolus push injection.
- the present invention provides a polypeptide as described herein, wherein said administering said polypeptide is followed by performing a PE within 5 min to 8h, such as within 10 min to 6 h or 15 min to 4h, for instance within 8h, 7h, 6h, 5b, 4h, 3h, 3h, lh, 45 min, 30 min, 20 min, 15 min, 10 min or even 5 min.
- the present invention provides a polypeptide as described herein, wherein said treating a vWF- related disease in a human in need thereof, further comprises:
- step (ii) administering a dose of 1-80 mg, such as 5-40 mg of said polypeptide 5 min to 4 h after said PE of step (i);
- step (iii) optionally measuring the platelet count and/or ADAMTS13 activity of said patient, wherein step (i) and step fii) are repeated once per day, preferably until the platelet count of said patient is >150 ⁇ 0/ ⁇ and/or said ADAMTS13 activity is at least 10% such as at least 15%, 20%, 25%, 30%, 35%, 45% or even 50% of the ADAMTS13 reference activity.
- the present invention provides a polypeptide as described herein, further comprising administering once per day a dose of 1-80 mg, such as 5-40 mg, preferably 10 mg of said polypeptide for at least 5, 10, 15, 20, 25, 30, 40, 50 60, 90 or even 120 days after the platelet count of said patient is >150.000/ ⁇ for the first time.
- the present invention provides a polypeptide as described herein, further comprising administering once per day a dose of 1-80 mg, such as 5-40 mg, preferably 10 mg of said polypeptide until said human enters remission.
- the present invention provides a polypeptide as described herein, comprising administering said polypeptide until the ADAMTS13 activity is at least 10% such as at least 15%, 20%, 25%, 30%, 35%, 45% or even 50% of the ADAMTS13 reference activity.
- the present invention provides a polypeptide as described herein, wherein said dose is about 1-80 mg, or 5-40 mg, such as 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40,
- the present invention provides a polypeptide as described herein, wherein said human suffers from an acute episode of TTP, an exacerbation of TTP or a relapse of TTP.
- the present invention provides a polypeptide comprising at least one immunoglobulin single variable domain (ISVD) against von Willebra nd Factor (vWF) for use in treating a vWF-related disease in a human in need thereof, comprising
- PE Plasma Exchange
- step (1) administering to said human a first dose of 1-80 mg, such as 5-40 mg, preferably 10 mg of said polypeptide, and if step (1) is performed preferably within 36h, such as within 32b, 30h, 28h, 26h, 24h, 22h, 20h, 18h, 16h, 14h, 12h, lOh, 8h, for instance within 7h, 6h, 5h, 4h, 3h, 3h, lh, 45 min, 30 min, 20 min, 15 min, 10 min or even 5 min of ⁇ the end of) step (1);
- PE Plasma Exchange
- step ⁇ 3 ⁇ and step ⁇ 4) repeating step ⁇ 3 ⁇ and step ⁇ 4) once per day; optionally until the platelet count of said patient is >150000/ ⁇ and/or said ADAMTS13 activity is at least 10% such as at least 15%, 20%, 25%, 30%, 35%, 45% or even 50% of the ADAMTS13 reference activity.
- the present invention provides a polypeptide comprising two anti-human vWF ISVDs for use in preventing (the symptoms of) a relapse of a n vWF-related disease in a human, by administering to the human 1-80 mg, such as 5-40 mg, preferably 10 mg doses of sa id polypeptide.
- the present invention provides a polypeptide as described herein, wherein said ISVD against vWF comprises at least one immunoglobulin single variable domain binding to SEQ. ID NO: 20.
- the present invention provides a polypeptide as described herein, wherein said ISVD against vWF comprises a heavy chain variable domain which is derived from a conventional four-chain antibody or a heavy chain variable domain which is derived from a heavy chain antibody or a Nanobody.
- the present invention provides a polypeptide as described herein, wherein said Nanobody is a VHH,
- the present invention provides a polypeptide as described herein, wherein said the ISVD against vWF essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which:
- CDR1 comprises or essentially consists of:
- amino acid sequence that has 2 or only 1 amino acid difference(s) with the amino acid sequence YNPMG;
- CDR2 comprises or essentially consists of:
- amino acid sequence that has at least 80%, preferably at least 90%, more preferably at least 95%, even more preferably at least 99% sequence identity with the amino acid sequence AISRTGGSTYYPDSVEG; or
- amino acid sequence that has 2 or only 1 amino acid difference(s) with the amino acid sequence AISRTGGSTYYPDSVEG;
- CDR3 comprises or essentially consists of:
- amino acid sequence that has at least 80%, preferably at least 90%, more preferably at least 95%, even more preferably at least 99% sequence identity with the amino acid sequence AGVRAEDGRVRTLPSEYTF; or
- amino acid sequence that has 2 or only 1 amino acid difference(s) with the amino acid sequence AGVRAEDGRVRTLPSEYTF.
- the present invention provides a polypeptide as described herein, in which:
- CDR1 is YNPMG (SEQ ID NO: 20);
- CDR2 is AISRTGGSTYYPDSVEG (SEQ ID NO: 21);
- CDR3 is AGVRAEDGRVRTLPSEYTF (SEQ ID NO: 22 ⁇ .
- the present invention provides a polypeptide as described herein, wherein the ISVD against vWF is represented by SEQ ID NO: 19 (12A02H1).
- the present invention provides a polypeptide as described herein, comprising or consisting of at least two ISVDs against vWF.
- each ISVD of said at least two ISVDs against vWF essentially consists of 4 framework regions (FRl to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which :
- CDR1 comprises or essentially consists of:
- amino acid sequence that has 2 or only 1 amino acid d ifference(s) with the amino acid sequence YNPMG;
- CDR2 comprises or essentially consists of
- amino acid sequence that has at least 80%, preferably at least 90%, more preferably at least 95%, even more preferably at least 99% sequence identity with the amino acid sequence AISRTGGSTYYPDSVEG; or
- amino acid sequence that has 2 or only 1 amino acid difference(s) with the amino acid sequence AISRTGGSTYYPDSVEG;
- CDR3 comprises or essentially consists of:
- amino acid sequence that has at least 80%, preferably at least 90%, more preferably at least 95%, even more preferably at least 99% sequence identity with the amino acid seq uence AGVRAEDGRVRTLPSEYTF; or
- amino acid sequence that has 2 or only 1 amino acid difference(s) with the amino acid sequence AGVRAEDGRVRTLPSEYTF.
- each ISVD against vWF essentially consists of 4 framework regions (FRl to FR4, respectively) and 3 complementarity determining regions (CDRI to CDR3, respectively), in which:
- CDRI is YNPMG (SEQ ID NO: 20);
- CDR2 is AISRTGGSTYYPDSVEG (SEQ I D NO: 21);
- CDR3 is AGVRAEDGRVRTLPSEYTF (SEQ I D NO: 22).
- the present invention provides a polypeptide as described herein, wherein said polypeptide comprises or consists of SEQ ID NO:s 1-19, preferably SEQ ID NO: 19.
- the present invention provides a polypeptide as described herein, wherein said ISVD against vWF is a single chain polypeptide comprising one or more immunoglobulin single variable domains.
- the present invention provides a polypeptide as described herein, wherein said ISVD against vWF is monovalent or multivalent,
- the present invention provides a polypeptide as described herein, wherein said ISVD against vWF is monospecific or multispecific.
- the present invention provides a polypeptide as described herein, wherein one or more immunoglobulin single variable domains are CDR-grafted, humanized, ca melized, de-immunized, or selected by phage display.
- the present invention provides a polypeptide as described herein, wherein said ISVD against vWF comprises an amino acid sequence which is at least 90% identical to SEQ ID NO: 1.
- the present invention provides a polypeptide as described herein, comprising two anti-human vWF immunoglobulin single variable domains (ISVDs) and an anti-human serum albumin ( HSA) ISVD
- the present invention provides a polypeptide as described herein, wherein said polypeptide is formulated in a pharmaceutically acceptable formulation.
- the present invention provides a polypeptide as described herein, wherein said formulation comprises a citrate or phosphate buffer with a pH in the range of 5.0 to 7.5,
- the present invention provides a polypeptide as described herein, wherein said formulation is suitable for parenteral administration, such as one or more selected from intravenous injection, subcutaneous injection, intramuscular injection or intraperitoneal injection.
- the present invention provides a polypeptide as described herein, wherein said formulation is in liquid, lyophilized, spray-dried, reconstituted lyophtlized or frozen form.
- the present invention provides a kit or an article of manufacture, comprising a container containing the polypeptide as described herein or the formulation as described herein, and instructions for use.
- the present invention provides a kit or article of manufacture as described herein, wherein the formulation is present in a vial or an injectable syringe.
- the present invention provides a kit or article of manufacture as described herein, wherein the formulation is present in a prefilled injectable syringe.
- the present invention provides a kit or article of manufacture as described herein, wherein the syringe or a vial is composed of glass, plastic, or a polymeric material chosen from a cyclic olefin polymer or copolymer.
- the present invention provides a formulation comprising:
- PE Plasma Exchange
- the present invention provides a pharmaceutical unit dosage form suitable for parenteral administration to a patient, preferably a human patient, comprising a polypeptide as described herein or a formulation as described herein.
- a pharmaceutical unit dosage form suitable for parenteral administration to a patient, preferably a human patient, comprising a polypeptide as described herein or a formulation as described herein.
- the present invention provides a polypeptide as described herein, wherein said vWF-related disease is chosen from acute coronary syndrome (ACS), transient cerebral ischemic attack, unstable or stable angina pectoris, stroke, myocardial infarction or thrombotic thrombocytopenic purpura (TTP).
- ACS acute coronary syndrome
- TTP thrombotic thrombocytopenic purpura
- the present invention provides a method for the treatment of a human patient susceptible to or diagnosed with a disease characterized by a vWF-related disease, comprising administering an effective amount of a polypeptide comprising at least one immunoglobulin single variable domain (ISVD) against von Willebrand Factor (vWF) to the human patient.
- ISVD immunoglobulin single variable domain
- vWF von Willebrand Factor
- the present invention provides a method of treating or preventing a vWF-related disease, such as TTP, comprising administering to a human, 1-80 mg, such as 5-40 mg, preferably 10 mg dose of a polypeptide comprising at least one immunoglobulin single variable domain (ISVD) against von Willebrand Factor (vWF), thereby reducing one or more symptoms associated with the vWF-related disease.
- a vWF-related disease such as TTP
- the present invention provides a treatment as described herein, wherein said administering a polypeptide as described herein is followed within 5 min to 8 h, such as 15 min to 4 h by performing a first Plasma Exchange (PE).
- PE Plasma Exchange
- the present invention provides a treatment as described herein, wherein said administering of a polypeptide as described herein is preceded by performing a preceded Plasma Exchange (PE), within 36h, preferably 32, 30, 28, 26, 24, 22, 20, 18, or 16h, preferably about 24h of said first PE.
- PE Plasma Exchange
- the present invention provides a treatment as described herein, wherein said first PE is followed by administering a second dose of 1-80 mg, such as 5 - 40 mg, preferably 10 mg of a polypeptide as described herein within 5 min to 8h, such as within 10 min to 6 h or 15 min to 4h, for instance within 8h, 7h, 6h, 5h, 4h, 3h, 3h, Ih, 45 min, 30 min, 20 min, 15 min, 10 min or even 5 min, for instance wherein said second dose of said polypeptide is administered within 1-60 min, such as 30 min of said first PE, preferably by subcutaneous injection.
- a second dose of 1-80 mg such as 5 - 40 mg, preferably 10 mg of a polypeptide as described herein within 5 min to 8h, such as within 10 min to 6 h or 15 min to 4h, for instance within 8h, 7h, 6h, 5h, 4h, 3h, 3h, Ih, 45 min, 30 min, 20 min, 15 min, 10 min or
- the present invention provides a treatment as described herein, further comprising:
- step (ii) administering a dose of 1 - 80 mg such as 5-40 mg, preferably 10 mg of a polypeptide as described herein 15 min to 4 h after said PE of step (i);
- step (i) and step (ii) are repeated once per day optionally until the platelet count of said patient is >15000 ⁇ / ⁇ and/or the ADA TS13 activity is at least 10% such as at least 15%, 20%, 25%, 30%, 35%, 45% or even 50% of the ADAMTS13 reference activity
- the present invention provides also a treatment as described herein, further comprising administering once per day a dose of 1 - 80 mg, such as 5-40 mg, preferably 10 mg of a polypeptide as described herein for at least 5, 10, 15, 20, 25, or even 30 days after the platelet count of said patient is >150.000/ ⁇ .
- the present invention provides a treatment as described herein, further comprising administering once per day a dose of 1-80 mg, such as 5-40 mg, preferably 10 mg of a polypeptide as described herein until said human enters remission.
- the present invention provides a treatment as described herein, comprising administering said polypeptide until the ADAMTS13 activity is at least 10% such as at least 15%, 20%, 25%, 30%, 35%, 45% or even 50% of the ADAMTS13 reference activity,
- the present invention relates to a method for reducing the risk of and/or preventing an acute episode of a vWF-related disease in a human in need thereof, comprising or consisting of; (i) administering to said human a dose of 5-40 mg, preferably 10 mg, of a polypeptide comprising at least one immunoglobulin single variable domain (ISVD) against von Willebrand Factor (vWF); wherein administration of said polypeptide reduces the risk of and/or prevents an acute episode of a vWF-related disease.
- ISVD immunoglobulin single variable domain
- vWF von Willebrand Factor
- said risk is reduced by a factor 1.2, 1.3, 1.4, 1.5, 1.6, 1.75, 1.8, 2 or more, such as 3, 4, 5, 6, 7, 8, 3, or even 10, or even more such as 20, 50 or even 100.
- said risk is reduced by 10% or even more such as 20%, 30%, 40%, 50%, 60% or more, such as 80 % or even 100%.
- the present invention relates to a method as described herein, wherein said step (i) of administering the polypeptide of the invention is repeated for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 times, or even more than 10 times, such as 20 times, preferably more than 30 times or even more.
- the present invention relates to a method as described herein, wherein said step (i) of administering the polypeptide of the invention is repeated for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 times, or even more than 10 times, such as 20 times, preferably more than 30 times or even more.
- the present invention relates to a method as described herein, wherein said
- (i) of administering the polypeptide of the invention is repeated for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 days, or even more than 10 days, such as 20 days, preferabl more than 30 days, such as 2 months, 3 months, 4 months, 5 months, 6 months or even more.
- the present invention relates to a method as described herein, wherein said dose is administered 1 time per day or two times per day.
- the present invention relates to a method as described herein, further comprising
- the present invention relates to a method as described herein, wherein said ADAMTS13 activity of said patient is measured every day, or every 2, 3, 4, 5, 6, 7, 8, 9, or 10 days, preferably at least once every week.
- the present invention relates to a method as described herein, wherein step (i) of administering the polypeptide of the invention is repeated until said ADAMTS13 activity is at least 10%, 15%, such 20%, or even 30% or higher of said reference ADA TS13 activity.
- the present invention relates to a method as described herein, wherein step (i) is repeated until said ADAMTS13 activity is at least 10%, 15%, such as 20% or 30% of said reference ADAMTS13 activity on at least 2 consecutive measurements.
- said 2 consecutive measurements are at least 24h, more preferably 48h apart, such as at least 3 days apart, or even more such as, 4, 5, 6, or even 7 days apart, preferable a week apart.
- the present invention relates to a method as described herein, wherein said step (i) of administering the polypeptide of the invention is repeated for at least at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 days, or even more than 10 days, such as 20 days, preferably more than 30 days or even more, after said ADAMTS13 activity is at least 10% or 15%, such as 20% or 30% of said reference activity on at least 2 consecutive measurements.
- the present invention relates to a method as described herein, further comprising
- step ⁇ i) of administering the polypeptide of the invention for at most 30 days, such as at most 20 days, or even 15, 10, 9, 8, 7, 6, 5, 4, 3, 2 days or even 1 day.
- the present invention relates to a method for reducing the risk of and/or preventing an acute episode of a vWF-related disease in a human in need thereof, comprising at least the following steps:
- ADAMTS13 activity is lower than 30%, 20%, 15% or 10% of said reference activity, then administering to said human a dose of 5-40 mg of a polypeptide comprising at least one immunoglobulin single variable domain (ISVD ) against von Wiliebrand Factor (vWF);
- ISVD immunoglobulin single variable domain
- vWF von Wiliebrand Factor
- the present invention relates to a method as described herein, wherein
- the risk of organ damage, ischaemic damage and/or microthrombi formation is reduced by 10%, 2.0%, 30%, preferably by at least 40%, or even at least 50%, such as 60%, 70%, 80%, 90% or even to 100%;
- the risk of organ damage, ischaemic damage and/or microthrombi formation is reduced by a factor 1.2.
- organ damage, ischaemic damage and/or microthrombi formation is reduced preferably by at least 10%, 2.0%, 30%, 40%, or even at least 50%, such as 60%, 70%, 80%, 90% or even to 100%; organ damage, ischaemic damage and/or microthrombt formation is reduced by a factor, 2 or more, such as 3, 4, 5, 6, 7, 8, 9, or even 10, or even more such as 20, 50 or even 100;
- organ damage markers such as LDH levels, troponin T, troponin I levels, and/or creatinine levels, return to at least 40%, or even at least 50%, such as 60%, 70%, 80%, 90% or even to 100% of normal levels;
- organ damage markers such as LDH levels, troponin T, troponin I levels, and/or creatinine levels, improve by at least 20%, such 30% or even higher, such as 40%, or even at least 50%, such as 60%, 70%, 80%, 90% or even to 100% of normal levels.
- said organ damage, such as LDH levels, troponin T, troponin I levels, and/or creatinine levels, markers improve in less than 30 days of treatment, preferably, in less than 20 days of treatment, such as, less than 15, 10, 9, 8, 7, 6, 5, 4, 3, 2 days or even within 1 day.
- the number of platelets is kept at > 150000/ ⁇ .
- the risk of exacerbations is reduced by at least 10%, 20%, 30%, 40%, or even at least 50%, such as 60%, 70%, 80%, 90% or even to 100%;
- the risk of exacerbations is reduced by a factor, 2 or more, such as 3, 4, 5, 6, 7, 8, 9, or even 10, or even more such as 20, 50 or even 100;
- vWF related disease mortality due to said vWF related disease is reduced by 10%, 20%, 30%, preferably by at least 40%, or even at least 50%, such as 60%, 70%, 80%, 90% or even to 100%;
- - mortality due to said vWF related disease is reduced by a factor 1.2, 1.3, 1.4, 1.5, 1.6, 1.75, 1.8, 2 or more, such as 3, 4, 5, 6, 7, 8, 9, or even 10, or even more such as 20, 50 or even 100.
- the present invention relates to a method as described herein, further comprising measuring the platelet number; and if said platelet number is lower than 150,000/ ⁇ , then repeating said step (i) of administering the polypeptide of the invention.
- the present invention relates to a method as described herein, wherein said platelet number of said patient is measured every day, or every 2, 3, 4, 5, 6, 7, 8, 3, or 10 days, preferably at least every week.
- the present invention relates to a method as described herein, wherein step (!) of administering the polypeptide of the invention is repeated until said platelet number is at least 150,000/ ⁇ .
- the present invention relates to a method as described herein, wherein step (i) of administering the polypeptide of the invention is repeated until said platelet number is at least 150,000/ ⁇ on at least 2 consecutive measurements.
- said 2 consecutive measurements are at least 2 h, more preferably 48h apart, such as at least 3 days apart, or even more such as, 4, 5, 6, or even 7 days apart, preferable a week apart.
- the present invention relates to a method as described herein, wherein said step (i) of administering the polypeptide of the invention is repeated for at least at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 days, or even more than 10 days, such as 20 days, preferably more than 30 days or even more, after said platelet number is at least 150,000/ ⁇ on at least 2 consecutive measurements.
