WO2015150491A1 - An isolated donor mhc-derived peptide and uses thereof - Google Patents
An isolated donor mhc-derived peptide and uses thereof Download PDFInfo
- Publication number
- WO2015150491A1 WO2015150491A1 PCT/EP2015/057257 EP2015057257W WO2015150491A1 WO 2015150491 A1 WO2015150491 A1 WO 2015150491A1 EP 2015057257 W EP2015057257 W EP 2015057257W WO 2015150491 A1 WO2015150491 A1 WO 2015150491A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- peptide
- tregs
- mhc
- cells
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/001—Preparations to induce tolerance to non-self, e.g. prior to transplantation
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/20—Cellular immunotherapy characterised by the effect or the function of the cells
- A61K40/22—Immunosuppressive or immunotolerising
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/418—Antigens related to induction of tolerance to non-self
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70539—MHC-molecules, e.g. HLA-molecules
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
- C12N5/0637—Immunosuppressive T lymphocytes, e.g. regulatory T cells or Treg
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56966—Animal cells
- G01N33/56972—White blood cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
- A61K2039/577—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 tolerising response
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/50—Cell markers; Cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2502/00—Coculture with; Conditioned medium produced by
- C12N2502/11—Coculture with; Conditioned medium produced by blood or immune system cells
- C12N2502/1121—Dendritic cells
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
- G01N2333/70503—Immunoglobulin superfamily, e.g. VCAMs, PECAM, LFA-3
- G01N2333/70539—MHC-molecules, e.g. HLA-molecules
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/24—Immunology or allergic disorders
- G01N2800/245—Transplantation related diseases, e.g. graft versus host disease
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/52—Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis
Definitions
- the invention is in the field of immunotherapy.
- the invention relates to an isolated peptide derived from a polymorphic region of donor MHC class II molecules which induces tolerance and thus prevents transplant rejection in a patient in need thereof.
- Allogeneic human to human transplant remains the best treatment to replace organs that have failed following disease.
- the incompatibility between the molecules of the major histocompatibility complex (MHC) of the recipient and donor cells is the main barrier to long- term success of organ transplantation.
- MHC major histocompatibility complex
- the induction of tolerance to the allograft has become a major objective and certain tolerance strategies are beginning to be applied clinically (1).
- Different populations of Tregs have been described as being capable of inducing tolerance to allogeneic organs. Most of these Tregs are CD4 + Tregs, while CD8 + Tregs are less well defined (2).
- CD8 + CD40Ig Tregs CD8 + CD40Ig Tregs cells
- potent suppressive capacity 2, 4-6. It has been showed that donor-specific CD8 + CD40Ig Tregs but not natural CD8 + CD45RC l0W Tregs transferred tolerance to naive transplant recipients.
- Treg-mediated suppression of immune response against the transplant such as donor- specific antibodies which are associated with antibody-mediated rejection
- non specific immunosuppressive drugs which have the drawbacks to increase the attack rate of opportunistic diseases (e.g. bacterial, viral or fungal infections) and increase the mortality of transplanted patients.
- the invention relates to an isolated peptide of length ranging between 15 and 40 amino acids which is derived from a MHC class II molecule that comprises the amino acid sequence: REEYARFDSDVGEYR (SEQ ID NO: 1) or a function-conservative variant thereof.
- the invention relates to a MHC/peptide multimer comprising a peptide of length ranging between 15 and 25 amino acids that comprises or consists of the amino acid sequence: REEYARFDSDVGEYR (SEQ ID NO: 1) or a function-conservative variant thereof.
- the invention in a third aspect, relates to an in vitro or ex vivo method for generating a population of CD8 + CD45RC low Tregs, comprising a step of culturing a population of CD8 + Tregs with a culture medium comprising an isolated peptide according to the invention in the presence of a population of plasmacytoid dendritic cells.
- the invention relates to an in vitro or ex vivo method for generating a population of CD8 + CD45RC low Tregs, comprising a step of culturing a population of CD8+ Tregs with a culture medium comprising a MHC/peptide multimer according to the invention.
- the invention relates to an isolated peptide of the invention or a MHC/peptide multimer for use as drug, for use in inducing tolerance in a patient in need thereof, and for use in preventing or reducing transplant rejection in a patient in need thereof.
- the invention relates to a pharmaceutical composition
- a pharmaceutical composition comprising: a) an isolated peptide of the invention.
- an antigen-presenting cell comprising a complex MHC molecule and a peptide of the invention
- the invention relates to an in vitro method for determining whether a transplanted patient (recipient) is tolerant, comprising a step of determining the presence of CD8+CD45RClow Tregs in a biological sample obtained from said transplanted patient, wherein the presence of CD8+CD45RClow Tregs is indicative of tolerance.
- CD8 + CD40Ig Tregs' TCR fine specificity influences Treg function and allograft survival have thus demonstrated for the first time in transplantation that induced CD8 + CD40Ig Tregs recognized a dominant peptide (called Du51) derived from a polymorphic region of donor MHC class II molecules.
- the inventors generated a specific tetramer and demonstrated ex vivo and in vivo the dominant tolerance exerted by antigen-specific CD8 + CD40Ig Tregs. Finally, they demonstrated that this peptide was recognized by Tregs expressing ⁇ ⁇ and Vpi8-specific TCRs. These TCRs comprised a private but restricted ⁇ 1 repertoire in the spleen and graft, but a private and diverse ⁇ 18 repertoire in the spleen and a more restricted ⁇ 18 repertoire in the graft, that ensure efficient suppression of alloreactive immune responses.
- a first aspect of the invention relates to an isolated peptide of length ranging between 15 and 40 amino acids which is derived from a MHC class 11 molecule that comprises the amino acid sequence: REEYARFDSDVGEYR (SEQ ID NO: 1) (also called herein 51-18) or a function-conservative variant thereof.
- the peptide is an isolated peptide of length ranging between 15 and 40 amino acids which is derived from a MHC class II molecule that comprises the amino acid sequence: REEYARFDSDVGEYR (SEQ ID NO: 1) or a function- conservative variant thereof with the exclusion of the following peptides:
- NREEFVRFDSDVGEFR SEQ ID NO: 30
- REEFVRFDSDVGEFR SEQ ID NO : 31 ;
- HQEEYVRFDSDVGEYRAV (SEQ ID NO: 34).
- the term "function-conservative variant” refers to those comprise at least 70% identity with a peptide of reference (such as SEQ ID NO: 1), even more preferably at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5% or 99.9%, and is still able to induce tolerance and thus prevent organ rejection in substantially the same way as a peptide of reference (such as SEQ ID NO: 1 (51-18)).
- said peptide is derived from a polymorphic region of a donor MHC class II molecule.
- said peptide consists of the amino acid sequence: RLLARLIYNREEYARFDSDVGEYRAVTELGRPSAEYRNKQ (SEQ ID NO: 28) or a function-conservative variant thereof.
- the peptide of the invention comprises at least 70% identity with the peptide of SEQ ID NO: 28, even more preferably at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5% or 99.9%, and is still able to induce tolerance and thus prevent organ rejection in substantially the same way as the peptide of SEQ ID NO: 28.
- said peptide comprises at most 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39 or 40 amino acids.
- the peptide is an isolated peptide of 15 or 16 amino acids long that comprises or consists of the amino acid sequence: REEYARFDSDVGEYR (SEQ ID NO: 1) (also called herein 51-18) or a function- conservative variant thereof.
- the peptide is an isolated peptide of 15 or 16 amino acids long that comprises or consists of the amino acid sequence: REEYARFDSDVGEYR (SEQ ID NO: 1) (also called herein 51-18) or a function- conservative variant thereof with the proviso that said variant is not a peptide consisting of the amino acid sequence: NREEYARFDSDVGEYR (SEQ ID NO: 2) (also called herein Du51).
- peptide refers to a polymer of amino acid residues joined by peptide bonds, whether produced naturally or synthetically, having no specific length.
- peptide does not exclude post-translational modifications that include but are not limited to phosphorylation, acetylation, glycosylation and the like.
- amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymer.
- an “isolated" peptide it is intended that the peptide is essentially free from contaminating cellular components, such as carbohydrate, lipid, or other proteinaceous impurities associated with the polypeptide in nature.
- a preparation of isolated peptide contains the peptide in a highly purified form, i.e., at least about 80%> pure, at least about 90%) pure, at least about 95%> pure, greater than 95%> pure, such as 96%>, 97%>, or 98%> or more pure, or greater than 99% pure.
- a peptide that is the predominant specie present in a preparation is substantially purified.
- the invention also encompasses peptides that are function-conservative variants of the peptide comprising SEQ ID NO: 1 as described here above.
- the peptide of the invention comprises at least 70% identity with the peptide of SEQ ID NO: 1, even more preferably at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5% or 99.9%, and is still able to induce tolerance and thus prevent organ rejection in substantially the same way as the peptide of SEQ ID NO: 1.
- polypeptide having an amino acid sequence at least, for example, 95% "identical" to a query amino acid sequence of the invention it is intended that the amino acid sequence of the subject peptide is identical to the query sequence except that the subject peptide sequence may include up to five amino acid alterations per each 100 amino acids of the query amino acid sequence.
- up to 5% (5 of 100) of the amino acid residues in the subject sequence may be inserted, deleted, or substituted with another amino acid.
- the percentage of identity is calculated using a global alignment (i.e., the two sequences are compared over their entire length).
- Methods for comparing the identity and homology of two or more sequences are well known in the art.
- the "needle" program which uses the Needleman-Wunsch global alignment algorithm (Needleman and Wunsch, 1970 J. Mol. Biol. 48:443-453) to find the optimum alignment (including gaps) of two sequences when considering their entire length, may for example be used.
- the needle program is for example available on the ebi.ac.uk world wide web site.
- the percentage of identity in accordance with the invention is preferably calculated using the EMBOSS: :needle (global) program with a "Gap Open” parameter equal to 10.0, a "Gap Extend” parameter equal to 0.5, and a Blosum62 matrix.
- the peptide according to the invention may differ from 1, 2, 3 or 4 amino acids to the SEQ ID NO: 1 or SEQ ID NO: 2 (Du51).
- Such a peptide may for example only comprise substitutions compared to the reference sequence. The substitutions preferably correspond to conservative substitutions as indicated in the table below:
- the invention encompasses peptides substantially identical to the peptide consisting of SEQ ID NO: 1 (51-18) or SEQ ID NO: 2 (Du51) in which one or more residues have been conservatively substituted with a functionally similar residue and which displays the functional aspects of the peptides consisting of SEQ ID NO: 1 (51-18) or SEQ ID NO: 2 (Du51) as described here below, i.e. being still able to induce tolerance and thus prevent organ rejection in substantially the same way as a peptide consisting of the given amino acid sequence (e.g. the peptides 51-18 or Du51).
- “conservative substitution” also includes the use of a chemically derivatized residue in place of a non-derivatized residue.
- “Chemical derivative” refers to a peptide having one or more residues chemically derivatized by reaction of a functional side group. Examples of such derivatized molecules include for example, those molecules in which free amino groups have been derivatized to form amine hydrochlorides, p-toluene sulfonyl groups, carbobenzoxy groups, t-butyloxycarbonyl groups, chloroacetyl groups or formyl groups. Free carboxyl groups may be derivatized to form salts, methyl and ethyl esters or other types of esters or hydrazides.
- Free hydroxyl groups may be derivatized to form O-acyl or O-alkyl derivatives.
- the imidazole nitrogen of histidine may be derivatized to form N-im- benzylhistidine.
- Chemical derivatives also include peptides that contain one or more naturally-occurring amino acid derivatives of the twenty standard amino acids. For examples: 4-hydroxyproline may be substituted for proline; 5-hydroxylysine may be substituted for lysine; 3-methylhistidine may be substituted for histidine; homoserine may be substituted for serine; and ornithine may be substituted for lysine.
- the term "conservative substitution” also includes the use of non natural amino acids aimed to control and stabilize peptides or proteins secondary structures.
- non natural amino acids are chemically modified amino acids such as prolinoamino acids, beta-amino acids, N-methylamino acids, cyclopropylamino acids, alpha,alpha-substituted amino acids as describe here below.
- These non natural amino acids may include also fluorinated, chlorinated, brominated- or iodinated modified amino acids.
- an analysis of CD8 + CD45RC low Treg activation and/or an analysis of tolerance induction after in vivo peptide infusion may be performed with each peptide. Additionally, a time-course and a dose-response performed in a model of allograft will determine the optimal conditions for each peptide.
