WO2015109264A1 - Receptor targeting constructs and uses thereof - Google Patents
Receptor targeting constructs and uses thereof Download PDFInfo
- Publication number
- WO2015109264A1 WO2015109264A1 PCT/US2015/011870 US2015011870W WO2015109264A1 WO 2015109264 A1 WO2015109264 A1 WO 2015109264A1 US 2015011870 W US2015011870 W US 2015011870W WO 2015109264 A1 WO2015109264 A1 WO 2015109264A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cancer
- drug delivery
- inlb
- subject
- cells
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7028—Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages
- A61K31/7034—Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages attached to a carbocyclic compound, e.g. phloridzin
- A61K31/704—Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages attached to a carbocyclic compound, e.g. phloridzin attached to a condensed carbocyclic ring system, e.g. sennosides, thiocolchicosides, escin, daunorubicin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
- A61K31/7105—Natural ribonucleic acids, i.e. containing only riboses attached to adenine, guanine, cytosine or uracil and having 3'-5' phosphodiester links
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K33/00—Medicinal preparations containing inorganic active ingredients
- A61K33/24—Heavy metals; Compounds thereof
- A61K33/32—Manganese; Compounds thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/66—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid the modifying agent being a pre-targeting system involving a peptide or protein for targeting specific cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/69—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit
- A61K47/6921—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit the form being a particulate, a powder, an adsorbate, a bead or a sphere
- A61K47/6927—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit the form being a particulate, a powder, an adsorbate, a bead or a sphere the form being a solid microparticle having no hollow or gas-filled cores
- A61K47/6929—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit the form being a particulate, a powder, an adsorbate, a bead or a sphere the form being a solid microparticle having no hollow or gas-filled cores the form being a nanoparticle, e.g. an immuno-nanoparticle
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/48—Preparations in capsules, e.g. of gelatin, of chocolate
- A61K9/50—Microcapsules having a gas, liquid or semi-solid filling; Solid microparticles or pellets surrounded by a distinct coating layer, e.g. coated microspheres, coated drug crystals
- A61K9/51—Nanocapsules; Nanoparticles
- A61K9/5107—Excipients; Inactive ingredients
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/48—Preparations in capsules, e.g. of gelatin, of chocolate
- A61K9/50—Microcapsules having a gas, liquid or semi-solid filling; Solid microparticles or pellets surrounded by a distinct coating layer, e.g. coated microspheres, coated drug crystals
- A61K9/51—Nanocapsules; Nanoparticles
- A61K9/5107—Excipients; Inactive ingredients
- A61K9/513—Organic macromolecular compounds; Dendrimers
- A61K9/5169—Proteins, e.g. albumin, gelatin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/55—Fusion polypeptide containing a fusion with a toxin, e.g. diphteria toxin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
- C07K2319/74—Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor
Definitions
- the invention relates to the field of biotechnology. Specifically, the invention relates to compositions that deliver therapeutic agents to target cells, such as cancer cells.
- c-Met proteins such as c-Met.
- lung cancer acquires resistance to EGF-R inhibitors such as Tarceva.
- Inhibitors like Tarceva are intended to block the activity of receptor tyrosine kinases (known as tyrosine kinase inhibitors, or TKI's), but the majority of cases do not respond to TK inhibition.
- TKI's receptor tyrosine kinases
- TKI's receptor tyrosine kinase inhibitors
- compositions described herein circumvent the need to block signaling by using a cell surface receptor (for example, c-Met) as a portal to deliver toxic molecules into the tumor cell and kill tumors from within.
- a cell surface receptor for example, c-Met
- Ligand directed delivery enables the targeted binding to tumors that are positive for specific cell surface receptors (for example, c-Met) and the membrane penetration domain in the delivery molecule enables penetration and lysis across the endosomal membrane after cell surface receptor- mediated endocytosis.
- the delivery protein is also modified to non-covalently assemble with and transport certain therapeutic molecules through, for example, ionic interactions.
- drug delivery molecules that comprise a ligand that targets a cell surface molecule; a membrane penetration domain; and a payload binding domain; and pharmaceutical compositions comprising the same. Also disclosed are methods of treating cancer, inhibiting the progression of cancer, preventing cancer metastasis, and delivering a therapeutic compound to the brain in a subject in need thereof, the methods comprising identifying a subject in need thereof; providing a composition comprising the drug delivery molecule as disclosed herein; and administering an effective amount of the composition to the subject.
- Figure 1 shows the results of the uptake of a single-stranded oligonucleotide using Lipofectamine as control (FIG. 1A) and HerPBKlO (FIG. IB).
- FIG. 2 shows that PBK10 can deliver a synthetic mRNA encoding GFP.
- FIG. 2A provides a summary of mRNA used in this experiment.
- FIG. 2B shows GFP expression from mRNA delivered by Lipofectin (right) in comparison a GFP- expressing plasmid delivered by Lipofectin (left).
- FIG. 2C is a schematic of PBK10- mRNA complexes.
- FIG. 2D shows the cell binding data for PBKlO-mRNA complexes.
- FIG. 2E shows the results of the uptake of cell-bound complexes.
- FIG. 2F shows the image of the results of the expression of GFP, whereas FIG. 2G depicts the same data in a graph form.
- Figure 3 is a schematic of (A) InlB321, which encompasses the minimal domain for c-MET receptor binding; and (B) InlB321 bound to the extracellular domain of c-MET.
- Figure 4 is a schematic showing a recombinant gene construct is assembled to encode a new fusion protein, InlB-PBK10.
- Figure 5 is the results of a Western blot showing the recombinant proteins InlB, InlB-PBK10 and GFP-InlB are produced in bacteria.
- Figure 6 is a graph showing the surface level of c-MET varies among different tumor and non-tumor cell lines. Relative receptor levels on the surface of non- permeabilized cells as measured by a cell surface ELISA performed in a 96-well format are shown. ELISA results show that the H1993 (lung cancer cell line) and MDA-MB-231 (breast cancer cell line) are among the cells with the highest cell surface levels of c-MET. RANKL (prostate cancer cell line) and MDA-MB-435 (breast cancer cell line) display moderate levels while LN-GFP (prostate cancer cell line) and Cos-7 (African green monkey kidney fibroblast) display low levels of cell surface c-MET.
- FIG. 7 shows the results of the experiments showing the InlB-derived peptide recognizes c-MET.
- InlB321 peptide shows preferential binding to c-MET positive, but not low c-MET, cells.
- Fluorescence activated cell sorting FACS was used to measure the relative level of InlB (recognized by immunofluorescence) bound to c- MET positive cells.
- the FACS data shows a relatively higher level of InlB binding to high c-MET cells (HI 993) compared to low c-MET cells (LN GFP).
- InlB binding to HI 993 could be inhibited when free InlB was pre-incubated with a soluble peptide derived from the extracellular, ligand binding domain of c-MET (MET) before binding to the cells. InlB and MET were incubated at a 1: 1 molar ratio (METTnlB), which predicts a 50% reduction in receptor binding if InlB is specific to MET.
- C. Cell binding by MB-PBKIO is proportional to c- MET levels.
- MB-PBKIO showed a higher level of binding to the cells with higher c- MET cell surface expression (MDA-MB-231) in comparison to cells expressing relatively low c-MET levels (Cos-7) as measured by cell surface ELISA.
- the concentrations of free InlB ligand were chosen so that the molar ratios of InlB-PBKlO to InlB were: 1: 1, 1:5, and 1: 10.
- Western blotting was performed to measure the relative InlB-PBKlO levels co-precipitating with the cell pellets. Densito metric measurements (right panel) of immunoblot bands show that levels of InlB-PBKlO binding decreased as the concentration of InlB increased, consistent with InlB-PBKlO binding to c-MET.
- Figure 8 shows that InlB-PBKlO internalizes into C-MET+ cells.
- FIG. 9 shows InlB-PBKlO can deliver toxic molecules to C-MET+ cells.
- D. I-Dox reduces survival of c-MET positive tumor cells.
- Figure 10 shows a Xenogen Spectum image for the biodistribution of InlB-PBKlO after systemic (tail vein) delivery in a nu/nu mouse bearing subcutaneous bilateral flank MDA-MB-435 tumors.
- A Images of the whole mouse at indicated time points after tail vein injection. Blue arrows point to kidneys. White arrows point to tumors.
- B Images of the tumors and tissues harvested from the same mouse sacrificed after the 4 h time point.
- Figure 11 depicts the assembly of HerMn.
- A Schematic of HerPBKlO protein, highlighting functional domains.
- B Chemical structure of Mn- corrole (S2Mn).
- C Schematic of non-covalent assembly.
- D TEM (inset) and dynamic light scattering (DSL) measurement of HerMn particles in solution.
- Figure 12 is a group of graphs showing HerPBKlO binds to HER3 and is not inhibited by patient serum.
- A ELISA of HerPBKlO binding to immobilized HER3 (human ErbB3 extracellular domain; Prospec) -/+ pre-incubation with soluble HER3 peptide as a competitive inhibitor (HER3 block). Un: no HerPBKlO.
- B ELISA of HerPBKlO binding to immobilized HER3 (human ErbB3 extracellular domain; Prospec) -/+ pre-incubation with soluble HER3 peptide as a competitive inhibitor (HER3 block). Un: no HerPBKlO.
- B ELISA of HerPBKlO binding to immobilized HER3 (human ErbB3 extracellular domain; Prospec) -/+ pre-incubation with soluble HER3 peptide as a competitive inhibitor (HER3 block). Un: no HerPBKlO.
- C. ELISA of HerPBKlO binding to HER2+ (MDA-MB-435) cells in serum from five HER2+ patients and age matched controls (HER2-). Control samples were bound in bovine serum and receptor- binding verified by competitive inhibition with recombinant heregulin ligand (+Her). N 3. *, p ⁇ 0.05 compared to control (-Her: no competitive inhibitor).
- FIG. 13 shows the results that HerPBKlO binds to mouse HER3.
- A Amino acid sequence alignment of domains I-II (aa 20-239, heregulin-binding domain) of human and mouse HER3. Blue residues indicate amino acid differences.
- B Relative HER3 levels detected by ELISA (without peraieabilization) using an anti-HER3 antibody that cross-reacts with both human and mouse HER3 (1B2E; Cell Signaling Technologies).
- Figure 14 is a graph showing the data for HerMn toxicity on human HER2+ and HER2- tumor cells.
- Figure 15 are photographs showing the mechanism of HerMn cytotoxicity.
- Figure 16 shows the data that S2Ga interacts with TSPO.
- A-B Retentates were evaluated for the presence of TSPO-bound corrole by measuring the absorbance and fluorescence spectra.
- C-D Evidence of HerGa interaction with TSPO in situ. The green fluorescent JC-1 dye used in C fluoresces red when accumulated into mitochondria. D is a quantification of red fluorescence in C. *, p ⁇ 0.05.
- Figure 17 shows the biodistribution in tumor-bearing mice. Xenogen imaging and quantification of Alexa680-labeled HerMn, trastuzumab (Tz) and BSA (12 nmol ea) after tail vein injection. Graph shows mean fluorescence-/+SEM.
- FIG. 18 shows the data for the therapeutic efficacy of HerMn.
- B HER2+ MDA-MB-435 tumor growth in female nude mice receiving daily IV (via tail vein) injections of HerMn or S2Mn (5 nmoles corrole/injection) once/day for 6 consecutive days. Control groups received saline or HerPBKlO at equivalent cone to HerMn. Treatments began at
- “Beneficial results” may include, but are in no way limited to, lessening or alleviating the severity of the disease condition, preventing the disease condition from worsening, curing the disease condition, preventing the disease condition from developing, lowering the chances of a patient developing the disease condition and prolonging a patient's life or life expectancy.
- the disease condition is cancer.
- the disease condition is an autoimmune disease.
- Cancer and “cancerous” refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth.
- Examples of cancer include, but are not limited to leukemia, myeloma, B-cell lymphomas (Hodgkin's lymphomas and/or non-Hodgkins lymphomas), brain cancer, breast cancer, colorectal cancer, lung cancer, hepatocellular cancer, kidney cancer, gastric cancer, pancreatic cancer, cervical cancer, ovarian cancer, liver cancer, bladder cancer, cancer of the urinary tract, thyroid cancer, renal cancer, carcinoma, melanoma, head and neck cancer, brain cancer, prostate cancer, androgen-dependent prostate cancer, and androgen-independent prostate cancer.
- leukemia myeloma
- B-cell lymphomas Hodgkin's lymphomas and/or non-Hodgkins lymphomas
- brain cancer breast cancer
- colorectal cancer lung cancer
- hepatocellular cancer kidney cancer
- gastric cancer pancreatic cancer
- Cyterapéutica drugs or “chemotherapeutic agents” as used herein refer to drugs used to treat cancer including but not limited to Albumin-bound paclitaxel (nab-paclitaxel), Actinomycin, Alitretinoin, All-trans retinoic acid, Azacitidine, Azathioprine, Bevacizumab, Bexatotene, Bleomycin, Bortezomib, Carboplatin, Capecitabine, Cetuximab, Cisplatin, Chlorambucil, Cyclophosphamide, Cytarabine, Daunorubicin, Docetaxel, Doxifluridine, Doxorubicin, Epirubicin, Epothilone, Erlotinib, Etoposide, Fluorouracil, Gefitinib, Gemcitabine, Hydroxyurea, Idarubicin, Imatinib, Ipilimumab, Irinotecan, Mechlorethamine
- Subject or “individual” or “animal” or “patient” or “mammal,” is meant any subject, particularly a mammalian subject, for whom diagnosis, prognosis, or therapy is desired.
- the subject has cancer.
- the subject had cancer at some point in the subject's lifetime.
- the subject's cancer is in remission, is re-current or is non-recurrent.
- mammal refers to any member of the class Mammalia, including, without limitation, humans, domestic animals, farm animals, zoo animals, sport animals, pet animals such as dogs, cats, guinea pigs, rabbits, rats, mice, horses, cattle, cows; primates such as apes, monkeys, orangutans, and chimpanzees; canids such as dogs and wolves; felids such as cats, lions, and tigers; equids such as horses, donkeys, and zebras; food animals such as cows, pigs, and sheep; ungulates such as deer and giraffes; rodents such as mice, rats, hamsters and guinea pigs; and so on.