- said 2 consecutive measurements are at least 24h, more preferably 48h apart, such as at least 3 days apart, or even more such as, 4, 5, 6, or even 7 days apart, preferably a week apart.
- the present invention relates to a method as described herein, further comprising measuring the platelet number of said patient; and if said platelet number > 150,000/ ⁇ , then repeating said step (i) of administering the polypeptide of the invention for at most 30 days, such as at most 20 days, or even 15, 10, 9, 8, 7, 6, 5, 4, 3, 2 days or even 1 day.
- the present invention relates to a method for reducing the risk of and/or preventing an acute episode of a vWF-related disease in a human in need thereof, comprising at least the following steps:
- the present invention relates to a method for treating an acute episode of a vWF-related disease, such as TTP, in a human in need thereof, comprising at least the following steps;
- vWF von Willebrand Factor
- step (ii) performing a first Plasma Exchange ( PE), preferably within 5 mtn to 8h of step (i).
- the present invention relates to a method for treating an acute episode of a vWF-related disease, such as TTP, in a human in need thereof, as described herein, wherein step (i), i.e. administering to said human the polypeptide of the invention, is preceded by performing a preceding PE, preferably within 24h of step (ii), i.e. performing a first PE.
- a preceding PE preferably within 24h of step (ii), i.e. performing a first PE.
- the present invention relates to a method for treating an acute episode of a vWF-related disease, such as TTP, in a human in need thereof, comprising at least the following steps; (i) performing a Plasma Exchange (PE); (ii) administering to said human a dose of 5-40 mg, preferably 10 mg of a polypeptide comprising at least one immunoglobulin single variable domain (ISVD) against von Willebrand Factor (vWF).
- PE Plasma Exchange
- ISVD immunoglobulin single variable domain
- vWF von Willebrand Factor
- said step (i), i.e. performing a PE, and said step (ii) i.e. administering to said human said polypeptide of the invention are repeated once or twice per day, for at most for 1, 2, 3, 4, 5, 6, or 7 days.
- the present invention relates to a method for treating an acute episode of a vWF-related disease, such as TTP, in a human in need thereof, as described herein, wherein step (ii) i.e. administering to said human said polypeptide of the invention, is performed within 15 min to 4 h of step (i), i.e. performing a PE.
- the present invention relates to a method for treating an acute episode of a vWF-related disease, such as TTP, in a human in need thereof, as described herein, further comprising measuring the platelet count of said human, preferably after step (ii) i.e.
- the present invention relates to a method for treating an acute episode of a vWF-related disease, such as TTP, in a human in need thereof, as described herein, further comprising measuring the platelet count of said human [preferably after step (ii) i.e. administering to said human said polypeptide of the invention]; and repeating step (i), i.e. performing a PE, and step ( ⁇ ) i.e.
- said 2 consecutive measurements are at least 24h, more preferably 48h apart, such as at least 3 days apart, or even more such as, 4, 5, 6, or even 7 days apart, preferable a week apart.
- the present invention relates to a method for treating an acute episode of a vWF-related disease, such as " TTP, in a human in need thereof, as described herein, further comprising administering once per day a dose of 5-40 mg, preferably 10 mg of said polypeptide for at least 1-30 days after the platelet count of said human was for the first time >150.000/ ⁇ .
- a vWF-related disease such as " TTP
- the present invention relates to a method for treating an acute episode of a vWF-related disease, such as TTP, in a human in need thereof, as described herein, further comprising measuring the AOAMTS13 activity of said human, preferably after step (ii) i.e. administering to said human said polypeptide.
- a vWF-related disease such as TTP
- the present invention relates to a method for treating an acute episode of a vWF-related disease, such as TTP, in a human in need thereof, as described herein, wherein step (i), i.e. performing a PE, and step (ii) i.e. administering to said human said polypeptide of the invention, are repeated until the ADAMTS13 activity is (for the first time] more than 15%, or 20% or even 30% of a reference ADAMTS13 activity.
- the present invention relates to a method for reducing the risk of and/or preventing ischaemic damage, organ damage and/or microthrombi formation [causable by a vWF- related disease] in a human in need thereof, comprising at least the following step; (i) administering to said human a dose of 5-40 mg/day, preferably 10 mg/day of a polypeptide comprising at least one immunoglobulin single variable domain (ISVD) against von Willebrand Factor (vWF); wherein administration of said polypeptide reduces the risk of and/or prevents ischaemic damage, organ damage and/or microthrombi formation by 10%, 20%, 30%, preferably by at least 40%, or even at least 50%, such as 60%, 70%, 80%, 90% or even to 100%,
- administration of said polypeptide reduces the risk of and/or prevents ischaemic damage, organ damage and/or microthrombi formation by a factor 1,2, 1,3, 1.4, 1,5, 1.6, 1.75, 1,8, 2 or
- the present invention relates to a method wherein said step (i) of administering said polypeptide is repeated for at least 1, 2, 3, 4, 5, 6, 7 days, or even longer such as 1 week, 2 weeks, 3 weeks, or even longer such as 1 month or even 2 months
- the present invention relates to a method further comprising measuring ADA TS13 activity of said patient, preferably once per week.
- the present invention relates to a method wherein said step ft) of administering said polypeptide is repeated for at least 1, 2, 3, 4, 5, 6, 7 days, or even longer such as 1 week, 2 weeks, 3 weeks, or even longer such as 1 month or even 2 months when the ADA TS13 activity is [for the first time] > 10%, such as more than 15%, or even more than 20% of a reference ADAMTS13 activity.
- the present invention relates to a method of treating a symptom of a vWF- related disease, such as TTP, in a human suffering from said disease, comprising administering to the subject a polypeptide of the invention, in an amount effective to treat the symptom of a vWF- related disease in a human suffering from said disease.
- a symptom of a vWF- related disease such as TTP
- the present invention relates to a method of inhibiting in a human the onset or progression of a vWF-related disease, such as TTP, the inhibition of which is effected by binding of a polypeptide comprising at least one immunoglobulin single variable domain (ISVD) against von Willebrand Factor (vWF) to vWF, comprising administering to the human at a predefined interval effective inhibitory doses of said polypeptide, wherein each administration of the polypeptide delivers to the human from 0.1 mg per kg to 25 mg per kg of the human's body weight, so as to thereby inhibit the onset or progression of the disease in the human.
- a vWF-related disease such as TTP
- the present invention relates to a method of reducing the likelihood of a human contracting ischaemic organ damage by a vWF-related disease, which comprises administering to the human at a predefined dose a polypeptide comprising at least one immunoglobulin single variable domain (ISVD) against von Willebrand Factor (vWF), wherein each administration of the antibody delivers to the human from 0.1 mg per kg to 25 mg per kg of the human's body weight, so as to thereby reduce the likelihood of the human contracting ischaemic organ damage.
- ISVD immunoglobulin single variable domain
- vWF von Willebrand Factor
- vWF levels in TTP patients Model-predicted % decrease from baseline of free vWF levels at the end of period 2 as a function of the daily dose level, including patients treated with placebo. Median, 25th and 75th percentiles are indicated.
- PK/PD-Model of caplacizumab and free, total and complexed vWF (A) Model- predicted caplacizumab concentration profiles after daily s.c. administration during period 1 and period 2 (with and without concomitant daily PE). (B) Model-predicted free vWF levels during a daily 10 mg s.c. administration of caplacizumab and after the treatment period. (C) Estimated complex caplacizumab-vWF levels during a daily 10 mg s.c. administration of caplacizumab and after the treatment period. (D) Model- predicted total vWF levels during a daily 10 mg s.c. administration of caplacizumab and after the treatment period. Median profiles, 5th and 95th percentiles are shown.
- the therapeutic potential of the polypeptides of the invention, such as ALX 0081, in a TTP setting was demonstrated by in vitro experiments using plasma from TTP patients in flow chamber experiments. In these experiments, endothelial cells were stimulated to produce ULvWF strings on their surface ⁇ see Example 7.2). It was demonstrated that the polypeptides of the invention, such as ALX 0081, were able to inhibit platelet-vWF interactions and particularly ULvWF-mediated platelet interaction in vitro and were also shown to have no impact on ADA TS13 function. In particular, it was demonstrated that the polypeptides of the invention, such as ALX 0081, are able to interact with vWF in both its active ⁇ i.e.
- polypeptides of the invention can be used to treat TTP patients. It also proves that the polypeptides of the invention, such as ALX 0081, do not interfere with the ADAMTS13 activity.
- the present invention is at least partly based on the finding that the administration to human TTP patients of polypeptides comprising at least one ISVD against vWF (also referred to herein as "polypeptide(s) of the invention") provides an unexpected decrease of 2 days in the time-to- response.
- the time-to-response was objectified by the time necessary for the recovery of platelets to > 150,000/ ⁇ .
- the invention provides an unexpectedly sustained and prolonged effect, reduced exacerbations, reduced hospitalization, reduced morbidity, a reduced number of required PEs, reduced ischaemia, reduced organ damage and red uced death toll.
- the invention relates to the use of the polypeptides of the invention to treat or ameliorate a vWF-related disease in a patient by an unexpectedly large decrease in the time-to- response, demonstrated by an accelerated platelet recovery.
- the invention also provides for less frequent PEs, while still maintaining the platelet recovery in the human patient at unexpectedly prolonged periods of time.
- methods for decreasing the time-to-response in a human patient by administering to the patient a polypeptide of the invention, wherein the amount of the polypeptide administered is effective to change one or more disease markers of TTP, such as the number of platelets, thrombocytopenia, neurocognitive function, disintegrin-like and meta lloprotease with throm bospondin repeats 13 (ADAMTS13) levels and anti-ADAMTS13 antibody titres, ADAMTS13 activity levels, cardiac marker (Troponin T or Troponin I), BMP (brain natriuretic peptide) or N-terminal pro brain natriuretic peptide ⁇ NT proBNP), and Brain damage markers (such as NSE (neuron specific enolase) and SplOO (SlOObeta)), preferentially an increase in the number of platelets.
- TTP disease markers of TTP
- ADAMTS13 disintegrin-like and meta lloprotease with throm
- polypeptide of the invention when administered to a human TTP patient was safe as examined by safety laboratory markers, such as RICO, vWF and FVtl l chromogene. Although there was a potential for an increased bleeding risk, this was wholly manageable.
- the markers can be measured using standard methods known to and used by the skilled person, such as various immunologically based assays, including enzyme-linked immunosorbent assays (ELISA; also known as an enzyme immunoassay (E IA)), radioimmunoassays or imm unoenzymetric assays. Chemical, colorimetric and enzymatic based assays also may be used when suitable.
- ELISA enzyme-linked immunosorbent assays
- E IA enzyme immunoassay
- radioimmunoassays radioimmunoassays or imm unoenzymetric assays.
- Chemical, colorimetric and enzymatic based assays also may be used when suitable.
- the present invention provides a polypeptide comprising at least one ISVD against vWF for use in treating a vWF-related disease in a human in need thereof, by administering to the human a 5-40 mg dose of said polypeptide, wherein said dose is followed within 15 min to 4 h by a first Plasma Exchange (PE).
- PE Plasma Exchange
- the polypeptides of the invention were administered as adjunctive treatment at specific times relative to the PE procedures to treat or prevent ⁇ e.g., reduce or ameliorate one or more symptoms associated with) a vWF-related disease, e.g., TTP.
- treating refers to administering a therapy in an amount, manner, and/or mode effective to improve a condition, symptom, or parameter associated with a disease or to prevent progression of a disease, to either a statistically significant degree or to a degree detectable to one skilled in the art.
- the treatment may improve, cure, maintain, or decrease duration of, the disease or condition in the subject.
- the subject may have a partial or full manifestation of the symptoms.
- treatment improves the disease or condition of the subject to an extent detectable by a physician, or prevents worsening of the disease or condition.
- the clinical features and signs in an acute episode of TTP as depicted in Table 1 or as provided in the TTP treatment guidelines (Scully et ai. 2012 supra) improve.
- the platelet count normalizes, the ADAMTS13 autoantibody titre decreases and/or the ADAMTS13 activity increases, all as known in the art and/or further detailed herein (cf. infra).
- An effective amount, manner, or mode can vary depending on the subject and may be tailored to the subject.
- the term "preventing” means to mitigate a symptom of the referenced disorder.
- said term encompasses the complete range of therapeutically positive effects of administrating a polypeptide of the invention to a subject including reduction of, alleviation of, and relief from, a vWF related disorder, e.g. TTP, and symptoms thereof.
- prevention includes the prevention or postponement of development of the disease, prevention or postponement of development of symptoms and/or a reduction in the severity of such symptoms that will or are expected to develop. These further include ameliorating existing symptoms, preventing additional symptoms and ameliorating or preventing the underlying causes of symptoms.
- the terms "subject” and “patient” are used interchangeably.
- the terms “subject” and “subjects” refer to an animal, e.g., a mammal including a non-primate (e.g., a cow, pig, horse, donkey, goat, camel, cat, dog, guinea pig, rat, mouse, sheep) and a primate (e.g., a monkey, such as a cynomolgus monkey, gorilla chimpanzee and a human).
- a “patient” preferably refers to a human.
- Said patient can include elderly, adults, adolescents and children, from any age, for instance children ranging from the age of 2 years to less than 12 years, adolescents ranging from 12 years to less than 18 years, adults ranging from 18 years to less than 65 years, and elderly from 85 years and up.
- Non-limiting examples of vWF-related diseases that can be treated include, but are not limited to, e.g. acute coronary syndrome (ACS), transient cerebral ischemic attack, unstable or stable angina pectoris, stroke, myocardial infarction, thrombotic thrombocytopenic purpura (TTP) and Upshaw- Schulman syndrome, preferably TTP.
- ACS acute coronary syndrome
- TTP thrombotic thrombocytopenic purpura
- Upshaw- Schulman syndrome preferably TTP.
- vWF-related disease such as e.g., TTP
- TTP a vWF-related disease
- Complete remission is defined as normal platelet count, i.e. > 150,000/ ⁇ , and optionally the absence of exacerbations (cf. Scully et al. 2012, supra).
- time-to-response is the time between the first treatment of a patient having an acute TTP episode and a platelet count of > 150,000/ ⁇ , in which the first treatment is a PE or the administration of a polypeptide of the invention, or both, whichever is the earliest.
- PE Prosma exchange
- TTP tissue transfer Protocol
- PE plasma exchange
- pathologic substances such as auto antibodies against ADA TS13 and ULvWF, but also some platelets.
- Plasma is used as a replacement fluid to replace ADAMTS13 when treating thrombotic thrombocytopenic purpura ( cLeod Best Pract Res Clin Haematol. 2006; 19:157-167).
- the bulk removal and replacement of plasma also has implications for laboratory testing, making patient testing intricate.
- Platelet counts can be done by any method known in the art, such as manually using a hemocytometer or with an automated analyzer, e.g. electronic counting. Counts can also be estimated during blood smear examination. The microscopic method uses a phase contrast microscope to view blood on a hemacytometer slide. Electronic counting of platelets is the most common method. There are two types of electronic counting, voltage-pulse and electro-optical counting systems.
- the ADVIA hematology analyzer can be used for obtaining platelet counts and verify the obtained count by estimating counts on a Wright's-stained blood smear.
- the polypeptide of invention comprising at least one ISVD against vWF, e.g. ALX 0031, was administered after said patient had received a PE ("preceding PE"; a PE preceding the administration of the first dose of the polypeptide of the invention).
- the present invention relates to performing a PE (preceding PE) to a patient in need thereof, e.g.
- first dose means the first administration of a polypeptide of the invention to a patient in need thereof, e.g. after an acute episode or every acute episode of TTP,
- an administration of the polypeptide of the invention to a patient preferably a first dose is followed within 5 min to 8h, such within 10 min to 6 h or 15 min to 4h, for instance within 8h, 7h, 6h, Sh, 4h, 3h, 3h, Ih, 45 min, 30 min, 20 min, 15 min, 10 min or even 5 min by a PE.
- first PE means the first PE performed after (or in some cases concurrent with) administration to a patient of a first dose of the polypeptide of the invention.
- the polypeptide of the invention can be administered or used for administration in the form of a liquid solution ⁇ e.g., injectable and infusible solutions).
- compositions can be administered by a parenteral mode (e.g., subcutaneous, intraperitoneal, or intramuscular injection), or by inhalation.
- parenteral administration and “administered parenterally” as used herein mean modes of administration other than enteral and topical administration, usually by injection, and include, subcutaneous (s.c.) or intramuscular administration, as well as intravenous (i.v.), intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcuticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion.
- the second or further doses of the polypeptides of the invention described herein are administered subcutaneously.
- the administration of the first dose of a polypeptide of the invention following an acute episode of TTP is an intravenous bolus injection, e.g. delivering the polypeptide through an intravenous tine, administered all at once, over a period of a minute or two.
- the administration of the first dose of a polypeptide of the invention following an acute episode of TTP is an intravenous push injection, e.g. delivering the polypeptide through an intravenous line, administered all at once, over a period of about 30 seconds or less.
- the polypeptide of the invention is safe to use as was demonstrated in previous studies in healthy volunteers and the present study with TTP patients (cf. Example 7.5.3), that TTP might be hard to diagnose, especially acute bouts of TTP, and that any time lost before starting a treatment results in adversities, concluded that this finding has the benefit that a treatment with the polypeptide of the invention can already be started timely, even before the patient enters a hospital, such as e.g. in an ambulance.
- the polypeptide of the invention such as ALX 081 is administered by an intravenous push injection, since this can easily be performed outside hospitals, thus saving valuable time.
- the present invention relates to administering to a patient in need thereof, such as e.g. patients with acute episodes (acute bouts) of TTP, a polypeptide of the invention about 8h, 7h, 6h, 5h, 4h, 3h, 3h, Ih, 45 min, 30 min, 20 min, 15 min, 10 min or even 5 min before starting PE, such as from 6h to 15 min before starting PE ("first dose").
- a polypeptide of the invention about 8h, 7h, 6h, 5h, 4h, 3h, 3h, Ih, 45 min, 30 min, 20 min, 15 min, 10 min or even 5 min before starting PE, such as from 6h to 15 min before starting PE ("first dose").
- first PE a PE
- second dose or “further dose”
- the second dose or further dose is administered within 120, 90 or 60 min, such as within 1 - 60 min, for instance, within 50, 45, 40, 35, 30, 25, 20, 15, 10, 5, 4, 3, 2 or even 1 min after the first PE.
- the replacement fluid e.g. the plasma of the PE.
- a first dose, a second dose or further dose of the polypeptide of the invention is about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, or 40, 50, 60, 70 or 80 mg, preferably 5-40 mg even more preferably 10 mg, which can be administered to a patient in need thereof, preferably per day.
- the dose may be adjusted to the weight of the patient.
- the dose is about 0.01, 0.025, 0.05, 0.075, 0.1, 0.12, 0.14, 0.15, 0.16, 1.08, 0.2, 0.22, 0.24 or 0.25 mg/kg, preferably 0.143 mg/kg which corresponds to a 10 mg dose in a 70 kg adult.
- the present invention relates to the administration of about 5 to 40 mg, preferably 10 mg of a polypeptide of the invention, e.g. ALX 0081, within 1-60 min after a PE procedure, e.g. the first PE, the second PE or a further PE,
- the polypeptide of the invention e.g. ALX 0081
- a TTP patient in need thereof preferably a patient with a platelet count below 100,000/ ⁇ plasma and/or a patient with an ADAMTS13 activity of ⁇ 10% such as ⁇ 5%:
- a TTP patient in need thereof is treated with
- step (i) a dose of 5-40 mg preferably 10 mgof said polypeptide 60 min to 1 m in after said PE of step (i),
- step (i) and step (ii) are repeated once or twice per day until the platelet count of said patient is at least 50,000/ ⁇ plasma, such as 75,000, 100,000, 125,000 or even 150,000 per ⁇ plasma .