- the peptide consists of the amino acid sequence selected from the group consisting of:
- the peptide having the amino acid sequence: REEYARFDSDVGEYR bears an asparagine (N) at the N-terminus.
- the peptide consists of the amino acid sequence selected from the group consisting of:
- NREEYARFDSDVGVYR (SEQ ID NO: 10).
- the peptides of the invention may be produced by conventional automated peptide synthesis methods or by recombinant expression. General principles for designing and making proteins are well known to those of skill in the art. Peptides of the invention may be synthesized in solution or on a solid support in accordance with conventional techniques. Various automatic synthesizers are commercially available and can be used in accordance with known protocols as described in Stewart and Young; Tarn et al, 1983; Merrifield, 1986 and Barany and Merrifield, Gross and Meienhofer, 1979. Peptides of the invention may also be synthesized by solid-phase technology employing an exemplary peptide synthesizer such as a Model 433A from Applied Biosystems Inc.
- any given peptide; generated through automated peptide synthesis or through recombinant methods may be determined using reverse phase HPLC analysis. Chemical authenticity of each peptide may be established by any method well known to those of skill in the art.
- recombinant DNA technology may be employed wherein a nucleotide sequence which encodes a peptide of choice is inserted into an expression vector, transformed or transfected into an appropriate host cell and cultivated under conditions suitable for expression as described herein below. Recombinant methods are especially preferred for producing longer peptides (polypeptides).
- nucleic acid encoding a peptide of the invention (such as the peptide shown in SEQ ID NO: 1), a vector comprising such nucleic acid or a host cell comprising such expression vector are also of interest within the context of the invention.
- the peptide consists of an amino acid sequence described above.
- Nucleic acids of the invention may be produced by any technique known per se in the art, such as, without limitation, any chemical, biological, genetic or enzymatic technique, either alone or in combination(s).
- a "vector” is any vehicle capable of facilitating the transfer of a nucleic acid to the cells
- the vectors useful in the invention include, but are not limited to, plasmids, phagemids, viruses, other vehicles derived from viral or bacterial sources that have been manipulated by the insertion or incorporation of the nucleic acid sequences of interest.
- Viral vectors are a preferred type of vector and include, but are not limited to nucleic acid sequences from the following viruses: retrovirus, such as moloney murine leukemia virus, harvey murine sarcoma virus, murine mammary tumor virus, and mouse sarcoma virus; adenovirus, adeno-associated virus; SV40-type viruses; polyoma viruses; Epstein-Barr viruses; papilloma viruses; herpes virus; vaccinia virus; polio virus; and R A virus such as a retrovirus.
- retrovirus such as moloney murine leukemia virus, harvey murine sarcoma virus, murine mammary tumor virus, and mouse sarcoma virus
- adenovirus adeno-associated virus
- SV40-type viruses polyoma viruses
- Epstein-Barr viruses Epstein-Barr viruses
- papilloma viruses herpes virus
- vaccinia virus poli
- Non-cytopathic viruses include retroviruses (e.g., lentivirus), the life cycle of which involves reverse transcription of genomic viral RNA into DNA with subsequent proviral integration into host cellular DNA. Retroviruses have been approved for human gene therapy trials. Most useful are those retroviruses that are replication-deficient (i.e., capable of directing synthesis of the desired peptides, but incapable of manufacturing an infectious particle). Such genetically altered retroviral expression vectors have general utility for the high-efficiency transduction of genes in vivo.
- adeno-viruses and adeno-associated viruses are double-stranded DNA viruses that have already been approved for human use in gene therapy.
- the adeno-associated virus can be engineered to be replication deficient and is capable of infecting a wide range of cell types and species. It further has advantages such as, heat and lipid solvent stability; high transduction frequencies in cells of diverse lineages, including hemopoietic cells; and lack of superinfection inhibition thus allowing multiple series of transductions.
- the adeno-associated virus can integrate into human cellular DNA in a site-specific manner, thereby minimizing the possibility of insertional mutagenesis and variability of inserted gene expression characteristic of retroviral infection.
- adeno-associated virus infections have been followed in tissue culture for greater than 100 passages in the absence of selective pressure, implying that the adeno-associated virus genomic integration is a relatively stable event.
- the adeno- associated virus can also function in an extrachromosomal fashion.
- Other vectors include plasmid vectors. Plasmid vectors have been extensively described in the art and are well known to those of skill in the art. See e.g., SANBROOK et al, "Molecular Cloning: A Laboratory Manual," Second Edition, Cold Spring Harbor Laboratory Press, 1989. In the last few years, plasmid vectors have been used as DNA vaccines for delivering antigen-encoding genes to cells in vivo.
- Plasmids may be delivered by a variety of parenteral, mucosal and topical routes.
- the DNA plasmid can be injected by intramuscular, intradermal, subcutaneous, or other routes. It may also be administered by intranasal sprays or drops, rectal suppository and orally. It may also be administered into the epidermis or a mucosal surface using a gene-gun.
- the plasmids may be given in an aqueous solution, dried onto gold particles or in association with another DNA delivery system including but not limited to liposomes, dendrimers, and microencapsulation.
- examples of host cells that may be used are antigen- presenting cells (APC) such as human dendritic cells or monocytes (particularly those obtained from the patient to be treated).
- APC antigen-presenting cells
- the means by which the vector carrying the gene may be introduced into the cells include, but are not limited to, microinjection, electroporation, transduction, or transfection using DEAE-dextran, lipofection, calcium phosphate or other procedures known to one skilled in the art.
- MHC/peptide multimers are examples of host cells that may be used.
- MHC/peptide multimer comprising a peptide of length ranging between 15 and 25 amino acids that comprises or consists of the amino acid sequence: REEYARFDSDVGEYR (SEQ ID NO: 1) (also called herein 51-18) or a function- conservative variant thereof as described here above.
- said peptide comprises at most 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 or 25 amino acids.
- said MHC/peptide multimer comprises a peptide of 15 or 16 amino acids long that comprises or consists of the amino acid sequence: REEYARFDSDVGEYR (SEQ ID NO: 1) (also called herein 51-18) or a function- conservative variant thereof as described here above.
- MHC/peptide multimer refers to a stable multimeric complex composed of major histocompatibility complex (MHC) protein subunits loaded with a peptide of the invention.
- MHC/peptide multimer also called herein MHC/peptide complex
- MHC/peptide complex include, but are not limited to, a MHC/peptide dimer, trimer, tetramer or pentamer.
- MHC Major Histocompatibility Complex
- the MHC/peptide multimer is a MHC class I/peptide multimer. In a particular embodiment of the invention, said MHC/peptide multimer is a rat MHC
- the MHC/peptide multimer is a HLA corresponding to MHC class I/peptide multimer.
- MHC class I molecules In humans there are three major different genetic loci that encode MHC class I molecules (the MHC-molecules of the human are also designated human leukocyte antigens (HLA)): HLA- A, HLA-B, and HLA-C. HLA-A*01, HLA-A*02, and HLA-A* 11 are examples of different MHC class I alleles that can be expressed from these loci.
- HLA-E functional homo log in mice is called Qa-lb
- MICA/B molecules are also encompassed within the context of the invention.
- the MHC/peptide multimer is a HLA/peptide multimer selected from the group consisting of HLA-A/peptide multimer, HLA-B/peptide multimer, HLA-C/peptide multimer, HLA-E/peptide multimer, MICA/peptide multimer and MICB/peptide multimer.
- said isolated peptide is selected from the group consisting of: REEYARFDSDVGEYR (SEQ ID NO: 1);
- REEYARFDSDVGVYR (SEQ ID NO : 6);
- NREEYARFDSDVGEFR (SEQ ID NO: 7);
- NQEEYARFDSDVGEYR (SEQ ID NO: 9) or
- NREEYARFDSDVGVYR (SEQ ID NO: 10).
- said MHC/peptide multimer can be used to visualise T cell populations that are specific for the MHC class I RTl .A7peptide complex or a HLAs corresponding to MHC class I/peptide complex as described here above.
- the MHC/peptide multimer may be a multimer where the heavy chain of the MHC is biotinylated, which allows combination as a tetramer with streptavidine.
- Such MHC-peptide tetramer has an increased avidity for the appropriate TCR-carrier T lymphocytes and can therefore be used to visualize reactive populations by immunofluorescence.
- said MHC/peptide multimer can be used for the detection and/or isolation by screening (in flow cytometry or by immunomagnetic screening) of T cell populations that are specific for a MHC/peptide complex as described here above.
- a MHC class I RTl .A7peptide multimer or a HLA corresponding to MHC class I/peptide multimer can be used for the detection and/or isolation by screening (in flow cytometry or by immunomagnetic screening) of T cell populations that are specific for said MHC class I RTl .A7peptide complex or said HLA corresponding to MHC class I/peptide multimer as described here above.
- Another aspect of the invention is beads, microspheres or nanoparticles coated with a MHC/peptide multimer as described here above.
- Another aspect of the invention is a peptide-presenting cell comprising a MHC/peptide multimer of the invention as described here above.
- said multimer MHC /peptide is a MHC class I RT 1. A7peptide multimer.
- the MHC/peptide multimer is a HLA corresponding to MHC class I/peptide multimer as defined above.
- the MHC/peptide multimer is a HLA/peptide multimer selected from the group consisting of HLA-A/peptide multimer, HLA-B/peptide multimer, HLA-C/peptide multimer, HLA-E/peptide multimer, MICA/peptide multimer and MICB/peptide multimer.
- said peptide is selected from the group consisting of:
- NREEYARFDSDVGEFR (SEQ ID NO: 7);
- NQEEYARFDSDVGEYR (SEQ ID NO: 9) or
- said antigen presenting cell is derived from the patient to be treated.
- the terms "antigen-presenting cell” (APC) also called herein "peptide- presenting cell” are used interchangeably and refer to a class of immune cells capable of internalizing and processing an antigen, so that antigenic determinants are presented on the surface of the cell as MHC-associated complexes, in a manner capable of being recognized by the immune system (e. g., MHC class I restricted cytotoxic T lymphocytes and/or MHC class II restricted helper T lymphocytes).
- MHC class I restricted cytotoxic T lymphocytes and/or MHC class II restricted helper T lymphocytes e.g., MHC class I restricted cytotoxic T lymphocytes and/or MHC class II restricted helper T lymphocytes.
- the two requisite properties that allow a cell to function as an APC are the ability to process endocytosed antigens and the expression of MHC gene products.
- APC include dendritic cells (DC), mononuclear phagocytes (e. g. macrophages), B lymphocyte
- said APC is a plasmacytoid dendritic cell (pDC).
- pDC plasmacytoid dendritic cells
- PBMC peripheral blood mononuclear cells
- Human pDCs typically express the surface markers IL-3 receptor a chain (IL-3Ra, CD123), BDCA-2 (CD303) and BDCA-4 (CD304), but do not express CDl lc or CD14, which distinguishes them from conventional dendritic cells or monocytes.
- said pDC is a mature pDC.
- Mature pDC typically express the surface markers HLA-DR, CD86 and produce large amount of IFNalph and IFNbeta.
- cells having an antigen-presenting ability are isolated from the patient to be treated, and pulsed ex vivo with a peptide of the invention to form a complex with the MHC molecule.
- the APC of the invention can be prepared as follows. Lymphocytes are isolated from peripheral blood of the patient to be treated by Ficoll method; adherent cells are separated from non-adherent cells; the adherent cells are then cultured in the presence of GM-CSF and IL-4 to induce dendritic cells; and the dendritic cells are pulsed by culturing with a peptide of the invention to obtain the APCs of the invention.
- the dendritic cells should be exposed to the peptide for sufficient time to allow the antigen to be internalized and presented on the dendritic cells surface.
- the resulting dendritic cells can then be re-administrated to the patient to be treated.
- Such methods are described in WO93/208185 and EP0563485, which are incorporated by reference.
- Lymphocytes T and uses thereof:
- T lymphocyte that recognizes specifically the peptide of 15 or 16 amino acids long that comprises or consists of the amino acid sequence: REEYARFDSDVGEYR (SEQ ID NO: 1) or a function-conservative variant thereof of the invention.
- said peptide is selected from the group consisting of:
- NREEYARFDSDVGEFR (SEQ ID NO: 7);
- NQEEYARFDSDVGEYR (SEQ ID NO: 9) or
- said T lymphocyte is a regulatory T lymphocyte
- said T lymphocyte is a T reg clone.
- regulatory T cell or “regulatory T lymphocyte” are used interchangeably and refer to a specific population of T lymphocytes that have the capacity to dominantly suppress the proliferation of responder T cells in vitro and inhibit diseases and conditions associated with or caused by an excessive immune response such as for example autoimmune diseases, transplantation rejection or a graft versus host disease.