- pet animals such as dogs, cats, guinea pigs, rabbits, rats, mice, horses, cattle, cows; primates such as apes, monkeys, orangutans, and chimpanzees; canid
- the mammal is a human subject.
- the term does not denote a particular age or sex. Thus, adult and newborn subjects, as well as fetuses, whether male or female, are intended to be included within the scope of this term.
- Treatment refers to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) the targeted pathologic condition, prevent the pathologic condition, pursue or obtain beneficial results, or lower the chances of the individual developing the condition even if the treatment is ultimately unsuccessful.
- Those in need of treatment include those already with the condition as well as those prone to have the condition or those in whom the condition is to be prevented.
- a particular procedure or administration is considered therapeutic even if, following the administration, the subject does not feel better. Thus, any amelioration of the subject's disease state, or any slowing of the progression of the disease, is considered therapeutic.
- cancer treatment examples include, but are not limited to, active surveillance, observation, surgical intervention, chemotherapy, immunotherapy, radiation therapy (such as external beam radiation, stereotactic radiosurgery (gamma knife), and fractionated stereotactic radiotherapy (FSR)), focal therapy, systemic therapy, vaccine therapies, viral therapies, molecular targeted therapies, or a combination thereof.
- radiation therapy such as external beam radiation, stereotactic radiosurgery (gamma knife), and fractionated stereotactic radiotherapy (FSR)
- FSR fractionated stereotactic radiotherapy
- Tumor refers to all neoplastic cell growth and proliferation, whether malignant or benign, and all pre-cancerous and cancerous cells and tissues.
- Therapeutic agents refers to agents that are used to, for example, treat, inhibit, prevent, mitigate the effects of, reduce the severity of, reduce the likelihood of developing, slow the progression of and/or cure, a disease.
- Diseases targeted by the therapeutic agents include but are not limited to carcinomas, sarcomas, lymphomas, leukemia, germ cell tumors, blastomas, antigens expressed on various immune cells, and antigens expressed on cells associated with various hematologic diseases, autoimmune diseases, and/or inflammatory diseases.
- a value in the context of the present disclosure it is meant that the disclosure encompasses the listed value + 25%, or alternatively the listed value + 15%, or alternatively the listed value + 10%, or alternatively the listed value + 5%.
- about 50 amino acids it is meant 50+25% amino acids (i.e., a range of 37-63 amino acids), or alternatively 50+15% amino acids (i.e., a range of 42-58 amino acids), or alternatively 50+10% amino acids (i.e., a range of 45-55 amino acids), or alternatively 50+5% amino acids (i.e., a range of 47-53 amino acids).
- the drug delivery molecule includes a ligand that targets a cell surface molecule, a membrane penetration domain and a payload binding domain.
- the ligand in the drug delivery molecule delivers the molecule to the target cell, such as a cancer cell.
- the membrane penetration domain mediates cytosolic penetration of the target cell.
- the payload binding domain forms a complex with a therapeutic agent.
- the drug delivery molecule in complex with the therapeutic molecule delivers the therapeutic agent to the target cell, such as a cancer cell.
- the cancer cell is any one or more of leukemia, myeloma, B-cell lymphomas (Hodgkin's lymphomas and/or non-Hodgkins lymphomas), brain cancer, breast cancer, colorectal cancer, lung cancer, hepatocellular cancer, kidney cancer, gastric cancer, pancreatic cancer, cervical cancer, ovarian cancer, liver cancer, bladder cancer, cancer of the urinary tract, thyroid cancer, renal cancer, carcinoma, melanoma, head and neck cancer, brain cancer, prostate cancer, androgen-dependent prostate cancer, and androgen-independent prostate cancer.
- leukemia myeloma
- B-cell lymphomas Hodgkin's lymphomas and/or non-Hodgkins lymphomas
- the drug delivery molecules disclosed herewith form nanoparticles having between about 5 nm to about 50 nm in diameter. In some embodiments, the nanoparticles have a size of between about 10 to about 30 nm.
- the payload i.e., the therapeutic agent, is then bound to the nanoparticle.
- the nanoparticle comprises a metallated corrole, for example manganese (Mn), iron (Fe), or gallium (Ga) corrole. In other embodiments, the nanoparticle comprises a protein or a protein fragment.
- the binding of the therapeutic agent to the nanoparticle is through a process selected from the group consisting of electrostatic interactions, hydrophobic interactions, hydrophilic interactions, hydrogen bonding, and covalent bonding.
- the cell surface molecule is a receptor that is implicated in a signal transduction pathway that leads to reduced or eliminated apoptosis.
- Examples of cell surface molecules that may be targeted by a ligand in the drug delivery molecule described herein include, but are not limited to, any one or more of 4- IBB, 5T4, adenocarcinoma antigen, alpha-fetoprotein, BAFF, B-lymphoma cell, C242 antigen, CA- 125, carbonic anhydrase 9 (CA-IX), c-MET, CCR4, CD152, CD19, CD20, CD200, CD22, CD221, CD23 (IgE receptor), CD28, CD30 (TNFRSF8), CD33, CD4, CD40, CD44 v6, CD51, CD52, CD56, CD74, CD80, CEA, CNT0888, CTLA-4, DR5, EGFR, EpCAM, CD3, FAP, fibronectin extra domain-B, folate receptor 1,
- the ligand targets c-MET on cancer cells.
- the ligand is HGF.
- the ligand is Internalin B or a fragment thereof or a variant thereof.
- the ligand is the bacterial invasin (Inv) protein.
- the ligand is a natural binding partner, or a molecule that can bind to the cell surface molecule.
- the ligand is a protein, protein fragment, polypeptide, or oligopeptide.
- the ligand is an antibody or an antibody fragment.
- the ligand is a small organic molecule that binds to the cell surface molecule.
- the small organic molecule mimics the structure of a natural binding partner for the target cell surface molecule and binds competitively to the target cell surface molecule, while in other embodiments, the small organic molecule binds non- competitively to the target cell surface molecule.
- the membrane penetration domain is a protein, protein fragment, polypeptide, or oligopeptide. In certain embodiments, the membrane penetration domain is a polypeptide having between about 3 to about 35 amino acids.
- the membrane penetration domain is the penton base protein or a fragment thereof from Adenovirus.
- the penton base protein normally mediates cell-binding, entry and cytosolic penetration of adenovirus (for example, adenovirus serotype 5) during the early stages of infection.
- the penton base may comprise an RGD motif (Arg-Gly-Asp).
- PB refers to a penton base segment.
- the payload binding domain is a protein, protein fragment, polypeptide, or oligopeptide.
- the membrane penetration domain is a polypeptide having between about 3 to about 35 amino acids.
- the payload binding domain is a decalysine motif, also referred to as "K10.”
- the decalysine motif comprises ten lysine residues.
- the payload that binds to the payload binding domain binds is a nucleic acid.
- the nucleic acid is selected from the group consisting of double stranded deoxyribonucleic acid (dsDNA), single stranded deoxyribonucleic acid (ssDNA), ribonucleic acid (RNA), messenger ribonucleic acid (mRNA), transfer ribonucleic acid (tRNA), ribosomal ribonucleic acid (rRNA), small interfering ribonucleic acid (siRNA), single stranded ribonucleic acid (ssRNA), and oligonucleotides (whether single stranded or double stranded).
- dsDNA double stranded deoxyribonucleic acid
- ssDNA single stranded deoxyribonucleic acid
- RNA messenger ribonucleic acid
- mRNA messenger ribonucleic acid
- tRNA transfer ribonu
- the binding of the payload binding domain to the payload is through a process selected from the group consisting of electrostatic interactions, electrophilic interactions, hydrophilic interactions (van der Waals forces), hydrogen binding, or covalent binding.
- the ligand in the drug delivery molecule targets a cell surface molecule on a cancer cell.
- the cell surface molecule is a receptor on a cancer cell.
- a drug delivery molecule that includes a ligand that targets a cell surface molecule, a membrane penetration domain and a payload binding domain, wherein the ligand is Internalin B (InlB) or a fragment thereof or a variant thereof, the membrane penetration domain is the penton base protein or a fragment thereof and the payload binding domain is a decalysine motif.
- Internalin B targets the cell surface protein c-Met.
- the natural ligand of c-Met is hepatocyte growth factor (HGF). HGF forms a tetramer and requires disulfide bond formation.
- Internalin B obtained from Listeria monocytogenes also recognizes and bind c-MET, but does not tertamerize or require disulfide bond formation. Internalin B can be expressed as a fusion protein and the fusion protein also binds to c-Met. InlB does not compete with HGF.
- the drug delivery molecule comprising InlB, penton base protein and decalysine motif may further comprise a cytotoxic agent, such as corrole compounds. Corrole compounds are porphyrin-like molecules. These compounds can chelate a number of different metals (such as iron, gallium, manganese etc.), non-covalently bind carrier proteins, are cytotoxic and cannot penetrate cells without carrier proteins.
- the ligand targets the cell surface molecule CD4, or alternatively, CD19 or CD20.
- the ligand targets one of the human epidermal growth factor receptors (HER), for example HER2 or HER3.
- the ligand targets an integrin.
- the drug delivery molecule further comprises a therapeutic agent.
- the therapeutic agent forms a complex with the payload binding domain.
- therapeutic agents include but are not limited to alkylating agents, antimetabolites, anti-tumor antibiotics, mitotic inhibitors, corticosteroids, cytotoxic agents or combinations thereof.
- the complex between the therapeutic agent and the payload binding domain may be covalent or non-covalent.
- non-covalent complexes may be via any one or more of van der Waals forces, hydrogen bonding, electrostatic interactions, hydrophobic/hydrophilic interactions.
- the interactions between the therapeutic agent and the payload binding domain may be mediated by a linker.
- the therapeutic agent is doxorubicin or a corrole compound.
- kits for treating cancer in a subject in need thereof comprise identifying a subject in need of the treatment and providing a composition that includes a drug delivery molecule and administering an effective amount of the composition to the subject so as to treat cancer.
- the drug delivery molecule includes a ligand that targets a receptor on a cell surface, a membrane penetration domain and a payload binding domain and further comprises a therapeutic agent as described herein.
- kits for inhibiting the progression of cancer in a subject in need thereof comprise identifying a subject in need of the treatment and providing a composition that includes a drug delivery molecule and administering an effective amount of the composition to the subject so as to inhibit the progression of cancer.
- the drug delivery molecule includes a ligand that targets a receptor on a cell surface, a membrane penetration domain and a payload binding domain and further comprises a therapeutic agent as described herein.
- kits for preventing cancer metastasis in a subject in need thereof comprise identifying a subject in need of the prevention and providing a composition that includes a drug delivery molecule and administering an effective amount of the composition to the subject so as to prevent cancer metastasis.
- the drug delivery molecule includes a ligand that targets a receptor on a cell surface, a membrane penetration domain and a payload binding domain and further comprises a therapeutic agent as described herein.
- kits for treating, inhibiting or preventing metastasis of drug resistant cancers for example, cancer resistant to EGFR tyrosine kinase inhibitor.
- the methods comprise identifying a subject in need of the treatment and providing a composition that includes a drug delivery molecule and administering an effective amount of the composition to the subject so as to treat, inhibit or prevent metastasis of drug resistant cancers.
- the drug delivery molecule includes a ligand that targets a receptor on a cell surface, a membrane penetration domain and a payload binding domain and further comprises a therapeutic agent as described herein.
- the drug resistant cancers over-express a receptor selected from the group consisting of c-Met, HER2, CD4, and CD20.
- compositions described herein surprisingly cross the blood-brain barrier and deliver the payload to the cells in the brain.
- these compositions are uniquely suited for the treatment of cancers, for example metastatic cancers, in the brain.
- the drug delivery molecule in the composition includes a ligand that targets a receptor on a cell surface, a membrane penetration domain and a payload binding domain, wherein the ligand is Internalin B (InlB) or a fragment thereof or a variant thereof, the membrane penetration domain is the penton base protein or a fragment thereof and the payload binding domain is a decalysine motif.
- the drug delivery molecule further comprises a therapeutic agent such as doxorubicin or corrole compounds.
- Another aspect of the invention relates to treating cancer (for example, leukemia, myeloma, B-cell lymphomas (Hodgkin's lymphomas and/or non-Hodgkins lymphomas), brain cancer, breast cancer, colorectal cancer, lung cancer, hepatocellular cancer, kidney cancer, gastric cancer, pancreatic cancer, cervical cancer, ovarian cancer, liver cancer, bladder cancer, cancer of the urinary tract, thyroid cancer, renal cancer, carcinoma, melanoma, head and neck cancer, brain cancer, prostate cancer, androgen- dependent prostate cancer, and androgen-independent prostate cancer) by administering an effective amount of a composition that includes the drug delivery molecules complexed with therapeutic agents as described herein.
- cancer for example, leukemia, myeloma, B-cell lymphomas (Hodgkin's lymphomas and/or non-Hodgkins lymphomas)
- brain cancer for example, leukemia, myeloma, B-cell lymphomas (Hodgkin
- the therapeutic agent can be any chemotherapeutic drug that is applicable to treating the particular type of cancers.
- the therapeutic agent can be an organic molecule, a biological molecule (e.g., a peptide or a nucleic acid), or a combination thereof.
- therapeutic agents include but are not limited to alkylating agents, antimetabolites, anti-tumor antibiotics, mitotic inhibitors, corticosteroids, cytotoxic agents or combinations thereof.
- the therapeutic agent is a corrole compound.
- the therapeutic agent is an siRNA molecule.
- the composition comprising an effective amount of the drug delivery molecule complexed with a therapeutic agent is administered with one or more chemo therapeutic agents, such as those set forth herein.
- Effective amounts of the composition and the chemotherapeutic agent may be administered sequentially or concurrently.
- the administering is systemic. In some embodiments, the administering is local. A variety of means for administering the composition to subjects are known to those of skill in the art. In some aspects of all the embodiments of the invention, the compositions are administered through routes, including ocular, oral, parenteral, intravenous, intramuscular, subcutaneous, transdermal, airway (aerosol), pulmonary, cutaneous, topical, or injection administration.
- Additional therapies that may be used with the compositions comprising an effective amount of the drug delivery molecule complexed with a therapeutic agent to treat cancer include but are not limited to surgery, radiation, immunotherapy, vaccine or combinations thereof.