- step (i) a nd step (ii) for a minimum of two days after complete remission fa platelet count of >150,000/ ⁇ plasma.
- 5-40 mg of the polypeptide of the invention is administered daily or twice daily for at least 5, 10, 15, 20, 25, 30, 60, 90 or even 120 days after the platelet count of said patient is >150.000/ ⁇ plasma, particularly when the ADAMTS13 activity of said patient is ⁇ 10% such as ⁇ 5%, or after the last PE.
- This Hazard Ratio means that at any time, subjects receiving the polypeptide of the invention have more than twice the rate of achieving the primary endpoint of confirmed platelet recovery in comparison to subjects on Placebo. In addition, this platelet recovery is achieved 2 days faster in the treatment group.
- polypeptides comprising at least one I5VD against vWF, such as ALX 0081
- administration of polypeptides comprising at least one I5VD against vWF, such as ALX 0081
- vWF such as ALX 0081
- exacerbation refers to a recurrent thrombocytopenia following a confirmed platelet response and requiring a reinitiation of daily PE treatment after > 1 day but ⁇ 30 days after the last PE. This indicates that the polypeptide of the invention, such as AtX 0081, can be solely responsible for treating and/or alleviating (the symptoms of) TTP,
- the present invention relates to a polypeptide comprising at least one ISVD against vWF, such as ALX 0081, for use in treating a vWF-related disease, such as TTP, in a human in need thereof, by administering to the human a dose of 1-80 mg or 5-40 mg, such as 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 50, 60, 70 or 80 mg, preferably 10 mg of said polypeptide.
- vWF-related disease such as TTP
- a further optimized treatment protocol was designed by the present inventors, in essence based on the idea that the distribution of confirmed platelet response time is shorter and not skewed and biased to the right (longer time to response ⁇ in the CAP arm in comparison to the placebo arm.
- all subjects are treated with a fixed PE treatment period, which is set for 3-5 days, such as 3 days or 4 days or 5 days, preferably 3 days.
- the PE treatment period can be independent of the recovery of platelets (> 150,000/ ⁇ ).
- the burden for the patient and the costs are decreased.
- the present invention relates to a polypeptide comprising at least one ISVD against vWF, such as ALX 0081, for use in treating a vWF-related disease in a human in need thereof, comprising: (i) performing a PE; and (ii) administering a dose of 5-40 mg, such as 10 mg of the polypeptide of the invention 15 min to 4 h after said PE of step (i), wherein step (i) and step (ii) are repeated once per day for 3-5 days, such as 3 days, 4 days or 5 days, preferably 3 days; followed by further comprising administering once per day a dose of 5-40 mg, such as 10 mg of said polypeptide for at least 10 days, such as at least 20 days or at least 30 days and/or for at least 10 days, such as at least 20 days or at least 30 days after the platelet count of said patient was for the first time >150.000/ ⁇ .
- remission refers to as confirmed platelet response and the absence of exacerbation.
- confirmation platelet response refers to the time-to-response of treatment as defined by a recovery of platelets > 150,000/ ⁇ , which response must be confirmed at 48 hours after the initial reporting of platelet recovery above 150,000/ ⁇ by a de novo measure of platelets ⁇ 150,000/ ⁇ , and preferably IDH ⁇ 2 X ULN.
- the present inventors now unexpectedly observed that remission appears more pronounced for the subgroup of subjects with low Baseline ADA TS13 activity [i.e. less than 10%, such as less than 5%), when starting treatment, e.g. administering the first dose, of the polypeptide of the invention, such as ALX 0081 (cf. Example 7.5.8).
- the present invention relates to a polypeptide comprising at least one ISVD against vWF for use in treating a vWF-related disease in a human in need thereof, by administering to said human a first dose of 1-40 mg, preferably 10 mg of said polypeptide, until the platelet count of said human is >150000/ ⁇ .
- said human has an ADAMTS13 activity of less than 10%, such as less than 5% when administering said polypeptide.
- relapse refers to a de novo event of TTP that occurs later than 30 days after the last daily PE, e.g. 0-2 days after the TTP patient showed complete remission.
- the "later than 30 days” date coincides with the last administration of the polypeptide of the invention in the present study.
- the polypeptide of the invention was not administered anymore, it has been found that the number of relapses in the Caplacizumab group equaled the number of relapses in the Placebo group (see Table 7, in Example 7.5.4).
- the inventors observed that in both treatment arms, relapses are more prominent in patients with a baseline ADA TS13 activity of ⁇ 10%, such as ⁇ 5%, even though the ADAMTS13 activity was only available in a subset of the patients.
- the data support the use of ADAMTS13 activity as predictive marker for recurrences of TTP and its potential for treatment decisions, ADAMTS13 activity is able to predict relapses which occur shortly after stopping caplacizumab treatment. These relapses are considered as relapses of the presenting TTP episode (unresolved disease activity, based on continuously low ADA TS13 activity).
- a 30-day treatment period (post PE) with caplacizumab has demonstrated a significant impact on the number of exacerbations.
- extending the caplacizumab treatment period for those patients at risk for relapse i.e.
- caplacizumab With underlying disease activity based on ADAMTS13 activity, will maintain the protective effects of caplacizumab until the underlying disease is adequately treated and resolved. Conversely, precautionary treatment with caplacizumab will reduce the risk of a -new- acute episode of TTP.
- polypeptide of the invention such as ALX 0081
- treatment with polypeptide of the invention should be continued for longer periods compared to patients with higher activity.
- the polypeptide of the invention should be administered to a TTP patient to reduce the risk of and/or prevent the chance of relapse(s) until the ADAMTS13 activity was at least 10%, such at least 15%, 20%, 25%, 30%, 35%, 40%, 45%, or even 50% compared to the normal or reference activity.
- the present invention relates to a polypeptide comprising at least one immunoglobulin single variable domain fISVD) against von Wiliebrand Factor (vWF) for use in reducing the risk of and/or preventing an acute episode of a vWF-related disease, e.g. TTP, in a human in need thereof, comprising a step (i): administering to said human a dose of 5-40 mg, preferably 10 mg, of said polypeptide.
- vWF-related disease e.g. TTP
- said risk is reduced by a factor of at least 1.2, 1.3, 1.4, 1,5, 1,6, 1,75, 1,8, 2 or more, such as 3, 4, 5, 6, 7, 8, 9, or even 10, or even more such as .20, 50 or even 100, Preferably said risk is reduced by 10% or even more such as 20%, 30%, 40%, 50%, 60% or more, such as 80 % or even 100%.
- the present invention relates to a polypeptide as described herein, wherein said step (i) of administering to said human said polypeptide is repeated for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 times, or even more than 10 times, such as 20 times, preferably more than 30 times or even more.
- step (ij of administering to said human said polypeptide is repeated for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 ⁇ days, or even more than 10 days, such as 20 days, preferably more than 30 days, such as 2 months, 3 months, 4 months, 5 months, 6 months or even more, Accordingly, the present invention relates to a polypeptide as described herein, wherein said dose is administered 1 time per day or two times per day.
- the present invention relates to a polypeptide as described herein, further comprising
- the present invention relates to a polypeptide as described herein, wherein said ADAMTS13 activity of said patient is measured every day, or every 2, 3, 4, 5, 6, 7, 8, 9, or 10 days, preferably at least once every week.
- the present invention relates to a polypeptide as described herein, wherein step (i) is repeated until said ADAMTS13 activity is at least 5%, 10%, 15%, such 20%, or even 30% or higher of said reference ADAMTS13 activity.
- the present invention relates to a polypeptide as described herein, wherein step (i) of administering to said human said polypeptide is repeated until said ADA TS13 activity is at least 5%, 10%, 15%, such as 20% or 30% of said reference ADAMTS13 activity on at least 2 consecutive measurements.
- said 2 consecutive measurements are at least 24b, more preferably 48h apart, such as at least 3 days apart, or even more such as, 4, 5, 6, or even 7 days apart, preferably a week apart.
- the present invention relates to a polypeptide as described herein, wherein said step (i) of administering to said human said polypeptide is repeated for at least at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 days, or even more than 10 days, such as 20 days, preferably more than 30 days or even more, after said ADAMTS13 activity is at least 5%, at least 10%, at least 15%, such as 20% or at least 30% of said reference activity on at least 2 consecutive measurements.
- the present invention relates to a polypeptide comprising at least one immunoglobulin single variable domain (ISVD) against von Willebrand Factor (vWF) for use in reducing the risk of and/or preventing an acute episode of a vWF-related disease, such as TTP, in a human in need thereof, comprising step (i): administering to said human a dose of 5-40 mg, preferably 10 mg of said polypeptide, further comprising
- ISVD immunoglobulin single variable domain
- vWF von Willebrand Factor
- ADAMTS13 activity is > 5%, such as > 10%, or even > 15%, or more than 20% or 30% of said reference ADAMTS13 activity, then repeating said step (i) for at most 30 days, such as at most 20 days, or even 15, 10, 9, 8, 7, 6, 5, 4, 3, 2 days or even 1 day.
- the present invention relates to a polypeptide comprising at least one immunoglobulin single variable domain (ISVD) against von Witlebrand Factor (vWF) for use in reducing the risk of and/or preventing an acute episode of a vWF-related disease, such as TTP, in a human in need thereof, comprising at least the following steps;
- ISVD immunoglobulin single variable domain
- vWF von Witlebrand Factor
- ADA TS13 activity is lower than 30%, 20%, 15%, 10% or 5% of said reference activity, then administering to said human a dose of 5-40 mg, preferably 10 mg of said polypeptide comprising at least one immunoglobulin single variable domain (ISVD ) against von Willebra nd Factor (vWF).
- ISVD immunoglobulin single variable domain
- vWF von Willebra nd Factor
- red ucing risk or incidence includes decreasing the probability or incidence of an indication, symptom or result of vWF-related disease, such as TTP, for a subject compared to a relevant, e.g. untreated, control population, or in the same subject prior to treatment according to the invention.
- An indication, symptom or result of a vWF-related disease, such as TTP, as used herein includes organ damage, ischaemic damage, microthrom bi formation, exacerbations, mortality, relapses, one or more disease markers of a vWF related disease, such as TTP, include the number of platelets, thrombocytopenia, neurocognitive function, ADAMTS13 levels and a nti-ADAMTS13 antibody litres, ADA TS13 activity levels, cardiac marker (Troponin T or Troponin I), BMP (brain natriuretic peptide) or N-terminal pro brain natriuretic peptide (NT proBN P), creatinine, and Brain damage markers (such as NSE (neuron specific enolase) and spiOO (SlOObeta)), preferentially organ damage markers, such as LDH levels, troponin T and/or troponin I levels, and/or creatinine levels,
- Risk or incidence can also be reduced if the severity of an indication, symptom or result of vWF-related disease, such as TTP, is reduced to a level such that it is not of clinical relevance. That is, the indication, symptom or result of a vWF-related disease, such as TTP, may be present but at a level that does not endanger the life, activities, and/or wellbeing of the subject. In some circumstances the occurrence of the vWF-related disease, such as TTP, is reduced to the extent that the subject does not present any signs of the vWF-related disease, such as TTP, during and/or after the treatment period.
- the polypeptide of the invention reduces the risk of and/or preventing an acute episode of a vWF-related disease, such as TTP.
- a vWF-related disease such as TTP.
- the indication, symptom or result of a vWF-related disease, such as TTP is also reduced.
- the recovery of platelet counts is an indirect measure of prevention of further microthrombi formation.
- the morbidity and the acute mortality associated with acquired TTP is a result of these microthrombi. Indeed, this reasoning is supported by the normalization of organ damage markers.
- the results indicate that the organ damage markers, such as troponin I and T, LDH and creatinine, return faster to normal levels in subjects receiving the polypeptide of the invention, e.g. ALX 0081, than in subjects receiving placebo fcf. Example 7.5.7).
- organ damage markers such as troponin I and T, LDH and creatinine
- the present invention relates to a method as described herein, wherein
- the risk of organ damage, ischaemic damage and/or microthrombi formation is reduced by 10%, 20%, 30%, preferably by at least 40%, or even at least 50%, such as 60%, 70%, 80%, 30% or even to 100% (e.g. absence of organ damage, ischaemic damage and/or microthrombi formation due to the vWF-related disease); the risk of organ damage, ischaemic damage and/or microthrombi formation is reduced by a factor 1,2, 1.3, 1,4, 1,5, 1.6, 1,75, 1.8, 2 or more, such as 3, 4, 5, 6, 7, 8, 9, or even 10, or even more such as 20, 50 or even 100;
- organ damage, ischaemic damage and/or microthrombi formation is reduced preferably by at least 10%, 20%, 30%, 40%, or even at least 50%, such as 60%, 70%, 80%, 30% or even to 100%; organ damage, ischaemic damage and/or microthrombi formation is reduced by a factor 1.2, 1.3, 1.4, 1.5, 1.6, 1.75, 1,8, 2 or more, such as 3, 4, 5, 8, 7, 8, 9, or even 10, or even more such as 20, 50 or even 100;
- organ damage markers such as LDH levels, troponin T, troponin I levels, and/or creatinine levels, return to at least 40%, or even at least 50%, such as 60%, 70%, 80 ⁇ %, 90% or even to
- organ damage markers such as LDH levels, troponin T, troponin 1 levels, and/or creatinine levels, improve by at least 20%, such 30% or even higher, such as 40%, or even at least 50%, such as 60%, 70%, 80%, 90% or even to 100% of normal levels.
- said organ damage, such as LDH levels, troponin T, troponin I levels, and/or creatinine levels, markers improve in less than 30 days of treatment, preferably, in less than 20 days of treatment, such as, less than 15, 10, 9, 8, 7, 6, 5, 4, 3, 2 days or even within 1 day.
- the number of platelets is kept at > 150000/ ⁇ .
- the time to platelet normalization (> 150000/ ⁇ ) is reduced by at least 10%, 20%, 30%, 35%, 39%, preferably by at least 40%, or even at least 50%, such as 60%, 70%, 80%.
- the risk of exacerbations is reduced by at least 10%, 20%, 30%, 40%, or even at least 50%, such as 60%, 70%, 80%, 90% or even to 100%;
- the risk of exacerbations is reduced by a factor, 2 or more, such as 3, 4, 5, 6, 7, 8, 9, or even 10, or even more such as 20, 50 or even 100;
- vWF related disease due to said vWF related disease is reduced by 10%, 20%, 30%, preferably by at least 40%, or even at least 50%, such as 60%, 70%, 80%, 90% or even to 100%;
- vWF related disease mortality due to said vWF related disease is reduced by a factor, 2 or more, such as 3, 4, 5, 6, 7, 8, 9, or even 10, or even more such as 20, 50 or even 100; and/or
- remission is increased by a factor 1.2, 1.3, 1.4, 1.5, 1,6, 1.75, 1.8, 2 or more, such as 3, 4, 5, 6, 7, 8, 9, or even 10, or even more such as 20, 50 or even 100,
- the present invention relates to a polypeptide for reducing the risk of and/or preventing ischaemic damage, organ damage and/or microthrombi formation, for instance causable by a vWF- related disease, such as TTP, in a human in need thereof, comprising at least the following step (i) administering to said human a dose of 5-40 mg/day, preferably 10 mg/day of a polypeptide comprising at least one immunoglobulin single variable domain (ISVD) against von Willebrand Factor (vWF); wherein administration of said polypeptide reduces the risk of and/or prevents ischaemic damage, organ damage and/or microthrombi formation by at least 10%, 20%, 30%, preferably by at least 40%, or even at least 50%, such as 60%, 70%, 80%, 90% or even to 100%.
- vWF-related disease such as TTP
- administration of said polypeptide reduces the risk of and/or prevents ischaemic damage, organ damage and/or microthrombi formation by a factor 1.2, 1.3, 1.4, 1.5, 1.6, 1.75, 1.8, 2 or more, such as 3, 4, 5, 6, 7, 8, 9, or even 10, or even more such as 20, 50 or even 100.
- the present invention relates to a polypeptide for reducing the risk of and/or preventing ischaemic damage, organ damage and/or microthrombi formation as described herein, wherein said step (i) of administrating said polypeptide is repeated for at least 1, 2, 3, 4, 5, 6, 7 days, or even longer such as 1 week, 2 weeks, 3 weeks, or even longer such as 1 month or even 2 months.
- the present invention relates to a polypeptide for reducing the risk of and/or preventing ischaemic damage, organ damage and/or microthrombi formation as described herein, further comprising measuring ADAMTS13 activity of said patient, preferably once per week.
- the present invention relates to a polypeptide for reducing the risk of and/or preventing ischaemic damage, organ damage and/or microthrombi formation as described herein, wherein said step (i) of administrating said polypeptide is repeated for at least 1, 2, 3, 4, 5, 6, 7 days, or even longer such as 1 week, 2 weeks, 3 weeks, or even longer such as 1 month or even 2 months when the ADAMTS13 activity is [for the first time] > 5%, such as > 10%, or even > 15% of a reference ADAMTS13 activity.
- the present invention relates to a polypeptide of the invention for treating a symptom of a vWF-related disease, such as TTP, in a human suffering from said disease, comprising administering to the subject a polypeptide of the invention, in an amount effective to treat the symptom of a vWF-related disease in a human suffering from said disease.
- a vWF-related disease such as TTP
- the present invention relates to a polypeptide of the invention for inhibiting in a human the onset or progression of a vWF-related disease, such as TTP, the inhibition of which is effected by binding of a polypeptide comprising at least one immunoglobulin single variable domain (ISVD) against von Willebrand Factor (vWF) to vWF, comprising administering to the human at a predefined interval effective inhibitory doses of said polypeptide, wherein each administration of the antibody delivers to the human from 0.1 mg per kg to 25 mg per kg of the human's body weight, so as to thereby inhibit the onset or progression of the disease in the human.
- a vWF-related disease such as TTP
- the present invention relates to a polypeptide for reducing the likelihood of a human contracting ischaem ic organ damage by a vWF-related disease, which comprises administering to the human at a predefined dose a polypeptide comprising at least one immunoglobulin single variable domain ( ISVD) against von Willebrand Factor (vWF), wherein each administration of the a ntibody delivers to the human from. 0.1 mg per kg to 25 mg per kg of the human's body weight, so as to thereby reduce the likelihood of the human contracting ischaemic organ damage.
- ISVD immunoglobulin single variable domain
- vWF von Willebrand Factor
- the present invention relates to administering the polypeptide of the invention every 1, 2, 3, 4, 5, 6 7 days or even 2, 4, 6, or 8 weeks at doses ranging from 1-80 mg, such as 5-40 mg, preferably in preventing acute episodes of " FTP.
- Particular efficacious doses are 10-20 mg.
- the dose in pa rticula r em bod ime nts, the dose com prises about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 50, 60, 70 or 80 mg, preferably 10 mg of a polypeptide comprising at least one ISVD against vWF, such as ALX 0081.
- the present invention relates to a method of preventing relapse in a TTP patient, com prising
- step (2) comparing said activity of step (1) with a reference value (normal value);
- step (1) if the ADAMTS13 activity of step (1) is less than 15%, such as less than 10% and less than 5%, of the reference value, then administering the polypeptide of the invention, e.g. ALX 0081, thereby preventing relapse.
- the polypeptide of the invention e.g. ALX 0081
- Preliminary results suggest that administration of the first dose of the polypeptide of the invention before the first PE already results in an increase in the number of platelets.