- Treg were originally identified as a CD4 + CD25 + cell population, but are also characterized by the expression of the forkhead family transcription factor, FoxP3. More recently, CD8 + Treg cells have also been identified as previously described.
- said Treg is a CD8 + CD45RC low Treg.
- said T lymphocyte is a genetically modified T lymphocyte that expresses a TCR that recognizes specifically the peptide of the invention.
- T lymphocyte expresses a biased restricted TCR repertoire.
- Biased TCR is well known form the skilled man in the art. Examples of TCR bias have been observed in classical polymorphic major histocompatibility complex (MHC)-restricted immune responses and have been described (64).
- MHC major histocompatibility complex
- the invention in another aspect, relates to an in vitro or ex vivo method for generating a population of Tregs, comprising a step of culturing a population of Tregs with a culture medium comprising an isolated peptide of length ranging between 15 and 40 amino acids which is derived from a MHC class II molecule that comprises the amino acid sequence: REEYARFDSDVGEYR (SEQ ID NO: 1) or a function-conservative variant thereof according the invention in the presence of a population of dendritic cells.
- said peptide consists of the amino acid sequence: RLLARLIYNREEYARFDSDVGEYRAVTELGRPSAEYRNKQ (SEQ ID NO: 28) or a function-conservative variant thereof.
- the invention relates to an in vitro or ex vivo method for generating a population of CD8 + CD45RC low Tregs, comprising a step of culturing a population of CD8 + Tregs with a culture medium comprising an isolated peptide of the invention in the presence of a population of plasmacytoid dendritic cells (pDCs).
- pDCs plasmacytoid dendritic cells
- pDCs are mature pDCs.
- said isolated peptide is an isolated peptide of 15 or 16 amino acids long that comprises or consists of the amino acid sequence: REEYARFDSDVGEYR (SEQ ID NO: 1) (also called herein 51-18) or a function-conservative variant thereof
- said isolated peptide selected from the group consisting of:
- NREEYARFDSDVGEFR (SEQ ID NO: 7);
- NQEEYARFDSDVGEYR (SEQ ID NO: 9) or
- NREEYARFDSDVGVYR (SEQ ID NO: 10).
- the term "culture medium” refers to any medium capable of supporting the growth and the differentiation of T cells into regulatory T cells. Typically, it consists of a base medium containing nutrients (a source of carbon, aminoacids), a pH buffer and salts, which can be supplemented with growth factors and/or antibiotics. Typically, the base medium can be RPMI 1640, DMEM, IMDM, X-VIVO or AIM-V medium, all of which are commercially available standard media.
- CDM chemically defined medium
- CDM chemically defined medium
- a chemically defined medium is a serum- free and feeder- free medium.
- the step of culturing a population of CD8 + Tregs with the peptide of the invention in the presence of a population of pDCs shall be carried out for the necessary time required for the presentation of said peptide by the pDCs to the CD8 + Tregs.
- the culture of a population of CD8 + Tregs with the peptide of the invention in the presence of a population of pDCs shall be carried from 1 day to 1 week or more.
- the method may comprise an additional step of isolating the population of regulatory T cells thus generated.
- the invention relates to an in vitro or ex vivo method for generating a population of Tregs, comprising a step of culturing a population of Tregs with a culture medium comprising a MHC/peptide multimer of the invention as defined above.
- the invention relates to an in vitro or ex vivo method for generating a population of CD8 + CD45RC low Tregs, comprising a step of culturing a population of CD8 + Tregs with a culture medium comprising a MHC/peptide multimer of the invention as defined above.
- the multimer is coated on a nanoparticle.
- the nanoparticle displays at its surface the MHC/peptide multimer according to the invention.
- the nanoparticles are of small size, small enough to be recognized by Tregs.
- the nanoparticles have a core with a mean diameter between 0.5 and 10 nm, more preferably between 1 and 2.5 nm.
- the core of the nanoparticle may be a polymeric core.
- the nanoparticle comprises polymers are selected from the group consisting of carbohydrate-based polymers (e.g., cellulose-based nanoparticles, chitosan-based nanoparticles), polyethylene glycol (PEG), polypropylene glycol (PPG), and copolymers of PEG and PPG, branched copolymers containing PEG and caprolactone, PEG and lactide, and PEG and [lactide-co-glycolide].
- carbohydrate-based polymers e.g., cellulose-based nanoparticles, chitosan-based nanoparticles
- PEG polyethylene glycol
- PPG polypropylene glycol
- copolymers of PEG and PPG branched copolymers containing PEG and caprolactone, PEG and lactide, and PEG and [lactide-co-glycolide.
- the core of the nanoparticle may also be a metallic core.
- the metallic core comprises Au, Ag or Cu, for example an alloy selected from Au/Ag, Au/Cu, Au/Ag/Cu, Au/Pt, Au/Pd, Au/Ag/Cu/Pd, Au/Fe, Au/Cu, Au/Gd, Au/Fe/Cu, Au/Fe/Gd or Au/Fe/Cu/Gd.
- the nanoparticles are soluble in most organic solvents and especially water.
- Nanoparticles can be prepared according to techniques well-known in the art.
- the invention relates to an in vitro or ex vivo method for generating a population of CD8 + CD45RC low Tregs, comprising a step of culturing a population of CD8 + Tregs with a culture medium comprising nanoparticles coated with a MHC/peptide multimer of the invention as defined above.
- the invention relates to a population of Tregs, more particularly a population of CD8 + CD45RC low Tregs, obtained by any one of the methods as previously described.
- compositions comprising: a) an isolated peptide of length ranging between 15 and 40 amino acids which is derived from a MHC class II moleculethat comprises the amino acid sequence: REEYARFDSDVGEYR (SEQ ID NO: 1) or a function-conservative variant thereof; or
- an antigen-presenting cell comprising a complex MHC molecule and a peptide of the invention
- said peptide consists of the amino acid sequence: RLLARLIYNREEYARFDSDVGEYRAVTELGRPSAEYRNKQ (SEQ ID NO: 28) or a function-conservative variant thereof.
- said pharmaceutical composition comprises an isolated peptide of 15 or 16 amino acids long that comprises or consists of the amino acid sequence: REEYARFDSDVGEYR (SEQ ID NO: 1) or a function-conservative variant thereof
- said pharmaceutical composition comprises an isolated peptide selected from the group consisting of:
- NREEYARFDSDVGEFR (SEQ ID NO: 7);
- NQEEYARFDSDVGEYR (SEQ ID NO: 9) or
- NREEYARFDSDVGVYR (SEQ ID NO: 10).
- Any therapeutic agent of the invention as above described may be combined with pharmaceutically acceptable excipients, and optionally sustained-release matrices, such as biodegradable polymers, to form therapeutic compositions.
- “Pharmaceutically” or “pharmaceutically acceptable” refers to molecular entities and compositions that do not produce an adverse, allergic or other untoward reaction when administered to a mammal, especially a human, as appropriate.
- a pharmaceutically acceptable carrier or excipient refers to a non-toxic solid, semi-solid or liquid filler, diluent, encapsulating material or formulation auxiliary of any type.
- compositions for example, the route of administration, the dosage and the regimen naturally depend upon the condition to be treated, the severity of the illness, the age, weight, and sex of the patient, etc.
- compositions of the invention can be formulated for a topical, oral, intranasal, intraocular, intravenous, intramuscular or subcutaneous administration.
- the pharmaceutical compositions contain vehicles which are pharmaceutically acceptable for a formulation capable of being injected.
- vehicles which are pharmaceutically acceptable for a formulation capable of being injected.
- These may be in particular isotonic, sterile, saline solutions (monosodium or disodium phosphate, sodium, potassium, calcium or magnesium chloride and the like or mixtures of such salts), or dry, especially freeze-dried compositions which upon addition, depending on the case, of sterilized water or physiological saline, permit the constitution of injectable solutions.
- the doses used for the administration can be adapted as a function of various parameters, and in particular as a function of the mode of administration used, of the relevant pathology, or alternatively of the desired duration of treatment.
- the daily dosage of the products may be varied over a wide range from 0.01 to 1,000 mg per adult per day.
- the compositions contain 0.01, 0.05, 0.1, 0.5, 1.0, 2.5, 5.0, 10.0, 15.0, 25.0, 50.0, 100, 250 and 500 mg of the active ingredient for the symptomatic adjustment of the dosage to the subject to be treated.
- a medicament typically contains from about 0.01 mg to about 500 mg of the active ingredient, preferably from 1 mg to about 100 mg of the active ingredient.
- An effective amount of the drug is ordinarily supplied at a dosage level from 0.0002 mg/kg to about 20 mg/kg of body weight per day, especially from about 0.001 mg/kg to 7 mg/kg of body weight per day.
- an effective amount of a polypeptide or a nucleic acid according to the invention may be dissolved or dispersed in a pharmaceutically acceptable carrier or aqueous medium.
- the pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions; formulations including sesame oil, peanut oil or aqueous propylene glycol; and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions.
- the form must be sterile and must be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms, such as bacteria and fungi.
- Solutions of the active compounds as free base or pharmacologically acceptable salts can be prepared in water suitably mixed with a surfactant, such as hydroxypropylcellulose. Dispersions can also be prepared in glycerol, liquid polyethylene glycols, mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.
- the peptides according to the invention and other therapeutic agent of the invention can be formulated into a composition in a neutral or salt form.
- Pharmaceutically acceptable salts include the acid addition salts (formed with the free amino groups of the protein) and which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric, mandelic, and the like. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, histidine, procaine and the like.
- the carrier can also be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetables oils.
- the proper fluidity can be maintained, for example, by the use of a coating, such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- the prevention of the action of microorganisms can be brought about by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like.
- isotonic agents for example, sugars or sodium chloride.
- Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminium monostearate and gelatin.
- Sterile injectable solutions are prepared by incorporating the active compounds in the required amount in the appropriate solvent with several of the other ingredients enumerated above, as required, followed by filtered sterilization.
- dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above.
- the preferred methods of preparation are vacuum-drying and freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile- filtered solution thereof.
- solutions Upon formulation, solutions will be administered in a manner compatible with the dosage formulation and in such amount as is therapeutically effective.
- the formulations are easily administered in a variety of dosage forms, such as the type of injectable solutions described above, but drug release capsules and the like can also be employed.
- the solution may be suitably buffered and the liquid diluent first rendered isotonic with sufficient saline or glucose.
- aqueous solutions are especially suitable for intravenous, intramuscular, subcutaneous and intraperitoneal administration.
- sterile aqueous media which can be employed will be known to those of skill in the art in light of the present disclosure.
- one dosage could be dissolved in 1 ml of isotonic NaCl solution and either added to 1000 ml of hypodermoclysis fluid or injected at the proposed site of infusion, (see for example, "Remington's Pharmaceutical Sciences” 15th Edition, pages 1035-1038 and 1570-1580).
- dosage will necessarily occur depending on the condition of the subject being treated.
- the person responsible for administration will, in any event, determine the appropriate dose for the individual subject.
- other pharmaceutically acceptable forms include, e.g. tablets or other solids for oral administration; time release capsules; and any other form currently used.
- the invention provides methods and compositions (such as pharmaceutical compositions) for use in inducing immune tolerance in a patient in need thereof.
- the invention also provides methods and compositions for use in preventing or reducing transplant rejection in a patient in need thereof.
- the invention relates to an isolated peptide of length ranging between 15 and 40 amino acids which is derived from a MHC class II molecule that comprises the amino acid sequence: REEYARFDSDVGEYR (SEQ ID NO: 1) (also called herein 51-18) or a function-conservative variant thereof as defined above for use as drug.
- said peptide consists of the amino acid sequence: RLLARLIYNREEYARFDSDVGEYRAVTELGRPSAEYRNKQ (SEQ ID NO: 28) or a function-conservative variant thereof.
- said peptide is an isolated peptide of 15 or 16 amino acids long that comprises or consists of the amino acid sequence: REEYARFDSDVGEYR (SEQ ID NO: 1) or a function-conservative variant.
- the invention relates to an isolated peptide of length ranging between 15 and 40 amino acids which is derived from a MHC class II molecule that comprises the amino acid sequence: REEYARFDSDVGEYR (SEQ ID NO: 1) (also called herein 51-18) or a function-conservative variant thereof as defined above for use in inducing immune tolerance in a patient in need thereof.
- said peptide consists of the amino acid sequence: RLLARLIYNREEYARFDSDVGEYRAVTELGRPSAEYRNKQ (SEQ ID NO: 28) or a function-conservative variant thereof.