- the additional therapies may be administered sequentially or simultaneously with therapies comprising administering an effective amounts of a compositions comprising an effective amount of the drug delivery molecule complexed with a therapeutic agent to treat cancer (for example, melanoma or ovarian carcinoma).
- chemotherapeutic agents may be selected from any one or more of cytotoxic antibiotics, antimetabolities, anti-mitotic agents, alkylating agents, arsenic compounds, DNA topoisomerase inhibitors, taxanes, nucleoside analogues, plant alkaloids, and toxins; and synthetic derivatives thereof.
- Exemplary compounds include, but are not limited to, alkylating agents: treosulfan, and trofosfamide; plant alkaloids: vinblastine, paclitaxel, docetaxol; DNA topoisomerase inhibitors: doxorubicin, epirubicin, etoposide, camptothecin, topotecan, irinotecan, teniposide, crisnatol, and mitomycin; anti-folates: methotrexate, mycophenolic acid, and hydroxyurea; pyrimidine analogs: 5-fluorouracil, doxifluridine, and cytosine arabinoside; purine analogs: mercaptopurine and thioguanine; DNA antimetabolites: 2'-deoxy-5- fluorouridine, aphidicolin glycinate, and pyrazoloimidazole; and antimitotic agents: halichondrin, colchicine, and rhizoxin.
- compositions comprising one or more chemotherapeutic agents (e.g. , FLAG, CHOP) may also be used.
- FLAG comprises fludarabine, cytosine arabinoside (Ara-C) and G-CSF.
- CHOP comprises cyclophosphamide, vincristine, doxorubicin, and prednisone.
- PARP e.g. , PARP-1 and/or PARP-2
- inhibitors are used and such inhibitors are well known in the art (e.g.
- therapies include, for example, radiation therapy.
- the radiation used in radiation therapy can be ionizing radiation.
- Radiation therapy can also be gamma rays, X-rays, or proton beams.
- Examples of radiation therapy include, but are not limited to, external-beam radiation therapy, interstitial implantation of radioisotopes (1- 125, palladium, iridium), radioisotopes such as strontium-89, thoracic radiation therapy, intraperitoneal P-32 radiation therapy, and/or total abdominal and pelvic radiation therapy.
- the radiation therapy can be administered as external beam radiation or teletherapy wherein the radiation is directed from a remote source.
- the radiation treatment can also be administered as internal therapy or brachytherapy wherein a radioactive source is placed inside the body close to cancer cells or a tumor mass.
- photodynamic therapy comprising the administration of photosensitizers, such as hematoporphyrin and its derivatives, Vertoporfin (BPD-MA), phthalocyanine, photo sensitizer Pc4, demethoxy-hypocrellin A; and 2BA-2-DMHA.
- photosensitizers such as hematoporphyrin and its derivatives, Vertoporfin (BPD-MA), phthalocyanine, photo sensitizer Pc4, demethoxy-hypocrellin A; and 2BA-2-DMHA.
- therapies include, for example, immunotherapy.
- Immunotherapy may comprise, for example, use of cancer vaccines and/or sensitized antigen presenting cells.
- the immunotherapy can involve passive immunity for short-term protection of a host, achieved by the administration of pre-formed antibody directed against a cancer antigen or disease antigen (e.g. , administration of a monoclonal antibody, optionally linked to a chemotherapeutic agent or toxin, to a tumor antigen).
- Immunotherapy can also focus on using the cytotoxic lymphocyte-recognized epitopes of cancer cell lines.
- therapies include, for example, hormonal therapy
- Hormonal therapeutic treatments can comprise, for example, hormonal agonists, hormonal antagonists (e.g. , flutamide, bicalutamide, tamoxifen, raloxifene, leuprolide acetate (LUPRON), LH-RH antagonists), inhibitors of hormone biosynthesis and processing, and steroids (e.g. , dexamethasone, retinoids, deltoids, betamethasone, Cortisol, cortisone, prednisone, dehydrotestosterone, glucocorticoids, mineralocorticoids, estrogen, testosterone, progestins), vitamin A derivatives (e.g.
- ATRA all- trans retinoic acid
- vitamin D3 analogs include vitamin D3 analogs; antigestagens (e.g. , mifepristone, onapristone), or antiandrogens (e.g., cyproterone acetate).
- antigestagens e.g. , mifepristone, onapristone
- antiandrogens e.g., cyproterone acetate
- the duration and/or dose of treatment with anti-cancer therapies may vary according to the particular anti-cancer agent or combination thereof.
- An appropriate treatment time for a particular cancer therapeutic agent will be appreciated by the skilled artisan.
- the invention contemplates the continued assessment of optimal treatment schedules for each cancer therapeutic agent, where the genetic signature of the cancer of the subject as determined by the methods of the invention is a factor in determining optimal treatment doses and schedules.
- the subject for whom predicted efficacy of an anti-cancer therapy is determined is a mammal (e.g. , mouse, rat, primate, non-human mammal, domestic animal such as dog, cat, cow, horse), and is preferably a human.
- the subject has not undergone chemotherapy or radiation therapy.
- the subject has undergone chemotherapy or radiation therapy (e.g. , such as with cisplatin, carboplatin, and/or taxane).
- the subject has not been exposed to levels of radiation or chemotoxic agents above those encountered generally or on average by the subjects of a species.
- the subject has had surgery to remove cancerous or precancerous tissue.
- the cancerous tissue has not been removed, e.g., the cancerous tissue may be located in an inoperable region of the body, such as in a tissue that is essential for life, or in a region where a surgical procedure would cause considerable risk of harm to the patient, or e.g., the subject is given the anticancer therapy prior to removal of the cancerous tissue.
- the present invention provides pharmaceutical compositions including a pharmaceutically acceptable excipient along with a therapeutically effective amount of the drug delivery molecule described herein so as to treat cancer (for example, leukemia, myeloma, B-cell lymphomas (Hodgkin's lymphomas and/or non-Hodgkins lymphomas), brain cancer, breast cancer, colorectal cancer, lung cancer, hepatocellular cancer, kidney cancer, gastric cancer, pancreatic cancer, cervical cancer, ovarian cancer, liver cancer, bladder cancer, cancer of the urinary tract, thyroid cancer, renal cancer, carcinoma, melanoma, head and neck cancer, brain cancer, prostate cancer, androgen-dependent prostate cancer, and androgen-independent prostate cancer).
- cancer for example, leukemia, myeloma, B-cell lymphomas (Hodgkin's lymphomas and/or non-Hodgkins lymphomas), brain cancer, breast cancer, colorectal cancer, lung cancer, hepatocellular cancer, kidney cancer, gastric cancer
- the drug delivery molecule includes a ligand that targets a receptor on a cell surface, a membrane penetration domain and a payload binding domain.
- the drug delivery molecule further comprises a therapeutic agent that complexes with the drug delivery molecule as described herein.
- the drug delivery molecule delivers the therapeutic agent to the target cancer cell.
- “Pharmaceutically acceptable excipient” means an excipient that is useful in preparing a pharmaceutical composition that is generally safe, non-toxic, and desirable, and includes excipients that are acceptable for veterinary use as well as for human pharmaceutical use. Such excipients may be solid, liquid, semisolid, or, in the case of an aerosol composition, gaseous.
- the pharmaceutical compositions according to the invention may be formulated for delivery via any route of administration.
- Route of administration may refer to any administration pathway known in the art, including but not limited to aerosol, nasal, oral, transmucosal, transdermal, parenteral or enteral.
- Parenteral refers to a route of administration that is generally associated with injection, including intraorbital, intraocular, infusion, intraarterial, intracapsular, intracardiac, intradermal, intramuscular, intraperitoneal, intrapulmonary, intraspinal, intrasternal, intrathecal, intrauterine, intravenous, subarachnoid, subcapsular, subcutaneous, transmucosal, or transtracheal.
- the compositions may be in the form of solutions or suspensions for infusion or for injection, or as lyophilized powders. Via the parenteral route, the compositions may be in the form of solutions or suspensions for infusion or for injection.
- the pharmaceutical compositions can be in the form of tablets, gel capsules, sugar-coated tablets, syrups, suspensions, solutions, powders, granules, emulsions, microspheres or nanospheres or lipid vesicles or polymer vesicles allowing controlled release.
- the compositions are administered by injection, either intravenously or intraperitoneally. Methods for these administrations are known to one skilled in the art.
- compositions according to the invention can also contain any pharmaceutically acceptable carrier.
- “Pharmaceutically acceptable carrier” as used herein refers to a pharmaceutically acceptable material, composition, or vehicle that is involved in carrying or transporting a compound of interest from one tissue, organ, or portion of the body to another tissue, organ, or portion of the body.
- the carrier may be a liquid or solid filler, diluent, excipient, solvent, or encapsulating material, or a combination thereof.
- Each component of the carrier must be “pharmaceutically acceptable” in that it must be compatible with the other ingredients of the formulation. It must also be suitable for use in contact with any tissues or organs with which it may come in contact, meaning that it must not carry a risk of toxicity, irritation, allergic response, immunogenicity, or any other complication that excessively outweighs its therapeutic benefits.
- compositions according to the invention can also be encapsulated, tableted or prepared in an emulsion or syrup for oral administration.
- Pharmaceutically acceptable solid or liquid carriers may be added to enhance or stabilize the composition, or to facilitate preparation of the composition.
- Liquid carriers include syrup, peanut oil, olive oil, glycerin, saline, alcohols and water.
- Solid carriers include starch, lactose, calcium sulfate, dihydrate, terra alba, magnesium stearate or stearic acid, talc, pectin, acacia, agar or gelatin.
- the carrier may also include a sustained release material such as glyceryl monostearate or glyceryl distearate, alone or with a wax.
- the pharmaceutical preparations are made following the conventional techniques of pharmacy involving milling, mixing, granulation, and compressing, when necessary, for tablet forms; or milling, mixing and filling for hard gelatin capsule forms.
- a liquid carrier When a liquid carrier is used, the preparation will be in the form of a syrup, elixir, emulsion or an aqueous or non-aqueous suspension.
- Such a liquid formulation may be administered directly p.o. or filled into a soft gelatin capsule.
- the pharmaceutical compositions according to the invention may be delivered in a therapeutically effective amount.
- the precise therapeutically effective amount is that amount of the composition that will yield the most effective results in terms of efficacy of treatment in a given subject. This amount will vary depending upon a variety of factors, including but not limited to the characteristics of the therapeutic compound (including activity, pharmacokinetics, pharmacodynamics, and bioavailability), the physiological condition of the subject (including age, sex, disease type and stage, general physical condition, responsiveness to a given dosage, and type of medication), the nature of the pharmaceutically acceptable carrier or carriers in the formulation, and the route of administration.
- formulants may be added to the agents.
- a liquid formulation may be preferred.
- these formulants may include oils, polymers, vitamins, carbohydrates, amino acids, salts, buffers, albumin, surfactants, bulking agents or combinations thereof.
- Carbohydrate formulants include sugar or sugar alcohols such as monosaccharides, disaccharides, or polysaccharides, or water soluble glucans.
- the saccharides or glucans can include fructose, dextrose, lactose, glucose, mannose, sorbose, xylose, maltose, sucrose, dextran, pullulan, dextrin, alpha and beta cyclodextrin, soluble starch, hydroxethyl starch and carboxymethylcellulose, or mixtures thereof.
- “Sugar alcohol” is defined as a C4 to C8 hydrocarbon having an—OH group and includes galactitol, inositol, mannitol, xylitol, sorbitol, glycerol, and arabitol. These sugars or sugar alcohols mentioned above may be used individually or in combination. There is no fixed limit to amount used as long as the sugar or sugar alcohol is soluble in the aqueous preparation. In one embodiment, the sugar or sugar alcohol concentration is between 1.0 w/v % and 7.0 w/v , more preferable between 2.0 and 6.0 w/v %.
- Amino acids formulants include levorotary (L) forms of carnitine, arginine, and betaine; however, other amino acids may be added.
- polymers as formulants include polyvinylpyrrolidone (PVP) with an average molecular weight between 2,000 and 3,000, or polyethylene glycol (PEG) with an average molecular weight between 3,000 and 5,000.
- PVP polyvinylpyrrolidone
- PEG polyethylene glycol
- a buffer in the composition it is also preferred to use a buffer in the composition to minimize pH changes in the solution before lyophilization or after reconstitution.
- Most any physiological buffer may be used including but not limited to citrate, phosphate, succinate, and glutamate buffers or mixtures thereof.
- the concentration is from 0.01 to 0.3 molar.
- Surfactants that can be added to the formulation are shown in EP Nos. 270,799 and 268,110.
- compositions can be chemically modified by covalent conjugation to a polymer to increase their circulating half-life, for example.
- Preferred polymers, and methods to attach them to peptides are shown in U.S. Pat. Nos. 4,766,106; 4,179,337; 4,495,285; and 4,609,546 which are all hereby incorporated by reference in their entireties.
- Preferred polymers are polyoxyethylated polyols and polyethylene glycol (PEG).
- PEG is soluble in water at room temperature and in some embodiments, has an average molecular weight between 1000 and 40,000, between 2000 and 20,000, or between 3,000 and 12,000.
- PEG has at least one hydroxy group, such as a terminal hydroxy group.
- the hydroxy group may be activated to react with a free amino group on the inhibitor.
- the type and amount of the reactive groups may be varied to achieve a covalently conjugated PEG/antibody of the present invention.
- Water soluble polyoxyethylated polyols are also useful in the present invention. They include polyoxyethylated sorbitol, polyoxyethylated glucose, polyoxyethylated glycerol (POG), etc. POG is preferred. One reason is because the glycerol backbone of polyoxyethylated glycerol is the same backbone occurring naturally in, for example, animals and humans in mono-, di-, triglycerides. Therefore, this branching would not necessarily be seen as a foreign agent in the body. The POG has a molecular weight in the same range as PEG. The structure for POG is shown in Knauf et al., 1988, J. Bio. Chem. 263: 15064-15070 and a discussion of POG/IL C 2 conjugates is found in U.S. Pat. No. 4,766,106, both of which are hereby incorporated by reference in their entireties.
- the liquid pharmaceutical composition may be lyophilized to prevent degradation and to preserve sterility.