- the present invention relates to administering the polypeptide of the invention in a patient in need thereof, such as e.g. a patient experiencing an acute episode of TTP, a dose of about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 50, 60, 70 or 80 mg, preferably 10 mg of a polypeptide comprising at least one ISVD against vWF, such as ALX 0081,
- polypeptides of invention comprising at least one ISVD against vWF, e.g. ALX. 0081, can be administered to a subject ⁇ e.g., a human subject) alone or combination with a second agent, e.g., a second therapeutically or pharmacologically active agent, to treat or prevent (e.g., reduce or ameliorate one or more symptoms associated with) a vWF-related disease, e.g., TTP.
- a vWF-related disease e.g., TTP.
- agents that can be co-formulated with the polypeptides of invention comprising at least one ISVD against vWF include, for example, adjunctive immunosuppressive treatment (e.g. corticosteroids such as (methyl)prednisolone or (methyl)- prednisone; or rituximab), antiplatelet agents ⁇ e.g. aspirin), supportive therapy with red cell transfusion or folate supplementation, treatment with vincristine or cyclosporin, anti- autoAPAMTSlS antibodies, or ADAMTS13.
- adjunctive immunosuppressive treatment e.g. corticosteroids such as (methyl)prednisolone or (methyl)- prednisone; or rituximab
- antiplatelet agents e.g. aspirin
- supportive therapy with red cell transfusion or folate supplementation treatment with vincristine or cyclosporin
- anti- autoAPAMTSlS antibodies anti- autoAPAMTSlS antibodies
- ADAMTS13
- the present invention relates to a combination therapy of the polypeptide of the invention together with an immunosuppressive treatment, in particular rituximab, which efficiently prevents relapses in TTP patients.
- the combination therapy is provided until the ADAMTS13 activity is at least > 5%, such as > 10%, >15%, >20%, 25%, 30%, 35%, 40%, 45% or even normalised such as >50% of the normal activity, TTP remains a diagnosis based on clinical history, examination of the patient and the blood film.
- ADAMTS13 assays help to confirm the diagnosis and monitor the course of the disease and possible need for additional treatments. Acute episodes of TTP can be diagnosed according to Table 1 and the guidelines of, for instance, Scully et a!. (2012 supra)
- Table 1 Clinical features and signs in acute episode of TTP.
- any particular polypeptide of the invention or dosing regimen may be determined by methods available to those of skill in the art. Briefly, during a clinical trial, the patients may be observed by medical personnel and the state of disease is assessed by any combination of criteria. The improvement of a patient's disease state is determined based on these criteria at numerous time points and the combination of these determinations on a patient population is plotted to assess the efficacy of treatment.
- assessment of efficacy may be measured by any or all of the criteria set forth below:
- Time-to-response of treatment defined by a recovery of platelets > 150,000/pL. This response must be confirmed at 48 hours after the initial reporting of platelet recovery above 150,000/ ⁇ by a de novo measure of platelets > 150,000/pL and preferably by LDH ⁇ 2 X ULN
- Exacerbation is defined as recurrent thrombocytopenia following a response and requiring a re-initiation of daily PE treatment after > 1 day but ⁇ 30 days after the last daily PE.
- Neurocognitive function as measured by a neurocognitive test battery, at complete remission and at 1 year follow up. This test will be preceded by the Glasgow Coma Score to measure the state of consciousness of the subject
- biomarkers of TTP including but not limited to a disintegrin-like and metalloprotease with thrombospondin repeats 13 (ADA TS13) levels and anti-ADA TS13 antibody titres.
- ADA TS13 disintegrin-like and metalloprotease with thrombospondin repeats 13
- ADAMTS13 activity can be evaluated using electrophoresis of vWF multimers to detect ultra-large multimers uncleaved by the protease (Moake ef al. (1982) The New England journal of medicine 307, 1432-1435; Furlan, et al. (1997) Blood 89, 3097-3103 7, 8).
- ADAMTS13 activity can be tested employing FRETS-vWF73, a fragment of vWF chemically modified to emit fluorescence when cleaved by ADAMTS13.
- FRET5-vWF73 is added to a sample of the patient's plasma, and the change in fluorescence is measured over time to determine ADAMTS13 activity.
- ADAMTS13 activity can be determined as described in for instance Vesely et al. (2003, supra), Fontana et al. (2004, supra) or Remuzzi et al. (Blood 2002; 100: 778-7852002).
- indirect ADAMTS13 activity assays involve the detection of cleavage of products either of a full- length VWF molecule or a VWF fragment that encompasses the ADAMTS13 cleavage site in the A2 domain of VWF.
- Collagen Binding Assays Normal plasma or purified VWF is incubated with the test plasma sample in the presence of BaCI2 and 1.5M urea which denatures the VWF. VWF is cleaved by ADAMTS13 and residual VWF is measured by its binding to collagen Type III. The bound VWF is quantitated using an ELISA assay with a conjugated anti-VWF antibody.
- VWF is measured by ristocetin-induced platelet aggregation using a platelet aggregometer.
- Functional ELISA assays In this assay, a recombinant VWF fragment is immobilised onto an ELISA plate using an antibody to a tag on the VWF. The VWF fragment encodes the A2 domain and the ADAMTS13 cleavage site at Tyrl605-Metl6O6 and is tagged with S-transferase [GST]-histidine [GST-VWF73-His].
- Plasma is added to the immobilised GST-VWF73-His fragment and cleavage of the immobilised fragment occurs at the ADAMTS13 cleavage site.
- the residual, cleaved VWF fragment is measured by using a second monoclonal antibody that recognises only the cleaved VWF fragment and not. the interact fragment, ADAMTS13 activity is, therefore, inversely proportional to the residual substrate concentration. This method forms the basis for the TECHNOZY * ADAMTS13 Activity EL1SA.
- anti-ADAMTS13 autoantibodies can be determined by ELISA, such as the TECHNOZYM- ADAMTS13 INH ELISA (Technoclone).
- Ristocetin Cofactor activity in human samples for instance, the Ristocetin Cofactor can be determned by the vW Select of Bio/Data corp. on an aggregometer PAP-8E analyzer (Bio/Data corp.).
- the person skilled in the art is familiar in determining Factor VIII in human samples, for instance using Coamatic Factor VIII (Chromogenix) on a STA-R evolution analyzer (Diagnostica Stago).
- the person skilled in the art is familiar in determining von Willebrand Factor antigen in human samples, for instance using a immunoturbidometric assay (e.g. using a STA Lia test vWF:Ag) on a STA-R evolution analyzer (Diagnostica Stago).
- a immunoturbidometric assay e.g. using a STA Lia test vWF:Ag
- STA-R evolution analyzer Diagnostica Stago
- the person skilled in the art is familiar in determining LDH levels. Most methods are based on a lactate dehydrogenase -based enzymatic analysis on a spectrophotometer. A convenient review is provided by Medbo et al. (2000) "Examination of four different instruments for measuring blood lactate concentration”. Scand J Clin Lab Invest 60:367-380.
- assays such as Abnova (Catalog Number KA1653) which measures the catalysis by LDH of the interconversion of lactate and pyruvate, i.e. a non-radioactive colorimetric LDH assay based on the reduction of the tetrazolium salt MTT in a NADH-coupled enzymatic reaction to a reduced form of MTT which exhibits an absorption maximum at 565 nm.
- the intensity of the purple color formed is directly proportional to the enzyme activity.
- MAK066-1KT LDH reduces NAD to NADH, which is specifically detected by colorimetric (450 nm) assay. Normal values are provided in the Table 1.1 below.
- troponin I and T are measured by immunoassay methods, which are available on many different immunoassay platforms, e.g. DPC Immulite, Abbott AxSYM, Bayer ACS:Centaur, Ortho Vitros, Roche Elecsys, third generation.
- DPC Immulite Abbott AxSYM
- Bayer ACS Centaur
- Ortho Vitros Roche Elecsys
- a convenient review is provided by Wu et al. (1999) National Academy of Clinical Biochemistry Standards of Laboratory Practice: recommendations for the use of cardiac markers in coronary artery diseases. Clin Chem. Jul 1999;45(7):1104-21. Normal values are provided in the Table 1.1 below.
- the person skilled in the art is familiar in determining creatinine.
- the polypeptides of the invention typically comprise at least one ISVD against vWF.
- the immunoglobulin single variable domains of the present invention bind to and/or have affinity for vWF.
- vWF includes, but is not limited, to cynomolgus, baboon, pig, guinea pig, mouse, and/or human vWF and most preferred human vWF, i.e. SEQ ID NO: 20 or GenBank entry: NP_000543.
- the ISVD against vWF essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which: a) CDR1 comprises or essentially consists of:
- CDR2 comprises or essentially consists of:
- amino acid sequence AISRTGGSTYYPDSVEG or an amino acid sequence that has at least 80%, preferably at least 90%, more preferably at least 95%, even more preferably at least 99% sequence identity with the amino acid sequence AISRTGGSTYYPDSVEG; or
- amino acid sequence that has 2 or only 1 amino acid difference(s) with the amino acid sequence AISRTGGSTYYPDSVEG;
- CDR3 comprises or essentially consists of:
- amino acid sequence that has at least 80%, preferably at least 90%, more preferably at least 95%, even more preferably at least 99% sequence identity with the amino acid sequence AGVRAEDGRVRTLPSEYTF; or
- the ISVD against vWF essentially consists of 4 framework regions (FRl to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which: a) CDR1 is YNPMG (SEQ ID NO: 20);
- CDR2 is AISRTGGSTYYPDSVEG (SEQ, ID NO: 21);
- CDR3 is AGVRAEDGRVRTLPSEYTF (SEQ ID NO: 22).
- the ISVD against vWF is represented by SEQ ID NO: 19 (12A02H 1) .
- the polypeptides of the invention comprise or consist of at least two ISVDs against vWF.
- the polypeptides of the present invention comprise or consist of two ISVDs against vWF defined by SEQ ID NO:s 1-18, and most preferably SEQ ID NO: 1 (ALX 0081; INN Caplacizumab).
- ALX 0081 is a bivalent Nanobody, consisting of two identical monovalent building blocks, that target vWF.
- the polypeptides comprising at least one ISVD against vWF, e.g. SEQ ID NO:s 1-19, may be used in a treatment of a vWF-related disease, in particular thrombotic thrombocytopenic purpura (TTP).
- TTP thrombotic thrombocytopenic purpura
- polypeptide and “amino acid sequence” are used interchangeably herein.
- suitable polypeptides for use in the invention may include the compounds in Table A-1, e.g. SEQ ID NO: 1-19 or 20-22, or a compound having 80% or more, more preferably 85% or more, most preferred 90%, 95%, 96%, 97%, 98%, 99% or more, amino acid sequence identity to a compound in Table A-1 (see Definition section for "sequence identity").
- the ISVD against vWF for use in the polypeptides of the invention are 12A02H1-Iike compounds.
- a 12A02H1-Iike compound is a compound which comprises 12A02H1 (i.e.
- SEQ ID NO; 19 or a compound having 80% or more, more preferably 85% or more, most preferably 90%, 95%, 96%, 97%, 98%, 99% or more, amino acid sequence identity to 12A02H1 (SEQ ID NO: 19).
- a particularly preferred polypeptide comprising two ISVDs against vWF is ALX 0081 (SEQ ID NO: 1).
- Immunoglobulin single variable domains such as camelid VHH domains, camelized VH domains or humanized VHH domains, represent a rapidly growing class of therapeutics.
- immunoglobulin single variable domains against vWF have been described in W02004/015425, WO2004/062551, WO20O6/074947, WO20O6/122825, W02QQ9/1156 , and WO2011/067160.
- Further preferred immunoglobulin single variable domains for use in the polypeptides of the invention include the improved Nanobodies described in W006/122825.
- immunoglobulin sequence whether used herein to refer to a heavy chain antibody or to a conventional 4-chain antibody - is used as a general term to include both the full-size antibody, the individual chains thereof, as well as all parts, domains or fragments thereof (including but not limited to antigen-binding domains or fragments such as VHH domains or VH/VL domains, respectively).
- sequence as used herein (for example in terms like “immunoglobulin sequence”, “antibody sequence”, “variable domain sequence”, “VHH sequence” or “protein sequence”), should generally be understood to include both the relevant amino acid sequence as well as nucleic acids or nucleotide sequences encoding the same, unless the context requires a more limited interpretation.
- immunoglobulin single variable domain (“ISVD”), interchangeably used with “single variable domain”, defines molecules wherein the antigen binding site is present on, and formed by, a single immunoglobulin domain. This sets immunoglobulin single variable domains apart from “conventional” immunoglobulins or their fragments, wherein two immunoglobulin domains, in particular two variable domains, interact to form an antigen binding site.
- a heavy chain variable domain VH
- VL light chain variable domain
- CDRs complementarity determining regions
- immunoglobulin single variable domain hence does not comprise conventional immunoglobulins or their fragments which require interaction of at least two variable domains for the formation of an antigen binding site. This is aiso the case for embodiments of the invention which "comprise” or “contain” an immunoglobulin single variable domain, In the context of the present invention, such embodiments exclude conventional immunoglobulins or their fragments.
- a polypeptide or a composition that "comprises” or “contains” an immunoglobulin single variable domain may relate to e.g. constructs comprising more than one immunoglobulin single variable domain.
- further constituents other than the immunoglobulin single variable domains e.g. auxiliary agents of different kinds, protein tags, colorants, dyes, etc.
- these terms do comprise fragments of conventional immunoglobulins wherein the antigen binding site is formed by a single variable domain.
- single variable domains will be amino acid sequences that essentially consist of 4 framework regions ⁇ FRl to FR4 respectively) and 3 complementarity determining regions (CDRl to CDR3 respectively).
- Such single variable domains and fragments are most preferably such that they comprise an immunoglobulin fold or are capable for forming, under suitable conditions, an immunoglobulin fold.
- the single variable domain may for example comprise a light chain variable domain sequence (e.g. a VL-sequence) or a suitable fragment thereof; or a heavy chain variable domain sequence (e.g. a VH-sequence or VHH sequence) or a suitable fragment thereof; as long as it is capable of forming a single antigen binding unit ⁇ i.e.
- the immunoglobulin single variable domains are light chain variable domain sequences (e.g. a VL-sequence), or heavy chain variable domain sequences (e.g.
- the immunoglobulin single variable domains can be heavy chain variable domain sequences that are derived from a conventional four-chain antibody or heavy chain variable domain sequences that are derived from a heavy chain antibody (e.g. a VHH).
- a heavy chain antibody e.g. a VHH
- Nanobodies in particular VHH sequences and partially humanized Nanobodies
- a further description of the Nanobodies, including humanization and/or camelization of Nanobodies, as well as other modifications, parts or fragments, derivatives or "Nanobody fusions", multivalent constructs (including some non-limiting examples of linker sequences) and different modifications to increase the half-life of the Nanobodies and their preparations can be found e.g. in WO 08/101985 and WO 08/142164.
- the single variable domain or immunoglobulin single variable domain ⁇ or an amino acid sequence that is suitable for use as an immunoglobulin single variable domain may be a (single) domain antibody (or an amino acid sequence that is suitable for use as a (single) domain antibody), a "dAb” or dAb (or an amino acid sequence that is suitable for use as a dAb) or a Nanobody (as defined herein, and including but not limited to a VHH sequence); other single variable domains, or any suitable fragment of any one thereof.
- single variable domains can be derived from certain species of shark (for example, the so- called "IgNAR domains", see for example WO 05/18629).
- the immunoglobulin single variable domain may be a Nanobody ® (as defined herein) or a suitable fragment thereof, [Note: Nanobody ® , Nanobodies ® and Nanocione ® are registered trademarks of Ablynx N.V.]
- Nanobodies reference is made to the further description below, as well as to the prior art cited herein, such as e.g. described in WO 08/020079 (page 16).
- the amino acid sequence and structure of an immunoglobulin sequence, in particular an immunoglobulin single variable domain can be considered - without however being limited thereto - to be comprised of four framework regions or "FR's", which are referred to in the art and herein as “Framework region 1" or “FR1”; as “Framework region 2" or “FR2”; as “Framework region 3" or “FR3”; and as “Framework region 4" or "FR4", respectively; which framework regions are interrupted by three complementary determining regions or "CDR's", which are referred to in the art as "Complementarity Determining Region 1" or “CDR1”; as “Complementarity Determining Region 2" or “CDR2”; and as “Complementarity Determining Region 3" or “CDR3", respectively.
- the total number of amino acid residues in an immunoglobulin single variable domain can be in the region of 110-12.0, is preferably 112-115, and is most preferably 113. It should however be noted that parts, fragments, analogs or derivatives of an immunoglobulin single variable domain are not particularly limited as to their length and/or size, as long as such parts, fragments, analogs or derivatives meet the further requirements outlined herein and are also preferably suitable for the purposes described herein.
- immunoglobulin single variable domain or “single variable domain” comprises peptides which are derived from a non-human source, preferably a camelid, preferably a camel heavy chain antibody. They may be humanized, as previously described, e.g. in WO 08/101985 and WO 08/142164. Moreover, the term comprises polypeptides derived from non-camelid sources, e.g. mouse or human, which have been “camelized”, as previously described, e.g. in WO 08/101985 and WO 08/142164.
- immunoglobulin single variable domain encompasses immunoglobulin sequences of different origin, comprising mouse, rat, rabbit, donkey, human and camelid immunoglobulin sequences. It also includes fully human, humanized or chimeric immunoglobulin sequences. For example, it comprises camelid immunoglobulin sequences and humanized camelid immunoglobulin sequences, or camelized immunoglobulin single variable domains, e.g. camelized dAb as described by Ward et al (see for example WO 94/04678 and Davies and Riechmann 1994, Febs Lett. 339: 285 and 1996, Protein Engineering 9: 531). All the ISVDs against vWF (or vWF binders) mentioned above are well known from the literature.
- ALX 0081 is prepared as described e.g. in WO2006/122825 or WO2009/115614.
- the immunoglobulin single variable domains provided by the invention are preferably in isolated form or essentially isolated form, or form part of a protein or polypeptide of the invention, which may comprise or essentially consist of one or more immunoglobulin single variable domains and which may optionally further comprise one or more further amino acid sequences (all optionally linked via one or more suitable linkers ⁇ .
- the one or more immunoglobulin single variable domains may be used as a binding unit in such a protein or polypeptide, which may optionally contain one or more further amino acid sequences that can serve as a binding unit (i.e.
- immunoglobulin single variable domains comprise constructs comprising two or more antigen binding units in the form of single domains, as outlined above.
- two (or more) immunoglobulin single variable domains with the same or different antigen specificity can be linked to form e.g. a bivalent, trivalent or multivalent construct.
- a polypeptide according to the invention may comprise two immunoglobulin single variable domains directed against target A, and one immunoglobulin single variable domain against target B, making it bivalent for A and monovalent for B.
- Such constructs and modifications thereof, which the skilled person ca n readily envisage, are a ll encompassed by the present invention .
- the invention relates to bi-paratopic constructs comprising at least two immunoglobulin single variable domains directed to different epitopes within the same target antigen.
- polypeptide of the invention which is synonymous with “immunoglobulin sequences” or “immunoglobulin single variable domains” of the invention.
- sequence as used herein ⁇ for example in terms like “immunoglobulin sequence”, “antibody sequence”, “variable domain sequence”, “V HH -seq uence” or “protein sequence), should generally be understood to include both the relevant amino acid sequence as well as nucleic acid sequences or nucleotide sequences encoding the same, unless the context requires a more limited interpretation.
- the immunoglobulin sequences, Nanobody* or polypeptide of the invention is glycosylated.
- the immunoglobulin seq uences, Nanobody ® or polypeptide of the invention is non-glycosylated.
- polypeptides typically comprising at least one, such as 2 or more ISVDs against vWF, i.e. ISVDs that bind and/or have affinity for an antigen as defined herein, e.g. von Willebra nd Factor (vWF) and preferably human vWF (SEQ I D NO; 20),
- ISVDs against vWF i.e. ISVDs that bind and/or have affinity for an antigen as defined herein, e.g. von Willebra nd Factor (vWF) and preferably human vWF (SEQ I D NO; 20)
- binding to and/or having affinity for a certain antigen has the usual meaning in the art as understood e.g. in the context of antibodies and their respective antigens.