- said peptide is an isolated peptide of 15 or 16 amino acids long that comprises or consists of the amino acid sequence: REEYARFDSDVGEYR (SEQ ID NO: 1) or a function-conservative variant for use in inducing immune tolerance in a patient in need thereof.
- immune tolerance refers to a state of unresponsiveness of the immune system to substances or tissues that have the capacity to elicit an immune response.
- Peptides of the invention are useful for achieving tolerance or partial tolerance against the transplant upon transplantation of said transplant.
- a "partial tolerance” is a partial immune tolerance results in a reduced immune response.
- immune response includes T cell mediated and/or B cell mediated immune responses.
- exemplary immune responses include T cell responses, e.g., cytokine production and cellular cytotoxicity
- immune response includes immune responses that are indirectly effected by T cell activation, e.g., antibody production (humoral responses) and activation of cytokine responsive cells, e.g., macrophages.
- Immune cells involved in the immune response include lymphocytes, such as B cells and T cells (CD4 + , CD8 + , Thl and Th2 cells); antigen presenting cells (e.g. professional antigen presenting cells such as dendritic cells); natural killer cells; myeloid cells, such as macrophages, eosinophils, mast cells, basophils, and granulocytes.
- immune responses are involved in transplant rejection, as well as in the concomitant physiological result of such immune responses, such as for example, interstitial fibrosis, chronic graft arteriosclerosis, or vasculitis.
- treated patients with a peptide of the invention in comparison with untreated patients, display the following physiological features: a) a decreased level of an immune response against the transplant (thought to be mediated at least in part by B cell mediated immune responses, more particularly donor-specific antibodies); b) a delay in the onset or progression of a immune response against the transplant; or c) a reduced risk of the onset or progression of an immune response against the transplant.
- patient in need thereof is meant an individual suffering from or susceptible of suffering from transplant rejection to be treated.
- the individuals to be treated in the frame of the invention are mammals, preferably human beings.
- the invention relates to an isolated peptide of length ranging between 15 and 40 amino acids which is derived from a MHC class II molecule that comprises the amino acid sequence: REEYARFDSDVGEYR (SEQ ID NO: 1) (also called herein 51-18) or a function-conservative variant thereof as defined above for use in preventing or reducing transplant rejection in a patient in need thereof.
- said peptide consists of the amino acid sequence: RLLARLIYNREEYARFDSDVGEYRAVTELGRPSAEYRNKQ (SEQ ID NO: 28) or a function-conservative variant thereof.
- said peptide is an isolated peptide of 15 or 16 amino acids long that comprises or consists of the amino acid sequence: REEYARFDSDVGEYR (SEQ ID NO: 1) or a function-conservative variant.
- the term "preventing or reducing transplant rejection” is meant to encompass prevention or inhibition of immune transplant rejection, as well as delaying the onset or the progression of immune transplant rejection.
- the term is also meant to encompass prolonging survival of a transplant in a patient, or reversing failure of a transplant in a patient.
- the term is meant to encompass ameliorating a symptom of an immune transplant rejection, including, for example, ameliorating an immunological complication associated with immune rejection, such as for example, interstitial fibrosis, chronic graft arteriosclerosis, or vasculitis.
- transplant rejection encompasses both acute and chronic transplant rejection.
- Acute rejection is the rejection by the immune system of a tissue transplant recipient when the transplanted tissue is immunologically foreign. Acute rejection is characterized by infiltration of the transplant tissue by immune cells of the recipient, which carry out their effector function and destroy the transplant tissue. The onset of acute rejection is rapid and generally occurs in humans within a few weeks after transplant surgery. Generally, acute rejection can be inhibited or suppressed with immunosuppressive drugs such as rapamycin, cyclosporin and the like. “Chronic rejection” generally occurs in humans within several months to years after engraftment, even in the presence of successful immunosuppression of acute rejection. Fibrosis is a common factor in chronic rejection of all types of organ transplants.
- transplantation refers to the insertion of a transplant (also called graft) into a recipient, whether the transplantation is syngeneic (where the donor and recipient are genetically identical), allogeneic (where the donor and recipient are of different genetic origins but of the same species), or xenogeneic (where the donor and recipient are from different species).
- the host is human and the graft is an isograft, derived from a human of the same or different genetic origins.
- the graft is derived from a species different from that into which it is transplanted, including animals from phylogenically widely separated species, for example, a baboon heart being transplanted into a human host.
- the donor of the transplant is a human.
- the donor of the transplant can be a living donor or a deceased donor, namely a cadaveric donor.
- the transplant is an organ, a tissue or cells.
- organ refers to a solid vascularized organ that performs a specific function or group of functions within an organism.
- the term organ includes, but is not limited to, heart, lung, kidney, liver, pancreas, skin, uterus, bone, cartilage, small or large bowel, bladder, brain, breast, blood vessels, esophagus, fallopian tube, gallbladder, ovaries, pancreas, prostate, placenta, spinal cord, limb including upper and lower, spleen, stomach, testes, thymus, thyroid, trachea, ureter, urethra, uterus.
- tissue refers to any type of tissue in human or animals, and includes, but is not limited to, vascular tissue, skin tissue, hepatic tissue, pancreatic tissue, neural tissue, urogenital tissue, gastrointestinal tissue, skeletal tissue including bone and cartilage, adipose tissue, connective tissue including tendons and ligaments, amniotic tissue, chorionic tissue, dura, pericardia, muscle tissue, glandular tissue, facial tissue, ophthalmic tissue. a particular embodiment of the invention, the transplant is a cardiac allotransplant.
- the term "cells" refers to a composition enriched for cells of interest, preferably a composition comprising at least 30%, preferably at least 50%, even more preferably at least 65 % of said cells.
- the cells are selected from the group consisting of multipotent hematopoietic stem cells derived from bone marrow, peripheral blood, or umbilical cord blood; or pluripotent (i.e. embryonic stem cells (ES) or induced pluripotent stem cells (iPS)) or multipotent stem cell-derived differentiated cells of different cell lineages such as cardiomyocytes, beta-pancreatic cells, hepatocytes, neurons, etc...
- pluripotent i.e. embryonic stem cells (ES) or induced pluripotent stem cells (iPS)
- multipotent stem cell-derived differentiated cells of different cell lineages such as cardiomyocytes, beta-pancreatic cells, hepatocytes, neurons, etc...
- the cell composition is used for allogeneic hematopoietic stem cell transplantation (HSCT) and thus comprises multipotent hematopoietic stem cells, usually derived from bone marrow, peripheral blood, or umbilical cord blood.
- HSCT allogeneic hematopoietic stem cell transplantation
- HSCT can be curative for patients with leukemia and lymphomas. Howerver, an important limitation of allogeneic HCT is the development of graft versus host disease (GVHD), which occurs in a severe form in about 30-50% of humans who receive this therapy.
- GVHD graft versus host disease
- Peptides of the invention are useful in inducing immune tolerance and thus in preventing or reducing Graft-versus-Host-Disease (GvHD).
- GvHD Graft-versus-Host-Disease
- the patient in need thereof is affected with a disease selected from the group consisting of acute myeloid leukemia (AML); acute lymphoid leukemia (ALL); chronic myeloid leukemia (CML); myelodysplasia syndrome (MDS) / myeloproliferative syndrome; lymphomas such as Hodgkin and non-Hodgkin lymphomas, chronic lymphatic leukemia (CLL) and multiple myeloma.
- AML acute myeloid leukemia
- ALL acute lymphoid leukemia
- CML chronic myeloid leukemia
- MDS myelodysplasia syndrome
- lymphomas such as Hodgkin and non-Hodgkin lymphomas, chronic lymphatic leukemia (CLL) and multiple myeloma.
- the invention relates to
- an antigen-presenting cell comprising a complex MHC molecule and a peptide of the invention; or f) a T lymphocyte that recognizes specifically the peptide of the invention; for use in inducing immune tolerance in a patient in need thereof.
- the invention relates to
- an antigen-presenting cell comprising a complex MHC molecule and a peptide of the invention
- a T lymphocyte that recognizes specifically the peptide of the invention; for use in preventing or reducing transplant rejection in a patient in need thereof.
- Another aspect of the invention relates to a method for inducing immune tolerance in a patient in need thereof, comprising a step of administering to said patient a prophylactically effective amount of an isolated peptide of the invention as described above, or a nucleic acid of the invention, or an expression vector of the invention, or a host cell of the invention, or a MHC/peptide multimer of the invention, or a T lymphocyte that recognizes specifically the peptide of the invention.
- Another aspect of the invention relates to a method for preventing or reducing transplant rejection in a patient in need thereof, comprising a step of administering to said patient a prophylactically effective amount of an isolated peptide of the invention as described above, or a nucleic acid of the invention, or an expression vector of the invention, or a host cell of the invention, a MHC/peptide multimer of the invention or a T lymphocyte that recognizes specifically the peptide of the invention.
- prophylactically effective amount is intended for a minimal amount of active agent, which is necessary to prevent, reduce, alleviate or delay) transplant rejection in a patient.
- the invention relates to an in vitro method for determining whether a transplanted patient (recipient) is tolerant, comprising a step of determining the presence of CD8+CD45RC low Tregs in a biological sample obtained from said transplanted patient, wherein the presence of CD8+CD45RC low Tregs is indicative of tolerance.
- determining includes qualitative and/or quantitative detection (i.e. detecting and/or measuring the amount) with or without reference to a control or a predetermined value.
- detecting means determining if CD8+CD45RC low Tregs are present or not in a biological sample and “measuring” means determining the amount of CD8+CD45RC low Tregs in a biological sample.
- biological sample has its general meaning in the art and refers to any sample which may be obtained from a patient for the purpose of in vitro evaluation.
- a preferred biological sample is a blood sample (e.g. whole blood sample, serum sample, or plasma sample).
- the determination of the presence of CD8+CD45RC low Tregs may comprise a step of contacting the biological sample with selective reagents such as antibodies, and thereby detecting the presence, or measuring the amount, of cells of interest originally in said biological sample. Contacting may be performed in any suitable device, such as a plate, microtiter dish, test tube, well, glass, column, and so forth.
- the methods according to the invention comprise a step of contacting the biological sample with a binding partner capable of selectively interacting with CD8+CD45RC l0W Tregs in said biological sample.
- the binding partner is a MHC/peptide multimer comprising a peptide of the invention as described here above.
- the MHC/peptide multimer is a MHC/peptide tetramer comprising a peptide selected from the group consisting of:
- REEYARFDSDVGEFR SEQ ID NO: 3
- REEYVRFDSDVGEYR SEQ ID NO: 4
- NQEEYARFDSDVGEYR (SEQ ID NO: 9) or
- NREEYARFDSDVGVYR (SEQ ID NO: 10).
- the patient is a mammal, preferably a human being.
- FIGURES
- FIG. 1 Analysis of CD8 + CD45RC
- CD8 + Tregs were cocultured for 6 days with syngeneic CpG-matured pDCs in the presence of peptides.
- Mean value 1 is equal to 32.85 ⁇ 1.98%.
- Results are expressed as the ratio ⁇ SEM between the percentage of CD25 positive cells after peptide stimulation and percentage of CD25 positive cells in the control condition without peptide. *p ⁇ 0.05, **p ⁇ 0.01 and ***p ⁇ 0.001 versus control condition (value 1.0).
- n 4 to 18 for each peptide.
- Figure 2 In vitro and in vivo suppressive potential of Du51-specific CD40IgCD8 + Tregs.
- A The proliferation of naive CFSE-labeled LEW.IA CD4 CD25 T cells stimulated with either donor LEW.1W (direct pathway) or alloantigens-loaded recipient LEW.IA (indirect pathway) pDCs was analyzed after 6 days of culture, in the absence or presence of LEW.IA naive, total, tetramer " or tetramer + CD8 + CD40Ig Tregs at a 1 : 1 effector:suppressor ratio.
- the CD4 + CD25 " T cell proliferation alone was ⁇ 80% and was given the value 100 in each experiment.
- Figure 3 Tolerance induction after in vivo peptide Du51 infusion.
- A Recipient
- Results are plotted into graphs for percentage of tetramer + cells among CD8 + Tregs and absolute number of tetramer + CD8 + Tregs in spleen ⁇ SEM.
- Figure 4 Splenocyte-mediated transfer of tolerance following Du51 peptide monotherapy.
- LEW.1A recipients were sublethally irradiated (4.5 Gy) at day -1 and received heart allografts and i.v. injections of 1,5.10 8 splenocytes from long surviving recipient or naive animals at day 0. Graft survival was monitored by abdominal palpation.