- Methods for lyophilizing liquid compositions are known to those of ordinary skill in the art.
- the composition may be reconstituted with a sterile diluent (Ringer's solution, distilled water, or sterile saline, for example) which may include additional ingredients.
- a sterile diluent Finger's solution, distilled water, or sterile saline, for example
- the composition is administered to subjects using those methods that are known to those skilled in the art.
- compositions are administered so that antibodies are given at a dose between ⁇ g/kg and 20 mg/kg, between 20 ⁇ g/kg and 10 mg/kg, between lmg/kg and 7 mg/kg. In some embodiments, it is given as a bolus dose, to increase circulating levels by 10-20 fold and for 4-6 hours after the bolus dose. Continuous infusion may also be used after the bolus dose. If so, the antibodies may be infused at a dose between 5 ⁇ g/kg/minute and 20 ⁇ g/kg/minute, or between 7 ⁇ g/kg/minute and 15 ⁇ g/kg/minute.
- the invention also provides a kit to treat, inhibit and/or prevent metastasis of cancer in a subject in need thereof.
- the kit comprises a composition comprising a drug delivery molecule complexed with a therapeutic agent, as described herein and instructions for use of the composition for treating, inhibiting and/or preventing metastasis of cancer in subjects in need thereof.
- the kit is an assemblage of materials or components, including at least one of the inventive compositions.
- the kit contains a composition including a drug delivery molecule complexed with a therapeutic agent, as described above.
- the kit is configured particularly for human subjects.
- the kit is configured for veterinary applications, treating subjects such as, but not limited to, farm animals, domestic animals, and laboratory animals.
- Instructions for use may be included in the kit.
- “Instructions for use” typically include a tangible expression describing the technique to be employed in using the components of the kit to effect a desired outcome, such as to treat, reduce the severity of, inhibit or prevent neutropenia in a subject.
- the kit also contains other useful components, such as, measuring tools, diluents, buffers, pharmaceutically acceptable carriers, syringes or other useful paraphernalia as will be readily recognized by those of skill in the art.
- the materials or components assembled in the kit can be provided to the practitioner stored in any convenient and suitable ways that preserve their operability and utility.
- the components can be in dissolved, dehydrated, or lyophilized form; they can be provided at room, refrigerated or frozen temperatures.
- the components are typically contained in suitable packaging material(s).
- packaging material refers to one or more physical structures used to house the contents of the kit, such as inventive compositions and the like.
- the packaging material is constructed by well-known methods, preferably to provide a sterile, contaminant- free environment.
- the term "package” refers to a suitable solid matrix or material such as glass, plastic, paper, foil, and the like, capable of holding the individual kit components.
- a package can be a bottle used to contain suitable quantities of an inventive composition containing the catalytically active antibody having sialidase activity produced by the methods described herein.
- the packaging material generally has an external label which indicates the contents and/or purpose of the kit and/or its components.
- mRNA delivery vectors must breach the nucleus to enable gene expression, whereas mRNA only requires delivery into the cytoplasm for translation of protein products.
- Such as approach is used to express, for example, the so-called Yamanaka factors for inducing pluripotency in somatic cells. While traditional "lipofection" may be useful for delivery of mRNA in vitro, this and similar systems are not effective in vivo.
- HerPBKlO The disclosed targeted cell penetration protein, HerPBKlO, has proven efficacy for nucleic acid and drug delivery in vivo.
- the related protein, PBK10 has also been developed for gene and drug delivery.
- HerPBKlO facilitates targeted binding and penetration of cells via interaction with the human epidermal growth factor receptor (HER3), and PBK10 does so via integrin interaction.
- HER3 human epidermal growth factor receptor
- HerPBKlO transports a labeled oligonucleotide in MDA-MB-435 cells.
- a Cy3-labeled oligonucleotide 50 pmol was incubated with HerPBKlO (5 ⁇ g) or Lipofectamine 2000 (Invitrogen, Carlsbad, CA, USA), a commercial transfection reagent as a comparative control, in 0.1 M HEPES/Optimem I (Invitrogen; Carlsbad, CA, USA) for 20 minutes at RT.
- the resulting mixture was added to MDA-MB-435 cells, which express HER, and incubated for lh at 37°C.
- Cells were fixed in 4 PFA for 15' at RT and processed for immunofluorescence against HerPBKlO.
- Cells were counterstained with DAPI to identify nuclei. Images were acquired using a Leica SP2 laser scanning confocal microscope. Lipofectamine-mediated uptake resulted in oligonucleotide localization inside the cells, as expected (Fig. 1A).
- HerPBKlO colocalized with the oligonucleotide during binding and uptake of HerPBKlO-oligo complexes (Fig. IB), suggesting that HerPBKlO mediates transport of the oligonucleotide into cells.
- PBK10 mediates mRNA delivery.
- a 1 kb synthetic mRNA encoding GFP (Fig. 2A) was used to test the ability of PBK10 to mediate delivery into cells for protein expression.
- GFP expression from mRNA delivered by Lipofectin was compared to a GFP-expressing plasmid delivered by Lipofectin.
- the mRNA expressed GFP at levels in HeLa cells that were detectable by fluorescence microscopy (Fig. 2B).
- PBK10 and synthetic mRNA encoding GFP were mixed at a 20: 1 weight ratio of PBK10:mRNA for -20 min at RT in HEPES -buffered saline (HBS) and then added to adherent HeLa cells at -50-70% confluency.
- HBS HEPES -buffered saline
- PBK10 formed complexes with mRNA similar to the gene delivery complexes that PBK10 had previously been developed to deliver (Fig. 2C).
- PBK10- mRNA complexes were incubated on the HeLa cells on ice to promote receptor binding but not internalization, then the cells were washed to remove free (unbound) complexes and processed by ELISA to identify cell surface-bound complexes using a primary antibody against PBK10.
- An ELISA-based detection of cell surface binding showed that the complexes bind (PBKlO+mRNA) to the cells (Fig. 2D).
- PBKlO+mRNA bind
- the receptor tyrosine kinase (RTK), c-MET, and its endogenous ligand, hepatocyte growth factor (HGF), contribute to cell migration, morphogenic differentiation, and organization of three-dimensional tubular structures as well as cell growth and angiogenesis during normal tissue development.
- RTK receptor tyrosine kinase
- c-MET c-MET
- HGF hepatocyte growth factor
- dysregulation of c-MET and HGF can contribute to tumor progression, and in such circumstances, correlates with poor prognosis in a broad range of human cancers.
- Tumor-targeting strategies that do not require signal inhibition may prove more effective on c-MET positive cancer cells. This may be addressed by ligands that recognize c-MET to trigger cell uptake of attached therapeutics, thus bypassing the need to block signaling. While HGF has the potential to accomplish this, its requirement for tetramerization and disulfide bonding presents technical complications for therapeutics development.
- An alternative, and potentially superior ligand for c-MET targeting may possibly be derived from a bacterium that causes food-poisoning.
- the human pathogen, Listeria monocytogenes binds c-MET to invade host cells through its surface proteins called Internalins.
- InlB Internalin B
- HGF Human epidermal growth factor receptor
- PBK10 is a recombinant protein derived from the adenovirus capsid penton base that can mediate gene and drug delivery into cells through the membrane penetrating activity of the penton base. It has been shown that PBK10 can be targeted to tumor cells when fused to tumor- specific ligands. In this study, the receptor-binding site of InlB is produced as a recombinant fusion to PBK10 to produce the new protein, InlB- PBK10, which mediates the targeted-delivery of cytotoxic agents to c-MET positive cancer cells.
- InlB-PBK10 can be produced as a soluble fusion protein that recognizes c-MET on a variety of tumor cell lines, and undergoes rapid internalization after cell binding.
- MB-PBKIO forms -10-20 nm diameter nanoclusters with toxic compounds such as corroles, and mediates corrole penetration into the cytoplasm after cell entry, causing tumor cell death.
- Inl-PBK10 is a novel construct for mediating the targeted delivery of toxic molecules to MET-expressing tumors.
- C-MET as a tumor biomarker.
- Mesenchymal Epithelial Transition factor or MET is a receptor tyrosine kinase (RTK) that was first discovered as an activated oncogene.
- the endogenous ligand for MET Hepatocyte Growth Factor (HGF), also known as fibroblast-derived cell motility factor or Scatter Factor (SF), normally activates MET to induce cell proliferation, motility, survival and differentiation pathways.
- HGF Hepatocyte Growth Factor
- SF fibroblast-derived cell motility factor
- SF fibroblast-derived cell motility factor
- MET and HGF are mainly expressed in cells of epithelial and mesenchymal origin, respectively.
- the paracrine signaling between HGF and MET mediates epithelial- mesenchymal interactions that regulate tissue growth and morphogenic differentiation.
- HGF-MET signaling in normal tissue contributes to embryogenesis, organogenesis, angiogenesis, wound healing and tissue regeneration, whereas aberrant signal
- C-MET consists of an amino (N) -terminal extracellular domain, a membrane spanning segment and a carboxy (C) -terminal intracellular kinase domain.
- the extracellular region consists of an amino (N) -terminal Semaphorin (Sema) domain adjacent to a PSI domain (present in plexins, semaphorins, and integrins) followed by four immunoglobulin (Ig)-like domains, which together comprise the binding site for HGF.
- Receptor binding by HGF leads to dimerization of MET, activating signaling through ERK1/2, AKT and STAT3, phosphoinositide 3-kinase (PI-3K), Ras-Raf-MAPK, and phospholipase C.
- Ligand-triggered endocytosis of MET occurs through dynamin and clathrin-dependent pathways that mediate trafficking through both degradative and recycling endocytotic routes.
- Dysregulation of c-MET signaling occurs through several mechanisms, including overexpression and constitutive kinase activation with or without gene amplification, kinase-domain mutation, and paracrine/autocrine activation of c-MET by overexpression of HGF.
- Ligand-independent activation of c-MET also disrupts normal HGF-MET signaling and can result from mutations causing constitutive dimerization, as well as hypoxic conditions. The latter can activate HIF- ⁇ -induced transcription of MET causing elevated protein levels amplifying HGF signaling and promoting invasion.
- the therapies currently targeted at the HGF/MET pathway in the clinic consist of either antibodies directed against HGF (Ficlatuzumab) or MET (Onartuzumab), or small molecule inhibitors (Tivantinib or ARQ197 ) directed at the MET kinase domain.
- a problem with all of these approaches is their reliance on signal inhibition for therapeutic efficacy, which is prone to the compensatory RTK cross-talk mentioned earlier, facilitating the development of resistance.
- a bacterial pathogen protein as a potential c-MET targeting agent.
- Internalin B is a protein displayed on the surface of the human bacterial pathogen, L. monocytogenes (Lm), and facilitates the entry of Lm into non-phagocytic cells through binding to c-MET.
- InlB is a member of the larger family of Lm internalin proteins which are comprised of an N-terminal helical cap domain followed by differing numbers of leucine-rich repeats (LRRs) adjacent to an immunoglobulin-like inter-repeat (IR) region.
- LRRs leucine-rich repeats
- IR immunoglobulin-like inter-repeat
- InlB structure also contains a B-repeat and three GW modules at the C-terminal end.
- InlB321 a fragment of InlB capable of binding to c-MET with high affinity, consists of protein domains known as the Cap, LRR (protein-protein interaction domain), and IR regions.
- the binding of InlB321 to MET occurs through its two domains: LRR and IR, which bind to the Igl and Sema domain of MET respectively.
- InlB has several advantages over HGF as a potential tumor-targeting ligand.
- HGF is a heterodimeric protein containing 20 sulfide bonds and requires cleavage of a pro-protein into assembled subunits, which may pose complications for recombinant production, especially as a fusion to exogenous protein domains.
- MB321 has already been produced as a recombinant soluble ligand in Escherichia coli and can tolerate fusion to other proteins (FIG. 3A).
- FOG. 3A proteins
- In vitro studies have demonstrated that the InlB321 peptide can trigger receptor-mediated internalization after MET binding, which is conducive to its use as a nano-delivery agent. It is also important to note that there is no overlap between the HGF binding site of MET with that of InlB321 (FIG. 3B); therefore, there is no competition between these two ligands for binding to MET.
- this peptide is re-engineered by producing it as a recombinant fusion to the Ad5 penton base (PB) that is modified by a decalysine sequence (K10) at the carboxyl (C)-terminus end.
- PB Ad5 penton base
- K10 decalysine sequence
- C carboxyl
- InlB-PBKlO contains functions for transport of anionic cargoes such nucleic acids or corroles (mediated by the K10 domain), targeted binding and internalization (mediated by the InlB321 domain), and membrane penetration and intracellular trafficking (mediated by the PB domain).
- Results are presented for the construction of the InB-PBKlO fusion gene, the production of the fusion protein encoded by this recombinant gene, the characterization of the protein with respect to its ability to bind to MET and enter cells, and the evaluation of its ability to deliver cytotoxic payloads in vitro.
- a recombinant gene can be constructed to encode InlB-PBKlO.
- the strategy for producing the InlB-PBKlO gene construct involved a two-step cloning method entailing polymerase chain reaction (PCR) amplification of InlB321 for cloning into the pRSET-A bacterial expression plasmid, followed by insertion of PBK10 at the 3' end of the InlB321 sequence.
- oligonucleotide primers were designed to introduce restriction sites by PCR into InlB321 to join this sequence with PBK10 for "in-frame" insertion into the expression plasmid, pRSET-A.
- Sacl The restriction site, Sacl, was introduced in the forward primer to place the MB321 reading frame contiguous with the N-terminal poly-histidine sequence encoded by pRSET-A.
- Bglll and Kpnl restriction sites were introduced into the reverse primer. Sacl and Kpnl were used to insert InlB321 into pRSETA, and Bglll was used for subsequent insertion of PBK10 just 3' to the InlB321 coding sequence.
- a sequence encoding a Gly-Gly-Ser-Gly-Gly-Ser (SEQ ID NO:3) amino acid motif was included in the reverse primer to incorporate a short flexible linker between InlB321 and PBK10.
- a high-fidelity polymerase was used to ensure that mutations were not introduced into the MB321 PCR product.
- pRSETA-GFP-InlB that encodes InlB321 as a carboxy [C] -terminal fusion to green fluorescent protein (GFP) for possible future in vitro and in vivo imaging experiments.