- the term "binds to and/or having affinity for” means that the immunoglobulin sequence specifically interacts with an antigen, and is used interchangeably with immunoglobulin sequences "against" the said antigen.
- the term "specificity” refers to the number of different types of antigens or antigenic determinants to which a particular immunoglobulin sequence, antigen-binding molecule or antigen-binding protein (such as a Nanobody ® or a polypeptide of the invention) can bind.
- the specificity of an antigen-binding protein can be determined based on affinity and/or avidity.
- the affinity represented by the equilibrium constant for the dissociation of an antigen with an antigen-binding protein (KD) is a measure for the binding strength between an antigenic determinant and an antigen-binding site on the antigen-binding protein: the lesser the value of the KD, the stronger the binding strength between an antigenic determinant and the antigen-binding molecule (alternatively, the affinity can also be expressed as the affinity constant (KA), which is 1/KD).
- affinity can be determined in a manner known per se, depending on the specific antigen of interest.
- Avidity is the measure of the strength of binding between an antigen-binding molecule (such as a Nanobody ® or polypeptide of the invention) and the pertinent antigen. Avidity is related to both the affinity between an antigenic determinant and its antigen binding site on the antigen-binding molecule and the number of pertinent binding sites present on the antigen-binding molecule.
- immunoglobulin sequences of the present invention will bind to their antigen with a dissociation constant (KD) of 10 "5 to 10 "12 moles/liter or less, and preferably lO "7 to 10 "12 motes/liter or less and more preferably 10 " ⁇ to 10 ⁇ 12 moles/liter (i.e. with an association constant (KA) of 10 ⁇ to 10 12 liter/ moles or more, and preferably 10 7 to 10 * 2 liter/moles or more and more preferably 10 ⁇ to
- KD dissociation constant
- KA association constant
- Any KD value greater than 10 "4 M (or any KA value lower than 10 4 M "1 ) is generally considered to indicate non-specific binding.
- a monovalent immunoglobulin sequence of the invention will bind to the desired antigen with an affinity less than 500 nM, preferably less than 200 nM, more preferably less than 10 nM, such as less than 500 p .
- Specific binding of an antigen-binding protein to an antigen or antigenic determinant can be determined in any suitable manner known per se, including, for example, Scatchard analysis and/or competitive binding assays, such as radioimmunoassays (RIA), enzyme immunoassays (EIA) and sandwich competition assays, and the different variants thereof known per se in the art; as well as the other techniques mentioned herein.
- Scatchard analysis and/or competitive binding assays such as radioimmunoassays (RIA), enzyme immunoassays (EIA) and sandwich competition assays, and the different variants thereof known per se in the art; as well as the other techniques mentioned herein.
- the dissociation constant (KD) may be the actual or apparent dissociation constant, as will be clear to the skilled person. Methods for determining the dissociation constant will be clear to the skilled person, and for example include the techniques mentioned herein. In this respect, it will also be clear that it may not be possible to measure dissociation constants of more than 10 "4 moles/liter or
- the affinity denotes the strength or stability of a molecular interaction.
- the affinity is commonly given as by the KD, or dissociation constant, which has units of mol/liter ⁇ or M ).
- the affinity can also be expressed as an association consta nt, KA, which equals 1/KD and has units of (mol/liter) " 1 (or M ' 1 ) .
- the KD for biological interactions are typically in the range of 10 "10 M (0.1 nM) to 10 "5 M ⁇ 10000 nM). The stronger an interaction is, the lower is its KD.
- the off- rate koff has units s " * (where s is the SI unit notation of second).
- the on-rate kon has units M " *s ⁇ l.
- the on-rate may vary between 10 2 M ' ⁇ s "1 to about 10 7 M'V 1 , approaching the diffusion-limited association rate constant for bimolecular interactions.
- the off-rate is related to the half-life of a given molecular interaction by the relation tl/2-ln(2)/koff .
- the off-rate of immunoglobulin sequences of the invention may vary between 10 ⁇ 6 s "1 (near irreversible complex with a tl/2 of multiple days) to 1 s "1 (tl/2-0.69 s).
- the affinity of a molecular interaction between two molecules can be measured via different techniques known per se, such as the well-known surface plasmon resonance (SPR) biosensor technique (see for example Ober et al., Intern. Immunology, 13, 1551-1559, 2001) where one molecule is immobilized on the biosensor chip and the other molecule is passed over the immobilized molecule under flow conditions yielding kon, koff measurements and hence KD (or KA) values.
- SPR surface plasmon resonance
- the measured KD may correspond to the apparent KD if the measuring process somehow influences the intrinsic binding affinity of the implied molecules for example by artefacts related to the coating on the biosensor of one molecule.
- an apparent KD may be measured if one molecule contains more than one recognition sites for the other molecule. In such situation the measured affinity may be affected by the avidity of the interaction by the two molecules.
- Another approach that may be used to assess affinity is the 2-step ELISA (Enzyme-Linked Immunosorbent Assay) procedure of Friguet et al. (J. Immunol. Methods, 77, 305-19, 1985). This method establishes a solution phase binding equilibrium measurement and avoids possible artefacts relating to adsorption of one of the molecules on a support such as plastic.
- KD KD
- apparent KD measurements can be used as an approximation of the true KD and hence i the present document KD and apparent KD should be treated with equal importance or relevance.
- the experienced scientist may judge it to be convenient to determine the binding affinity relative to some reference molecule. For example, to assess the binding strength between molecules A and B, one may e.g.
- a reference molecule C that is known to bind to B and that is suitably labelled with a fluorophore or chromophore group or other chemical moiety, such as biotin for easy detection in an ELISA or FACS (Fluorescent activated cell sorting) or other format (the fluorophore for fluorescence detection, the chromophore for light absorption detection, the biotin for streptavidin-mediated ELISA detection).
- the reference molecule C is kept at a fixed concentration and the concentration of A is varied for a given concentration or amount of B. As a result an IC50 value is obtained corresponding to the concentration of A at which the signal measured for C in absence of A is halved.
- KD ref the KD of the reference molecule
- the present invention relates to immunoglobulin single variable domains described in, or obtainable by the methods as disclosed in WO2004/015425, WO2004/062551, WO2006/074947, WO2006/122825, WO2009/115614, or WO2011/067160, all in the name of the present applicant.
- an "optimized variant" of an amino acid sequence according to the invention is a variant that comprises one or more beneficial substitutions such as a substitutions increasing i) the degree of "humanization", ii) the chemical stability, and/or iii) the level of expression; while the potency (measured e.g.. by the potency assay as described in the experimental part of WO2006/122325 remains comparable (i.e. within a 10% deviation) to the wild type 12A02. (as defined in WO2006/122825) or comparable to the variant 12A02H1 (SEQ ID NO; 19), also as defined in WO2006/122825.
- an amino acid sequence of the invention contains at least one such substitution, and preferably at least two such substitutions, and preferably at least three humanizing substitutions and preferably at least 10 such humanizing substitutions.
- the amino acid sequences of the invention contain a total of between 1 and 15, preferably between 2 and 14, such as between 9 and 13, e.g. 10, 11 or 12 amino acid substitutions compared to the wild-type sequence 12A02.
- these differences preferably at least comprise one and preferably at least two, such as three, four or five or ten humanizing substitutions, and may optionally comprise one or more further substitutions (such as any one of, or any suitable combination of any two or more of, the further substitutions (a) to (c) as mentioned herein).
- the skilled person will be able to select fa suitable combination of) one or more such suitable humanizing and/or further substitutions.
- the present invention encompasses polypeptide sequences that are highly similar to any of the specific examples provided herein, or any of the specific examples defined by reference above. Highly similar means an amino acid identity of at least 90%, e.g. 95, 97, 98 or 99%.
- the highly similar polypeptide sequences will have the same function as the sequence they are derived from, i.e. they will bind to vWF, more specifically bind to and inhibit interaction between vWF and platelets.
- the invention relates to sequences highly similar to any one of SEQ ID NO :s 1-19, In particular SEQ ID NO: 1.
- SEQ ID NO: 1-19 In particular SEQ ID NO: 1.
- the invention in particular refers to variants or highly simila r sequences which are stable in the formulations as defined herein.
- Methods to generate polypeptide sequences of the invention are widely known and include e.g. recombinant expression or synthesis.
- suitable expression technology e.g. suitable recombinant vectors and host cells, e.g. bacterial or yeast host cells.
- suitable recombinant vectors and host cells e.g. bacterial or yeast host cells.
- suitable purification techniques and protocols are also well known.
- the present invention provides a lso form ulations of polypeptides comprising at least one immunoglobulin single variable domain against vWF, e.g. ALX 0081, which are stable, and preferably suitable for pharmaceutical uses, including the preparation of medicaments (also called “pharmaceutical form ulation of the invention” or “form ulation(s) of the invention”).
- the formulation com prises one or more polypeptides selected from SEQ ID NOis 1-19, preferably SEQ ID NO: 1,
- pharmaceutical formulation refers to a preparation which is in such form as to permit the biological activity of the active ingredient (the polypeptide of the invention) to be effective, and which contains no additional components which are unacceptabiy toxic to a subject to which the formulation would be administered. Such formulations are sterile. "Pharmaceutically acceptable" excipients (vehicles, additives ⁇ are those which can reasonably be administered to a subject mammal to provide an effective dose of the active ingredient employed.
- excipient refers to an inert substance which is commonly used as a diluent, vehicle, preservative, lyoprotectant, surfactant, binder, carrier or sta bilizing agent for compounds which impart a beneficial physical property to a formulation.
- excipients suitable for pharmaceutical purposes which may have particular functions in the formulation, such as lyoprotection, stabilization, preservation, etc.
- a "sterile" formulation is aseptic or free or essentially free from all living microorga nisms and their spores. This is readily accomplished by filtration through sterile filtration membranes.
- a “stable” formulation is one in which the protein therein essentially retains its physical stability and/or chemical stability and/or biological activity upon storage. Preferably, the formulation essentially retains its physical and chemical stability, as well as its biological activity upon storage. The storage period is generally selected based on the intended shelf-life of the formulation.
- Various analytical techniques for measuring protein stability are available in the art and are reviewed in Peptide and Protein Drug Delivery, 247-301, Vincent Lee Ed., Marcel Dekker, Inc., New York, N.Y., Pubs. (1991) and Jones, A. Adv.
- Stability can be measured at a selected temperature for a selected time period.
- the formulation is stable at about 40° C. for at least about 1, 2, 3, 4, 5, 6, 7, 8, or more weeks.
- the formulation is preferably stable following freezing (to, e.g., -20° C. or -70° C.) and thawing of the formulation, for example following 1, 2 3, 4, or 5 cycles of freezing and thawing.
- Stability can be evaluated qualitatively and/or quantitatively in a variety of different ways known by the person skilled in the art. Stability studies showed that ALX 0081 is stable at -20°C for at least 3 years.
- the formulation comprises an aqueous carrier.
- the aqueous carrier is in particular a buffer.
- buffer refers to a buffered solution that resists changes in pH by the action of its acid-base conjugate components.
- the formulation of the invention comprises a buffer selected from at least one of citrate or phosphate buffer, preferably a citrate buffer. As determined previously, these buffers enhance the stability of the vWF binders.
- the formulation according to the invention comprises a citrate buffer at a concentration in the range of 5-200 mM, preferably 7.5-80 mM, even more preferably 10-50, e.g. 10, 15, 20, 25 or 30 mM, and most preferably 20 mM, wherein each value is understood to optionally encompass a range of ⁇ 5 mM.
- the formulation according to the invention may comprise a phosphate buffer at a concentration in the range of 5-200 mM, preferably 5-80 mM, more preferably 7.5-60 mM, even more preferably 10-40, e.g. 10, 15, 20, 25 or 30 mM, and most preferably 10 mM, wherein each value is understood to optionally encompass a range of +5 mM. It will be understood that a lower concentration of the buffer has an effect on the final osmolality, and correspondingly on the additional solutes that may have to be added.
- the pH of the formulation of the invention is in the range 5.0 to 7.5, wherein each value is understood to encompass a range of ⁇ 0.2.
- the most advantageous pH will depend on the buffer comprised in the formulation.
- the invention relates particularly to a formulation comprising a phosphate buffer, which preferably has a pH in the range of 6.5 to 7.5, preferably 6.9, 7.0, 7.1, e.g. 7.1. It was shown that a formulation comprising a citrate buffer was outstandingly suitable for storage and use.
- the present invention relates to a formulation comprising a citrate buffer, which preferably has a pH between 6.0 and 7.0, more preferably 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8 or 6,9, e.g. 6.5, wherein each value is understood to optionally encompass a range of ⁇ 0.2.
- the formulations of the invention will comprise the polypeptides of the invention, in particular the immunoglobulin single variable domains or polypeptides comprising at least one immunoglobulin single variable domain against vWF, such as ALX 0081, at a concentration that is suitable for clinical purposes, which includes concentrations used in stock solutions for dilution prior to use on the patient.
- the formulations of the invention enable high concentrations of the polypeptides comprising at least one ISVD against vWF, such as ALX 0081,
- Typical concentrations of the active agent e.g. polypeptides comprising at least one ISVD against vWF such as ALX 0081
- concentrations in the range of 0.1 to 150 mg/mL such as 1-100 mg/ml, 5-80mg/mL, or 10-40 mg/mL, preferably 10 mg/mL, wherein each value is understood to optionally encompass a range of ⁇ 20% (e.g. a value of 10 optionally encompasses a range of 8 to 12 mg mL).
- the formulation according to any aspect of the invention may further comprise a detergent or surfactant.
- a "surfactant” refers to a surface-active agent, preferably a nonionic surfactant.
- surfactants herein include polysorbate; poloxamer (e.g. poloxamer 188); Triton; sodium dodecyl sulfate (SDS); sodium laurel sulfate; sodium octyl glycoside; lauryl-, myristyl-, linoleyl-, or stearyl- sulfobetaine; lauryl-, myristyl-, linoleyl- or stearyl-sarcosine; linoleyl-, myristyl-, or cetyl-betaine; lauroamidopropyl-, cocamidopropyl-, linoleamidopropyl-, myristamidopropyl-, pa Imido propyl-, or isostearamidopropyl-betaine (e.
- lauroamidopropyl myristamidopropyl-, palmidopropyl-, or isostearamidopropyl-dimethylamine; sodium methyl cocoyl-, or disodium methyl oleyl-taurate; and the MONAQUAT ® series (Mona Industries, Inc., Paterson, N.J.); polyethyl glycol, polypropyl glycol, and copolymers of ethylene and propylene glycol ⁇ e.g. Pluronics, PF68 etc); etc.
- the surfactant herein is polysorbate 80
- Preferred suitable detergents or surfactants for use with the invention include, but are not limited to, polyoxyethylene sorbitan fatty acid esters e.g. polysorbate - 20, -40, -60, -65, -80 or -85
- Common brand names for polysorbates include Alkest, Canarcel and Tween.
- the detergent is a non-ionic detergent. More specifically, the detergent is polysorbate-80, also designated Tween-80 hereafter.
- the concentration of detergent for a formulation of the invention, Typically, the concentration wilt be as low as possible, whilst maintaining the beneficial effects of the detergents, e.g. a stabilizing effect under conditions of shear stress, e.g. stirring, which reduces aggregation of the formulated polypeptides of the invention.
- the concentration of the detergent may be in the range of 0.001 to 0.5%, e.g.
- the formulation of the invention may further comprise excipients such as preservatives.
- a "preservative" is a compound which can be optionally included in the formulation to essentially reduce bacterial action therein, thus facilitating the production of a multi-use formulation, for example.
- potential preservatives include octadecyldimethylbenzyl ammonium chloride, hexamethonium chloride, benzalkonium chloride (a mixture of alkylbenzyldimethyiammonium chlorides in which the alkyl groups are long-chain compounds), and benzethonium chloride.
- preservatives include aromatic alcohols such as phenol, butyl and benzyl alcohol, alkyl parabens such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, 3-pentanol, and m- cresol.
- the preservative herein is benzyl alcohol.
- the formulation of the invention may further comprise stabilizing agents, such as a polyols.
- a "polyol” is a substance with multiple hydroxy I groups, and includes sugars (reducing and nonreducing sugars), sugar alcohols and sugar acids.
- a polyol may optionally be included in the formulation, for instance to improve stability.
- polyols herein have a molecular weight which is less than about 600 kD (e.g. in the range from about 120 to about 400 kD).
- a "reducing sugar” is one which contains a hemi-acetal group that can reduce metal ions or react covalently with lysine and other amino groups in proteins and a "nonreducing sugar” is one which does not have these properties of a reducing sugar.
- reducing sugars are fructose, mannose, maltose, lactose, arabinose, xylose, ribose, rhamnose, galactose and glucose.
- Nonreducing sugars include sucrose, trehalose, sorbose, melezitose and raffinose. Mannitol, xylitol, erythritol, threitol, sorbitol and glycerol are examples of sugar alcohols.
- sugar acids these include L- gluconate and metallic salts thereof.
- the polyol is preferably one which does not crystallize at freezing temperatures (e.g. -20° C.) such that it destabilizes the antibody in the formulation.
- nonreducing sugars such as sucrose and trehalose are examples of polyols, with sucrose being preferred, despite the solution stability of trehalose.
- Therapeutic compounds of the invention used in accordance with the present invention are prepared for storage by mixing a polypeptide(s) having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. [1980]), in the form of lyophilized formulations or aqueous solutions.
- Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed. Accordingly, the formulations according to the invention may also optionally comprise one or more excipients.
- compositions include, but are not limited to, ton exchangers, alumina, aluminum stearate, lecithin, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, hydrophilic polymers such as polyvinyl pyrrolidone, cellulose based substances, polyethylene glycol, sodium carboxymethylcellulose, polyacrylates, waxes, gelatin, polyethylene polyoxypropylene block polymers, polyethylene glycol and wool fat.
- ton exchangers alumina, aluminum stearate, lecithin
- serum proteins such as human serum albumin
- buffer substances such as phosphates, glycine, sorbic acid, potassium sorb
- antioxidants including ascorbic acid and methionine; preservatives; low molecular weight (less than about 10 residues) polypeptides; proteins; and amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine.
- the excipient may be one or more selected from the list consisting of NaCI, trehalose, sucrose, mannitol or glycine.
- the active ingredients may also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions.
- colloidal drug delivery systems for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
- the polypeptides of the invention may be formulated into any pharmaceutically acceptable formulation.
- the formulation may be liquid or dry.
- the formulation may be generated via mixing, drying, lyophilization, vacuum drying, or any known method for formulating pharmaceutical compositions.
- a preferred formulation of the invention comprises a polypeptide comprising at least one ISVD against vWF, such as ALX 0081, in a phosphate buffer solution (pH 7.1). Even more preferably, a formulation of the invention comprises a polypeptide comprising at least one ISVD against vWF, such as ALX 0081, in a phosphate buffer solution (pH 7.1), Glycine (0.2 M) and polysorbate 80 (0.02% v/v).
- the polypeptides of the invention may further be formulated as described in PCT/EP14/060107.
- a preferred formulation comprises:
- a polypeptide comprising at least one ISVD against vWF, such as ALX 0081 at a concentration from about 0.1 mg/mL to about 80 mg/mL;
- an excipient chosen from sucrose, glycine, mannitol, trehalose or NaCI at a concentration of about 1% to about 15% (w/v);
- a citrate buffer at a concentration of about 5 mM to about 200 mM such that the pH of the formulation is about 6.0 to 7.0.
- a further preferred formulation of the invention comprises a polypeptide comprising at least one
- a formulation is stored as a liquid.