- AdCD40Ig human IgGl
- Ad recombinant non-coding adenovirus
- Peptides libraries 16-mer overlapping peptide libraries with 4 aa lagging were designed to cover the entire polymorphic sequences of MHC-I RT1.A" (alpha 1, 2 and 3 domains), MHC-II RT1.B" (all domains) and MHC-II RT1.D” (alpha2 and betal domains) as previously published (17-19) and manufactured by GL Biochem Ltd (Shangai, China). Lyophilized peptides were dissolved in 0.4% sterile DMSO / sterile water and stored at -80°C. As control peptides, we used in vitro various allogeneic non activating peptides #7, 26 and 39 and in vivo, we used peptide #31.
- total splenocytes were depleted with a cocktail of anti- ⁇ T cells (V65), anti-CD45RA cells (0X33), anti-CD161 NK cells (3.2.3) and anti-CD l lb/c monocytes (0X42) using magnetic beads (Dynal).
- Enriched T cells were labeled with anti-CD45RC-biotin (0X22) and Strepavidin-PE-Cy7, anti-CD8a-PE (0X8), anti-TCRap-Alexa 647 (R73) and anti-CD25- FITC (0X39) mAbs.
- CD8 + CD45RC low T cells and CD4 CD25 T cells were sorted after gating of TCRa,p + cells with FACSAria (BD Biosciences, Mountain View, CA). Purity of sorted populations was greater than 99%.
- Plasmacytoid dendritic cells were purified as previously described (6). Briefly, splenocytes recovered after collagenase digestion were further purified by negative depletion with anti-TCR (R73 and V65) T cells and anti-CD45RA (0X33) B cells mAbs. Enriched cells were labeled with anti-CD45R-PE (His24), anti-CD4-APC (0X35), anti-TCR-FITC (R73) and anti-CD45RA-FITC (0X33). pDCs, defined as CD45R and CD4 positive cells, were sorted after gating on FITC negative cells.
- LEW.IA origin (5x 10 4 cells) and allogeneic pDCs isolated from donor LEW.1W animals (1.25 ⁇ 10 4 cells) were plated in triplicate for 6 days in a final volume of 200 ⁇ 1 of completed RPMI-1640 medium in round-bottom 96 wells plates with FACS-sorted freshly purified naive CD8 + CD45RC l0W Treg cells, peptide-expanded CD8 + CD40Ig Treg cells (5x l0 4 cells), Du51 tetramer + or ⁇ CD8 + CD40Ig Tregs.
- splenocytes isolated from donor LEW.1W animals were frozen-thawed to induce apoptosis.
- Apoptotic cells were then cultured overnight with pDCs isolated from recipient LEW.IA animals (8: 1 ratio) at 0.65x l0 6 pDCs/mL. Alloantigens-loaded pDCs were finally washed and plated as described before for the direct MLR.
- pDCs isolated from recipient LEW.IA animals (8: 1 ratio) at 0.65x l0 6 pDCs/mL. Alloantigens-loaded pDCs were finally washed and plated as described before for the direct MLR.
- round-bottom 96 wells plates were coated with anti-CD3 (1 ⁇ g/mL, BD Pharmingen) and anti-CD28 (10 ⁇ g/mL) mAbs for 1 hour at 37°C, 5% C02, then washed and 5.10 4 CD8 + CD40Ig Treg cells were added to each well in 200 ⁇ 1 completed RPMI-1640 for 1, 2, 3 and 6 days.
- CD8 + CD45RC l0W Tregs were analyzed by flow cytometry on a FACSCanto II cytometer (BD Biosciences, Mountain View, CA) after gating on TCR + CD4 + cells or TCR + CD8 + cells among live cells (DAPI negative).
- Extracellular and intracellular staining For extracellular staining, cells were stained with the following mAbs: anti-TCRaP (R73, Alexa Fluor 647-conjugated), anti-CD8a (0X8, PE-Cy7-conjugated, ebiosciences), anti-CD4 (W3.25, PE-Cy7-conjugated), anti- CD45RC (0X22, FITC-conjugated), anti-CD28 (JJ319, biotin- labeled), anti-CD71 (0X26, biotin-labeled), anti-mouse Vbl l (KT11, biotin-labeled, AbD Serotec) anti-CD25 (0X39, biotin-labeled) and anti-MHC-II (0X6, biotin-labeled).
- anti-TCRaP R73, Alexa Fluor 647-conjugated
- anti-CD8a (0X8, PE-Cy7-conjugated, ebioscience
- RT1-A a 2m and peptide Du51 were refolded in 0,4M L-arginine, 0,1M Tris pH8, 2mM EDTA, 5mM reduced glutathione, and 0,5mM oxydated glutathione for 5 days at 4°C.
- the solution was then concentrated and the buffer changed on amicon membrane 10 Kd (Millipore, Bedford, MA).
- Folded MHC/peptide complexes were biotinylated with the BirA enzyme (Avidity, Denvers CO) for 5h at 30°C and desalted on Hiprep 26/10 desalting column (GE Healthcare).
- MHC/peptide complexes were then purified by anion exchange Q- Sepharose chromatography. Biotinylation was tested by tetramerization with streptavidin (Sigma Aldrich) at a molar ratio of 4: 1.
- Tetramerization and staining Tetramerization of RTl .A7Du51 was performed at room temperature by addition of streptavidin-PE (Jackson ImmunoResearch) or streptavidin- APC (BD Biosciences) at a 4: l-molar ratio, in four equal aliquots added at 15-min intervals.
- streptavidin-PE Jackson ImmunoResearch
- streptavidin- APC streptavidin- APC
- Cells were further stained for CD8 and CD45RC and fluorescence was analyzed on a FACSCanto II cytometer (BD Biosciences, Mountain View, CA). Cells were first gated by their morphology and dead cells excluded by selecting DAPI negative cells.
- Peptides treatment in vivo 16-mer peptides were dissolved in 0.4% DMSO/PBS before injection.
- first protocol single doses of peptide (500 ⁇ g/injection) were injected i.v at different time points before and after transplantation at day -6, -3, 0 +3 and +7 into grafted LEW.IA recipients.
- mini osmotic pumps AZET, Cupertino, CA, USA
- a first pump was implanted on day -7 before transplantation and was replaced by a second one at day +7, allowing delivery of 14 or 28 mg of peptide per animal for 28 consecutive days.
- a depleting anti-CD8a mAb (OX8, IgGl, 3 mg/kg) or an anti-MHC class la and lb mAb (OX18, 3 mg/kg) were injected i.p. twice a week from day -7 until rejection. Allografts were monitored daily by palpation and allograft rejection was defined as complete cessation of palpable heart beat.
- Adoptive cell transfer Cell transfers were performed by i.v. injection of purified sorted total or Du51 tetramer " CD8 + CD40Ig Tregs into LEW. IA recipients sublethally irradiated (4.5 Gy whole-body irradiation) on the day before transplantation. Total splenocytes (1,5.10 8 cells) were adoptively transferred i.v. the day before heart transplantation into naive LEW-1A recipients that had received 4.5 Gy of whole-body irradiation the same day.
- CD8 + CD40Ig Tregs activation in vitro In order to identify TCR recognition of allogeneic MHC/peptide complexes by CD8 + CD40Ig Tregs and subsequent activation of their function, we had to select a specific marker of activation allowing analysis by flow cytometry following exposure to antigenic stimulation. Therefore, we screened molecules expressed at different time points by CD8 + CD40Ig Tregs upon stimulation with polyclonal anti-CD3 and anti-CD28 antibodies. Expression of molecules on freshly isolated CD8 + CD40Ig Tregs has been previously assessed by Q RT-PCR (5) and demonstrated that among these molecules, CD25 and IFNy were markers distinguishing CD8 + CD40Ig Tregs from other cell populations. We analyzed by flow cytometry at day 0, 1, 2, 3 and 6 their expression of CD71, CD25 and IFNy.
- CD71, CD25 and IFNy expression increased significantly from the first day and remained stable over time with respectively 82 ⁇ 4.5%, 98.1 ⁇ 1.9% and 91.7 ⁇ 7% of positive cells at day 6.
- CD25 was the most and the earliest up-regulated marker and since it was a marker previously described by us and others (5, 12), we selected this marker to assess CD8 + CD40Ig Treg activation for the remaining aspects of this study.
- CD8 + CD40Ig Tregs cells recognized two donor MHC class II-derived peptides.
- donors RT1 U
- recipients RTl a
- donor and recipient MHC I and II amino acids aa
- Peptides were first grouped into pools of 6 to 8 peptides (30 ⁇ g/ml of each peptide) and tested in an in vitro assay where immature or mature syngeneic recipient pDCs and sorted-CD8 + CD40Ig Tregs from CD40Ig-treated long-term allograft bearing recipients were cocultured for 3 or 6 days.
- Du51 induced a stronger upregulation of CD25 expression compared to Bu31 , suggesting that Du51 is the dominant peptide recognized by CD8 + CD40Ig Tregs, while Bu31 is sub-dominant.
- antigen-specific CD8 + CD40Ig Tregs mainly recognized two peptides, Bu31 (YLRYDSDVGEYRAVTE) and Du51 (NREEYARFDSDVGEYR), derived respectively from the ⁇ chain of donor MHC class II RT1.B" and RT1.D" molecules.
- CD8 + CD40Ig Tregs recognized an unusually long allogeneic 15-mer peptide.
- Du51-activated CD8 + CD40Ig Treg cells displayed a modified phenotype and efficiently suppressed antigen-specific activated T cells.
- CD8 + CD40Ig Tregs The phenotype of Du51 -activated CD8 + CD40Ig Tregs was analyzed 6 days after stimulation.
- CD8 + CD40Ig Tregs acted through secretion of high levels of IFNy, that in turn induced IDO expression by DCs and graft ECs and this action was necessary for tolerance induction in vivo (5).
- stimulation of CD8 + Tregs by the peptide in the presence of pDCs led to significant increased expression of IFNy, most likely by activated CD8 + CD40Ig Tregs.
- CD8 + CD40Ig Tregs in the presence of allogeneic pDCs or syngeneic pDC and a lysate of donor cells, could suppress the proliferation of syngeneic effector CD4 + CD25 ⁇ T cells, showing that CD8 + CD40Ig Tregs acted through the direct and indirect pathway of allorecognition, and that they are more efficient suppressor cells than naive CD8 + CD45RC low Tregs (6).
- Du51 -stimulated CD8 + CD40Ig Tregs could efficiently suppress effector T cell proliferation after 6 days coculture and thus maintained their suppressor activity, compared to CD8 + CD40Ig Tregs stimulated with a non-activating control peptide.
- non peptide-specific cells can be visualized and excluded as they bind to a control tetramer bearing the same heavy chain RTl .A a but with an irrelevant peptide associated.
- Cells were secondary stained with CD8-PeCy7 and CD45RC- FITC to identify either CD8 + CD45RC low Tregs or CD8 + CD45RC high T cells. With such a strategy, we were able to identify 2.19 ⁇ 0.6% in the spleen and 1.16 ⁇ 0.25% in the graft of Du51 -specific cells among CD8 + CD40Ig Tregs.
- naive splenic CD8 + CD45RC low Tregs population we evaluated the precursor frequency at 0.73 ⁇ 0.2%, demonstrating that even 120 days following transplantation and CD40Ig treatment, the frequency was still increased around 3 times and that in naive animals, we were able to identify a pool of donor-specific Tregs. This difference was true when looking at the percentage and absolute number of tetramer-positive CD8 + CD40Ig Tregs or naive CD8 + CD45RC low T cells in the spleen (0.624 ⁇ 0.128 vs. 0.173 ⁇ 0.071 respectively for percentage and 623800 ⁇ 127700 vs. 172600 ⁇ 70500 for absolute number in the spleen, p ⁇ 0.05).
- CD8 + CD45RC l0W Tregs Naive CD8 + CD45RC l0W Tregs, total CD8 + CD40Ig Tregs, RTlA7Du51 tetramer negative (tet " ) and RTlA7Du51 tetramer positive (tet + ) CD8 + CD40Ig Tregs were sorted and incubated for 6 days with allogeneic (direct pathway) or alloantigens-loaded syngeneic pDCs (indirect pathway) and naive CFSE-labeled syngeneic CD4 + CD25 " T cells. In this assay, RTlA7Du51 tetramer-specific CD8 + CD40Ig Tregs were activated by tetramer binding (data not shown and (27)).