- This construct was made by digesting the 800 bp InlB PCR product described earlier with Sacl and Bglll, and ligating this into the pRSETA-GFP plasmid, which places the InlB insert in-frame with the coding sequence of GFP (FIG. 4B). All constructs were double digested and evaluated by electrophoresis using a 1% agarose gel to confirm the presence of the expected bands (FIG. 4C). Additionally, all three constructs were sequenced to confirm their identity as well as verify that mutations were not introduced into the reading frames.
- Recombinant proteins InlB, InlB-PBKlO and GFP-InlB can be produced in bacteria. All three plasmid constructs described earlier (pRSET-InlB, pRSET-InlB-PBKlO, and pRSET-GFP-InlB) were transformed into the E. coli strain, BLR (DE3) pLysS, for subsequent protein expression and purification, as described in the Methods. This strain is more tolerant of repeat sequences in contrast to more traditional (i.e. BL21) expression strains, thus enabling the ability to obtain full-length proteins containing C-terminal polylysines.
- the pRSET-A plasmid encodes proteins as N-terminal fusions to a polyhistidine sequence.
- This histidine (His)-tag enables affinity purification using nickel-chelating resin and provides an epitope for recognition by anti His-tag antibodies.
- the surface level of c-MET varies among different tumor cell lines.
- the first objective in characterizing InlB-PBKlO was to determine whether this protein recognizes c-MET on tumor cells.
- Most of the literature regarding c-MET levels associated with different tumor cell lines is based either on total c-MET protein expression or RNA expression, and thus is not informative with regard to the level of c- MET displayed on the cell surface. Therefore, it was important to first determine the relative cell surface levels of c-MET on the panel of cell lines available for our use. This proved to be an initial challenge because the majority of antibodies available for such assessments have been generated against cytosolic domains of c-MET, and used to evaluate mechanisms of c-MET expression and activation.
- the MET3 antibody developed specifically against cell surface c-MET, was used.
- a cell- surface ELISA to measure relative cell-surface levels of c-MET on a variety of cell lines. Briefly, this approach enables us to measure relative receptor levels on the surface on non-permeabilized cells and can be performed in a 96-well format, allowing both multiple replicates as well as the conservation of precious reagents.
- Our ELISA results show that the H1993 (lung cancer cell line) and MDA-MB-231 (breast cancer cell line) are among the cell lines with the highest surface levels of c-MET.
- RANKL prostate cancer cell line
- MDA-MB-435 breast cancer cell line
- LN-GFP prostate cancer cell line
- Cos-7 Africann green monkey kidney fibroblast
- the InlB-derived peptide recognizes c-MET.
- FACS fluorescence activated cell sorting
- Two tumor cell lines were tested for the binding of InlB: one tumor cell line with high expression of c-MET (H1993) and another tumor cell line with low expression of c-MET (LN GFP).
- InlB exhibited a proportionately higher level of binding to HI 993 cells in comparison to LN GFP (FIG. 7A).
- InlB-PBKlO showed a higher level of binding to the cells with higher c-MET cell surface expression (MDA-MB-231) in comparison to cells expressing relatively low c- MET levels (Cos-7) (FIG. 7C).
- free InlB ligand was used as a competitive inhibitor.
- InlB-PBKlO showed decreased binding to MDA-MB-231 cells in the presence of increasing concentrations of InlB, suggesting that InlB-PBKlO binds these cells through c-MET (FIG. 7D).
- InlB-PBKlO exhibits binding to c-MET on cells in suspension.
- InlB-PBKlO levels co-precipitating with cell pellets were then assessed by Western blotting using an antibody specific for InlB-PBKlO (Ad5 antibody, which recognizes the penton base).
- Ad5 antibody which recognizes the penton base.
- the levels of Inl-PBK10 binding decreased as the concentration of InlB increased, with binding nearly completely inhibited, thus verifying that InlB-PBKlO can recognize and bind c-MET on cells in suspension (FIG. 7E).
- InlB-PBKlO internalizes into C-MET+ cells.
- InlB-PBKlO we first incubated InlB-PBKlO with three different cell types, MDA-MB-231, MDA-MB-435 and H1993, at 4°C to promote receptor binding but not internalization.
- To induce endocytosis we then incubated the cells at 37°C for the indicated times and fixed the cells at the specific time points up to 30 minutes.
- Immunofluorescent staining and confocal microscopy show that in all the three cell lines InlB-PBKlO (shown in green) congregated on the cell membrane and gathered into foci at the cell membrane within the first 5 minutes of binding.
- InlB-PBKlO then accumulated in the perinuclear region by 30 minutes. These data show that InlB-PBKlO can internalize and accumulate inside the cells within 30 minutes after cell binding (FIG. 8). Cells were fixed at the specific time points up to 30 minutes and imaged by laser scanning confocal microscopy. Red, actin; Blue, nucleus. Bar, -10 microns.
- InlB-PBKlO delivers toxic molecules to C-MET+ cells.
- Sulfonated corroles containing gallium (III) S2Ga or Ga- corrole
- S2Ga or Ga- corrole are intensely fluorescent compounds that can spontaneously assemble with proteins.
- FIG. 9A shows the spherical assemblies formed when Ga-corrole (+S2Ga) is added to InlB-PBKlO compared to InlB-PBKlO alone (-S2Ga).
- the imaging shows that the protein and corrole form 10-20 nm diameter clusters.
- Dynamic light scattering, used to measure particle size, shows that InlB-PBKlO alone forms particles of 8.4 nm average diameter while MBPBKIO-Ga is about 16.4 nm diameter.
- InlB-PBK10-Ga could penetrate cells and induce corrole-mediated toxicity in c-MET positive cancer cell lines.
- MDA-MB-435 cells 1 ⁇ , 5 ⁇ and 10 ⁇ of each of the following: InlB-PBKlO, S2Ga and InlB- PBKIO-Ga.
- InlB-PBK10-Ga reduced cell survival by 60% whereas ⁇ and higher concentrations of S2Ga alone and InlB-PBKlO alone did not affect cell survival.
- These data affirm that InlB-PBKlO bears endosomolytic capacity, and shows that this construct is capable of delivering cytotoxic agents such as Ga-corroles into cells expressing cell surface c-MET (FIG. 9C).
- Doxorubicin is an FDA approved cytotoxic agent that is used for a broad range of cancer types. If such drugs could be targeted mainly to tumor cells, it would be beneficial in terms of reducing side effects.
- Dox is intercalated into a double stranded oligo to form DNA-Dox, which then can bind to the polylysine of InlB-PBKlO (via charge interactions with the DNA phosphate backbone) and form a complex that we have designated, I-Dox.
- the I-Dox complex (5 ⁇ with respect to Dox concentration) was incubated on the indicated cell lines under the conditions described in the Methods. InlB-PBKlO was incubated at equivalent concentrations to that in the I-Dox complex. Cell survival was assessed by metabolic (MTT) assay at 24h after treatment.
- MTT metabolic
- the I-Dox complex induced significant toxicity to cells with high c-MET expression (HI 993) when compared to cells with low c-MET expression (LAPC4) (FIG. 9D). H1993 cells were first treated with free InlB ligand to block c-MET, followed by exposure to I-Dox at the same conditions as above.
- InlB- PBK10 alone appeared to slightly but not significantly reduce cell numbers, suggesting that the main mechanism of cell death was through the delivery of Dox. Additionally, free InlB ligand inhibited cytotoxicity by I-Dox, suggesting that I-Dox-mediated cytotoxicity occurs through c-MET binding and entry for the delivery of Dox (FIG. 9E).
- MDA-MB-435 and MDA-MB-231 were maintained in DMEM, 10% v/v fetal bovine serum (FBS, Sigma-Aldrich), and 1% v/v penicillin/streptomycin (Sigma-Aldrich) under 5% C0 2 .
- H1993 and A2780 cells were maintained in RPMI, 10% v/v FBS, and 1% v/v penicillin/streptomycin under 5% C0 2 .
- Cos-7 cells were maintained in DMEM/F12 medium, 20% v/v non-heat inactivated fetal bovine serum (ATCC 30-2020), and 1% v/v penicillin/streptomycin (Sigma-Aldrich) under 5% C0 2 .
- LNCaP Neo/RANKL LNCaP Neo were maintained in RPMI medium, 10% v/v FBS, and 1% v/v penicillin/streptomycin and 200 ⁇ g of G418 disulfate salt solution (Sigma Aldrich G8168). 200 ⁇ g/ml of hygromycin (GEMINI Bio-products 400-123) was added to the medium of the LNCaP Neo/RANKL cells to maintain the RANKL-expression plasmid. In order to maintain equivalent confluency between the cell lines, in certain assays they were plated according to their growth rate.
- the targeting construct, InlB-PBK10 was produced by a two-step cloning method (Summarized in FIG. 8A) in which sequences encoding InlB and PBK10 were sequentially ligated together into the protein expression plasmid, pRSET-A (Invitrogen, Carlsbad, CA, USA).
- a plasmid construct encoding aa 36-321 of internalin B (pMET-30-InlB321) (CeBiTec), Bielefeld University, Germany) was used as a template for polymerase chain reaction (PCR) amplification using forward and reverse oligonucleotide primers containing the sequences, 5'-
- a Sacl restriction site was introduced in the forward primer for in-frame insertion into pRSET-A.
- Bglll and Kpnl restriction sites were introduced into the reverse primer for subsequent in-frame insertion of PBK10 just 3' to the InlB coding sequence.
- the reverse primer also contains a sequence encoding a flexible linker (GlyGlySerGlyGlySer) (SEQ ID NO:3) in-between the MB and PBK10 sequences.
- the 800 bp InlB PCR product was digested with Sacl and Kpnl for ligation into pRSET-A.
- the resulting construct, pRSETA-InlB was then digested with Bglll and Hindlll to accommodate the insertion of PBK10 in-frame with InlB.
- PBK10 was excised from the plasmid, pRSET- ⁇ , using BamHI and Hindlll restriction enzymes, and inserted into the Bglll-Hindlll sites of pRSETA-InlB, resulting in the pRSET-InlB-PBK10 construct.
- the pRSETA-GFP-InlB construct that encodes MB321 as a carboxy [C] -terminal fusion to green fluorescent protein (GFP) was made by digesting the 800 bp InlB PCR product, described earlier, with Sacl and Bglll, and ligating this into the pRSETA-GFP plasmid for in-frame cloning of InlB321.
- lysis buffer 50 mM Tris, pH 8.0, 50 mM NaCl, 2 mM EDTA, pH 8.0
- PMSF ImM phenylmethylsulfonyl fluoride
- lysates received 10 mM MgCl 2
- O.Olmg/ml DNase and lysates were rocked for 10 minutes at room temperature to allow digestion of genomic DNA before lysates were returned to ice, after which they received 300 mM NaCl and 10 mM imidazole.
- Lysates were transferred to pre-cooled centrifuge tubes, balanced, and centrifuged at 4 °C in a pre-chilled rotor at 39,000 x g for 1 hour. Supernatants were recovered, added to Ni-NTA resin (Qiagen, Valencia, CA, USA) pre- equilibrated with MCAC-10 (50 mM NaH 2 P0 4 , 300 mM NaCl, lOmM imidazole, and 0.1% Triton X-100, pH 8.0), and incubated for 1 h on ice.
- Ni-NTA resin Qiagen, Valencia, CA, USA
- the resin containing bound protein was washed with 20 mL of MCAC-10 buffer one time for 10 minutes rocking on ice and three times with MCAC-20 (50 mM NaH2P04, 500 mM NaCl, 20mM imidazole, and 10% glycerol, pH 8.0), followed by elution with 2 mL of a solution of 50 mM Na- phosphate, pH 8.0, 300 mM NaCl, 250 mM imidazole, and 10% glycerol.
- Proteins were simultaneously buffer exchanged into low-salt buffer and concentrated by ultrafiltration (Amicon Ultra Centrifugal Filters - Ultracel - 50K (Millipore, Bedford, MA, USA) and their concentrations measured using the BioRad protein quantification assay (BioRad Laboratories, Hercules, CA, USA).
- Antibody-antigen complexes were detected by incubation with horseradish peroxidase (HRP) conjugated secondary antibodies (Sigma, St Louis, MO, USA), followed by reaction with HRP substrate and chemiluminescence detection reagents (Thermo Fisher), and exposure to film (Hyperfilm ECL; Amersham Pharmacia Biotech).
- HRP horseradish peroxidase
- ELISA Based Assay for c-MET Cell Surface Expression To determine c-MET levels on cell lines, cells were plated in 96- well plates using the following cell numbers: 8xl0 3 MDA-MB-231, MDA-MB-435, A2780, LNCaP Neo/RANKL , LNCaP Neo and 9xl0 3 for HI 993 and LAPC4 per well.
- Buffer A serum free DMEM, 20mM HEPES pH 7.4, 2mM MgCl 2 , 3% BSA. Cells were incubated with 50 ⁇ ⁇ of buffer A containing the indicated concentrations of InlB- PBK10 for 1 hour on ice with agitation at 4°C.
- the indicated concentrations of InlB were incubated on cells before adding InlB-PBK10. Specifically, cell lines plated as described earlier were briefly washed with ⁇ Buffer A, followed by incubation in 50 ⁇ L ⁇ of buffer A containing 1 ⁇ , 5 ⁇ or 10 ⁇ of InlB for an hour on ice with agitation at 4 °C. Cells were washed one time with Buffer A (100 ⁇ ) and then incubated with 50 ⁇ ⁇ of Buffer A containing 1 ⁇ of MB-PBKIO for an hour on ice with agitation at 4 °C.
- the cells were washed with PBS+ (200 ⁇ /well) one time and processed for immune-detection of surface-bound InlB-PBK10 as described earlier, except plates were incubated with an antibody that recognizes the penton base domain of InlB-PBK10 (Ad5 antibody; Abeam) at 1:5000 dilution. Plates were incubated with secondary antibody (goat anti rabbit, at 1:2000 dilution), for one hour at room temperature. Binding was detected as explained earlier for c-MET cell surface expression ELISA.