- a formulation is prepared as a liquid and then is dried, e.g., by lyophilization or spray-drying, prior to storage.
- a dried formulation can be used as a dry compound, e.g., as an aerosol or powder, or reconstituted to its original or another concentration, e.g., using water, a buffer, or other appropriate liquid.
- the present invention also relates to vials comprising filled with lyophiiisate containing 12,5 mg caplacizumab and excipients for solution for injection.
- Excipients per mL of reconstituted solution: 0.21 mg citric acid, 5.58 mg tri sodium citrate di-hydrate, 70 mg sucrose, 0.11 mg polysorbate-80 per vial (pH 6.5 +/- 0.5).
- WFI Water for injection
- the invention also encompasses products obtainable by further processing of a liquid formulation, such as a frozen, lyophilized or spray-dried product. Upon reconstitution, these solid products can become liquid formulations as described herein (but are not limited thereto). In its broadest sense, therefore, the term "formulation" encompasses both liquid and solid formulations. However, solid formulations are understood as derivable from the liquid formulations (e.g. by freezing, freeze- drying or spray-drying), and hence have various characteristics that are defined by the features specified for liquid formulations herein. The invention does not exclude reconstitution that leads to a composition that deviates from the original composition before e.g.
- the lyophilized formulation may be reconstituted to produce a formulation that has a concentration that differs from the original concentration (i.e., before lyophilization), depending upon the amount of water or diluent added to the lyophilate relative to the volume of liquid that was originally freeze- dried.
- Suitable formulations can be identified by assaying one or more parameters of antibody integrity.
- the formulations according to the invention are isotonic in relation to human blood.
- Isotonic solutions possess the same osmotic pressure as blood plasma, and so can be intravenously infused into a subject without changing the osmotic pressure of the subject's blood plasma.
- Tonicity can be expressed in terms of osmolality, which can be a theoretical osmolality, or preferably an experimentally determined osmolality.
- osmolality will be in the range of 290 ⁇ 60 mOsm/kg, preferably 290 ⁇ 20 mOsm/kg.
- the formulations of the invention may also comprise compounds that are specifically useful for protecting the polypeptide of the invention during freeze-drying.
- Such compounds are also known as lyo rotectants, and are well known to the skilled person. Specific examples include, but are not limited to sugars like sucrose, sorbitol or trehalose; amino acids such as glutamate, in particular monosodium glutamate or histidine; betain, magnesium sulfate, sugar alcohols, propylene glycol, polyethylene glycols and combinations thereof.
- sugars like sucrose, sorbitol or trehalose
- amino acids such as glutamate, in particular monosodium glutamate or histidine
- betain magnesium sulfate
- sugar alcohols e.g., propylene glycol, polyethylene glycols and combinations thereof.
- Formulations that are particularly suitable for freeze-drying may furthermore comprise bulking agents.
- Suitable agents are widely known to the skilled person, ft has been shown that a formulation comprising sucrose was not only particularly suited for maintaining the physical stability, during e.g. storage and freeze-thawing, of the vWF binders, but also as lyoprotectant.
- any of the above formulations can be further processed e.g. by Iyophilization, spray-drying or freezing, e.g. bulk freezing.
- the resulting processed product has characteristics derived from the liquid starting formulation, as defined above.
- additional agents may be included for further processing, such as, for instance, lyoprotectants, etc.
- the formulations of the present invention have the effect after Iyophilization of maintaining the chemical and physical integrity of the polypeptides of the present invention, in particular ALX 0081, i.e. even after prolonged storage, e.g. for durations as defined above, at temperatures between -70X and +4GT, the purity/impurity profile of the product is essentially not changing.
- prolonged storage after Iyophilization did not have a significant effect on RP-HPLC, SE-HPLC or clEF profiles.
- polypeptides of the invention can be produced by any commonly used method. Typical examples include the recombinant expression in suitable host systems, e.g. bacteria or yeast. The polypeptides of the invention will undergo a suitable purification regimen prior to being formulated in accordance to the present invention.
- the polypeptides of the invention are produced by living host cells that have been genetically engineered to produce the polypeptide.
- Methods of genetically engineering cells to produce proteins are well known in the art. See e.g. Ausubel et ai, eds. (1990), Current Protocols in Molecular Biology (Wiley, New York). Such methods include introducing nucleic acids that encode and allow expression of the polypeptide into living host cells.
- These host cells can be bacterial cells, funga l cells, or animal cells grown in culture.
- Bacterial host cells include, but are not limited to, Escherichia coli cells. Examples of suitable E.
- coli strains include: HB101, DH5a, GM2929, JM109, KW251, NM538, IMM539, and any E, coli strain that fails to cleave foreign DNA.
- Fungal host cells that can be used include, but are not limited to, Saccharomyces cerevisiae, Pichia pastoris and Aspergillus cells.
- a few examples of animal cell lines that can be used are CHO, VERO, BHK, HeLa, Cos, MDCK, 293, 3T3, and WI38. New animal cell lines can be established using methods well known by those skilled in the art (e.g., by transformation, viral infection, and/or selection).
- the polypeptide can be secreted by the host cells into the medium.
- the polypeptides can be produced in bacterial cells, e.g., E. coli cells.
- the polypeptide is encoded by sequences in a phage display vector that includes a suppressive stop codon between the display entity and a bacteriophage protein (or fragment thereof)
- the vector nucleic acid can be transferred into a bacterial cell that cannot suppress a stop codon.
- the polypeptide is not fused to the gene III protein and is secreted into the periplasm and/or media.
- the polypeptides can a lso be produced in eukaryotic cells.
- the polypeptides are expressed in a yeast cell such as Pichia (see, e.g., Powers ef al. J Immunol Methods 251:123-35 (2001)), Hansen ula, or Saccharomyces.
- polypeptides are produced in mammalian cells.
- Typical mammalian host cells fo r expressing the clone antibodies or antigen-binding fragments thereof include Chinese Hamster Ovary (CHO cells) (including dhfr - CHO cells, described in Urlaub and Chasin, Proc. Natl. Acad . Sci.
- lymphocytic cell lines e.g., NS0 myeloma cells and SP2 cells, COS cells, and a cell from a transgenic animal, e.g., a transgenic mammal.
- the cell is a mamma ry epithelial cell .
- the recombinant expression vectors may carry additional sequences, such as sequences that regulate replication of the vector in host cells (e.g., origins of replication) and selectable marker genes.
- the selectable marker gene facilitates selection of host cells into which the vector has been introduced (see e.g., U.S. Patent Nos. 4,399,216; 4,634,665; and 5, 179,017).
- the selectable marker gene confers resistance to drugs, such as 6418, hygromycin, or methotrexate, on a host cell into which the vector has been introduced.
- Standard molecular biology techniques can be used to prepare the recombinant expression vector, transfect the host cells, select for transformants, culture the host cells and recover the antibody molecule from the culture medium.
- the polypeptides of the invention can be isolated by affinity chromatography.
- the polypeptide of the invention is purified as described in WO 10/058550.
- the polypeptide is purified from one or more contaminants by: contacting a mixture of polypeptide and contaminant(s) with a Protein A-based support and/or an ion exchange support, under conditions that allow the polypeptide to bind to or adsorb to the support; removing one or more contaminants by washing the bound support under conditions where the polypeptide remains bound to the support, and selectively eluting the polypeptide from the support by eluting the adsorbed polypeptide molecule with an elution buffer.
- the polypeptides of the invention can also be produced by a transgenic animal.
- U.S. Patent No. 5,849,992 describes a method of expressing an antibody in the mammary gland of a transgenic mammal.
- a transgene is constructed that includes a milk-specific promoter and nucieic acids encoding the antibody molecule and a signal sequence for secretion.
- the milk produced by females of such transgenic mammals includes, secreted therein, the single domain of interest.
- the antibody molecule can be purified from the milk, or for some applications, used directly.
- the present invention encompasses methods of producing the formulations as defined herein.
- the purification and formulation steps may coincide, e.g. when the polypeptides of the invention are eluted from a column using a buffer according to the present invention.
- the formulations of the invention can be prepared by exchanging a buffer by any suitable means, e.g. means widely used in the art such as dialyzing, ultrafiltration, etc.
- the method of producing a formulation of the invention may also relate to the reconstitution of a lyophilized or spray-dried formulation, e.g. by addition of water or a suitable buffer (which may optionally comprise further excipients).
- the methods for preparing a formulation according to the present invention may encompass further steps, such as filling it into vials suitable for clinical use, such as sealed containers and/or confectioning it in a dosage unit form.
- the methods may also comprise further steps such as spray-drying, lyophilization, or freezing, e.g. bulk freezing.
- the invention also encompasses the containers, dosage unit forms, or other products obtainable by any of the methods recited herein.
- the formulations of the present invention can be used to store the polypeptides of the invention, e.g. polypeptides comprising at least one ISVD against vWF, such as ALX 0081, as defined herein.
- the invention encompasses a method of storage of the polypeptides of the invention as used herein, characterized by the use of a formulation as defined herein. More specifically, the invention encompasses methods for stabilizing the polypeptides of the invention for storage, comprising e.g. the preparation of a formulation as described herein. Storage can be 1-36 months, such as 1, 1.5, 3, 6, 9, 12, 18, 24, 30 or 36 months, e.g.
- storage may encompass freezing, freeze-drying (lyophilization) and/or spray-drying.
- the storage methods may furthermore comprise the assessment of physical and chemical integrity of the vWF binders as defined herein.
- the present invention also relates to methods for analyzing formulations comprising at least one of the vWF binders as defined herein.
- the formulations can be analyzed for any signs of chemical or physical instability of the vWF binders as defined herein.
- the formulations can be assessed for the presence of degradation products, e.g. low molecular weight derivatives such as proteolytic fragments; and/or for chemical derivatives, e.g. pyroglutamate variants; and/or for high molecular weight derivatives such as aggregates, agglomerates, etc.
- the formulation can also be assessed for total protein content and/or potency.
- Each of the various assay methods as referred to herein can be used in the analysis method of the present invention.
- the present invention also relates to a method for monitoring and/or assessing the quality and/or stability of a formulation, e.g. during one or more of manufacture, storage and use.
- the invention also relates to a method of quality control of a formulation, e.g. to assess that the formulation meets product specifications as further described herein.
- the invention in any of these aspects comprises one or more selected from the comparison with one or more reference samples, the analysis of batch to batch variation, and the ongoing monitoring of a production process.
- the present invention relates to any product that is associated with the formulations of the present invention, e.g. by comprising them, or by being necessary for their production or confectioning, without any limitations.
- the present invention relates to an article of manufacture, e.g. a sealed container comprising one or more of the formulations according to the present invention.
- the invention also relates to a pharmaceutical unit dosage form, e.g. a dosage form suitable for parenteral administration ⁇ e.g., intradermal ⁇ , intramuscularly, intraperitoneally, intravenously and subcutaneousiy) to a patient, preferably a human patient, comprising one or more of the formulation according to any embodiment described herein.
- a pharmaceutical unit dosage form e.g. a dosage form suitable for parenteral administration ⁇ e.g., intradermal ⁇ , intramuscularly, intraperitoneally, intravenously and subcutaneousiy
- the dosage unit form can be e.g. in the format of a prefilled syringe, an ampoule, cartridge or a vial.
- kits or articles of manufacture comprising the formulation of the invention and instructions for use by, e.g., a healthcare professional.
- the kits o articles of manufacture may include a vial or a syringe containing the formulation of the invention as described herein.
- the vial or syringe is composed of glass, plastic, or a polymeric material chosen from a cyclic olefin polymer or copolymer.
- the syringe, ampoule, cartridge or vial can be manufactured of any suitable material, such as glass or plastic and may include rubber materials, such as rubber stoppers for vials and rubber plungers and rubber seals for syringes and cartridges.
- the invention also relates to a kit comprising one or more of the formulations according to the present invention.
- the kit may further comprise instructions for use and/or a clinical package leaflet.
- the invention also encompasses the presence of packaging material, instructions for use, and/or clinical package leaflets, e.g. as required by regulatory aspects.
- the percentage of "sequence identity" between a first amino acid sequence and a second amino acid sequence may be calculated by dividing [the number of amino acid residues in the first amino acid sequence that are identical to the amino acid residues at the corresponding positions in the second amino acid sequence] by [the total number of amino acid residues in the first amino acid sequence] and multiplying by [100%], in which each deletion, insertion, substitution or addition of an amino acid residue in the second amino acid sequence - compared to the first amino acid sequence - is considered as a difference at a single amino acid residue (position), i.e. as an "amino acid difference" as defined herein.
- the degree of sequence identity between two amino acid sequences may be calculated using a known computer algorithm, such as those mentioned above for determining the degree of sequence identity for nucleotide sequences, again using standard settings.
- a known computer algorithm such as those mentioned above for determining the degree of sequence identity for nucleotide sequences, again using standard settings.
- the amino acid sequence with the greatest number of amino acid residues will be taken as the "first" amino acid sequence, and the other amino acid sequence will be taken as the "second" amino acid sequence.
- amino acid substitutions which can generally be described as amino acid substitutions in which an amino acid residue is replaced with another amino acid residue of similar chemical structure and which has little or essentially no influence on the function, activity or other biological properties of the polypeptide.
- Such conservative amino acid substitutions are well known in the art, for example from WO 04/037999, GB-A-3 357 768, WO 98/49185, WO 00/46383 and WO 01/09300; and (preferred) types and/or combinations of such substitutions may be selected on the basis of the pertinent teachings from WO 04/037999 as well as WO 38/49185 and from the further references cited therein.
- Such conservative substitutions preferably are substitutions in which one amino acid within the following groups (a) - (e) is substituted by another amino acid residue within the same group: (a) small aliphatic, nonpolar or slightly polar residues: Ala, Ser, Thr, Pro and Gly; (b) polar, negatively charged residues and their (uncharged) amides: Asp, Asn, Glu and Gin; (c) polar, positively charged residues: His, Arg and Lys; (d) large aliphatic, nonpolar residues: Met, Leu, He, Val and Cys; and (e) aromatic residues: Phe, Tyr and Trp.
- Particularly preferred conservative substitutions are as follows: Ala into Gly or into Ser; Arg into Lys; Asn into Gin or into His; Asp into Glu; Cys into Ser; Gin into Asn; Glu into Asp; Gly into Ala or into Pro; His into Asn or into Gin; lie into Leu or into Val; Leu into lie or into Val; Lys into Arg, into Gin or into Glu; Met into Leu, into Tyr or into lie; Phe into Met, into Leu or into Tyr; Ser into Thr; Thr into Ser; Trp into Tyr; Tyr into Trp; and/or Phe into Val, into lie or into Leu.
- Any amino acid substitutions applied to the polypeptides described herein may also be based on the analysis of the frequencies of amino acid variations between homologous proteins of different species developed by Schulz et al.. Principles of Protein Structure, Springer-Verlag, 1978, on the analyses of structure forming potentials developed by Chou and Fasman, Biochemistry 13: 211, 1974 and Adv. Enzymol., 47: 45- 149, 1978, and on the analysis of hydrophobicity patterns in proteins developed by Eisenberg et al., Proc. Natl. Acad. Sci. USA 81: 140-144, 1984; Kyte & Doolittle; J Molec. Biol. 157: 105-132, 1981, and Goldman et al., Ann. Rev.
- the present invention also relates to a method of treating or preventing a vWF-related disease, such as e.g. acute coronary syndrome (ACS), transient cerebral ischemic attack, unstable or stable angina pectoris, stroke, myocardial infarction or thrombotic thrombocytopenic purpura (TIP); said method comprising administering to a subject a pharmaceutical composition comprising the formulation of the invention, thereby reducing one or more symptoms associated with said vWF-related disease.
- a vWF-related disease such as e.g. acute coronary syndrome (ACS), transient cerebral ischemic attack, unstable or stable angina pectoris, stroke, myocardial infarction or thrombotic thrombocytopenic purpura (TIP); said method comprising administering to a subject a pharmaceutical composition comprising the formulation of the invention, thereby reducing one or more symptoms associated with said vWF-related disease.
- said vWF-related disease is TTP.
- the present invention relates to a method for the treatment of a human patient susceptible to or diagnosed with a disease characterized by a vWF-related disease, comprising administering an effective amount of a polypeptide comprising at least one immunoglobulin single variable domain (ISVD) against von Willebrand Factor (vWF) to the human patient.
- the present invention provides a method of treating or preventing a vWF-related disease, such as TIP, comprising administering to a human, 5-40 mg dose of a polypeptide comprising at least one immunoglobulin single variable domain (ISVD) against von Willebrand Factor (vWF), thereby reducing one or more symptoms associated with the vWF-related disease ,
- the present invention provides a treatment as described herein, wherein said administering a polypeptide as described herein is followed within 5 min to 8 h by performing a first Plasma Exchange (PE).
- PE Plasma Exchange
- the present invention provides a treatment as described herein, wherein said administering of a polypeptide as described herein is preceded by performing a preceded Plasma Exchange ⁇ PE), within 36h, preferably 32, 30, 28, 26, 24, 22, 20, 18, or 16h, preferably about 24h of said first PE.
- the present invention provides a treatment as described herein, wherein said first PE is followed by administering a second dose of 1-40 mg, preferably 10 mg of a polypeptide as described herein within 5 min to 8h, such as within 10 min to 6 h or 15 min to 4h, for instance within 8h, 7h, 6h, 5h, 4h, 3h, 3h, lh, 45 min, 30 min, 20 min, 15 min, 10 min or even 5 min, for instance wherein said second dose of said polypeptide is administered within 1-60 min, such as 30 min of said first PE, preferably by subcutaneous injection.
- a second dose of 1-40 mg preferably 10 mg of a polypeptide as described herein within 5 min to 8h, such as within 10 min to 6 h or 15 min to 4h, for instance within 8h, 7h, 6h, 5h, 4h, 3h, 3h, lh, 45 min, 30 min, 20 min, 15 min, 10 min or even 5 min, for instance wherein said second dose of said poly
- the present invention provides a treatment as described herein, further comprising:
- step (iii) optionally measuring the platelet count and/or ADAMTS13 activity of said patient, wherein step (i) and step (ii) are repeated once per day until the platelet count of said patient is >150000/ ⁇ and/or the ADAMTS13 activity is at least 10% such as at least 15%, 20%, 25%, 30%, 35%, 45% or even 50% of the ADAMTS13 reference activity.
- the present invention provides also a treatment as described herein, further comprising administering once per day a dose of 5-40 mg of a polypeptide as described herein for at least 5, 10, 15, 20, 25, or even 30 days after the platelet count of said patient is >150.000/ ⁇ 1 .
- the present invention provides a treatment as described herein, further comprising administering once per day a dose of 5-40 mg of a polypeptide as described herein until said human enters remission.
- the present invention provides a treatment as described herein, comprising administering said polypeptide until the ADA TS13 activity is at least 10% such as at least 15%, 20%, 25%, 30%, 35%, 45% or even 50% of the ADAMTS13 reference activity.
- an article of manufacture containing materials useful for the treatment of a disease as described above comprises a contained, a label and a package insert.
- Suitable containers include, for example, bottles, vials, syringes, etc.
- the containers may be of a variety of materials such as glass or plastic.
- the container holds the composition which is effective in treating the condition and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
- At least one active agent in the composition is the polypeptide of the invention, such as ALX 0081.
- the label on, or associated with, the container indicates that the composition is used for treating the condition of choice.
- the article of manufacture may further comprise a second container comprising a pharmaceutically acceptable buffer, such as a phosphate buffer saline or a citrate buffered saline as described herein. It may further include other materials desirable from a user or commercial standpoint, including other buffers, diluents, filters, needles and syringes.
- a pharmaceutically acceptable buffer such as a phosphate buffer saline or a citrate buffered saline as described herein.
- It may further include other materials desirable from a user or commercial standpoint, including other buffers, diluents, filters, needles and syringes.
- the present invention provides a kit or an article of manufacture, comprising a container containing the polypeptide as described herein or the formulation as described herein, and instructions for use.
- the present invention provides a kit or article of manufacture as described herein, wherein the formulation is present in a vial or an injectable syringe.
- the present invention provides a kit or article of manufacture as described herein, wherein the formulation is present in a preftlled injectable syringe.
- the present invention provides a kit or article of manufacture as described herein, wherein the syringe or a vial is composed of glass, plastic, or a polymeric material chosen from a cyclic olefin polymer or copolymer.
- ADAMTS13 a disintegrin-like and metalloprotease with throm bospondin repeats 13
- VH heavy chain variable domain VH heavy chain variable domain
- VHH heavy chain variable domain sequence that is derived from a heavy chain antibody
- Clinical trials were performed in accordance with applicable laws and regulations (including the Declaration of Helsinki and the principles of medical secret and the protection of patient privacy) and after all required approvals (including approvals by relevant ethics committees) and consents (including informed consent of subjects involved) were obtained.
- the study also determines the effect of a polypeptide of the invention, such as ALX 0081, on the activity of ADAMTS13.
- the flow chamber test was used to test whether a polypeptide of the invention, such as ALX 0081, can inhibit the interaction between platelets and ULvWF according to Sixma (Sixma ef al. 1998 Thromb Res 92: 543-548).
- endothelial cells were cultivated on coverslips and stimulated, thereby secreting ULvWF.
- Plasma from TTP patients was supplemented with platelets and perfused over the stimulated cells. Strings of platelets adhering to ULvWF were visualized by real time video- microscopy. The experiment was repeated in the presence of increasing concentrations of a polypeptide of the invention, such as ALX 0081.
- Severe liver im pairment corresponding to grade 3 toxicity defined by the CTCAE scale. For the key liver pa rameters, this is defined as follows:
- GTT gamma glutamyl transpeptidase
- the present study was designed as a Phase II multicentre, single-blinded, parallel design, randomised, placebo-controlled study (Titan trial),
- the study population were symptomatic patients with acute episodes of acquired TTP, requiring treatment with PE, After confirmation of eligibility to study participation (cf. Example 7,3), patients were randomised in a ratio of 1:1 to either receive ALX 0081 or placebo as adjunctive therapy to PE (Figure 1).
- Patients were randomised prior to the start of PE treatment.
- a patient was randomised after a preceding, single PE session ("preceding PE"), but prior to the start of the next PE session ("first PE"). This overall next PE session was started within 24 hours of the end of the preceding PE session, and was considered the first PE-on-study ("first PE").
- the study drug was administered as an adjunctive treatment at specific times relative to PE procedures.
- the study drug consisted of 10 mg of Caplacizumab ("treatment group”) or placebo ("placebo group”), once or twice daily. 7,4.1 First drug administration
- study drug was administered daily. On days with a PE, study drug administration was within 30 minutes after the end of the PE procedure; on days without PE, study drug administration was 24 h ( + ⁇ 1 h) after previous administration. Daily s.c. study drug administration of 10 mg continued for 30 days after the very last PE (including tapering).
- TTR time-to-response
- LDH lactate dehydrogenase
- ADAMTS13 activity and functional inhibitor activity were measured by a fluorogenic assay using the FRETS- WF73 substrate (Kokame et al. 2005. Br J Haematol 129(1):93-100; remer Hovinga ef al.
- the ADAMTS13 activity ( ⁇ of a sample was then calculated as: (y - b) x 1/a.
- ADAMTS13 functional inhibitor activity was measured by the same fluorogenic FRETS- VWF73 method by determination of residual ADA TS13 activity of norma! human plasma after 1 :1 (v:v) incubation for 2 hours at 37 °C with heat-inactivated patient's plasma (30 min at 56 °C).
- a calibration curve was generated using a normal human plasma pool (NHP; Swiss Red Cross Blood Services, Bern, Switzerland) diluted 1:25 (100%) in assay buffer. Further calibration samples were obtained by serial predilutions of NHP of 1:2 (50%), 1:4 (25%), 1:10 (10%), 1:20 (5%), 1:50 (2%) and 1: 100 (1%) in heat-inactivated NHP. All calibration points were applied in singlicate. Acceptance criteria: (1) The slope of the final regression of the standard curve line has to be >6.0; and (2) 2 of the regression of the final plot has to be >0.98 (or R >0.9899). Otherwise, the assay was rejected.
- phase II study comprised a sample size of 75 patients, which were randomized as set out in Table 2.
- the primary analysis population was the intent-to-treat ⁇ ITT) population, which consisted of all randomised subjects according to a randomised treatment assignment.
- the per protocol population PP was used.
- the PP population is a subset of the ITT population and consists of all randomised subjects, according to the randomised treatment assignment, with exclusion of all major protocol deviations and violators.
- Both treatment arms were well bala nced for vWF.AG and ADA TS13 activity. More than half of the subjects have idiopathic TTP as indicated by ⁇ 5% ADAM TS 13 activity.
- the time-to-response of blood ma rkers was monitored in a survival setting.
- the primary endpoint time-to-response of blood markers comprised recovery of platelets > 150,000/ ⁇ , The platelet levels represent a reliable surrogate marker for " FTP disease activity.
- Zero to time-to-event period was set at 30 days.
- the Hazard Ratio means that at any time, subjects receiving Caplacizumab have more than twice the rate of achieving the primary end point of confirmed platelet recovery in comparison to subjects on Placebo.
- the 95% CI of the time to Confirmed Platelet Response is 2 to 3 times narrower for the Caplacizumab arms versus the Placebo arms. This implies that the time to disease resolution is less variable in the Caplacizumab treatment arms than the Placebo arms.
- Exacerbations Within the ITT population, the proportion of subjects with exacerbations was determined. Exacerbation refers to a recurrent thrombocytopenia following a confirmed platelet response and requiring a re-initiation of daily PE treatment after > 1 day but ⁇ 30 days after the last PE.
- polypeptide of the invention such as ALX 0081, can be solely responsible for treating and/or alleviating (the symptoms of) TTP.
- Relapse of TTP is defined as a de novo event of TTP that occurs later than 30 days after the last daily PE.
- Table 7 the proportion of subjects with exacerbation and/or relapse in the 1st month after end of treatment in the ITT Population is depicted.
- Caplacizumab (CAP) treatment may possibly have been too short duration for some subjects. Indeed, higher number of early relapses in the CAP arm substantiates a protective effect and warrants longer CAP treatment in some patients. This implies that Caplacizumab treatment should be continued for prolonged periods, It is interesting to note that in both treatment arms, relapses are more prominent in patients with a baseline ADAMTS13 activity of ⁇ 5%, even though the ADAMTS13 activity was only available in a subset of the patients.
- the Caplacizumab arm presents 1.6 x more subjects with complete remission versus the Placebo arm.
- the number of consecutive days of PE was (mean ⁇ st dev) 6.6 ⁇ 3.4 days for CAP versus 8.1 ⁇ 6.5 days for PLC with a total plasma volume administered including tapering of 22.5 ⁇ 15.9 liters for CAP versus 28.4 ⁇ 21.3 liters for PLC.
- AE adverse events
- SAE serious adverse events
- the SAE assessment included haemorrhage from catheter insertion, sepsis, catheter thrombosis, pneumothorax, fluid overload, hypoxia, hypotension, anaphylactoid reactions and TRALI.
- the number of serious adverse events was similar across both treatment arms; 57% in the Caplacizumab arm compared to 51% in the placebo arm.
- the number of adverse events was also similar across treatment arms: 97% in the Caplacizumab arm compared to 100% in the placebo arm.
- the number of subjects with bleeding related AEs was slightly elevated in the Caplacizumab arm (54% ⁇ ) compared to the placebo arm (38%).
- Caplacizumab was investigated in a preclinical surgical bleeding model. In this study, surgical blood loss in animals receiving Caplacizumab was comparable to blood loss in Heparin ® treated animals, and 2- and 4 fold less than in Plavix ® and ReoPro* treated animals, respectively. Although this is a positive indication that Caplacizumab may be safer than Plavix ® and ReoPro ® in terms of bleeding risk, this was assessed in healthy persons. As indicated above, TTP-patient differs in many aspects from a healthy person in respect of vWF. Study treatment was stopped due to an adverse event in 4 patients treated with Caplacizumab and in 2 patients treated with placebo. The increase in bleeding tendency was however well manageable.
- TTP is potentially life threatening. There were 2 deaths (5.4%) reported in the trial, both in the placebo arm. It is noted that the number of deaths in the placebo arm is less than described in literature (10-30%). This may infer that the outcome of TTP has improved due to more effective standards of care (in the present study).
- a further optimized treatment protocol was designed by the present inventors, based on the idea that the distribution of confirmed platelet response time is shorter and not skewed and biased to the right (longer time to response) in the CAP arm in comparison to the placebo arm.
- the PE treatment period is set for 3-5 days, such as 3 days or 4 days or 5 days, preferably 3 days.
- the PE treatment period is independent of the recovery of platelets (> 150,000/ ⁇ ).
- Daily s.c. study drug administration is continued for at least 10 days, such as 20 days or 30 days after the very last PE, but preferably for at least 10 days, such as 20 days or 30 days after the recovery of platelets to > 150,000/ ⁇ .
- the primary endpoint will be the number of exacerbations as defined supra.
- ADAMTS13 activity was set out to further evaluate ADAMTS13 activity as marker for underlying disease activity and to evaluate ADAMTS13 activity as marker to guide optimal treatment duration of caplacizumab, to maintain treatment benefit.
- ADAMTS13 activity was ⁇ 10% then underlying disease activity was assumed.
- ADA TS13 activity recovered to levels above 10%, suggesting resolution of the presenting TTP episode.
- Caplacizumab 2/3 (67%) had ADAMTS13 activity ⁇ 10% around their exacerbation
- ADA TS13 activity was below 10%, suggesting unresolved disease activity leading to exacerbation.
- Caplacizumab 7/7 (100%) had ADAMST13 activity values ⁇ 10% close to treatment stop; relapses occurred within 10 days after treatment stop
- Caplacizumab 4/4 ⁇ 100%) had ADAMST13 activity values >10% close to treatment stop; relapses occurred within >30 days after treatment stop ⁇ range: 30 -167 days). AH 4 patients had again ADAMTS13 activity ⁇ 10% at the time of relapse.
- ADAMTS13 activity recovered to levels above 10% near treatment stop, suggesting resolution of the presenting TTP episode; values were low again ( ⁇ 10 ) at the time of relapse, indicating a new TTP episode
- the data support the use of ADAMTS13 activity as predictive marker for recurrences of TTP and its potential for treatment decisions.
- ADAMTS13 activity is able to predict relapses which occur shortly after stopping caplacizumab treatment.
- a 30-day treatment period (post PE) with caplacizumab has demonstrated a significant impact on the number of exacerbations.
- Acute myocardial infarction ⁇ AMI has been reported as a n early complication of TTP based both on clinical diagnosis of AM I (Patschan et al. 2006 Nephrology, dialysis, transplantation 21 : p.1549-54) and autopsy findings (Hosier et al. Archives of pathology & laboratory medicine, 2003. 127(7): p.834- 9).
- LDH lactate dehydrogenase
- Tnl troponin I
- LDH is an important marker of non-specific tissue ischemia. Proportions were calculated based on the number of subjects in the ITT ' Population. The number and proportion of subjects in the ITT Population with values for LDH ⁇ 2 x ULN was summarized by planned treatment for the first 5 study days. A summary of results is provided in Table 9, The mean LDH/ULN ratio by study day is provided in Table 10.
- a Kaplan-Meier analysis was conducted to compare the time to normalization of LDH values according to the planned treatment. Time to LDH normalization curves are provided in Figure 2, From the Kaplan-Meier analysis a more rapid return to normal levels of LDH is suggested for subjects receiving ALX 0081 as compared to subjects receiving placebo.
- the organ damage markers troponin I and T, LDH and creatinine return faster to normal levels in subjects receiving ALX 0081 than in subjects receiving placebo.
- the results suggest that a faster normalization rate of these organ damage markers is linked to a better clinical outcome, i.e. a reduced risk of and less organ damage due to organ ischemia caused by microthrombi.
- Caplacizumab affects the functionality of vWF, leading to inability of vWF to bind to platelets. It also affects the disposition of vWF, leading to transient reductions of total vWFAg levels during treatment.
- a PK/PD model was used to evaluate the expected exposure and corresponding effect on total, free and complexed vWF levels for different dosing scenarios in a virtual TTP patient population, through simulations.
- a virtual population of TTP patients (n-500), with characteristics based on the population from the TITAN study, was created by sampling the truncated distributions of body weights (mean 81.9 kg ⁇ 22.6 SO, range 47.5-150 kg) and model-estimated baseline vWF in the TTP population of the TITAN trial as well as gender distribution (M:F 40:60 ⁇ , Simulated scenarios included an initial 8 days daily PE procedure with a concomitant s.c.
- caplacizumab Ih daily administration of caplacizumab Ih after the termination of each PE at doses of 2,5, 5, 10, 20 mg ⁇ period 1). Subsequently, caplacizumab was assumed to be administered at the same dose levels/ regimen for additional 30 days in absence of any other PE procedure ⁇ period 2).
- the % change of the free vWF from baseline increases with the dose, but less than dose- proportional.
- a large inter-individual variability mainly related to the large variability of target expression (vWF) at study entry, is predicted at all the dose levels.
- the two lower doses (2.5 and 5 mg once daily) lead to a sub-optimal target inhibition, whereas a higher daily dose of caplacizumab than the one tested in the TITAN study (20 mg) does not substantially benefit the overall simulated TTP population.
- Figure 5 shows the model-predicted % decrease from baseline of free vWF:Ag levels at the end of period 2 as a function of the dose level, including patients treated with placebo.
- the dosing regimen used herein (5-40 mg, preferably 10 mg daily) is considered as adequate for reaching the desired suppression of the platelet-binding capacity of (UL)vWF in TTP patients, while bleeding events are minimal and at least controllable,
- ALX 0081 represents a novel approach to the treatment of TTP and provides a significant benefit in terms of efficacy, safety and quality of life for patients with TTP,
- Caplacizumab Proof of concept of Caplacizumab was demonstrated with statistically significant and clinically meaningful reduction of time to confirmed platelet response.
- the median days to confirmed platelet response was 3 days for Caplacizumab vs. 4.9 days for Placebo.
- the HR (Placebo over Caplacizumab) of 2,2 with 95% CI (1.28, 3,78), p 0.013.
- the AEs and SAEs are consistent with serious, potentially life-threatening condition. Nearly twice as many bleeding events in Caplacizumab arm (66 events) vs. Placebo arm (35 events), although only 5 SAEs in 2 subjects for Caplacizumab arm vs. 2 SAEs in 2 subjects for Placebo arm.
- the benefit risk assessment for patients with acquired TTP is very positive.
- the polypeptides of the invention such as ALX 0081
- the more rapid normalisation of the platelet count also reduces the risk of haemorrhagic complications. Its use also results in improved outcomes in poorly responsive patients, including those with secondary TTP where mortality from the disease remains high.
- the polypeptides of the invention, such as ALX 0081 are of value in the prevention of relapses after recovery from an acute episode.
- A05-GS30-12A05 7 AVQLVESGGGLVQPGGSLRLSCLASGRIFSIGAMGMYRQAPGKQRELVA
- B06H2-3a 12 EVQLVESGGGLVQPGGSLRLSCAASG RTFSYN PMGWFRQAPGKGREVVB06H2 AAISRTGGSTYYARSVEGRFTISRDNAKRMVYLQM NSLRAEDTAVYYCAA
- A02H4-GS9- 14 EVQLVESGGG LVQPGGSLRLSCAASGRTFSYNPMGWFRQAPG KGRE LVAA02 H4 AISRTGGSTYYPDSVEGRFTISRDNAKRSVYLQM NSLRAEDTAVYYCAAAG
- A02 H1 19 EVQLVESGGGLVQPGGSLRLSCAASGRTFSYNPMGWFRQAPGKGRELVA
- VPLDSSPATCHNNIMKQT VDSSCRILTSDVFQDCN
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Organic Chemistry (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Hematology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Diabetes (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Dermatology (AREA)
- Urology & Nephrology (AREA)
- Vascular Medicine (AREA)
- Cardiology (AREA)
- Heart & Thoracic Surgery (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (25)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2016573549A JP6688746B2 (ja) | 2014-06-16 | 2015-06-16 | 免疫グロブリン単一可変ドメインでttpを処置する方法、およびその使用 |
| KR1020227012546A KR102568585B1 (ko) | 2014-06-16 | 2015-06-16 | 면역글로불린 단일 가변 도메인을 이용한 ttp의 치료 방법 및 그의 용도 |
| PL15729829T PL3154569T3 (pl) | 2014-06-16 | 2015-06-16 | Pojedyncze domeny zmienne immunoglobuliny do zastosowania w leczeniu TTP |
| AU2015276237A AU2015276237B2 (en) | 2014-06-16 | 2015-06-16 | Methods of treating TTP with immunoglobulin single variable domains and uses thereof |
| EP18153676.4A EP3332800B1 (en) | 2014-06-16 | 2015-06-16 | Immunoglobulin single variable domains for use in methods of treating ttp |
| EP18153673.1A EP3335723B1 (en) | 2014-06-16 | 2015-06-16 | Immunoglobulin single variable domains for use in methods of treating ttp |
| ES15729829T ES2881331T3 (es) | 2014-06-16 | 2015-06-16 | Dominios variables únicos de inmunoglobulina para su uso en el tratamiento de TTP |
| EP18153671.5A EP3366305B1 (en) | 2014-06-16 | 2015-06-16 | Methods of treating ttp with immunoglobulin single variable domains and uses thereof |
| CN201580040020.4A CN106559985A (zh) | 2014-06-16 | 2015-06-16 | 用免疫球蛋白单可变结构域治疗ttp的方法及其用途 |
| SG11201610488QA SG11201610488QA (en) | 2014-06-16 | 2015-06-16 | Methods of treating ttp with immunoglobulin single variable domains and uses thereof |
| PL18153671T PL3366305T3 (pl) | 2014-06-16 | 2015-06-16 | Sposoby leczenia ttp za pomocą pojedyńczych immunoglobulinowych domen zmiennych i ich zastosowania |
| EP18153674.9A EP3335724B1 (en) | 2014-06-16 | 2015-06-16 | Immunoglobulin single variable domains for use in methods of treating ttp |
| RU2017100077A RU2704444C2 (ru) | 2014-06-16 | 2015-06-16 | Способы лечения ттп иммуноглобулиновыми одиночными вариабельными доменами и их применение |
| US15/319,467 US10858445B2 (en) | 2014-06-16 | 2015-06-16 | Methods of treating TTP with immunoglobulin single variable domains and uses thereof |
| PL18153676T PL3332800T3 (pl) | 2014-06-16 | 2015-06-16 | Pojedyncze domeny zmienne immunoglobuliny do stosowania w sposobach leczenia TTP |
| EP15729829.0A EP3154569B1 (en) | 2014-06-16 | 2015-06-16 | Immunoglobulin single variable domains for use in treating ttp |
| EP22172948.6A EP4059513A1 (en) | 2014-06-16 | 2015-06-16 | Methods of treating ttp with immunoglobulin single variable domains and uses thereof |
| KR1020177001152A KR102403388B1 (ko) | 2014-06-16 | 2015-06-16 | 면역글로불린 단일 가변 도메인을 이용한 ttp의 치료 방법 및 그의 용도 |
| CA2952103A CA2952103A1 (en) | 2014-06-16 | 2015-06-16 | Methods of treating ttp with immunoglobulin single variable domains and uses thereof |
| IL249540A IL249540B (en) | 2014-06-16 | 2016-12-13 | Methods of treating ttp with immunoglobulin single variable domains and uses thereof |
| US15/880,870 US20180155440A1 (en) | 2014-06-16 | 2018-01-26 | Methods of treating ttp with immunoglobulin single variable domains and uses thereof |
| US15/881,003 US10919980B2 (en) | 2014-06-16 | 2018-01-26 | Methods of treating TTP with immunoglobulin single variable domains and uses thereof |
| US15/880,978 US12269893B2 (en) | 2014-06-16 | 2018-01-26 | Methods of treating TTP with immunoglobulin single variable domains and uses thereof |
| US15/881,055 US20180155443A1 (en) | 2014-06-16 | 2018-01-26 | Methods of treating ttp with immunoglobulin single variable domains and uses thereof |
| AU2021202747A AU2021202747B2 (en) | 2014-06-16 | 2021-05-03 | Methods of treating TTP with immunoglobulin single variable domains and uses thereof |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| NL2013007 | 2014-06-16 | ||
| NL2013007A NL2013007B1 (en) | 2014-06-16 | 2014-06-16 | Methods of treating TTP with immunoglobulin single variable domains and uses thereof. |
| US201462030817P | 2014-07-30 | 2014-07-30 | |
| US62/030,817 | 2014-07-30 |
Related Child Applications (5)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/319,467 A-371-Of-International US10858445B2 (en) | 2014-06-16 | 2015-06-16 | Methods of treating TTP with immunoglobulin single variable domains and uses thereof |
| US15/880,978 Continuation US12269893B2 (en) | 2014-06-16 | 2018-01-26 | Methods of treating TTP with immunoglobulin single variable domains and uses thereof |
| US15/880,870 Continuation US20180155440A1 (en) | 2014-06-16 | 2018-01-26 | Methods of treating ttp with immunoglobulin single variable domains and uses thereof |
| US15/881,003 Continuation US10919980B2 (en) | 2014-06-16 | 2018-01-26 | Methods of treating TTP with immunoglobulin single variable domains and uses thereof |
| US15/881,055 Continuation US20180155443A1 (en) | 2014-06-16 | 2018-01-26 | Methods of treating ttp with immunoglobulin single variable domains and uses thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2015193326A1 true WO2015193326A1 (en) | 2015-12-23 |
Family
ID=51541255
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2015/063493 Ceased WO2015193326A1 (en) | 2014-06-16 | 2015-06-16 | Methods of treating ttp with immunoglobulin single variable domains and uses thereof |
Country Status (15)
| Country | Link |
|---|---|
| US (5) | US10858445B2 (https=) |
| EP (6) | EP4059513A1 (https=) |
| JP (3) | JP6688746B2 (https=) |
| KR (2) | KR102568585B1 (https=) |
| CN (1) | CN106559985A (https=) |
| AU (2) | AU2015276237B2 (https=) |
| CA (1) | CA2952103A1 (https=) |
| ES (5) | ES2843642T3 (https=) |
| IL (1) | IL249540B (https=) |
| NL (1) | NL2013007B1 (https=) |
| PL (5) | PL3332800T3 (https=) |
| PT (5) | PT3154569T (https=) |
| RU (1) | RU2704444C2 (https=) |
| SG (2) | SG10201811109PA (https=) |
| WO (1) | WO2015193326A1 (https=) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2019154867A1 (en) | 2018-02-06 | 2019-08-15 | Ablynx Nv | Methods of treating initial episode of ttp with immunoglobulin single variable domains |
| RU2794143C2 (ru) * | 2018-02-06 | 2023-04-11 | Аблинкс Нв | Способы лечения первоначального эпизода ttp с помощью одиночных вариабельных доменов иммуноглобулинов |
| US12269893B2 (en) | 2014-06-16 | 2025-04-08 | Ablynx N.V. | Methods of treating TTP with immunoglobulin single variable domains and uses thereof |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN107340225B (zh) * | 2017-07-13 | 2019-07-05 | 徐州医科大学 | 一种基于流式细胞术检测血小板受体GPIba胞外段酶切的方法 |
| US20230405096A1 (en) * | 2020-11-18 | 2023-12-21 | Green Cross Corporation | Adamts13 variant having increased escaping rate or activity against autoantibody |
| CA3232223A1 (en) | 2021-09-17 | 2023-03-23 | Ying Fu | Synthetic humanized llama nanobody library and use thereof to identify sars-cov-2 neutralizing antibodies |
| CN118715246A (zh) * | 2021-12-10 | 2024-09-27 | 李人浩 | 结合血管性血友病因子(vwf)a1结构域或自动抑制模块的多肽、变体及其用途 |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2006122825A2 (en) * | 2005-05-20 | 2006-11-23 | Ablynx Nv | Single domain vhh antibodies against von willebrand factor |
Family Cites Families (34)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB335768A (en) | 1929-10-24 | 1930-10-02 | Jacoviac Maurice | Improvements in protecting devices for gramophone disc records |
| US4399216A (en) | 1980-02-25 | 1983-08-16 | The Trustees Of Columbia University | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US5179017A (en) | 1980-02-25 | 1993-01-12 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4634665A (en) | 1980-02-25 | 1987-01-06 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US5043429B1 (en) | 1987-05-01 | 1997-10-14 | Scripps Research Inst | Protein fragments containing factor VIII binding domain of von willebrand factor |
| EP0368684B2 (en) | 1988-11-11 | 2004-09-29 | Medical Research Council | Cloning immunoglobulin variable domain sequences. |
| DK1621554T4 (da) | 1992-08-21 | 2012-12-17 | Univ Bruxelles | Immunoglobuliner blottet for lette kæder |
| US5827690A (en) | 1993-12-20 | 1998-10-27 | Genzyme Transgenics Corporatiion | Transgenic production of antibodies in milk |
| US6329516B1 (en) | 1997-04-28 | 2001-12-11 | Fmc Corporation | Lepidopteran GABA-gated chloride channels |
| CA2361678A1 (en) | 1999-02-05 | 2000-08-10 | Rijksuniversiteit Leiden | Method of modulating metabolite biosynthesis in recombinant cells |
| IL147920A0 (en) | 1999-08-02 | 2002-08-14 | Keygene Nv | Method for generating cgmmv resistant plants, genetic constructs, and the obtained cgmmv-resistant plants |
| US20060073141A1 (en) | 2001-06-28 | 2006-04-06 | Domantis Limited | Compositions and methods for treating inflammatory disorders |
| AU2003251238A1 (en) | 2002-08-07 | 2004-02-25 | Umc Utrecht Holding B.V. | Modulation of platelet adhesion based on the surface exposed beta-switch loop of platelet glycoprotein ib-alpha |
| BRPI0315666B8 (pt) | 2002-10-23 | 2021-05-25 | Ludwig Inst For Cancer Res Ltd | dna de a34 e a33 do tipo 3, proteínas, seus anticorpos e métodos de tratamento usando os mesmos |
| NZ576284A (en) | 2003-01-10 | 2010-07-30 | Ablynx Nv | Therapeutic polypeptides, homologues thereof, fragments thereof and for use in modulating platelet-mediated aggregation |
| JP2006517789A (ja) | 2003-01-10 | 2006-08-03 | アブリンクス エン.ヴェー. | 治療用ポリペプチド、その相同物、その断片、および血小板媒介凝集の調節での使用 |
| US7461263B2 (en) | 2003-01-23 | 2008-12-02 | Unspam, Llc. | Method and apparatus for a non-revealing do-not-contact list system |
| EP1656128A4 (en) | 2003-08-12 | 2007-02-28 | William M Yarbrough | SINGLE ACNE TREATMENT AND METHOD OF USE |
| US7270976B2 (en) * | 2004-07-19 | 2007-09-18 | American Diagnostica, Inc. | Methods for measuring ADAMTS13 activity and protein on platelets and in plasma |
| US7563443B2 (en) | 2004-09-17 | 2009-07-21 | Domantis Limited | Monovalent anti-CD40L antibody polypeptides and compositions thereof |
| WO2006040153A2 (en) | 2004-10-13 | 2006-04-20 | Ablynx N.V. | Single domain camelide anti -amyloid beta antibodies and polypeptides comprising the same for the treatment and diagnosis of degenarative neural diseases such as alzheimer's disease |
| WO2006074947A2 (en) | 2005-01-14 | 2006-07-20 | Ablynx N.V. | METHODS AND ASSAYS FOR DISTINGUISHING BETWEEN DIFFERENT FORMS OF DISEASES AND DISORDERS CHARACTERIZED BY THROMBOCYTOPENIA AND/OR BY SPONTANEOUS INTERACTION BETWEEN VON WILLEBRAND FACTOR (vWF) AND PLATELETS |
| WO2008020079A1 (en) | 2006-08-18 | 2008-02-21 | Ablynx N.V. | Amino acid sequences directed against il-6r and polypeptides comprising the same for the treatment of deseases and disorders associated with il-6-mediated signalling |
| EP2121757A2 (en) | 2007-02-21 | 2009-11-25 | Ablynx N.V. | Amino acid sequences directed against vascular endothelial growth factor and polypeptides comprising the same for the treatment of conditions and diseases characterized by excessive and/or pathological angiogenesis or neovascularization |
| CA2687903C (en) | 2007-05-24 | 2016-09-13 | Ablynx N.V. | Amino acid sequences directed against rank-l and polypeptides comprising the same for the treatment of bone diseases and disorders |
| EP2252303A2 (en) | 2008-03-21 | 2010-11-24 | Ablynx NV | Von willebrand factor specific binders and methods of use therefor |
| BRPI0919879A2 (pt) | 2008-10-29 | 2016-02-16 | Wyeth Llc | métodos para purificação de moléculas de ligação a antígeno de domínio único |
| CA2738243C (en) | 2008-10-29 | 2020-09-29 | Wyeth Llc | Formulations of single domain antigen binding molecules |
| US20120321640A1 (en) | 2009-12-01 | 2012-12-20 | Ablynx N.V. | Von willebrand factor specific binding agents and uses thereof |
| BR112013011176A2 (pt) * | 2010-11-05 | 2020-09-01 | Novartis Ag | métodos de tratamento de artrite reumatoide usando antagonistas de il-17 |
| DK3412305T3 (da) | 2011-06-10 | 2021-03-01 | Baxalta GmbH | Behandling af koagulationssygdom ved administration af rekombinant vwf |
| PE20141522A1 (es) | 2011-08-17 | 2014-11-17 | Glaxo Group Ltd | Proteinas y peptidos modificados |
| NL2013007B1 (en) | 2014-06-16 | 2016-07-05 | Ablynx Nv | Methods of treating TTP with immunoglobulin single variable domains and uses thereof. |
| EP3749696A1 (en) | 2018-02-06 | 2020-12-16 | Ablynx N.V. | Methods of treating initial episode of ttp with immunoglobulin single variable domains |
-
2014
- 2014-06-16 NL NL2013007A patent/NL2013007B1/en active
-
2015
- 2015-06-16 RU RU2017100077A patent/RU2704444C2/ru active
- 2015-06-16 EP EP22172948.6A patent/EP4059513A1/en not_active Withdrawn
- 2015-06-16 PT PT157298290T patent/PT3154569T/pt unknown
- 2015-06-16 KR KR1020227012546A patent/KR102568585B1/ko active Active
- 2015-06-16 ES ES18153671T patent/ES2843642T3/es active Active
- 2015-06-16 SG SG10201811109PA patent/SG10201811109PA/en unknown
- 2015-06-16 US US15/319,467 patent/US10858445B2/en active Active
- 2015-06-16 ES ES18153674T patent/ES2924199T3/es active Active
- 2015-06-16 PL PL18153676T patent/PL3332800T3/pl unknown
- 2015-06-16 EP EP18153671.5A patent/EP3366305B1/en active Active
- 2015-06-16 AU AU2015276237A patent/AU2015276237B2/en active Active
- 2015-06-16 JP JP2016573549A patent/JP6688746B2/ja active Active
- 2015-06-16 PT PT181536715T patent/PT3366305T/pt unknown
- 2015-06-16 EP EP18153674.9A patent/EP3335724B1/en active Active
- 2015-06-16 PT PT181536731T patent/PT3335723T/pt unknown
- 2015-06-16 PL PL18153674.9T patent/PL3335724T3/pl unknown
- 2015-06-16 CA CA2952103A patent/CA2952103A1/en not_active Abandoned
- 2015-06-16 PT PT181536749T patent/PT3335724T/pt unknown
- 2015-06-16 ES ES18153676T patent/ES2831865T3/es active Active
- 2015-06-16 PL PL18153673.1T patent/PL3335723T3/pl unknown
- 2015-06-16 ES ES15729829T patent/ES2881331T3/es active Active
- 2015-06-16 EP EP18153673.1A patent/EP3335723B1/en active Active
- 2015-06-16 PL PL15729829T patent/PL3154569T3/pl unknown
- 2015-06-16 PT PT181536764T patent/PT3332800T/pt unknown
- 2015-06-16 EP EP15729829.0A patent/EP3154569B1/en active Active
- 2015-06-16 WO PCT/EP2015/063493 patent/WO2015193326A1/en not_active Ceased
- 2015-06-16 KR KR1020177001152A patent/KR102403388B1/ko active Active
- 2015-06-16 SG SG11201610488QA patent/SG11201610488QA/en unknown
- 2015-06-16 EP EP18153676.4A patent/EP3332800B1/en active Active
- 2015-06-16 ES ES18153673T patent/ES2915473T3/es active Active
- 2015-06-16 CN CN201580040020.4A patent/CN106559985A/zh active Pending
- 2015-06-16 PL PL18153671T patent/PL3366305T3/pl unknown
-
2016
- 2016-12-13 IL IL249540A patent/IL249540B/en unknown
-
2018
- 2018-01-26 US US15/881,055 patent/US20180155443A1/en not_active Abandoned
- 2018-01-26 US US15/881,003 patent/US10919980B2/en active Active
- 2018-01-26 US US15/880,870 patent/US20180155440A1/en not_active Abandoned
- 2018-01-26 US US15/880,978 patent/US12269893B2/en active Active
-
2020
- 2020-01-30 JP JP2020014229A patent/JP7105260B2/ja active Active
-
2021
- 2021-05-03 AU AU2021202747A patent/AU2021202747B2/en active Active
-
2022
- 2022-07-11 JP JP2022110921A patent/JP2022160431A/ja active Pending
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2006122825A2 (en) * | 2005-05-20 | 2006-11-23 | Ablynx Nv | Single domain vhh antibodies against von willebrand factor |
Non-Patent Citations (4)
| Title |
|---|
| F. CALLEWAERT ET AL: "Evaluation of efficacy and safety of the anti-VWF Nanobody ALX-0681 in a preclinical baboon model of acquired thrombotic thrombocytopenic purpura", BLOOD, vol. 120, no. 17, 4 September 2012 (2012-09-04), pages 3603 - 3610, XP055109473, ISSN: 0006-4971, DOI: 10.1182/blood-2012-04-420943 * |
| FLORA PEYVANDI ET AL: "Nanobodies - Inspired by nature First results of the Phase II TITAN trial: anti-von Willebrand factor Nanobody as adjunctive treatment for patients with acquired thrombotic thrombocytopenic purpura", 28 July 2011 (2011-07-28), XP055163774, Retrieved from the Internet <URL:http://www.ablynx.com/wp-content/uploads/2011/07/Peyvandi_TITAN-study_final.pdf> [retrieved on 20150121] * |
| JOSEFIN-BEATE HOLZ: "The TITAN trial Assessing the efficacy and safety of an anti-von Willebrand factor Nanobody in patients with acquired thrombotic thrombocytopenic purpura", TRANSFUSION AND APHERESIS SCIENCE, vol. 46, no. 3, 2012, pages 343 - 346, XP028422906, ISSN: 1473-0502, [retrieved on 20120319], DOI: 10.1016/J.TRANSCI.2012.03.027 * |
| KENT CHAPMAN ET AL: "Therapy for Thrombotic Thrombocytopenia Purpura: Past, Present, and Future", SEMINARS IN THROMBOSIS AND HEMOSTASIS, vol. 40, no. 01, 31 December 2013 (2013-12-31), pages 034 - 040, XP055163569, ISSN: 0094-6176, DOI: 10.1055/s-0033-1363165 * |
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12269893B2 (en) | 2014-06-16 | 2025-04-08 | Ablynx N.V. | Methods of treating TTP with immunoglobulin single variable domains and uses thereof |
| WO2019154867A1 (en) | 2018-02-06 | 2019-08-15 | Ablynx Nv | Methods of treating initial episode of ttp with immunoglobulin single variable domains |
| US20210221912A1 (en) * | 2018-02-06 | 2021-07-22 | Ablynx N.V. | Methods of treating initial episode of ttp with immunoglobulin single variable domains |
| RU2794143C2 (ru) * | 2018-02-06 | 2023-04-11 | Аблинкс Нв | Способы лечения первоначального эпизода ttp с помощью одиночных вариабельных доменов иммуноглобулинов |
| US11999797B2 (en) | 2018-02-06 | 2024-06-04 | Ablynx N.V. | Methods of treating initial episode of TTP with immunoglobulin single variable domains |
| IL276200B1 (en) * | 2018-02-06 | 2024-09-01 | Ablynx Nv | A polypeptide comprising two variable domains of anti-human immunoglobulins of (vWF) VON- for use in the treatment of an initial episode of Willebrand Factor (vWF)-related disease |
| IL276200B2 (en) * | 2018-02-06 | 2025-01-01 | Ablynx Nv | Polypeptide comprising two variable domains of anti-human (vWF) immunoglobulins VON- for use in the treatment of a first episode of von Willebrand Factor (vWF)-related disease |
| AU2019217584B2 (en) * | 2018-02-06 | 2025-08-14 | Ablynx Nv | Methods of treating initial episode of TTP with immunoglobulin single variable domains |
| KR102929403B1 (ko) * | 2018-02-06 | 2026-02-24 | 아블린쓰 엔.브이. | 면역글로불린 단일 가변 도메인을 이용한 ttp의 초기 에피소드의 치료 방법 |
| RU2856869C2 (ru) * | 2024-03-20 | 2026-02-25 | федеральное государственное бюджетное учреждение "Национальный медицинский исследовательский центр детской гематологии, онкологии и иммунологии имени Дмитрия Рогачева" Министерства здравоохранения Российской Федерации | Способ коррекции тромбоцитопении у детей с приобретенной тромботической тромбоцитопенической пурпурой |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12269893B2 (en) | Methods of treating TTP with immunoglobulin single variable domains and uses thereof | |
| US11999797B2 (en) | Methods of treating initial episode of TTP with immunoglobulin single variable domains | |
| HK40078326A (en) | Methods of treating ttp with immunoglobulin single variable domains and uses thereof | |
| HK1256731B (en) | Immunoglobulin single variable domains for use in methods of treating ttp | |
| HK1258508B (en) | Methods of treating ttp with immunoglobulin single variable domains and uses thereof | |
| HK1256730B (en) | Immunoglobulin single variable domains for use in methods of treating ttp | |
| HK1255930A1 (en) | Immunoglobulin single variable domains for use in methods of treating ttp | |
| HK1255930B (en) | Immunoglobulin single variable domains for use in methods of treating ttp | |
| RU2807602C2 (ru) | Способы лечения ттп иммуноглобулиновыми одиночными вариабельными доменами и их применение | |
| HK1236434B (en) | Immunoglobulin single variable domains for use in treating ttp |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15729829 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2952103 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 249540 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2016573549 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15319467 Country of ref document: US |
|
| REEP | Request for entry into the european phase |
Ref document number: 2015729829 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2015729829 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2017100077 Country of ref document: RU Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20177001152 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2015276237 Country of ref document: AU Date of ref document: 20150616 Kind code of ref document: A |