- CD8 + CD40Ig Tregs that were depleted in Du51 antigen-specific cells
- CD8 + CD40Ig Tregs were unable to inhibit allograft rejection, demonstrating the crucial role of the antigen- specific CD8 + CD40Ig Tregs in the tolerogenic activity of the total CD8 + CD40Ig Treg pool preventing allograft rejection and promoting the infectious tolerance.
- Tolerance induction by in vivo peptide treatment correlated with increased proportion of CD8 + CD45RC
- Tregs recognize peptides and the role of this recognition is very limited and mostly based on either transgenic mouse models using CD4 + Treg's TCR gene transfer (8, 11) or on murine Qa-1 -restricted CD8 + Tregs involved in autoimmune disease and cancer and whose Qa-1 -peptide repertoire has been described in the last few years (29).
- these studies suggest that antigen- specific Tregs are crucially influencing the outcome of long-term transplantation and contribute to the establishment of tolerance (30).
- CD8 + CD45RC low Tregs through the indirect pathway of presentation, can recognize one dominant allopeptide, named Du51, (and one sub-dominant) derived from the ⁇ domain of natural donor MHC class II molecules. These peptides share 80-90% homology with human HLA class II molecules and thus could be used to detect specific CD8 + Tregs in humans.
- Du51 -specific CD8 + CD45RC low Tregs were enriched in CD40Ig- treated long-term surviving recipients, expressed a biased restricted ⁇ ⁇ chain, displayed a strong suppressive activity ex-vivo and played a crucial role in tolerance induction upon adoptive transfer.
- peptide Du51 was shown to induce prolongation of allograft survival in vivo, inducing donor-specific CD8 + Tregs.
- the rat MHC class I molecule RTl .A a has been known to accommodate particularly long peptides, with key-position residues as Gin, Met or Leu at P2, Phe at P3, Pro at P4 and Arg at the C terminus (21, 22).
- Speir et al has demonstrated previously in a model of maternally transmitted minor histocompatibility antigen (MTF-E) of 13 residues that important anchor residues (in particular arginine at position 13 (PI 3)) allowed binding with considerable bulged conformation (37).
- MTF-E minor histocompatibility antigen
- peptide Du51 was not involved in acute rejection in their model and the two immunodominant peptides identified by ballet et al. were not recognized by our CD8 + CD40Ig Tregs, suggesting that Tregs and non-Tregs did not recognize the same antigens.
- Foxp3 does not seem to be an interesting marker of CD8 + CD40Ig Tregs unstimulated or stimulated with peptide, although upon several rounds of strong anti- CD3/anti-CD28/IL-2 stimulation, we were able to detect substantial levels of Foxp3 (data not shown).
- IFNy was already shown by us as a crucial cytokine in our model (6).
- TCR sequences that are shared between individuals tend to be more efficiently produced by a process of convergent recombination (43) and thus present at a higher frequency in the naive T cell repertoire (44-46).
- inter-individually shared TCR sequences are not necessarily dominant in the immune response to antigen (47). This appears to be the case in our model, suggesting that this process may be modified by either TCR expansion or TCRa-chain pairing.
- More recent publications have revealed the important contribution of the alpha-chain in the specific pMHC recognition and how TCRa- ⁇ diversity should be taken into consideration, as some specific TCR Va pairings dictate and alter MHC restriction (48, 49).
- naive CD8 + Tregs displayed a highly diverse repertoire that was remodeled and biased by expansion of Du51 -specific CD8 + Tregs after transplantation and CD40Ig treatment.
- CD40Ig treatment results in allograft acceptance mediated by CD8CD45RC T cells, IFN-gamma, and indoleamine 2,3- dioxygenase. J Clin Invest 117: 1096-1106.
- CD4+CD25+Foxp3+ regulatory T lymphocytes Nat Med 14:88-92.
- Ettinger R.A., Moustakas, A.K., and Lobaton, S.D. 2004. Open reading frame sequencing and structure-based alignment of polypeptides encoded by RTl-Bb, RT1- Ba, RTl-Db, and RTl-Da alleles. Immunogenetics 56:585-596.
- the rat cim effect TAP allele-dependent changes in a class I MHC anchor motif and evidence against C-terminal trimming of peptides in the ER.
- IL-10 is required for regulatory T cells to mediate tolerance to alloantigens in vivo. J Immunol 166:3789-3796.
- Synthetic MHC class I peptide prolongs cardiac survival and attenuates transplant arteriosclerosis in the Lewis ⁇ >Fischer 344 model of chronic allograft rejection. Transplantation 64 : 14- 19.
- CD45RC isoform expression identifies functionally distinct T cell subsets differentially distributed between healthy individuals and AAV patients. PLoS One 4:e5287.
- HLA-A2-peptide complexes refolding and crystallization of molecules expressed in Escherichia coli and complexed with single antigenic peptides. Proc Natl Acad Sci USA 89:3429-3433. 62. Venturi, V., Kedzierska, K., Turner, S.J., Doherty, P.C., and Davenport, M.P. 2007.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Biomedical Technology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Cell Biology (AREA)
- Zoology (AREA)
- Epidemiology (AREA)
- Genetics & Genomics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Hematology (AREA)
- Biotechnology (AREA)
- Biochemistry (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Microbiology (AREA)
- Wood Science & Technology (AREA)
- Urology & Nephrology (AREA)
- Gastroenterology & Hepatology (AREA)
- Transplantation (AREA)
- Pharmacology & Pharmacy (AREA)
- General Engineering & Computer Science (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Toxicology (AREA)
- Food Science & Technology (AREA)
- Mycology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Virology (AREA)
- Pathology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
Priority Applications (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US15/300,896 US10105425B2 (en) | 2014-04-01 | 2015-04-01 | Isolated donor MHC-derived peptide and uses thereof |
| JP2016559818A JP2017515795A (ja) | 2014-04-01 | 2015-04-01 | 単離されたドナーmhc由来ペプチド及びその使用 |
| ES15713503T ES2749073T3 (es) | 2014-04-01 | 2015-04-01 | Un péptido donante aislado derivado de MHC y su uso |
| EP15713503.9A EP3126377B1 (en) | 2014-04-01 | 2015-04-01 | An isolated donor mhc-derived peptide and uses thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP14163081 | 2014-04-01 | ||
| EP14163081.4 | 2014-04-01 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2015150491A1 true WO2015150491A1 (en) | 2015-10-08 |
Family
ID=50390011
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2015/057257 Ceased WO2015150491A1 (en) | 2014-04-01 | 2015-04-01 | An isolated donor mhc-derived peptide and uses thereof |
Country Status (5)
| Country | Link |
|---|---|
| US (1) | US10105425B2 (https=) |
| EP (1) | EP3126377B1 (https=) |
| JP (2) | JP2017515795A (https=) |
| ES (1) | ES2749073T3 (https=) |
| WO (1) | WO2015150491A1 (https=) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2019519197A (ja) * | 2016-04-06 | 2019-07-11 | イマティクス バイオテクノロジーズ ゲーエムベーハー | Amlおよびその他のがんに対する免疫療法において使用するための新規ペプチドおよびペプチドの組み合わせ |
| WO2020120786A1 (en) * | 2018-12-14 | 2020-06-18 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Isolated mhc-derived human peptides and uses thereof for stimulating and activating the suppressive function of cd8+cd45rclow tregs |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2019099788A1 (en) * | 2017-11-16 | 2019-05-23 | Benaroya Sesearch Institute At Virginia Mason | Antigen-specific t regulatory cell assay |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0563485A1 (en) | 1992-03-30 | 1993-10-06 | Schering-Plough | In vitro generation of human dendritic cells and uses thereof |
| WO1993020185A1 (en) | 1992-04-01 | 1993-10-14 | Steinman Ralph M | Method for in vitro proliferation of dendritic cell precursors and their use to produce immunogens |
| WO1996026962A1 (en) | 1995-02-28 | 1996-09-06 | The Board Of Trustees Of The Leland Stanford Junior University | Mhc-antigen complexes for detecting and purifying antigen-specific t cells |
| WO2001018053A1 (fr) | 1999-09-06 | 2001-03-15 | Institut National De La Sante Et De La Recherche Medicale (I.N.S.E.R.M.) | Moyens de detection et de purification de populations lymphocytaires tcd8+, specifiques de peptides presentes dans le contexte hla |
| US20090004213A1 (en) * | 2007-03-26 | 2009-01-01 | Immatics Biotechnologies Gmbh | Combination therapy using active immunotherapy |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1642905B1 (en) * | 2004-10-02 | 2009-01-21 | Immatics Biotechnologies GmbH | Immunogenic T-helper epitopes from human tumour antigens and immunotherapeutic methods using said epitopes |
-
2015
- 2015-04-01 WO PCT/EP2015/057257 patent/WO2015150491A1/en not_active Ceased
- 2015-04-01 JP JP2016559818A patent/JP2017515795A/ja not_active Ceased
- 2015-04-01 EP EP15713503.9A patent/EP3126377B1/en active Active
- 2015-04-01 ES ES15713503T patent/ES2749073T3/es active Active
- 2015-04-01 US US15/300,896 patent/US10105425B2/en not_active Expired - Fee Related
-
2019
- 2019-12-04 JP JP2019219661A patent/JP2020055845A/ja active Pending
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0563485A1 (en) | 1992-03-30 | 1993-10-06 | Schering-Plough | In vitro generation of human dendritic cells and uses thereof |
| WO1993020185A1 (en) | 1992-04-01 | 1993-10-14 | Steinman Ralph M | Method for in vitro proliferation of dendritic cell precursors and their use to produce immunogens |
| WO1996026962A1 (en) | 1995-02-28 | 1996-09-06 | The Board Of Trustees Of The Leland Stanford Junior University | Mhc-antigen complexes for detecting and purifying antigen-specific t cells |
| WO2001018053A1 (fr) | 1999-09-06 | 2001-03-15 | Institut National De La Sante Et De La Recherche Medicale (I.N.S.E.R.M.) | Moyens de detection et de purification de populations lymphocytaires tcd8+, specifiques de peptides presentes dans le contexte hla |