- MDA-MB-435 cells were plated in 96-well plates at 8x10 cells per well. 48 hrs later medium was aspirated and the cells were incubated with 30-50 ⁇ 1 of media containing the different concentrations of InlB-PBK10- Ga and S2Ga (1, 5 and 10 ⁇ ) for 4 hours on a rocker at 37 °C in a 5% C0 2 incubator. After the 4 hour incubation period, additional media was added to bring the total volume per well to 100 ⁇ ⁇ and cells were incubated for approximately 24 hrs without rocking. Promega CellTiter 96 Aqueous Non-Radioactive Cell Proliferation Assay was used to measure cell viability.
- cells were washed with PBS+, containing 1 mM Ca 2+ and 1 mM Mg 2+ , then incubated with 0.1% crystal violet ( ⁇ /well) for 15 minutes at RT and then washed 4 times with PBS+ (200 Plates were incubated with 95% Ethanol (100 for lOmin. at RT, and absorbance was measured at 590 nm.
- InlB-PBKlO uptake/intracellular trafficking assays For InlB-PBKlO uptake assays, cells were plated on coverslips in a twelve-well dish at lxlO 5 cells/well and grown for 2 days. On the day of treatment, dishes were transferred on ice and the cells were treated for the indicated experiments according to the following methods. To study the time course of uptake, cells were washed twice with cold PBS, and then 0.4 mL of Buffer A with 8 ⁇ g of InlB-PBKlO was added to each well.
- Dishes were incubated for 1 h on ice rocking at 4 °C to promote receptor binding but not internalization, and then cells were washed with cold PBS to remove unbound protein. Wells then received pre- warmed complete media, and dishes were incubated at 37 °C at 5% C0 2 for the indicated time points. The individual coverslips were then removed, washed three times with PBS/1% MgCl 2 then then fixed with 4% paraformaldehyde in PBS for 15 min at room temperature.
- Coverslips were washed three times with PBS, then incubated with 50 mM ammonium chloride in PBS for 5 min, 0.1% Triton X-100 in PBS for 5 min and then blocked with 1%BSA in PBS for 30minutes at room temperature.
- Cells on coverslips were incubated with primary antibodies overnight at 4 °C, washed three times with PBS and incubated with secondary antibodies for 1 h at room temperature in the dark. Where indicated, cells counterstained for actin and nuclei were incubated with Texas Red x- Phalloidin (Invitrogen T7471) at 1: 100 dilution during the secondary antibody incubation, followed by a 5 min incubation in DAPI at 300 nM final concentration.
- Phalloidin, DAPI and primary and secondary antibodies were all diluted in 1% BSA in PBS. After secondary antibody and DAPI treatment, cells on cover slips were washed three times with PBS and mounted in Prolong Antifade mounting medium (Molecular Probes, Eugene, OR, USA).
- the RGS-His antibody (Qiagen) was used at 1: 150 dilution and a fluorophore-conjugated goat anti-mouse (FITC-conjugated) at dilution of 1:500 was used for fluorescence detection at 488nm for InlB-PBKlO, 405 nm (DAPI) for nuclei and 532 nm (Texas red) for F- Actin.
- FITC-conjugated fluorophore-conjugated goat anti-mouse
- InlB-PBKlO-Dox (I-Dox) assembly The viral capsid-derived fusion protein, InlB-PBKlO, was assembled with doxorubicin following well-established procedures. Briefly, complementary oligonucleotide duplexes were prepared by mixing together with equal molar concentration of the 30 base oligonucleotide, LLAA-5 (5'- CGCCTGAGCAACGCGGCGGGCATCCGCAAG-3 ' ) (SEQ ID NO:4) and its corresponding reverse complement, LLAA-3. The mixture was boiled for 5 minutes and cool down to room temperature for 30min to promote annealing of oligonucleotides.
- the double stranded oligos were mixed with Dox at 1: 10 molar ratio (DNA:Dox) and incubated at room temperature (RT) for 30 minutes, followed by incubation with InlB- PBK10 at 6: 1 molar ratio of MB-PBK10:DNA-Dox in HBS, and ultrafiltration using 50k MW cutoff (mwco) filter membranes (which was prepared by pre-incubating with 10% glycerol for 2hours-overnight) to isolate I-Dox from incompletely assembled components.
- the complexes were centrifuged at 4000 x g for 15min or until volume was reduced by >80%.
- InlB-PBK10-Ga assembly InlB-PBK10 was noncovalently assembled with sulfonated gallium corrole (S2Ga) by incubating a lOx molar excess of corrole with InlB-PBK10 in the dark at 4°C for 1 h with gently agitation. The unbound corroles were removed by ultrafiltration through 50 K MW cutoff spin column filters (Millipore Corporation, Billerica, MA, USA) according to the manufacturer's procedures for filtration, and the complexes washed with PBS until the filtrate clarified. The retentates retained their bright green color (indicative of corrole pigment) throughout the filtration process.
- S2Ga sulfonated gallium corrole
- the retentates were resuspended in PBS and measured for absorbance at t of the corrole to obtain the corrole concentration as described earlier. Whereas the S2Ga, for example, shifts from 424 to 429 nm when bound to proteins, this does not dramatically change the estimation of corrole concentration in complexes.
- the tubes were spun for 2 minutes at 300 x g and resuspended with 3% milk in PBS containing the indicated concentrations of InlB and incubated on ice in the cold room for 1 hr. Cells were then washed four times with PBS and incubated with RGS-His antibody diluted 150 fold in 3% BSA in PBS for 30min at room temperature. Cells were washed four times before re- suspending them with secondary antibody antibody, Alexa Fluor 647 Goat Anti-Mouse IgG (H+L), in 3% BSA and incubated at room temperature for 30min. Cells were washed 4 times, incubated with 0.1% PFA for 15min and then washed again for four times and analyzed with Beckman Coulter Cyan ADP FACS machine.
- MB321 and MET peptide (YCP2247 SPEED BioSystems. RockviUe, MD) were incubated in 3% milk in IxPBS for 30-40min on ice before binding to cells.
- the binding assay was performed as described above.
- MDA-MB-435 cells grown for 48hrs were lifted using 2 mM EDTA in lx PBS at 37 °C with agitation for 5-10min. After spinning the cells for 5min at 300 x g, they were washed once and resuspended in Buffer A+3% BSA and divided into four Eppendorf tubes (2 x 10 6 cells/tube). The cells were spun again and resuspended into 500 ⁇ ⁇ of buffer A+3%BSA. In three of the tubes 0.4 ⁇ , 2 ⁇ and 4 ⁇ of InlB was added and no protein was added to the fourth tube; all tubes were incubated on ice for 1 hr.
- InlB-PBKlO in 500ul of Buffer A was added to all four tubes, followed by rocking on ice for 2 hours to promote receptor binding but not internalization. Cells were washed and spun three times as described earlier. Pellets then suspended in 50 ⁇ , of SDS-PAGE sample buffer and evaluated by SDS-PAGE/Western blotting using an antibody specific to InlB-PBKlO (Ad5 antibody, which recognizes the penton base) at the 1:5000 dilution.
- Ad5 antibody which recognizes the penton base
- Example 3 Inl-PBKIO biodistribution in nu/nu mice bearing bilateral flank MDA- MB-435 tumors
- MDA-MB-435 cells display marked levels of c-MET on the cell surface.
- the c-MET targeted protein construct, InlB- PBK10 binds these cells through an interaction that is competitively inhibited by the c- MET ligand, InlB, indicating that this construct can bind these cells through c-MET.
- FIG. 7E the c-MET targeted protein construct, InlB- PBK10
- FIG. 8 shows that InlB-BKlO enters these cells after receptor binding
- Figure 9C shows that the protein can mediate the delivery of a membrane impermeable toxic molecule (gallium-metallated corrole) into these cells, causing cell death (thus also verifying that Inl-PBK10 is capable of endosomal membrane disruption).
- a membrane impermeable toxic molecule gallium-metallated corrole
- the mouse was sacrificed and tumors and tissues removed for further imaging. While the tumors show some fluorescence accumulation, a significant proportion of injected material was eliminated to the kidney by 4 hours while some fluorescence could be detectable in the liver (FIG. 10B). Remaining tissues, including heart, spleen, lung, brain, and skeletal muscle, showed no detectable fluorescence (FIG. 10B). Further studies will entail tissue harvest at earlier and later time points to determine whether delivery to the kidney is the result of rapid elimination, as well as determining biodistribution with a competitive inhibitor to verify that tumor delivery occurs via c-MET.
- HER3 human epidermal growth factor receptor subunit 3
- BBB blood brain barrier
- HER2+ breast tumors that metastasize to the brain these tumors, while targetable outside of the central nervous system (CNS) by HER2 antibodies such as trastuzumab, are unreachable by these same antibodies because the HER2 subunit, though present on the brain endothelium, does not mediate antibody transcytosis across the blood vessel wall.
- HerMn a self-assembling nanobiological particle
- HerMn which uses HER3 as a portal for targeted entry of toxic molecules into tumor cells.
- HerMn is a 10-20 nm diameter serum- stable particle comprised of the receptor-targeted cell penetration protein, HerPBKlO, non- covalently assembled with a sulfonated manganese(III) corrole (S2Mn or Mn-corrole) (FIG. 11).
- HerPBKlO The targeting domain of HerPBKlO is derived from the ligand, heregulin alpha, which specifically interacts with the human epidermal growth factor receptor subunit 3 (HER3) and induces rapid receptor-mediated endocytosis.
- HER3 is the preferred dimerization partner of HER2
- HER2-3 heterodimers are prevalent on HER2+ tumor cells.
- HerPBKlO can target therapeutic and imaging molecules to HER2+ tumors in mice, mediating tumor growth ablation at >10x lower dose compared to the chemotherapy agent, doxorubicin, while sparing heart and liver tissue, and with no detectable immunogenicity.
- Tumor-targeted toxicity by HerMn occurs by mitochondria membrane disruption and superoxide-mediated damage to the cytoskeleton. HerMn can also elicit tumor- selective detection by magnetic resonance imaging (MRI) due to the paramagnetic property of the corrole.
- MRI magnetic resonance imaging
- HerMn appears to distribute to the brain after systemic injection in mice, in addition to showing preferential homing and toxicity to subcutaneous HER2+ tumors. Interestingly, the Mn corrole is known to exhibit neuroprotective effects due to its antioxidant activity on normal tissue. In support, HerMn supports human cardiac cell survival ex vivo. Taken altogether, it is intriguing to speculate that HerMn may have the capacity to target toxicity to brain-metastatic breast tumors while sparing off-target tissue due to both its targeting capacity and ability to provide beneficial protective effects to normal tissue such as the brain and heart.
- Brain metastasis is a serious clinical problem. Patients with breast cancer metastases to the brain on average survive less than one year. While a growing repertoire of targeted therapies have emerged for treating peripheral tumors, most are unsuitable for treating brain metastases due to their inability to cross the blood brain barrier (BBB).
- BBB blood brain barrier
- An example of this is the use of the monoclonal antibody, trastuzumab (Tz), which is directed against the human epidermal growth factor receptor subunit 2 (HER2) for treating HER2+ breast cancer.
- Tz trastuzumab
- HER2+ cancers are associated with aggressive tumors, recalcitrance to standard therapies, metastasis, and increased mortality.
- TNBC triple-negative breast cancer
- Lp lapatinib
- TKI tyrosine kinase inhibitor
- HerPBKlO is specific to HER3.
- HerPBKlO contains the receptor binding region of the HER3 ligand, heregulin-cc (amino acids 35-239, comprising the Ig- like and EGF-like domains), fused to a membrane-penetrating moiety derived from the adenovirus penton base capsid protein (FIG. 11A).
- HerPBKlO was originally designed as a non-viral gene transfer vector, containing payload assembly, targeting, internalization, and endosomal penetration functions within a single multidomain protein molecule.
- HerPBKlO can target therapeutic and imaging molecules to HER2+ tumors in mice, mediating tumor growth ablation at >10x lower dose compared to the chemotherapy agent, doxorubicin, while sparing heart and liver tissue, and with no detectable immunogenicity.
- FIG. 12A The specificity of HerPBKlO to HER3 is supported by its ability to bind to an immobilized peptide containing the extracellular domain of human HER3 (FIG. 12A). This is inhibited by pre-adsorption of HerPBKlO with free HER3 peptide in vitro (FIG. 12A). The same peptide also inhibits binding to both human (FIG. 12B) and mouse (FIG. 13B-C) HER3+ cells. Notably, the ligand-binding domain of mouse and human HER3 share high (94%) sequence identity (FIG. 13A).
- HER2-3 heterodimers are prevalent on HER2+ tumor cells, the heterodimerization-inhibiting antibody, pertuzumab (Pz), does not prevent HerPBKlO binding to cellular HER3 (FIG. 12B), indicating that HER2-3 dimerization is not required for HerPBKlO binding. Binding is also not inhibited by a HER4 peptide or betacellulin (which blocks HER4) (FIG. 12B), indicating that HerPBKlO is HER3- specific.
- HerPBKlO self-assembles with Mn-corroles to form HerMn nanoparticles.
- the carboxy [C]-terminus of HerPBKlO is comprised of a decalysine tail (FIG. 11 A), which can mediate electrophilic binding to anionic molecules, including corroles.
- Corroles are macrocyclic molecules with structural similarity to porphyrins and likewise can contain a metal ligand (FIG. 11B).
- Sulfonated corroles are amphiphilic, soluble in physiological solutions, and can spontaneously bind proteins through non- covalent interactions, including electrophilic and hydrophobic interactions.
- the anionic sulfonato groups prevent non-specific cell entry due to repulsion by the negatively charged cell membrane, thus enabling the potential to direct corrole delivery into target cells via a carrier protein.
- HerPBKlO a sulfonated manganese(III) corrole (S2Mn or Mn-corrole) to form rapidly self-assembling 10-20 nm diameter particles designated HerMn (FIG. 11C-D). These particles contain multiple corrole molecules bound to a single protein (25-35 corroles/protein), and can withstand high-speed ultrafiltration.
- HerMn targets HER3+ tumors.
- HerMn exhibits targeted toxicity to HER2+/HER3+ but not HER2-/HER3- tumor cells in culture while Mn-corrole has no effect on cell survival.
- the data is shown in FIG. 14, where each cell line received the indicated concentration of HerMn or S2Mn and was assessed for survival 24 hours later via crystal violet (CV) stain.
- N 3 per concentrate, from 3 separate experiments. It has been shown that the targeting ligand of HerPBKlO induces rapid endocytosis after receptor binding. As sulfonated corroles are unable to breach the endosomal membrane on their own, the penton base moiety of HerPBKlO enables effective membrane disruption after endocytic uptake, and entry into the cytoplasm.
- FIG. 15 A where the control is PBS-treated.
- Confocal fluorescence images, FIG. 15B show superoxide- mediated collapse of actin (red) and tubulin (green) by HerMn (5 ⁇ ) after 24h incubation on MDA-MB-435 cells.
- S2Mn (5 ⁇ ), HerPBKlO (at equivalent protein concentration as HerMn) and PBS served as controls.
- MDA-MB-435 cells were transfected with a plasmid expressing exogenous TSPO (as a competitive inhibitor of endogenous TSPO binding) 24h before cells were treated with HerGa and examined for HerGa-mediated mitochondrial disruption, evidenced by reduced red fluorescent dye accumulation in mitochondria and accumulated green fluorescence in the cytoplasm (FIG. 16C-D).
- TSPO translocates porphyrins and other metabolites into mitochondria for processing, interacts with components of the mitochondrial permeability transition pore complex, and contributes to cellular homeostasis.
- Ga-corrole specifically recognizes the porphyrin-binding site on TSPO (FIG. 16A-B), as corrole binding can be competitively inhibited by PK11195, which inhibits porphyrin binding to TSPO.
- Overexpression of recombinant soluble TSPO in MDA-MB-435 cells prevents corrole - mediated disruption of mitochondrial membrane potential (FIG. 16C-D), suggesting that the corrole interacts with TSPO in situ.
- Mn-corrole exhibits similar mitochondrial membrane disruption as the Ga-corrole, it is likely that TSPO is a molecular target of Mn- corrole.
- HerMn homes to tumors in vivo after systemic delivery, bypassing most normal tissue including the heart (FIG. 17), and ablates tumor growth at very low pharmacologic dose (0.008 mg/kg) (FIG. 18A).
- the Mn- corrole is also paramagnetic, thus useful for MRI.
- HerMn can distribute to the brain in contrast to trastuzumab (Tz) (FIG. 17).
- HerPBKlO injected in the tail veins of mice without tumors also show brain localization, whereas systemic delivery of PBK10 (which lacks the HER3 targeting ligand) shows no detectable brain delivery (FIG. 19).
- HerMn is not only non-toxic to human cardiosphere-derived cells (CDCs), but at escalating doses with extended exposure, augments CDC survival in culture, in contrast to doxorubicin (which has known cardiotoxicity), and HerPBKlO alone, which has no toxic or growth promoting effect on tumor cells or CDCs (FIG. 18B).
- CDCs human cardiosphere-derived cells
- HerPBKlO alone, which has no toxic or growth promoting effect on tumor cells or CDCs
- HerMn imparts a beneficial effect on normal tissue while targeting toxicity to tumor tissue, especially brain metastases with elevated HER3.
- the targeting specificity of HerMn renders this point less relevant, as a minority of systemic particles appear to distribute to non-tumor tissue (FIG. 17). But, as relatively low corrole levels afford neuroprotection, as well as tumor toxicity (FIG. 18A), this potential dual activity is worth exploring.
- HerMn has the capability of delivering toxicity to brain-metastatic breast tumors while sparing off-target tissue due to both its targeting capacity and ability to provide protection to normal tissue such as the brain and heart.
- Example 5 Targeting beta-1 integrins using Yersinia enterocolitica Invasin-derived peptide
- Yersinia enterocolitica is a bacterial pathogen that invades the intestinal epithelium, particularly the Peyer's patches of the intestinal wall, and causes food poisoning. Binding and entry of intestinal epithelia occurs through the interaction of the bacterial invasin (Inv) protein with beta-1 integrins, which are predominantly expressed on epithelial cells overlying Peyer's patches.
- Inv bacterial invasin
- the plasmid containing the nucleotide sequence encoding Invasin (pHIT123-Inv) was used as a PCR template, and oligonucleotide primers were designed to amplify the minimal sequence encoding the beta-1 integrin binding site (-600 bp) while introducing restriction sites for in-frame cloning into exogenous peptides for targeted delivery.
- the primers used included the following sequences: 5'- AC AG AGCTC ATA ACCGGC ATTA ACGTG A AT- 3 ' (SEQ ID NO:6); 5'- CTGTGTGCGG AGCCGC A AT AGG A ATTC ATC- 3 ' (SEQ ID NO:7); and 5'- GATGAATTCCTATTGCGGCTCCGCACACAG-3' (SEQ ID NO: 8). These primers are used for amplifying and adding Sacl and EcoRI restriction sites to Inv insert.
- Additional primers included the following sequences: 5'- GTCCAAAACCAAGAAAAGGCGGAGCAGCTGTAC-3' (SEQ ID NO:9); 5'- AC A ATG ACGCGTGT AC AGCTGCTCCGCCTTTTCTTGGTTTTGG AC- 3 ' (SEQ ID NO: 10); 5 ' -CCGCTGTGTGCGGAGCCGCAAGGAGGAACGCGTACACAC-3 ' (SEQ ID NO: 11 ) ; 5 ' -GTGTGTACGCGTTCCTCCTTGCGGCTCCGCACACAGCGG-3 ' (SEQ ID NO: 12); and 5 ' - AC ACACGGATCCTTGCGGCTCCGC ACACAGCGG-3 ' (SEQ ID NO: 13). These primers introduce Mlul or BamHI restriction sites for cloning into either Knob or full-length fiber constructs.
- the exogenous peptides encode the adenovirus (Ad) capsid fiber and knob proteins.
- the fiber delineates each of the antenna- like projections extending from the Ad capsid that mediate primary cell binding to initiate infection, and are comprised of an N-terminal long fibrous shaft domain followed by a C-terminal globular knob domain.
- the knob domain is what specifically interacts with cell surface receptor and is produced as a soluble protein in the absence of the shaft.
- Inv is an effective ligand when fused to PBK10.
- the Inv sequence is inserted into the knob using two strategies of replacing knob sub-domains with Inv, resulting in the recombinant knob constructs, ABCJ-Inv and AGJ-Inv.
- Recombinant protein is produced in bacteria from pRSET vectors expressing these constructs, as both N-terminally GFP-tagged (GFP-ABCJ-Inv and GFP-AGJ-Inv) and untagged protein.
- Inv was inserted into the DG loop of the knob and used in vitro translation to produce S35-labeled protein.
- TITLPCRIKQFINMWQEVGKAMYAPPISGQIRCSSNITGLLLTR SEQ ID NO:5
- HAV human immunodeficiency virus
- SEQ ID NO:5 derived from the CD4 binding domain of the human immunodeficiency virus (HIV) gpl20 envelope protein, is sufficient for binding to CD4.
- This sequence was obtained using standard molecular biology techniques.
- the nucleic acid sequence encoding SEQ ID NO:5 (-132 nt) was cloned into pBluescript (PSK) plasmid. Ethidium bromide stained electrophoresis gel showed excision of insert (-132 nt) from the vector (-3 kb) by BamHI-EcoRI digest.
- the resulting product is then inserted in-frame with exogenous peptides such as PBK10 for targeting such delivery proteins to cells expressing CD4 (i.e. "helper" T-cells).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Epidemiology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Immunology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Biochemistry (AREA)
- Cell Biology (AREA)
- Nanotechnology (AREA)
- Oncology (AREA)
- Gastroenterology & Hepatology (AREA)
- Dermatology (AREA)
- Biophysics (AREA)
- Virology (AREA)
- Genetics & Genomics (AREA)
- Hematology (AREA)
- Optics & Photonics (AREA)
- Inorganic Chemistry (AREA)
- Biomedical Technology (AREA)
- Physics & Mathematics (AREA)
- Zoology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicinal Preparation (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
Priority Applications (17)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP15737653.4A EP3096773B1 (en) | 2014-01-17 | 2015-01-16 | Receptor targeting constructs and uses thereof |
| CN201580004623.9A CN106413738B (zh) | 2014-01-17 | 2015-01-16 | 受体靶向构造物和其使用 |
| CA2935404A CA2935404C (en) | 2014-01-17 | 2015-01-16 | Receptor targeting constructs and uses thereof |
| RU2016124731A RU2682335C2 (ru) | 2014-01-17 | 2015-01-16 | Рецептор-направленные конструкции и их применение |
| HK17105050.7A HK1231385B (en) | 2014-01-17 | 2015-01-16 | Receptor targeting constructs and uses thereof |
| JP2016546449A JP6608370B2 (ja) | 2014-01-17 | 2015-01-16 | 受容体標的化構築物およびその使用 |
| US15/112,162 US10183078B2 (en) | 2014-01-17 | 2015-01-16 | Receptor targeting constructs and uses thereof |
| EP20182924.9A EP3791889B1 (en) | 2014-01-17 | 2015-01-16 | C-met receptor targeting constructs and uses thereof |
| BR112016016202A BR112016016202A2 (pt) | 2014-01-17 | 2015-01-16 | Construtos de direcionamento de receptores e uso dos mesmos |
| KR1020167020838A KR102434541B1 (ko) | 2014-01-17 | 2015-01-16 | 수용체 표적화 작제물 및 이의 용도 |
| MX2016009284A MX381016B (es) | 2014-01-17 | 2015-01-16 | Composiciones de nanopartículas para su uso en la entrega de una carga útil al cerebro. |
| AU2015206271A AU2015206271B2 (en) | 2014-01-17 | 2015-01-16 | Receptor targeting constructs and uses thereof |
| IL246668A IL246668B (en) | 2014-01-17 | 2016-07-07 | Structures targeting receptors and their uses |
| ZA2016/05237A ZA201605237B (en) | 2014-01-17 | 2016-07-28 | Receptor targeting constructs and uses thereof |
| US16/197,240 US11369687B2 (en) | 2014-01-17 | 2018-11-20 | Receptor targeting constructs and uses thereof |
| AU2020203434A AU2020203434B2 (en) | 2014-01-17 | 2020-05-25 | Receptor Targeting Constructs And Uses Thereof |
| US17/751,366 US12502351B2 (en) | 2014-01-17 | 2022-05-23 | Receptor targeting constructs and uses thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201461928903P | 2014-01-17 | 2014-01-17 | |
| US61/928,903 | 2014-01-17 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/112,162 A-371-Of-International US10183078B2 (en) | 2014-01-17 | 2015-01-16 | Receptor targeting constructs and uses thereof |
| US16/197,240 Division US11369687B2 (en) | 2014-01-17 | 2018-11-20 | Receptor targeting constructs and uses thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2015109264A1 true WO2015109264A1 (en) | 2015-07-23 |
Family
ID=53543519
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2015/011870 Ceased WO2015109264A1 (en) | 2014-01-17 | 2015-01-16 | Receptor targeting constructs and uses thereof |
Country Status (12)
| Country | Link |
|---|---|
| US (3) | US10183078B2 (https=) |
| EP (2) | EP3791889B1 (https=) |
| JP (3) | JP6608370B2 (https=) |
| KR (1) | KR102434541B1 (https=) |
| CN (1) | CN106413738B (https=) |
| AU (2) | AU2015206271B2 (https=) |
| BR (1) | BR112016016202A2 (https=) |
| IL (1) | IL246668B (https=) |
| MX (1) | MX381016B (https=) |
| RU (1) | RU2682335C2 (https=) |
| WO (1) | WO2015109264A1 (https=) |
| ZA (1) | ZA201605237B (https=) |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2880160A4 (en) * | 2012-08-03 | 2016-04-20 | Cedars Sinai Medical Center | ISOLATION OF TRAFFIC-REINFORCING MUTANTS OF AN ACTIVE-SPREADING PROTEIN |
| US9850293B2 (en) | 2014-04-04 | 2017-12-26 | Cedars-Sinai Medical Center | Targeting trastuzumab-resistant HER2+ breast cancer with a HER3-targeting nanoparticle |
| WO2018067526A1 (en) * | 2016-10-03 | 2018-04-12 | Eos Biosciences, Inc. | Functional rna and small-molecule drug therapeutic complexes and nanoparticle delivery vehicles |
| US10183078B2 (en) | 2014-01-17 | 2019-01-22 | Cedars-Sinai Medical Center | Receptor targeting constructs and uses thereof |
| RU2688422C1 (ru) * | 2018-06-07 | 2019-05-21 | Светлана Александровна Ермолаева | Рекомбинантный интерналин В 321, полученный с помощью штамма Escherichia coli |
| US11795454B2 (en) | 2009-01-23 | 2023-10-24 | Cedars-Sinai Medical Center | Targeted delivery system |
| US12569569B2 (en) | 2020-03-15 | 2026-03-10 | Nanocarry Therapetics Ltd. | Nano-delivery system and therapeutic and diagnostic use thereof |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2009009441A2 (en) | 2007-07-06 | 2009-01-15 | Cedars-Sinai Medical Center | Self-assembling complex for targeting chemical agents to cells |
| RU2674146C2 (ru) | 2013-05-08 | 2018-12-07 | Седарс-Синай Медикал Центр | Нацеленные корролы, проявляющие опухолевую токсичность и предназначенные для мрт |
| CN108865147B (zh) * | 2018-06-01 | 2021-05-18 | 福州大学 | 一种埃罗替尼保护的铂银纳米簇及其制备方法 |
| WO2020028562A1 (en) * | 2018-07-31 | 2020-02-06 | Loma Linda University | Snail sirna-loaded mesoporous silica nanoparticles |
| CN119868271A (zh) * | 2024-12-30 | 2025-04-25 | 沈阳药科大学 | 一种化疗药物与免疫刺激剂共递送的功能性聚合物胶束及其制备方法和应用 |
Citations (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US4495285A (en) | 1981-10-30 | 1985-01-22 | Kimihiro Shimizu | Plasminogen activator derivatives |
| US4609546A (en) | 1982-06-24 | 1986-09-02 | Japan Chemical Research Co., Ltd. | Long-acting composition |
| EP0268110A1 (en) | 1986-10-27 | 1988-05-25 | Cetus Oncology Corporation | Pharmaceutical compositions of recombinant interleukin-2 and formulation processes |
| EP0270799A1 (en) | 1986-10-27 | 1988-06-15 | Cetus Oncology Corporation | Pharmaceutical compositions of recombinant beta-interferon and formulation processes |
| US4766106A (en) | 1985-06-26 | 1988-08-23 | Cetus Corporation | Solubilization of proteins for pharmaceutical compositions using polymer conjugation |
| USRE36397E (en) | 1994-02-04 | 1999-11-16 | The John Hopkins University | Inhibitors of poly(ADP-ribose) synthetase and use thereof to treat NMDA neurotoxicity |
| WO2009009441A2 (en) | 2007-07-06 | 2009-01-15 | Cedars-Sinai Medical Center | Self-assembling complex for targeting chemical agents to cells |
| US20110318338A1 (en) * | 2005-10-14 | 2011-12-29 | Phigenix, Inc. | Targeting pax2 for the treatment of breast cancer |
| US20120004181A1 (en) | 2009-01-23 | 2012-01-05 | Cedars-Sinai Medical Center | Targeted delivery system |
| US20120071540A1 (en) * | 2008-12-31 | 2012-03-22 | Lu Patrick Y | Compositions and Methods Using siRNA Molecules and siRNA Cocktails for the Treatment of Breast Cancer |
| US8541568B2 (en) * | 2008-05-24 | 2013-09-24 | Hai Yan | Compositions and methods using siRNA molecules for treatment of gliomas |
Family Cites Families (31)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5391723A (en) | 1989-05-31 | 1995-02-21 | Neorx Corporation | Oligonucleotide conjugates |
| US5559099A (en) | 1994-09-08 | 1996-09-24 | Genvec, Inc. | Penton base protein and methods of using same |
| US6333396B1 (en) | 1998-10-20 | 2001-12-25 | Enzon, Inc. | Method for targeted delivery of nucleic acids |
| CA2391534A1 (en) | 1999-11-15 | 2001-05-25 | Drug Innovation & Design, Inc. | Selective cellular targeting: multifunctional delivery vehicles |
| US6855135B2 (en) | 2000-11-29 | 2005-02-15 | Hill-Rom Services, Inc. | Vacuum therapy and cleansing dressing for wounds |
| AU2002240201A1 (en) | 2001-02-02 | 2002-08-19 | Yale University | Peptides for facilitating composite receptor expression and translocation of macromolecules |
| WO2002094318A1 (en) | 2001-05-18 | 2002-11-28 | University Of Southern California | Vector for targeted delivery to cells |
| US6939963B2 (en) | 2001-07-02 | 2005-09-06 | Technion Research And Development Foundation Ltd. | Method for the preparation of selectively-substituted corroles and new substituted corroles |
| SE0201863D0 (en) | 2002-06-18 | 2002-06-18 | Cepep Ab | Cell penetrating peptides |
| JP2004024724A (ja) | 2002-06-28 | 2004-01-29 | Biopol Co Ltd | 多層構造の微細多孔性フォームドレッシング材及びその製造方法 |
| US7329638B2 (en) | 2003-04-30 | 2008-02-12 | The Regents Of The University Of Michigan | Drug delivery compositions |
| US7205387B2 (en) | 2003-08-28 | 2007-04-17 | Agency For Science, Technology And Research | Recombinant polypeptide useful for neurotrophin receptor mediated gene delivery and as neurotrophin agonist |
| US20050096502A1 (en) | 2003-10-29 | 2005-05-05 | Khalili Theodore M. | Robotic surgical device |
| US20060014712A1 (en) | 2004-05-30 | 2006-01-19 | Cemines, Inc. | Controlled delivery of therapeutic compounds |
| US8057821B2 (en) | 2004-11-03 | 2011-11-15 | Egen, Inc. | Biodegradable cross-linked cationic multi-block copolymers for gene delivery and methods of making thereof |
| WO2006095267A1 (en) * | 2005-03-10 | 2006-09-14 | Institut Pasteur | Compositions for the treatment of tumour pathologies, comprising internalin b (in1b) of listeria monocytogene protein or a fragment thereof |
| WO2007137117A2 (en) | 2006-05-17 | 2007-11-29 | Massachusetts Institute Of Technology | Aptamer-directed drug delivery |
| US8791099B2 (en) | 2007-08-28 | 2014-07-29 | Technion Research And Development Foundation Ltd. | Transition metal complexes of corroles for preventing cardiovascular diseases or disorders |
| US10036099B2 (en) | 2008-08-07 | 2018-07-31 | Slt Technologies, Inc. | Process for large-scale ammonothermal manufacturing of gallium nitride boules |
| EP2473160A4 (en) | 2009-09-01 | 2015-06-03 | Univ Northwestern | ADMINISTRATION OF THERAPEUTIC AGENTS WITH OLIGONUCLEOTIDE-MODIFIED NANOPARTICLES AS SUPPORT |
| US20130065778A1 (en) | 2010-01-26 | 2013-03-14 | Yale University | MicroRNA Signatures Predicting Responsiveness To Anti-HER2 Therapy |
| WO2013151665A2 (en) * | 2012-04-02 | 2013-10-10 | modeRNA Therapeutics | Modified polynucleotides for the production of proteins associated with human disease |
| CN104661601B (zh) | 2012-05-22 | 2018-06-22 | 史密夫及内修公开有限公司 | 用于伤口治疗的设备和方法 |
| US10036009B2 (en) | 2012-08-03 | 2018-07-31 | Cedars-Sinai Medical Center | Isolating traffic-enhancing mutants of drug delivery protein |
| RU2674146C2 (ru) | 2013-05-08 | 2018-12-07 | Седарс-Синай Медикал Центр | Нацеленные корролы, проявляющие опухолевую токсичность и предназначенные для мрт |
| JP6608370B2 (ja) | 2014-01-17 | 2019-11-20 | シーダーズ―シナイ メディカル センター | 受容体標的化構築物およびその使用 |
| US9850293B2 (en) | 2014-04-04 | 2017-12-26 | Cedars-Sinai Medical Center | Targeting trastuzumab-resistant HER2+ breast cancer with a HER3-targeting nanoparticle |
| US10111898B2 (en) | 2014-08-27 | 2018-10-30 | Peptimed, Inc. | Anti-tumor compositions and methods |
| BR112018074304A2 (pt) | 2016-05-27 | 2019-10-01 | Cedars Sinai Medical Center | composições de nanopartículas, kit e método para tratar um indivíduo com câncer resistente a fármacos |
| EP3518939A4 (en) | 2016-10-03 | 2020-06-24 | EOS Biosciences, Inc. | FUNCTIONAL RNA AND THERAPEUTIC COMPLEXES WITH SMALL MOLECULAR ACTIVE SUBSTANCES AND NANOPARTICLE RELEASE VEHICLES |
| CA3087325A1 (en) | 2018-01-02 | 2019-07-11 | Cedars-Sinai Medical Center | Nanoparticles for the targeted delivery of therapeutic polypeptides |
-
2015
- 2015-01-16 JP JP2016546449A patent/JP6608370B2/ja active Active
- 2015-01-16 WO PCT/US2015/011870 patent/WO2015109264A1/en not_active Ceased
- 2015-01-16 MX MX2016009284A patent/MX381016B/es unknown
- 2015-01-16 BR BR112016016202A patent/BR112016016202A2/pt not_active Application Discontinuation
- 2015-01-16 CN CN201580004623.9A patent/CN106413738B/zh not_active Expired - Fee Related
- 2015-01-16 EP EP20182924.9A patent/EP3791889B1/en active Active
- 2015-01-16 RU RU2016124731A patent/RU2682335C2/ru active
- 2015-01-16 US US15/112,162 patent/US10183078B2/en active Active
- 2015-01-16 EP EP15737653.4A patent/EP3096773B1/en active Active
- 2015-01-16 AU AU2015206271A patent/AU2015206271B2/en active Active
- 2015-01-16 KR KR1020167020838A patent/KR102434541B1/ko active Active
-
2016
- 2016-07-07 IL IL246668A patent/IL246668B/en unknown
- 2016-07-28 ZA ZA2016/05237A patent/ZA201605237B/en unknown
-
2018
- 2018-11-20 US US16/197,240 patent/US11369687B2/en active Active
-
2019
- 2019-10-23 JP JP2019192818A patent/JP7665282B2/ja active Active
-
2020
- 2020-05-25 AU AU2020203434A patent/AU2020203434B2/en active Active
-
2022
- 2022-05-23 US US17/751,366 patent/US12502351B2/en active Active
-
2024
- 2024-08-05 JP JP2024128996A patent/JP2024156895A/ja active Pending
Patent Citations (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US4495285A (en) | 1981-10-30 | 1985-01-22 | Kimihiro Shimizu | Plasminogen activator derivatives |
| US4495285B1 (https=) | 1981-10-30 | 1986-09-23 | Nippon Chemiphar Co | |
| US4609546A (en) | 1982-06-24 | 1986-09-02 | Japan Chemical Research Co., Ltd. | Long-acting composition |
| US4766106A (en) | 1985-06-26 | 1988-08-23 | Cetus Corporation | Solubilization of proteins for pharmaceutical compositions using polymer conjugation |
| EP0270799A1 (en) | 1986-10-27 | 1988-06-15 | Cetus Oncology Corporation | Pharmaceutical compositions of recombinant beta-interferon and formulation processes |
| EP0268110A1 (en) | 1986-10-27 | 1988-05-25 | Cetus Oncology Corporation | Pharmaceutical compositions of recombinant interleukin-2 and formulation processes |
| USRE36397E (en) | 1994-02-04 | 1999-11-16 | The John Hopkins University | Inhibitors of poly(ADP-ribose) synthetase and use thereof to treat NMDA neurotoxicity |
| US20110318338A1 (en) * | 2005-10-14 | 2011-12-29 | Phigenix, Inc. | Targeting pax2 for the treatment of breast cancer |
| WO2009009441A2 (en) | 2007-07-06 | 2009-01-15 | Cedars-Sinai Medical Center | Self-assembling complex for targeting chemical agents to cells |
| US8541568B2 (en) * | 2008-05-24 | 2013-09-24 | Hai Yan | Compositions and methods using siRNA molecules for treatment of gliomas |
| US20120071540A1 (en) * | 2008-12-31 | 2012-03-22 | Lu Patrick Y | Compositions and Methods Using siRNA Molecules and siRNA Cocktails for the Treatment of Breast Cancer |
| US20120004181A1 (en) | 2009-01-23 | 2012-01-05 | Cedars-Sinai Medical Center | Targeted delivery system |
Non-Patent Citations (5)
| Title |
|---|
| "Remington: The Science and Practice of Pharmacy", 2000, WILLIAMS & WILKINS |
| HELLMAN ET AL.: "Principles of Cancer Management: Radiation Therapy", 2001, J. B. LIPPENCOTT COMPANY |
| KNAUF ET AL., J. BIO. CHEM., vol. 263, 1988, pages 15064 - 15070 |
| KOCHUT ET AL.: "Bacterial invasion factors: Tools for crossing biological barriers and drug delivery?", EUROPEAN JOURNAL OF PHARMACEUTICS AND BIOPHARMACEUTICS, vol. 84, no. 2, 19 June 2013 (2013-06-19), pages 242 - 250, XP028555021 * |
| See also references of EP3096773A4 |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11795454B2 (en) | 2009-01-23 | 2023-10-24 | Cedars-Sinai Medical Center | Targeted delivery system |
| EP2880160A4 (en) * | 2012-08-03 | 2016-04-20 | Cedars Sinai Medical Center | ISOLATION OF TRAFFIC-REINFORCING MUTANTS OF AN ACTIVE-SPREADING PROTEIN |
| US10036009B2 (en) | 2012-08-03 | 2018-07-31 | Cedars-Sinai Medical Center | Isolating traffic-enhancing mutants of drug delivery protein |
| US10752893B2 (en) | 2012-08-03 | 2020-08-25 | Cedars-Sinai Medical Center | Isolating traffic-enhancing mutants of drug delivery protein |
| US10183078B2 (en) | 2014-01-17 | 2019-01-22 | Cedars-Sinai Medical Center | Receptor targeting constructs and uses thereof |
| US9850293B2 (en) | 2014-04-04 | 2017-12-26 | Cedars-Sinai Medical Center | Targeting trastuzumab-resistant HER2+ breast cancer with a HER3-targeting nanoparticle |
| WO2018067526A1 (en) * | 2016-10-03 | 2018-04-12 | Eos Biosciences, Inc. | Functional rna and small-molecule drug therapeutic complexes and nanoparticle delivery vehicles |
| RU2688422C1 (ru) * | 2018-06-07 | 2019-05-21 | Светлана Александровна Ермолаева | Рекомбинантный интерналин В 321, полученный с помощью штамма Escherichia coli |
| US12569569B2 (en) | 2020-03-15 | 2026-03-10 | Nanocarry Therapetics Ltd. | Nano-delivery system and therapeutic and diagnostic use thereof |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12502351B2 (en) | Receptor targeting constructs and uses thereof | |
| Park et al. | Secreted protein acidic and rich in cysteine mediates active targeting of human serum albumin in U87MG xenograft mouse models | |
| CN101678078B (zh) | Sparc及其使用方法 | |
| US10391180B2 (en) | Self-assembling complex for targeting chemical agents to cells | |
| US20250121079A1 (en) | Targeted Protease Compositions and Uses Related Thereto | |
| CA2935404C (en) | Receptor targeting constructs and uses thereof | |
| US20210077575A1 (en) | Nanoparticles for the targeted delivery of therapeutic polypeptides | |
| WO2016073647A2 (en) | COMPOSITIONS AND METHODS FOR TREATING HIF-1alpha OVER-EXPRESSING CANCERS | |
| HK40112162A (zh) | 靶向蛋白造影剂、其制备方法及用途 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15737653 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2935404 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2015206271 Country of ref document: AU Date of ref document: 20150116 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 246668 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2016546449 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15112162 Country of ref document: US Ref document number: MX/A/2016/009284 Country of ref document: MX |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112016016202 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 20167020838 Country of ref document: KR Kind code of ref document: A |
|
| REEP | Request for entry into the european phase |
Ref document number: 2015737653 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2015737653 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2016124731 Country of ref document: RU Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 112016016202 Country of ref document: BR Kind code of ref document: A2 Effective date: 20160712 |