| US20090004213A1 (en) * | 2007-03-26 | 2009-01-01 | Immatics Biotechnologies Gmbh | Combination therapy using active immunotherapy |
Non-Patent Citations (74)
| Title |
|---|
| "A Laboratory Manual", 1990, W.H. FREEMAN C.O. |
| "Remington's Pharmaceutical Sciences 15th Edition,", MACK PUBLISHING, article "pages 1035-1038 and 1570-158" |
| ADEEGBE, D.; MATSUTANI, T.; YANG, J.; ALTMAN, N.H.; MALEK, T.R.: "CD4(+) CD25(+) Foxp3(+) T regulatory cells with limited TCR diversity in control of autoimmunity", J1MMUUØ/, vol. 184, 2010, pages 56 - 66 |
| BALLET C ET AL: "Indirect CD4+ TH1 response, antidonor antibodies and diffuse C4d graft deposits in long-term recipients conditioned by donor antigens priming.", AMERICAN JOURNAL OF TRANSPLANTATION : OFFICIAL JOURNAL OF THE AMERICAN SOCIETY OF TRANSPLANTATION AND THE AMERICAN SOCIETY OF TRANSPLANT SURGEONS APR 2009, vol. 9, no. 4, April 2009 (2009-04-01), pages 697 - 708, XP002729265, ISSN: 1600-6143 * |
| BALLET, C.; RENAUDIN, K.; DEGAUQUE, N.; LE MAI, H.; BOEFFARD, F.; LAIR, D.; BERTHELOT, L.; FENG, C.; SMIT, H.; USAL, C. ET AL.: "Indirect CD4+ TH1 response, anti-donor antibodies and diffuse C4d graft deposits in long term recipients conditioned by donor antigens priming", AM J TRANSPLANT, vol. 9, 2008, pages 697 - 708 |
| BLUESTONE, J.A.; AUCHINCLOSS, H.; NEPOM, G.T.; ROTROSEN, D.; ST CLAIR, E.W.; TURKA, L.A.: "The Immune Tolerance Network at 10 years: tolerance research at the bedside", NAT REV IMMUNOL, vol. 10, 2010, pages 797 - 803 |
| BUELOW, R.; VEYRON, P.; CLAYBERGER, C.; POULETTY, P.; TOURAINE, J.L.: "Prolongation of skin allograft survival in mice following administration of ALLOTRAP", TRANSPLANTATION, vol. 59, 1995, pages 455 - 460 |
| BURROWS, S.R.; ROSSJOHN, J.; MCCLUSKEY, J.: "Have we cut ourselves too short in mapping CTL epitopes?", TRENDS IMMUNOL, vol. 27, 2006, pages 11 - 16 |
| CHATTOPADHYAY, P.K.; MELENHORST, J.J.; LADELL, K.; GOSTICK, E.; SCHEINBERG, P.; BARRETT, A.J.; WOOLDRIDGE, L.; ROEDERER, M.; SEWEL: "Techniques to improve the direct ex vivo detection of low frequency antigen-specific CD8+ T cells with peptide-major histocompatibility complex class I tetramers", CYTOMETRY A, vol. 73, 2008, pages 1001 - 1009 |
| DATABASE Geneseq [online] 18 March 2010 (2010-03-18), "Renal cancer treatment related human peptide sequence, SEQ ID 885.", XP002729266, retrieved from EBI accession no. GSP:AXU79191 Database accession no. AXU79191 * |
| DAY, E.B.; GUILLONNEAU, C.; GRAS, S.; LA GRUTA, N.L.; VIGNALI, D.A.; DOHERTY, P.C.; PURCELL, A.W.; ROSSJOHN, J.; TURNER, S.J.: "Structural basis for enabling T-cell receptor diversity within biased virus-specific CD8+ T-cell responses", PROC NATL ACAD SCI USA, vol. 108, 2011, pages 9536 - 9541 |
| DOUILLARD, P.; PANNETIER, C.; JOSIEN, R.; MENORET, S.; KOURILSKY, P.; SOULILLOU, J.P.; CUTURI, M.C.: "Donor-specific blood transfusion-induced tolerance in adult rats with a dominant TCR-Vbeta rearrangement in heart allografts", J IMMUNOL, vol. 157, 1996, pages 1250 - 1260 |
| EKERUCHE-MAKINDE, J.; MILES, J.J.; VAN DEN BERG, H.A.; SKOWERA, A.; COLE, D.K.; DOLTON, G.; SCHAUENBURG, A.J.; TAN, M.P.; PENTIER,: "Peptide length determines the outcome of TCR/peptide-MHCI engagement", BLOOD, vol. 121, 2013, pages 1112 - 1123 |
| ETTINGER, R.A.; MOUSTAKAS, A.K.; LOBATON, S.D.: "Open reading frame sequencing and structure-based alignment of polypeptides encoded by RTl-Bb, RT1-Ba, RTl-Db, and RT1-Da alleles", IMMUNOGENETICS, vol. 56, 2004, pages 585 - 596 |
| FOHSE, L.; SUFFNER, J.; SUHRE, K.; WAHL, B.; LINDNER, C.; LEE, C.W.; SCHMITZ, S.; HAAS, J.D.; LAMPRECHT, S.; KOENECKE, C. ET AL.: "High TCR diversity ensures optimal function and homeostasis of Foxp3+ regulatory T cells", EUR JIMMUNOL, vol. 41, 2011, pages 3101 - 3113 |
| GARBOCZI, D.N.; HUNG, D.T.; WILEY, D.C.: "HLA-A2-peptide complexes: refolding and crystallization of molecules expressed in Escherichia coli and complexed with single antigenic peptides", PROC NATL ACAD SCI USA, vol. 89, 1992, pages 3429 - 3433 |
| GOKMEN, M.R.; LOMBARDI, G.; LECHLER, R.I.: "The importance of the indirect pathway of allorecognition in clinical transplantation", CURR OPIN IMMUNOL, vol. 20, 2008, pages 568 - 574 |
| GRAS S; KJER-NIELSEN L; BURROWS SR; MCCLUSKEY J; ROSSJOHN J.: "T-cell receptor bias and immunity", CURR OPIN IMMUNOL., vol. 20, no. 1, 2008, pages 119 - 25 |
| GUILLONNEAU, C.; HILL, M.; HUBERT, F.X.; CHIFFOLEAU, E.; HERVE, C.; LI, X.L.; HESLAN, M.; USAL, C.; TESSON, L.; MENORET, S. ET AL.: "CD40Ig treatment results in allograft acceptance mediated by CD8CD45RC T cells, IFN-gamma, and indoleamine 2,3-dioxygenase", J CLIN INVEST, vol. 117, 2007, pages 1096 - 1106 |
| GUILLONNEAU, C.; LOUVET, C.; RENAUDIN, K.; HESLAN, J.M.; HESLAN, M.; TESSON, L.; VIGNES, C.; GUILLOT, C.; CHOI, Y.; TURKA, L.A. ET: "The role of TNF-related activation-induced cytokine-receptor activating NF-kappa B interaction in acute allograft rejection and CD40L-independent chronic allograft rejection", J IMMUNOL, vol. 172, 2004, pages 1619 - 1629 |
| GUILLONNEAU, C.; PICARDA, E.; ANEGON, 1.: "CD8+ regulatory T cells in solid organ transplantation", CURR OPIN ORGAN TRANSPLANT, vol. 15, 2010, pages 751 - 756 |
| GUILLONNEAU, C.; SEVENO, C.; DUGAST, A.S.; LI, X.L.; RENAUDIN, K.; HASPOT, F.; USAL, C.; VEZIERS, J.; ANEGON, I.; VANHOVE, B.: "Anti-CD28 antibodies modify regulatory mechanisms and reinforce tolerance in CD40Ig-treated heart allograft recipients", J IMMUNOL, vol. 179, 2007, pages 8164 - 8171 |
| GUILLOT, C.; GUILLONNEAU, C.; MATHIEU, P.; GERDES, C.A.; MENORET, S.; BRAUDEAU, C.; TESSON, L.; RENAUDIN, K.; CASTRO, M.G.; LOWENS: "Prolonged blockade of CD40-CD40 ligand interactions by gene transfer of CD40Ig results in long-term heart allograft survival and donor-specific hyporesponsiveness, but does not prevent chronic rejection", J1MMUUØ/, vol. 168, 2002, pages 1600 - 1609 |
| HAMANO, K.; RAWSTHORNE, M.A.; BUSHELL, A.R.; MORRIS, P.J.; WOOD, K.J.: "Evidence that the continued presence of the organ graft and not peripheral donor microchimerism is essential for maintenance of tolerance to alloantigen in vivo in anti-CD4 treated recipients", TRANSPLANTATION, vol. 62, 1996, pages 856 - 860 |
| HARA, M.; KINGSLEY, C.I.; NIIMI, M.; READ, S.; TURVEY, S.E.; BUSHELL, A.R.; MORRIS, P.J.; POWRIE, F.; WOOD, K.J.: "IL-10 is required for regulatory T cells to mediate tolerance to alloantigens in vivo", J1MMUUØ/, vol. 166, 2001, pages 3789 - 3796 |
| HARIBHAI, D.; WILLIAMS, J.B.; JIA, S.; NICKERSON, D.; SCHMITT, E.G.; EDWARDS, B.; ZIEGELBAUER, J.; YASSAI, M.; LI, S.H.; RELLAND,: "A requisite role for induced regulatory T cells in tolerance based on expanding antigen receptor diversity", IMMUNITY, vol. 35, 2011, pages 109 - 122 |
| HAYASHI, Y.; TSUKUMO, S.; SHIOTA, H.; KISHIHARA, K.; YASUTOMO, K.: "Antigen-specific T cell repertoire modification of CD4+CD25+ regulatory T cells", J IMMUNOL, vol. 172, 2004, pages 5240 - 5248 |
| HICKMAN, H.D.; LUIS, A.D.; BUCHLI, R.; FEW, S.R.; SATHIAMURTHY, M.; VANGUNDY, R.S.; GIBERSON, C.F.; HILDEBRAND, W.H.: "Toward a definition of self: proteomic evaluation of the class I peptide repertoire", J1MMUUØ/, vol. 172, 2004, pages 2944 - 2952 |
| IYER, S.; WOO, J.; CORNEJO, M.C.; GAO, L.; MCCOUBREY, W.; MAINES, M.; BUELOW, R.: "Characterization and biological significance of immunosuppressive peptide D2702.75-84(E -- V) binding protein. Isolation of heme oxygenase-1", J BIOL CHEM, vol. 273, 1998, pages 2692 - 2697 |
| JIANG, S.; TSANG, J.; GAME, D.S.; STEVENSON, S.; LOMBARDI, G.; LECHLER, R.I: "Generation and expansion of human CD4+ CD25+ regulatory T cells with indirect allospecificity: Potential reagents to promote donor-specific transplantation tolerance", TRANSPLANTATION, vol. 82, 2006, pages 1738 - 1743 |
| JOFFRE, 0.; SANTOLARIA, T.; CALISE, D.; AL SAATI, T.; HUDRISIER, D.; ROMAGNOLI, P.; VAN MEERWIJK, J.P: "Prevention of acute and chronic allograft rejection with CD4+CD25+Foxp3+ regulatory T lymphocytes", NAT MED, vol. 14, 2008, pages 88 - 92 |
| KARIM, M.; FENG, G.; WOOD, K.J.; BUSHELL, A.R.: "CD25+CD4+ regulatory T cells generated by exposure to a model protein antigen prevent allograft rejection: antigen-specific reactivation in vivo is critical for bystander regulation", BLOOD, vol. 105, 2005, pages 4871 - 4877 |
| KIM, H.J.; CANTOR, H.: "Regulation of self-tolerance by Qa-1-restricted CD8(+) regulatory T cells", SEMIN IMMUNOL, vol. 23, 2011, pages 446 - 452 |
| LEAVENWORTH, J.W.; TANG, X.; KIM, H.J.; WANG, X.; CANTOR, H.: "Amelioration of arthritis through mobilization of peptide-specific CD8+ regulatory T cells", J CLIN INVEST, vol. 123, 2013, pages 1382 - 1389 |
| LI, X.L.; MENORET, S.; BEZIE, S.; CARON, L.; CHABANNES, D.; HILL, M.; HALARY, F.; ANGIN, M.; HESLAN, M.; USAL, C. ET AL.: "Mechanism and localization of CD8 regulatory T cells in a heart transplant model of tolerance", JIMMUNOL, vol. 185, 2010, pages 823 - 833 |
| LI, X.L.; MENORET, S.; LE MAUFF, B.; ANGIN, M.; ANEGON, 1.: "Promises and obstacles for the blockade of CD40-CD40L interactions in allotransplantation", TRANSPLANTATION, vol. 86, 2008, pages 10 - 15 |
| LIU, Y.C.; CHEN, Z.; BURROWS, S.R.; PURCELL, A.W.; MCCLUSKEY, J.; ROSSJOHN, J.; GRAS, S.: "The energetic basis underpinning T-cell receptor recognition of a super-bulged peptide bound to a major histocompatibility complex class I molecule", J BIOL CHEM, vol. 287, 2012, pages 12267 - 12276 |
| MASTELLER, E.L.; TANG, Q.; BLUESTONE, J.A.: "Antigen-specific regulatory T cells--ex vivo expansion and therapeutic potential", SEMIN IMMUNOL, vol. 18, 2006, pages 103 - 110 |
| MICHAEL MARIA ET AL: "Regulatory T Cells in Allogeneic Stem Cell Transplantation", CLINICAL & DEVELOPMENTAL IMMUNOLOGY, 2013, XP002729267, ISSN: 1740-2522 * |
| MURPHY, B.; KIM, K.S.; BUELOW, R.; SAYEGH, M.H.; HANCOCK, W.W.: "Synthetic MHC class I peptide prolongs cardiac survival and attenuates transplant arteriosclerosis in the Lewis-- Fischer 344 model of chronic allograft rejection", TRANSPLANTATION, vol. 64, 1997, pages 14 - 19 |
| MURRY: "Methods in Molecular Biology", vol. 7, 1991, HUMANA PRESS, INC. |
| NEEDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443 - 453 |
| OHKURA, N.; SAKAGUCHI, S.: "Regulatory T cells: roles of T cell receptor for their development and function", SEMIN IMMUNOPATHOL, vol. 32, 2010, pages 95 - 106 |
| ORDONEZ, L.; BERNARD, I.; CHABOD, M.; AUGUSTO, J.F.; LAUWERS-CANCES, V.; CRISTINI, C.; CUTURI, M.C.; SUBRA, J.F.; SAOUDI, A.: "A higher risk of acute rejection of human kidney allografts can be predicted from the level of CD45RC expressed by the recipients' CD8 T cells", PLOS ONE, vol. 8, 2013, pages E69791 |
| ORDONEZ, L.; BERNARD, I.; L'FAQIHI-OLIVE, F.E.; TERVAERT, J.W.; DAMOISEAUX, J.; SAOUDI, A.: "CD45RC isoform expression identifies functionally distinct T cell subsets differentially distributed between healthy individuals and AAV patients", PLOS ONE, vol. 4, 2009, pages E5287 |
| PICARDA ELODIE ET AL: "MHC-derived allopeptide activates TCR-biased CD8(+) Tregs and suppresses organ rejection", JOURNAL OF CLINICAL INVESTIGATION, vol. 124, no. 6, June 2014 (2014-06-01), pages 2497 - 2512, XP002729269, ISSN: 0021-9738 * |
| PICARDA, E.; ANEGON, I.; GUILLONNEAU, C.: "T-cell receptor specificity of CD8(+) Tregs in allotransplantation", IMMUNOTHERAPY, vol. 3, 2011, pages 35 - 37 |
| POWIS, S.J.; YOUNG, L.L.; JOLY, E.; BARKER, P.J.; RICHARDSON, L.; BRANDT, R.P.; MELIEF, C.J.; HOWARD, J.C.; BUTCHER, G.W.: "The rat cim effect: TAP allele-dependent changes in a class I MHC anchor motif and evidence against C-terminal trimming of peptides in the ER", IMMUNITY, vol. 4, 1996, pages 159 - 165 |
| QUIGLEY, M.F.; GREENAWAY, H.Y.; VENTURI, V.; LINDSAY, R.; QUINN, K.M.; SEDER, R.A.; DOUEK, D.C.; DAVENPORT, M.P.; PRICE, D.A.: "Convergent recombination shapes the clonotypic landscape of the naive T-cell repertoire", PROC NATL ACAD SCI US A, vol. 107, 2010, pages 19414 - 19419 |
| RENNER, P.; POPP, F.C.; EGGENHOFER, E.; SLOWIK, P.; PISO, P.; GEISSLER, E.K.; SCHLITT, H.J.; DAHLKE, M.H.: "Antigen-specific recognition is critical for the function of regulatory CD8(+)CD28(-) T cells", TRANSPL IMMUNOL, vol. 22, 2010, pages 144 - 149 |
| ROBINS, H.S.; SRIVASTAVA, S.K.; CAMPREGHER, P.V.; TURTLE, C.J.; ANDRIESEN, J.; RIDDELL, S.R.; CARLSON, C.S.; WARREN, E.H.: "Overlap and effective size of the human CD8+ T cell receptor repertoire", SCI TRANSL MED, vol. 2, 2010, pages 47RA64 |
| SAFINIA, N.; LEECH, J.; HERNANDEZ-FUENTES, M.; LECHLER, R.; LOMBARDI, G.: "Promoting transplantation tolerance; adoptive regulatory T cell therapy", CLIN EXP IMMUNOL, vol. 172, 2013, pages 158 - 168 |
| SAGOO, P.; ALI, N.; GARG, G.; NESTLE, F.O.; LECHLER, R.I.; LOMBARDI, G.: "Human regulatory T cells with alloantigen specificity are more potent inhibitors of alloimmune skin graft damage than polyclonal regulatory T cells", SCI TRANSL MED, vol. 3, 2011, pages 83RA42 |
| SANBROOK ET AL.: "Molecular Cloning: A Laboratory Manual Second Edition,", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SPEIR JEFFREY A ET AL: "Two different, highly exposed, bulged structures for an unusually long peptide bound to rat MHC class I RT1-Aa", IMMUNITY, vol. 14, no. 1, January 2001 (2001-01-01), pages 81 - 92, XP002729268, ISSN: 1074-7613 * |
| SPEIR, J.A.; STEVENS, J.; JOLY, E.; BUTCHER, G.W.; WILSON, I.A.: "Two different, highly exposed, bulged structures for an unusually long peptide bound to rat MHC class I RTl-Aa", IMMUNITY, vol. 14, 2001, pages 81 - 92 |
| STEVENS, J.; WIESMULLER, K.H.; BARKER, P.J.; WALDEN, P.; BUTCHER, G.W.; JOLY, E.: "Efficient generation of major histocompatibility complex class I-peptide complexes using synthetic peptide libraries", JBIOL CHEM, vol. 273, 1998, pages 2874 - 2884 |
| STEVENS, J.; WIESMULLER, K.H.; WALDEN, P.; JOLY, E.: "Peptide length preferences for rat and mouse MHC class I molecules using random peptide libraries", EURJ IMMUNOL, vol. 28, 1998, pages 1272 - 1279 |
| TANG, Q.; BLUESTONE, J.A.; KANG, S.M.: "CD4(+)Foxp3(+) regulatory T cell therapy in transplantation", J MOL CELL BIOL, vol. 4, 2012, pages 11 - 21 |
| TANG, Q.; HENRIKSEN, K.J.; BI, M.; FINGER, E.B.; SZOT, G.; YE, J.; MASTELLER, E.L.; MCDEVITT, H.; BONYHADI, M.; BLUESTONE, J.A.: "In vitro-expanded antigen-specific regulatory T cells suppress autoimmune diabetes", J EXP MED, vol. 199, 2004, pages 1455 - 1465 |
| THOMAS, P.G.; HANDEL, A.; DOHERTY, P.C.; LA GRUTA, N.L.: "Ecological analysis of antigen-specific CTL repertoires defines the relationship between naive and immune T-cell populations", PROC NATL ACAD SCI USA, vol. 110, 2013, pages 1839 - 1844 |
| THORPE, C.J.; MOSS, D.S.; POWIS, S.J.; HOWARD, J.C.; BUTCHER, G.W.; TRAVERS, P.J.: "An analysis of the antigen binding site of RTI .Aa suggests an allele-specific motif", IMMUNOGENETICS, vol. 41, 1995, pages 329 - 331 |
| TSANG, J.Y.; RATNASOTHY, K.; LI, D.; CHEN, Y.; BUCY, R.P.; LAU, K.F.; SMYTH, L.; LOMBARDI, G.; LECHLER, R.; TAM, P.K.: "The potency of allospecific Tregs cells appears to correlate with T cell receptor functional avidity", AM J TRANSPLANT, vol. 11, 2011, pages 1610 - 1620 |
| TSANG, J.Y.; TANRIVER, Y.; JIANG, S.; XUE, S.A.; RATNASOTHY, K.; CHEN, D.; STAUSS, H.J.; BUCY, R.P.; LOMBARDI, G.; LECHLER, R.: "Conferring indirect allospecificity on CD4+CD25+ Tregs by TCR gene transfer favors transplantation tolerance in mice", J CLIN INVEST, vol. 118, 2008, pages 3619 - 3628 |
| TURNER, S.J.; ROSSJOHN, J.: "alphabeta T cell receptors come out swinging", IMMUNITY, vol. 35, 2011, pages 660 - 662 |
| VAN DENDEREN, B.; PECHE, H.; GAGNE, K.; USAL, C.; CUTURI, M.C.; SOULILLOU, J.P: "Identification of immunodominant donor MHC peptides following rejection and donor strain transfusion-induced tolerance of heart allografts in adult rats", EUR J IMMUNOL, vol. 31, 2001, pages 1333 - 1339 |
| VENTURI, V.; KEDZIERSKA, K.; TURNER, S.J.; DOHERTY, P.C.; DAVENPORT, M.P.: "Methods for comparing the diversity of samples of the T cell receptor repertoire", J IMMUNOL METHODS, vol. 321, 2007, pages 182 - 195 |
| VENTURI, V.; PRICE, D.A.; DOUEK, D.C.; DAVENPORT, M.P.: "The molecular basis for public T-cell responses?", NAT REV IMMUNOL, vol. 8, 2008, pages 231 - 238 |
| VENTURI, V.; QUIGLEY, M.F.; GREENAWAY, H.Y.; NG, P.C.; ENDE, Z.S.; MCINTOSH, T.; ASHER, T.E.; ALMEIDA, J.R.; LEVY, S.; PRICE, D.A.: "A mechanism for TCR sharing between T cell subsets and individuals revealed by pyrosequencing", J IMMUNOL, vol. 186, 2011, pages 4285 - 4294 |
| WAN, Q.; KOZHAYA, L.; IMBERG, K.; MERCER, F.; ZHONG, S.; KROGSGAARD, M.; UNUTMAZ, D.: "Probing the effector and suppressive functions of human T cell subsets using antigen-specific engineered T cell receptors", PLOS ONE, vol. 8, 2013, pages E56302 |
| WING, J.B.; SAKAGUCHI, S.: "TCR diversity and Treg cells, sometimes more is more", EUR J IMMUNOL, vol. 41, 2011, pages 3097 - 3100 |
| WOOD, K.J.; BUSHELL, A.; HESTER, J.: "Regulatory immune cells in transplantation", NAT REV IMMUNOL, vol. 12, 2012, pages 417 - 430 |
| WOOLDRIDGE, L.; LISSINA, A.; COLE, D.K.; VAN DEN BERG, H.A.; PRICE, D.A.; SEWELL, A.K.: "Tricks with tetramers: how to get the most from multimeric peptide-MHC", IMMUNOLOGY, vol. 126, 2009, pages 147 - 164 |
| ZANG, W.; MURPHY, B.: "Peptide-mediated immunosuppression", AM J THER, vol. 12, 2005, pages 592 - 599 |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2019519197A (ja) * | 2016-04-06 | 2019-07-11 | イマティクス バイオテクノロジーズ ゲーエムベーハー | Amlおよびその他のがんに対する免疫療法において使用するための新規ペプチドおよびペプチドの組み合わせ |
| JP2021045150A (ja) * | 2016-04-06 | 2021-03-25 | イマティクス バイオテクノロジーズ ゲーエムベーハー | Amlおよびその他のがんに対する免疫療法において使用するための新規ペプチドおよびペプチドの組み合わせ |
| WO2020120786A1 (en) * | 2018-12-14 | 2020-06-18 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Isolated mhc-derived human peptides and uses thereof for stimulating and activating the suppressive function of cd8+cd45rclow tregs |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2020055845A (ja) | 2020-04-09 |
| US20170021001A1 (en) | 2017-01-26 |
| EP3126377A1 (en) | 2017-02-08 |
| EP3126377B1 (en) | 2019-09-04 |
| ES2749073T3 (es) | 2020-03-19 |
| US10105425B2 (en) | 2018-10-23 |
| JP2017515795A (ja) | 2017-06-15 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP6069755B2 (ja) | 高親和性t細胞受容体およびその用途 | |
| CN107148427B (zh) | 新型免疫原性肽 | |
| RU2721574C2 (ru) | Вакцинная композиция против злокачественной опухоли | |
| Picarda et al. | MHC-derived allopeptide activates TCR-biased CD8+ Tregs and suppresses organ rejection | |
| AU2008290061B2 (en) | CDCA1 peptide and pharmaceutical agent comprising the same | |
| KR102228843B1 (ko) | Cd4+ t-세포 반응의 증강을 위한 변형된 에피토프 | |
| RU2761653C2 (ru) | Пептиды и способы для лечения диабета | |
| JP7317158B2 (ja) | Her2/Neu (ERBB2)受容体タンパク質に由来する369~377位エピトープに特異的な完全ヒトT細胞受容体 | |
| JP2020055844A (ja) | 単離されたドナーmhc由来ペプチド及びその使用 | |
| JP2023052647A (ja) | 標的治療免疫調節のためのMHCクラスIb分子及びペプチドの組合せ | |
| JP7026970B2 (ja) | 白血病およびその他のがんに対する免疫療法において使用するためのペプチドおよびペプチドの組み合わせ | |
| WO2020145222A1 (ja) | 新規ネオアンチゲン及びそれらを用いたがん免疫治療薬 | |
| JP2020055845A (ja) | 単離されたドナーmhc由来ペプチド及びその使用 | |
| TW201416375A (zh) | 對於th1細胞之cdca1抗原決定位胜肽及含此之疫苗 | |
| AU2018250926B2 (en) | Methods to produce peptides, polypeptides or cells for modulating immunity | |
| JP7847777B2 (ja) | SARS-CoV-2蛋白由来ペプチドおよびそれを含むワクチン | |
| US20060045884A1 (en) | Vaccines for autoimmune and infectious disease | |
| JP2012530106A (ja) | HLA−Gα1多量体及びその薬学的使用 | |
| NL2034657B1 (en) | RCN1-derived TEIPP neoantigens and uses thereof | |
| KR20230147078A (ko) | 치료에 사용하기 위한 t 세포 | |
| JP2013176366A (ja) | Vegfr1由来ペプチドおよびそれを含むワクチン |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15713503 Country of ref document: EP Kind code of ref document: A1 |
|
| REEP | Request for entry into the european phase |
Ref document number: 2015713503 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2015713503 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2016559818 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15300896 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |