WO2015065020A1 - C형 간염 바이러스 감염 질환의 예방 또는 치료용 약학 조성물 - Google Patents

C형 간염 바이러스 감염 질환의 예방 또는 치료용 약학 조성물 Download PDF

Info

Publication number
WO2015065020A1
WO2015065020A1 PCT/KR2014/010200 KR2014010200W WO2015065020A1 WO 2015065020 A1 WO2015065020 A1 WO 2015065020A1 KR 2014010200 W KR2014010200 W KR 2014010200W WO 2015065020 A1 WO2015065020 A1 WO 2015065020A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
protein
grim19
fragment
hepatitis
Prior art date
Application number
PCT/KR2014/010200
Other languages
English (en)
French (fr)
Inventor
윤승규
김정희
허원희
조미라
최정은
이은별
Original Assignee
가톨릭대학교 산학협력단
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from KR1020140144534A external-priority patent/KR101638156B1/ko
Application filed by 가톨릭대학교 산학협력단 filed Critical 가톨릭대학교 산학협력단
Priority to US15/032,717 priority Critical patent/US10195166B2/en
Publication of WO2015065020A1 publication Critical patent/WO2015065020A1/ko

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702—Regulators; Modulating activity
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011—Details
    • C12N2770/24011—Flaviviridae
    • C12N2770/24211—Hepacivirus, e.g. hepatitis C virus, hepatitis G virus

Definitions

  • the present invention relates to a pharmaceutical composition for preventing or treating hepatitis C virus (HCV) infection disease. More specifically, the present invention provides a Gene-associated with Reinoid-Interferon induced Morality 19 (GRIM19) protein or a fragment thereof; And it relates to a pharmaceutical composition for the prevention or treatment of hepatitis C virus infection disease or an antiviral composition for hepatitis C virus comprising one or more selected from the group consisting of the gene encoding the protein or protein fragment.
  • HCV hepatitis C virus
  • Hepatitis C virus is infected by approximately 180 million people worldwide, and HCV-infected patients undergo acute hepatitis, some of which are cured, but in most cases (50-80%), they develop chronic infections. About 20% of these chronic hepatitis patients are known to develop cirrhosis and liver cancer.
  • HCV human immunodeficiency virus
  • peg-IFN- ⁇ and ribavirin a nucleoside analogue.
  • Flu like symptom fever, fatigue, muscle pain, headache, chills, etc.
  • anemia neutropenia
  • thrombocytopenia elevated serum ALT
  • neuropsychiatric disorders thyroid dysfunction
  • respiratory tract There may be side effects such as related diseases (such as interstitial pneumonia), ophthalmic abnormalities (retinal bleeding, loss of color vision, etc.), skin diseases (erythema, rash, etc.), and hair loss.
  • HCV standard therapy shows a limited effect depending on the genotype of HCV.
  • genotypes 2 and 3 there is a sustained viral response (SVR) of about 80% during the 6 months after the end of treatment, but genotypes 1 and 4 have a sustained viral response rate of 50%. Less than%, the likelihood of relapse is high.
  • SVR sustained viral response
  • GRIM19 is a gene associated with cell death, and is recently known as a partner that interacts with STAT3 through yeast-2-hybrid screening (Zhang J, Yang J, Roy SK, Tininini S, Hu J, Bromberg JF). et al. Proc Natl Acad Sci USA.2003; 100: 93429347), which inhibits the phosphorylation of tyrosin and serine residues or inhibits STAT3-induced transcription without interfering with DNA binding. (Chung CD, Liao J, Liu B, Rao X, Jay P, Berta P. et al. Science. 1997; 278: 18031805). However, nothing is known about GRIM19 in relation to hepatitis C virus.
  • the present inventors confirmed that the expression of GRIM19 is decreased in liver tissues and HCV-infected cells of patients with chronic liver disease caused by HCV, and it is also confirmed that overexpression of GRIM19 has an effect of inhibiting HCV replication.
  • the present invention has been completed.
  • An object of the present invention is a GRIM19 protein or fragment thereof; And it provides a pharmaceutical composition for the prevention or treatment of hepatitis C virus (hepatitis C virus) infection disease comprising at least one selected from the group consisting of the gene encoding the protein or protein fragment.
  • hepatitis C virus hepatitis C virus
  • Another object of the invention is a GRIM19 protein or fragment thereof; And at least one selected from the group consisting of genes encoding the proteins or protein fragments.
  • Another object of the present invention comprises administering at least one member selected from the group consisting of GRIM19 protein or a fragment thereof, and a gene encoding the protein or protein fragment to a subject having a hepatitis C virus infection disease, It provides a method for treating hepatitis C virus infection disease.
  • the present invention GRIM19 protein or protein fragment; And it relates to a pharmaceutical composition for the prevention or treatment of hepatitis C virus (hepatitis C virus) infection disease comprising at least one selected from the group consisting of the gene encoding the protein or protein fragment.
  • hepatitis C virus hepatitis C virus
  • the present invention relates to an antiviral composition for hepatitis C virus, comprising one or more selected from the group consisting of the gene encoding the protein or protein fragment.
  • the present invention includes administering at least one selected from the group consisting of GRIM19 protein or fragment thereof, and a gene encoding the protein or protein fragment to a subject with hepatitis C virus infection disease. And a method for treating hepatitis C virus infection disease.
  • the GRIM19 protein may be composed of the amino acid sequence of SEQ ID NO.
  • the gene encoding the GRIM19 protein may be composed of the nucleotide sequence of SEQ ID NO: 1.
  • the GRIM19 protein fragment comprises a protein fragment comprising the 1 to 36 amino acid sequence in SEQ ID NO: 2; A protein fragment comprising the 37-72st amino acid sequence in SEQ ID NO: 2; A protein fragment comprising the 73-101st amino acid sequence in SEQ ID NO: 2; And it may be one or more selected from the group consisting of protein fragments comprising the 102-144 amino acid sequence in SEQ ID NO: 2.
  • the fragment of GRIM19 protein may be composed of an amino acid sequence selected from the group consisting of SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10 and SEQ ID NO: 12.
  • the gene encoding the fragment of the GRIM19 protein may be at least one selected from the group consisting of genes comprising the 304 to 432rd nucleotide sequence in SEQ ID NO: 1.
  • the gene encoding the fragment of the GRIM19 protein may be composed of a base sequence selected from the group consisting of SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 11 and SEQ ID NO: 13.
  • the GRIM19 protein or fragment thereof may further comprise a cell-penetrating peptide at the N-terminus, C-terminus, or both ends.
  • the cell permeable peptide may be composed of an amino acid sequence selected from the group consisting of SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21 and SEQ ID NO: 22.
  • the gene encoding the GRIM19 protein or fragment thereof may be provided in a form included in a recombinant vector.
  • composition may further include a substance that inhibits the expression or activity of DGAT-1 (diacyl-glycerol acyltransferase-1).
  • DGAT-1 diacyl-glycerol acyltransferase-1
  • the substance that inhibits the expression or activity of DGAT-1 may be siRNA, shRNA or antisense nucleic acid that specifically binds to the gene or mRNA of DGAT-1.
  • the substance that inhibits the expression or activity of DGAT-1 may be an antibody, aptamer or a compound of Formula 1 or a salt thereof that specifically binds to DGAT-1.
  • composition may further include a substance that inhibits the expression or activity of RNA-dependent RNA polymerase (RNA-dependent RNA polymerase).
  • RNA-dependent RNA polymerase RNA-dependent RNA polymerase
  • the substance that inhibits the expression or activity of the RNA-dependent RNA polymerase may be a compound of Formula 2 or a salt thereof.
  • composition may further include a substance for activating AMP-activated protein kinase (AMPK).
  • AMPK AMP-activated protein kinase
  • the substance activating the AMP-activated protein kinase may be metformin.
  • the hepatitis C virus infection disease may be hepatitis C, liver fibrosis by hepatitis C virus, liver cirrhosis by hepatitis C virus, and liver cancer by hepatitis C virus.
  • the present invention is based on the reduction of the expression of GRIM19 in liver tissues and HCV-infected cells of patients with chronic liver disease caused by HCV, it was confirmed that there is an HCV replication inhibitory effect when GRIM19 is overexpressed, GRIM19 protein or protein It provides a pharmaceutical composition for the prevention or treatment of hepatitis C virus infection disease or a composition for antiviral against hepatitis C virus, comprising a fragment and at least one member selected from the group consisting of the protein or the gene encoding the protein fragment. .
  • the present invention comprises the step of administering at least one selected from the group consisting of GRIM19 protein or fragment thereof, and the gene encoding the protein or protein fragments to the individual caused hepatitis C virus infection disease, type C
  • a method of treating hepatitis virus infection disease is provided.
  • the expression level of GRIM19 in liver tissue and HCV infected cells of patients with chronic liver disease caused by HCV was measured using Western blot.
  • tissues of patients with chronic liver disease caused by HCV and HCVcc HCV obtained from cells cultured through an HCV infection model established by in vitro cell culture
  • HCVcc Hepatitis C Virus cell culture
  • GRIM19 overexpression vectors were constructed and transduced into HCV-infected cells to determine the effects on artificially increasing expression of GRIM19 when GRIM19 expression was increased. As a result, it was confirmed that about 60 to 70% of HCV RNA was decreased in the cells infected with HCV (Example 3).
  • HCV RNA levels were determined after treatment of GRIM19 overexpressed cells with lipids to determine whether they were associated with inhibition of HCV replication by GRIM19 overexpression and intracellular lipid accumulation. As a result, when GRIM19 was overexpressed, HCV RNA levels decreased and lipid accumulation in Huh7 cells decreased. However, when lipids were treated, HCV RNA levels were restored again (Example 4).
  • HCV RNA levels were confirmed when GRIM19-overexpressed cells were treated with a substance that inhibited acetyl-CoA carbosylase activity. As a result, it was confirmed that a synergistic effect on the inhibition of HCV appeared when treated with a substance that inhibits the activity of acetyl-CoA carbosylase (Example 6).
  • HCV RNA levels were confirmed when GRIM19-overexpressed cells were treated with a substance that inhibits the activity of RNA-dependent RNA polymerase.
  • a substance that inhibited the activity of RNA-dependent RNA polymerase was treated with each other alone
  • GRIM19 was over-expressed and a substance that inhibited the activity of RNA-dependent RNA polymerase was treated simultaneously. It was confirmed that a synergistic effect on HCV inhibition appeared (Example 8).
  • GRIM19 protein was divided into four domains to identify domains having anti-HCV effects. As a result, it was confirmed that each of the four domains classified in the present invention can significantly reduce HCV RNA levels when transfected into HCV infected Huh7 cells (Example 9).
  • GRIM19 when the expression of GRIM19 is increased in a cell by directly processing GRIM19 protein or protein fragment, overexpressing GRIM19 protein or protein fragment, or introducing a gene encoding GRIM19 protein, It has been demonstrated that it can be used to prevent or treat hepatitis C virus infection disease by inhibiting replication.
  • GRIM19 has been identified as a protein involved in the process of apoptosis that occurs during interferon / retinoid (IFN / retinoid) treatment, NDUFA13 (a component of the mitochondiral respiratory complex 1) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13) is also known.
  • GRIM19 is not known anything related to HCV.
  • the GRIM19 gene sequence of SEQ ID NO: 1 is known as GenBank Accession No. AF286697, and the GRIM19 protein amino acid sequence of SEQ ID NO: 2 is AAG28167 (NCBI), respectively.
  • the present invention provides a method for preventing or treating a hepatitis C virus infection disease comprising at least one selected from the group consisting of a GRIM19 protein or protein fragment and a gene encoding the protein or protein fragment. It relates to a therapeutic pharmaceutical composition.
  • the GRIM19 protein may be composed of the amino acid sequence of SEQ ID NO: 2, but in the present invention, the GRIM19 protein may include a form in which one or more amino acid residues are modified in a range that does not entirely change the activity of the molecule. Amino acid exchanges in proteins and peptides that do not alter the activity of the molecule as a whole are known in the art.
  • the most commonly occurring exchanges are amino acid residues Ala / Ser, Val / Ile, Asp / Glu, Thr / Ser, Ala / Gly, Ala / Thr, Ser / Asn, Ala / Val, Ser / Gly, Thy / Phe, Ala / Exchange between Pro, Lys / Arg, Asp / Asn, Leu / Ile, Leu / Val, Ala / Glu, Asp / Gly. In some cases, it may be modified by phosphorylation, sulfation, acetylation, glycosylation, methylation, farnesylation, or the like.
  • the present invention maintains at least 70%, preferably at least 75%, more preferably at least 85%, even more preferably at least 90%, and most preferably at least 95% phases with the amino acid sequence of GRIM19 as long as it retains GRIM19 protein activity. Proteins having amino acid sequences having homology are included within the scope of the present invention.
  • the protein fragment refers to a portion of the sequence of the entire sequence of GRIM19 protein, for example, a protein fragment comprising 29 to 144 consecutive amino acids in the GRIM19 protein; Protein fragment comprising 30 to 144 consecutive amino acids in the GRIM19 protein overall sequence; A protein fragment comprising 36 to 144 consecutive amino acids in the GRIM19 protein overall sequence; Protein fragment comprising 37 to 144 consecutive amino acids in the GRIM19 protein overall sequence; GRIM19 protein may be a protein fragment comprising a contiguous 43 to 144 amino acids in the entire sequence, and the like.
  • the protein fragment may include a protein fragment comprising an amino acid sequence of amino acids 1 to 36 in SEQ ID NO: 2; A protein fragment comprising the 37-72st amino acid sequence in SEQ ID NO: 2; A protein fragment comprising the 73-101st amino acid sequence in SEQ ID NO: 2; Protein fragments including the 102-144th amino acid sequence in SEQ ID NO: 2, etc., but are not limited thereto.
  • the protein fragment may be SEQ ID NO: 6, 8, 10 or 12, but may also include a form in which one or more amino acid residues are modified in a range that does not entirely change the activity of the GRIM19 protein fragment. Further, as long as the activity of the GRIM19 protein fragment is maintained, at least 70%, preferably 75%, more preferably 85%, more preferably 90%, most preferably 95% or more of the amino acid sequence of the GRIM19 protein fragment Proteins having amino acid sequences having homology are included within the scope of the present invention.
  • the gene encoding the protein is included in the scope of the present invention as long as it corresponds to a gene encoding the GRIM19 protein, for example, but may be composed of the nucleotide sequence of SEQ ID NO: 1, but is not limited thereto.
  • the present invention is at least 70%, preferably at least 75%, more preferably at least 85%, even more preferably at 90%, and most preferably at least 70% of the gene sequence encoding the GRIM19 protein as long as it retains GRIM19 protein activity. Genes having DNA sequences having at least 95% homology are included within the scope of the present invention.
  • the gene encoding the protein fragment is included in the scope of the present invention as long as it corresponds to a gene encoding a GRIM19 protein fragment, for example, a gene comprising the 3rd to 108th nucleotide sequence in SEQ ID NO: 1; A gene comprising the 109-216 nucleotide sequence in SEQ ID NO: 1; A gene comprising the 217-303 base sequence in SEQ ID NO: 1; Genes including the 304 to 432 nucleotide sequences in SEQ ID NO: 1, but are not limited thereto.
  • the gene encoding the protein fragment may be composed of the nucleotide sequence of SEQ ID NO: 7, 9, 11 or 13, but is not limited thereto.
  • the present invention at least 70%, preferably 75%, more preferably 85%, even more preferably 90%, most preferably with the gene sequence encoding the GRIM19 protein fragment as long as it maintains the activity of the GRIM19 protein fragment
  • genes with DNA sequences having at least 95% homology are included in the scope of the present invention.
  • the protein or protein fragment may further comprise a cell-penetrating peptide at the N-terminal, C-terminal, or both ends. Since the protein or protein fragment comprises a cell permeable peptide, HCV can effectively enter into infected cells and exhibit excellent anti-HCV activity.
  • the cell permeable peptide is, for example, R9 peptide (RRRRRRRRR, SEQ ID NO: 19), pentratratin (Penetratin) peptide (RQIKIWFQNRRMKWKK, SEQ ID NO: 20), TAT peptide (GRKKRRQRRRPPQ, SEQ ID NO: 21), MTS peptide (AAVALLPAVLLALLAP, sequence No. 22), but is included in the scope of the present invention without limitation, so long as it corresponds to a peptide having activity capable of penetrating cells.
  • the method for obtaining the GRIM19 protein or protein fragment is not particularly limited, for example, extracted from nature or synthesized (Merrifleld, J. Amer. Chem. Soc .. 85: 2149-2156, 1963) or based on DNA sequences. It can be produced by genetic recombination methods.
  • the gene encoding the GRIM19 protein or protein fragment refers to a nucleic acid molecule encoding amino acid information of the GRIM19 protein or protein fragment, which may be isolated or artificially modified in nature. That is, the present invention is not limited to the native DNA, and appropriate modifications are made, elements for expression control are added, or genetic engineering methods or chemical methods are obtained within the range of maintaining the activity of expressing the GRIM19 protein or protein fragment. It means that it can be used suitably for the purpose of the present invention regardless of whether.
  • the gene encoding the GRIM19 protein or protein fragment of the present invention may be provided included in an expression vector for intracellular delivery.
  • the gene encoding the GRIM19 protein or protein fragment may be combined in an expression vector with expression control sequences such as promoter / enhancer sequences and other sequences required for transcription, translation or processing.
  • Regulatory sequences may include tissue-specific regulatory and / or inducible sequences as well as direct constitutive expression of nucleotides, and the design of expression vectors may include the host cells to be transformed, the desired level of expression. It may be determined by such factors as.
  • a vector capable of inserting a gene encoding a GRIM19 protein or protein fragment may include a retrovirus vector, an adenovirus vector, an adeno-associated virus vector or a herpes simplex.
  • Virus-derived vectors such as herpes simplex virus vectors, plasmids that can be expressed in the body of animals, modified vectors thereof, and the like can be used.
  • the composition according to the present invention may further include a substance that inhibits the expression or activity of DGAT-1, through which hepatitis C virus replication than when treated with the composition according to the present invention alone The inhibitory effect can be raised.
  • DGAT-1 is known as an enzyme that produces triglycerides from diacylglycerol and acyl-CoA.
  • NCBI DGAT gene sequence of SEQ ID NO. 525342626
  • the DGAT protein amino acid sequence of SEQ ID NO: 18 is known as NP_036211.2 (NCBI), respectively.
  • a substance that inhibits DGAT-1 expression or activity refers to a substance that blocks synthetic pathways, reaction pathways, and the like of DGAT-1.
  • it may be siRNA, shRNA, or antisense oligonucleotide capable of complementarily hybridizing to the mRNA of the DGAT-1 gene.
  • the siRNA, shRNA or antisense nucleic acid specifically binds to the mRNA nucleotide sequence of the DGAT-1 gene and does not specifically bind to the nucleotide sequence of another nucleic acid material. If it corresponds to the blocking material is not limited thereto.
  • Complementary binding means that the antisense nucleic acid is sufficiently complementary to selectively hybridize to the mRNA target of the DGAT-1 gene under certain hybridization or annealing conditions, preferably physiological conditions.
  • substantially complementary and “complementarily complementary” are meant to include both complementary and perfectly complementary, and preferably mean completely complementary.
  • the siRNA may be complementary enough to selectively hybridize to the mRNA target of the DGAT-1 gene herein.
  • siRNA refers to a short double-chain RNA that can induce RNA interference (RNAi) through the cleavage of a particular mRNA. It consists of a sense RNA strand having a sequence homologous to mRNA of a target gene and an antisense RNA strand having a sequence complementary thereto.
  • siRNAs can be provided as an efficient gene knockdown method or as a method of gene therapy because they can inhibit the expression of a target gene.
  • siRNAs are not limited to completely paired double-stranded RNA moieties paired with RNA, but paired by mismatches (the corresponding bases are not complementary), bulges (there are no bases corresponding to one chain), and the like. May be included.
  • the total length is 10 to 100 bases, preferably 15 to 80 bases, more preferably 20 to 70 bases.
  • the siRNA terminal structure can be either blunt or cohesive, as long as the expression of the target gene can be inhibited by the RNAi effect.
  • the cohesive end structure can be either a 3 'end projecting structure or a 5' end projecting structure.
  • the number of protruding bases is not limited.
  • siRNA is a low-molecular RNA (for example, natural RNA molecules such as tRNA, rRNA, viral RNA or artificial RNA molecules) in the protruding portion of one end to the extent that can maintain the expression inhibitory effect of the target gene It may include.
  • the siRNA terminal structure does not need to have a cleavage structure at both sides, and may be a step loop structure in which the terminal portion of the double chain RNA general is connected by linker RNA.
  • the siRNA used in the present invention is itself a complete form with polynucleotide pairing, that is, a form introduced into a cell through two transformation processes in which the siRNA is directly synthesized in vitro, or one form to have such a form after administration in vivo.
  • Single-chain oligonucleotide fragments and their reverse complements can be derived from single-chain polynucleotides separated by spacers, e.g. siRNA expression vectors or PCR-derived siRNAs prepared to express siRNA in cells
  • the expression cassette may be in a form introduced into a cell through a transformation or infection process. Determination of how to prepare an siRNA and introduce it into a cell or animal may depend on the purpose and cellular biological function of the target gene product.
  • the shRNA may be complementary enough to selectively hybridize to the mRNA target of the DGAT-1 gene herein.
  • the term "shRNA” is intended to overcome the shortcomings of the high cost of biosynthesis of siRNA, short-term maintenance of RNA interference effects due to low cell transfection efficiency, and can be used to express adenovirus, lentivirus and plasmid expression vector systems from promoters of RNA polymerase III. It can be expressed by introducing it into the cell, and such shRNA is widely known to induce silencing of a target gene by converting it into siRNA having an accurate structure by siRNA processing enzyme (Dicer or Rnase III) present in the cell. .
  • siRNA processing enzyme Diicer or Rnase III
  • an antisense nucleic acid may be complementary enough to selectively hybridize to the mRNA target of the DGAT-1 gene herein.
  • the term "antisense nucleic acid” refers to DNA or RNA or derivatives thereof that contain nucleic acid sequences complementary to the sequence of a particular mRNA, and is characterized by binding to complementary sequences in the mRNA to inhibit translation of the mRNA into protein.
  • the antisense sequence of the present invention means a DNA or RNA sequence that is complementary to the mRNA of the DGAT-1 gene and capable of binding to the mRNA of the DGAT-1 gene, and translates the mRNA of the DGAT-1 gene and translocation into the cytoplasm. May inhibit the activity necessary for maturation or any other overall biological function.
  • the antisense nucleic acid has a length of 6 to 100 bases, preferably 8 to 60 bases, and more preferably 10 to 40 bases.
  • Antisense RNA can be synthesized in vitro and administered in vivo by conventional methods, or the antisense RNA can be synthesized in vivo.
  • One example of synthesizing antisense RNA in vitro is using RNA polymerase I.
  • One example of allowing antisense RNA to be synthesized in vivo is to allow the antisense RNA to be transcribed using a vector whose origin is in the opposite direction of the recognition site (MCS). Such antisense RNA is desirable to ensure that there is a translation stop codon in the sequence so that it is not translated into the peptide sequence.
  • composition of the present invention may further comprise one or more of siRNA, shRNA or DGAT-1 antisense nucleic acid of DGAT-1, and may further comprise additional substances for the prevention or treatment of hepatitis C virus infectious disease in a patient.
  • agents that promote the influx of siRNA or antisense nucleic acid molecules for example liposomes (US Pat. Nos. 4,897,355, 4,394,448, 4,23,871, 4,231,877, 4,224,179, 4,753,788, 4,673,567). No. 4,247,411, 4,814,270) or may be combined with one of the lipophilic carriers of a number of sterols, including cholesterol, cholate and deoxycholic acid.
  • Antisense nucleic acids can also be conjugated to peptides that are taken up by cells. Examples of useful peptides include peptide hormones, antigens or antibodies and peptide toxins.
  • Another example of a substance that inhibits DGAT-1 expression or activity is an antibody against DGAT-1; Aptamers; Or a compound of Formula 1 (A922500, MERK) or a salt thereof.
  • an antibody is a term known in the art to mean a specific protein molecule directed against an antigenic site.
  • an antibody refers to an antibody that specifically binds to the DGAT-1 protein of the present invention.
  • Such an antibody may be obtained by cloning the DGAT-1 gene to an expression vector according to a conventional method.
  • the DGAT-1 protein encoded by the DGAT-1 gene can be obtained and prepared by conventional methods from the obtained DGAT-1 protein.
  • the form of the antibody of the present invention is not particularly limited and a part thereof is included in the antibody of the present invention and all immunoglobulin antibodies are included as long as they are polyclonal antibody, monoclonal antibody or antigen-binding. Furthermore, the antibody of this invention also contains special antibodies, such as a humanized antibody.
  • Antibodies that inhibit the expression or activity of DGAT-1 of the present invention include functional fragments of antibody molecules as well as complete forms having two full length light chains and two full length heavy chains. do.
  • a functional fragment of an antibody molecule refers to a fragment having at least antigen binding function and includes Fab, F (ab '), F (ab') 2 and Fv.
  • aptamer refers to a nucleic acid molecule having binding activity to a given target molecule. Aptamers can inhibit the activity of a given target molecule by binding to the given target molecule.
  • the aptamer of the present invention may be a linear or cyclic nucleic acid such as RNA, DNA, modified nucleic acid or a mixture thereof. Aptamers, such as peptides produced by phage displays or monoclonal antibodies (“MAbs”), are capable of specifically binding to selected targets and modulating the activity of the targets, for example, Binding allows aptamers to block the target's ability to function.
  • aptamers are produced over 100 proteins including growth factors, transcription factors, enzymes, immunoglobulins, and receptors.
  • Typical aptamers are 10-15 kDa (30-45 nucleotides) in size, bind to the target with sub-nanomolar affinity, and are distinguished from closely related targets (eg, aptamers Typically does not bind with other proteins from the same gene family).
  • binding interaction eg, hydrogen bonding, electrostatic complementarity, hydrophobic contact, steric exclusion
  • “Aptamer” of the present invention is an aptamer having binding activity to DGAT-1.
  • the aptamer of the present invention may bind to DGAT-1 and inhibit HCV particle formation.
  • the composition according to the present invention may further include a substance that inhibits the expression or activity of the RNA-dependent RNA polymerase, through which the composition according to the present invention is treated with C alone. Hepatitis virus replication inhibitory effect may be elevated.
  • RNA-dependent RNA polymerase refers to a substance that blocks the synthetic pathway, reaction pathway, etc. of RNA-dependent RNA polymerase.
  • it may be a compound of Formula 2 or a salt thereof.
  • RNA-dependent RNA polymerase may be applied to the substance that inhibits the expression or activity of the DGAT-1.
  • the composition according to the present invention may further include a material for activating AMP-activated protein kinase (AMPK), through which the C-type composition than when treated with the composition according to the present invention alone Inhibition of hepatitis virus replication may be elevated.
  • AMPK AMP-activated protein kinase
  • a substance activating the AMP-activated protein kinase means a substance activating or promoting a synthetic pathway, a reaction pathway, and the like of the AMP-activated protein kinase.
  • it may be metformin.
  • hepatitis C virus infection disease refers to a disease that can be caused by the infection of hepatitis C virus.
  • hepatitis C caused by the hepatitis C virus, hepatic fibrosis, hepatic cirrhosis and hepatic cancer by the hepatitis C virus that can be caused by a chronic state of hepatitis C, but is not limited thereto, hepatitis C It can be any disease caused by infection with a virus.
  • the present invention relates to an antiviral composition for hepatitis C virus, comprising at least one selected from the group consisting of a GRIM19 protein or a fragment thereof and a gene encoding the protein or a protein fragment.
  • Description of the term associated with an antiviral composition may be applied to the pharmaceutical composition for the prevention or treatment of hepatitis C virus infection disease.
  • compositions of the present invention may be used alone, but in combination with other therapies used for the prevention or treatment of hepatitis C virus infection disease in order to increase the therapeutic efficiency.
  • composition of the present invention may be administered with a pharmaceutically acceptable carrier, and when used orally, a binder, a lubricant, a disintegrant, an excipient, a solubilizer, a dispersant, a stabilizer, a suspending agent, a pigment, a perfume, and the like may be used.
  • a binder a lubricant, a disintegrant, an excipient, a solubilizer, a dispersant, a stabilizer, a suspending agent, a pigment, a perfume, and the like
  • buffers, preservatives, analgesic agents, solubilizers, isotonic agents, stabilizers and the like can be mixed and used.
  • bases, excipients, lubricants, preservatives and the like can be used for topical administration.
  • Formulations of the compositions of the present invention can be prepared in a variety of mixtures with the pharmaceutically acceptable carriers described above.
  • oral administration in the case of oral administration, it may be prepared in the form of tablets, troches, capsules, elixirs, suspensions, syrups, wafers, etc., and in the case of injections, they may be prepared in unit dosage ampoules or in multiple dosage forms.
  • administration refers to introducing a composition of the invention to a patient in any suitable manner, and the route of administration of the composition of the invention may be administered via any general route as long as it can reach the desired tissue.
  • the range of effective dosages of the compositions of the present invention may range from sex, body surface area, type and severity of disease, age, sensitivity to drugs, route of administration and rate of release, time of administration, duration of treatment, target cells, expression levels, etc. It may vary according to various well-known factors, and can be easily determined by those skilled in the art.
  • the present invention provides a pharmaceutical composition for the prevention or treatment of hepatitis C virus infection disease or a composition for antiviral against hepatitis C virus, comprising a GRIM19 protein or protein fragment, and a gene encoding the protein or protein fragment.
  • HCV Hepatitis C virus
  • HBV-infected patients is infected with hepatitis B virus
  • CHC liver tissue of patients with chronic hepatitis C virus
  • CHB is the liver tissue of Chronic Hepatitis B virus
  • LC is the liver tissue of cirrhosis (LC) patients
  • HCC Hepatocelluar carcinoma
  • GRIM19 indicates expression of GRIM19 protein
  • ⁇ -actin indicates expression of ⁇ -actin protein.
  • Figure 2 is a graph comparing the expression of GRIM19 in liver tissue of patients with chronic liver disease induced by HCV.
  • Normal represents a normal control group
  • HCV-CLD represents a chronic hepatitis C patient infected with hepatitis C virus
  • HCV-CLD represents a chronic hepatitis B patient infected with hepatitis B virus.
  • Figure 3 is a Western blot analysis of the expression of GRIM19 in the in vitro HCV infection model (infection model). "Huh7" indicates before HCV infection, and “HCVcc (Days)” indicates the number of days infected with HCV.
  • Figure 5a shows the result of HCV RNA level change after 48 hours after transfection of Huh7 cells with HCVcc, pcDNA3_GRIM19 transduced.
  • FIG. 5B shows HCV RNA level changes following GRIM19 overexpression.
  • “Mock” represents the result in cells which have not been treated, and
  • pcDNA3_GRIM19 represents the cells into which the vector expressing GRIM19 is introduced.
  • Figure 6a shows the change in the degree of lipid accumulation in Huh7 cells when GRIM19 is overexpressed by transfection of a vector expressing GRIM19.
  • BSA indicates the case of adding bovine serum albumin as a control
  • OA indicates the case of adding lipid (oleic acid).
  • FIG. 6B shows that the transduction of a vector expressing GRIM19 results in overexpression of GRIM19 resulting in reduced HCV RNA levels in Huh7 cells reduced through treatment of lipids.
  • Figure 7a shows the expression changes of proteins involved in fatty acid synthesis when pcDNA3_GRIM19 is introduced and GRIM19 is overexpressed.
  • SIRT sirtuin protein
  • p-Acc phospho-acetyl-CoA carboxylase
  • Acc is acetyl-CoA carboxylase
  • p-AMPK phospho-AMP-activated protein kinase
  • AMPK is AMP-activated
  • Actin means actin protein.
  • Figure 7b shows the expression change of acetyl-CoA carbosylase (Acc) when pcDNA3_GRIM19 is introduced and GRIM19 is overexpressed.
  • FIG. 9 shows changes in HCV RNA levels when the compound of Formula 1 (DGAT-1 inhibitor) is co-treated with cells into which pcDNA3_GRIM19 is introduced.
  • DMSO is a control group treated with dimethyl sulfooxide (DMSO) instead of the compound of Formula 1
  • DMSO dimethyl sulfooxide
  • pcDNA3_GRIM19 represents the results in cells transduced a vector expressing GRIM19.
  • FIG. 10 shows changes in HCV RNA levels when pcDNA3_GRIM19 was introduced to cells treated with a compound of Formula 2 (activation inhibitor of RNA-dependent RNA polymerase).
  • "Sofosbuvir” refers to a compound of formula (2).
  • Figure 11a shows a schematic diagram divided into four domains GRIM19 protein in the present invention.
  • FIG. 11B shows changes in HCV RNA levels when the four domains of GRIM19 protein and GRIM19 protein according to the present invention were transduced in an in vitro HCV infection model.
  • Figure 12 shows the changes in HCV RNA levels when the peptides with cell permeable peptide sequence (CP) bound to the four domains of the GRIM19 protein identified in the present invention in an in vitro HCV infection model.
  • CP cell permeable peptide sequence
  • Fig. 13 shows a cleavage map showing the structure of pJFH-1.
  • FIG. 14 shows the structure of a GRIM19 overexpression vector prepared using pcDNA3.
  • PROPREP reaget INTRON BIOTECHNOLOGY
  • Western blot analysis using 20 ⁇ g of lysates.
  • Anti-GRIM19 monoclonal antibody was used for Abcam and anti- ⁇ -actin monoclonal antibody was used for Sigma.
  • HCV Since HCV is not infected with small animals such as mice, and the only animal model is chimpanzee, most of the current HCV studies are done through an in vitro infection model.
  • HCVcc Hepatitis C Virus cell culture
  • Huh7 cells (Korea Cell Line Bank) were synthesized by electroporation of the infectious HCV genome synthesized through in vitro transcription to establish a recombinant infectious HCV model. The cells were passaged every 3 days and the cells were cultured.
  • HCV RNA in Huh7 cells was confirmed by quantitative Real-time RT PCR.
  • Total RNA was extracted using Trizol LS reagents (Invitrogen), and cDNA was synthesized using 2 ⁇ g of extracted RNA.
  • Quantitative realtime RT PCR was performed using synthesized cDNA, Lightcycler 480 probe master (Roche), HCV 5'-UTR specific fluorescence probe (SEQ ID NO: 3) and primers (SEQ ID NOs: 4 and 5).
  • HCVcc was infected the next day after seeding 1.5 ⁇ 10 6 Huh7 cells in a 10-cm culture dish. Since, every three days, cells and cultures were passaged at a 1: 4 ratio.
  • Huh7 cells infected with HCVcc were harvested on days 3, 6, 9 and 12, and the expression level of GRIM19 was confirmed by Western blot analysis.
  • Cells were lysed using PROPREP reaget (INTRON BIOTECHNOLOGY) and then subjected to Western blot analysis using 20 ⁇ g lysates.
  • Anti-GRIM19 monoclonal antibody was used for Abcam and anti- ⁇ -actin monoclonal antibody was used for Sigma.
  • a GRIM19 overexpression vector was constructed to identify the effect of inhibiting HCV replication through overexpression of GRIM19.
  • the gene of GRIM19 was obtained from mRNA of Huh7 cells by RT PCR and cloned into pcDNA3 vector (invitrogen) (FIG. 14) using restriction enzymes BglII and HindIII. Overexpression of GRIM19 was confirmed by Western blot analysis (FIG. 4).
  • HCVcc was infected the next day after seeding 1.5 ⁇ 10 6 Huh7 cells in a 10-cm culture dish. Since, every three days, cells and cultures were passaged at a 1: 4 ratio. On day 1, 4, 7 and 10 of infection, cells passaged were transfected with 5 ⁇ g of pcDNA3_GRIM19 using FUGENE HD (Promega) the next day. 48 hours after transduction, cells were harvested and HCV RNA levels were confirmed by quantitative Real-time RT PCR.
  • FIG. 5A shows HCV RNA levels after 48 hours after transfection of Huh7 cells with HCVcc and transduction of pcDNA3_GRIM19. Even when Huh7 cells were infected with HCVcc, HCV RNA was reduced when GRIM 19 protein was expressed.
  • HCV RNA levels were checked.
  • the degree of lipid accumulation in the cells was confirmed by measuring the degree of fluorescence after Nile Red staining.
  • pcDNA3_GRIM19 was transduced 24 hours after seeding 2 ⁇ 10 5 Huh7 cells in 6 well plates. After pcDNA3_GRIM19 transduction, cells were cultured using serum free DMEM media. After 24 hours, 100 ⁇ M of oleic acid (OA) was treated with serum free DMEM media containing 1% BSA in pcDNA3_GRIM19-transduced cells. After 24 hours, the amount of intracellular lipids increased by OA treatment was confirmed by Nile Red staining.
  • OA oleic acid
  • HCV RNA level (Example 3) decreased as the pcDNA3_GRIM19 was introduced and GRIM19 was overexpressed, and was recovered through the treatment of lipid (oleic acid (OA)).
  • OA oleic acid
  • acetyl-CoA is an enzyme that promotes fatty acid synthesis in fatty acid synthesis. Expression changes of proteins related to fatty acid synthesis including carbosylase (Acc) were confirmed.
  • Huh7 cells were seeded in a 10-cm culture dish and cultured using serum free DMEM. After 24 hours, pcDNA3_GRIM19 was transduced, and after 48 hours, cells were harvested and Western blot was performed. The harvested cells were treated with iNtRON BIOTECHNOLOGY's PRO-PREP TM Protein Extraction Solution to obtain protein lysates. After 30 ⁇ g of protein lysates were separated by size through 8% SDS-PAGE and transferred to nitrocellulose membrane, the expression level of ACC was confirmed using ACC specific antibody. Anti-ACC antibody was purchased from Cell Signaling. The expression level of the protein was visualized by the chemiluminescence system (Amersham Pharmacia Biotech), and the ACC expression level was compared by analyzing the density of the visible ACC protein bands and ⁇ -actin band, which is the loading control.
  • acetyl-CoA carbosylase (Acc) is reduced when GRIM19 is overexpressed in Example 5, metformin, which is an activator of AMP-activated protein kinase (AMPK), which inhibits the activity of ACC (Sigama Aldrich, Cat. D150959) confirmed the change in HCV RNA copy when co-administered
  • Replication complex formation of HCV occurs dependent on the lipid membrane, and HCV particle formation also plays an important role in the formation of lipid droplets on cells overexpressing GRIM19 in HCVcc-infected Huh7 cells.
  • HCCcc-infected Huh7 cells were transduced with pcDNA3_GRIM19 using FUGENE HD, or sosofbuvir (sofosbuvir) (PharmaBLOCK R & D Co. Ltd.), a compound that inhibits the activity of RNA-dependent RNA polymerase of HCV. .) (Formula 2), or pcDNA3_GRIM19 transduced and treated with Sophosbuvir, and confirmed changes in HCV RNA copy
  • GRIM19 protein is composed of 144 amino acids, as shown in Table 1 below, divided into four domains (domain) to identify the domain having an anti-HCV effect (Fig. 11a).
  • GRIM19-D1 (aa 1-36) MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSML (SEQ ID NO: 6) atggcggcgtcaaaggtgaagcaggacatgcctccgccggggggctatgggcccatcgactacaaacggaacttgccgcgtcgaggactgtcgggctacagcatgctg (SEQ ID NO: 7) GRIM19-D2 (aa 37-72) MAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALL (SEQ ID NO: 8) atggccatagggattggaaccctgatctacgggcactggagcataatgaagtggaaccgtgagcgcaggcgcctacaaatcgaggacttcgaggctc
  • genes for each domain of GRIM19 were obtained by PCR using the pcDNA3_GRIM19 expression vector as a template, and each domain was designated as pCMV-3Tag- using EcoRI and SalI restriction sites. Subcloning to 3A vector (Agilent Technologies, Inc.). For GRIM19-D2, GRIM19-D3, and GRIM19-D4, an initiation codon was added 5 'before the actual corresponding GRIM19 gene sequence for expression in the vector, so that each protein fragment was actually the N terminus of the corresponding GRIM19 amino acid sequence. Methionine was added before.
  • Huh7 cells infected with HCVcc through the in vitro HCV infection model of Example 2 were treated with CP-GRIM19-D1, CP-GRIM19-D2 and 10 ⁇ M CP-GRIM19-D3 for 48 hours, and then RNA levels of HCV were examined.
  • the present invention was carried out with the support of the following R & D program.
  • the pharmaceutical composition for the prevention or treatment of hepatitis C virus infection disease or the composition for antiviral against hepatitis C virus, comprising the GRIM19 protein or protein fragment of the present invention, and a gene encoding the protein or protein fragment is HCV standard. It can be used in the field of treatment of hepatitis C because it can be treated for patients who do not receive treatment and can prevent or treat hepatitis C virus infection by inhibiting hepatitis C virus replication without limiting genotype. have.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Oncology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Veterinary Medicine (AREA)
  • Communicable Diseases (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Toxicology (AREA)
  • Virology (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

본 발명은 C형 간염 바이러스(hepatitis C virus, HCV) 감염 질환의 예방 또는 치료용 약학 조성물에 관한 것이다. 보다 구체적으로, 본 발명은 GRIM19 단백질 또는 이의 단편; 및 상기 단백질 또는 단백질 단편을 코딩하는 유전자로 이루어진 군에서 선택된 1종 이상을 포함하는 C형 간염 바이러스 감염 질환의 예방 또는 치료용 약학 조성물 또는 C형 간염 바이러스에 대한 항바이러스용 조성물에 관한 것이다.

Description

C형 간염 바이러스 감염 질환의 예방 또는 치료용 약학 조성물
본 발명은 C형 간염 바이러스(hepatitis C virus, HCV) 감염 질환의 예방 또는 치료용 약학 조성물에 관한 것이다. 보다 구체적으로, 본 발명은 GRIM19(Genes-associated with Reinoid-Interferon induced Morality 19) 단백질 또는 이의 단편; 및 상기 단백질 또는 단백질 단편을 코딩하는 유전자로 이루어진 군에서 선택된 1종 이상을 포함하는 C형 간염 바이러스 감염 질환의 예방 또는 치료용 약학 조성물 또는 C형 간염 바이러스에 대한 항바이러스용 조성물에 관한 것이다.
C형 간염 바이러스는 전세계적으로 대략 1억 8천만의 사람들이 감염되어 있으며, HCV에 감염된 환자는 급성간염을 거쳐 일부는 완치되나 대부분의 환자의 경우(50-80%) 만성감염으로 진행된다. 이러한 만성 간염 환자의 약 20%는 간경화 및 간암이 발병하는 것으로 알려져 있다.
현재 HCV에 대한 백신은 상용화된 것이 없어 의학적 접근의 예방은 불가능한 상황이고, HCV의 표준치료법으로 페길화 인터페론(peg-IFN-α)과 뉴클레오사이드 유사체인 리바비린(ribavirin)의 병행치료를 사용하고 있으나, 독감 유사 증상(flu like symptom; 발열, 피로, 근육통, 두통, 오한 등), 빈혈, 호중구 감소증(Neutropenia), 혈소판 감소증(Thrombocytopenia), 혈청 ALT 상승, 신경정신과적 이상, 갑상선 기능 이상, 호흡기 관련 질환(간질성 폐렴 등), 안과적 이상(망막 출혈, 색각 소실 등), 피부 질환(홍반, 발진 등), 탈모 등의 부작용이 있을 수 있다.
또한, 상기 HCV 표준치료법은 HCV의 유전자형(genotype)에 따라 제한적인 효과를 보인다. 유전자형 2와 3에 대해서는 약 80%의 지속적인 바이러스성 반응율(sustained virological response, SVR; 치료 종료 후 6개월동안 혈중 HCV가 검출되지 않는 상태)을 나타내나, 유전자형 1과 4는 지속적인 바이러스성 반응율이 50% 미만으로, 재발 가능성이 높다.
최근, 페길화 인터페론과 리바비린 병행치료의 제한적 효과를 극복하고자 DAA(Direct-Acting Antivirals)개념의 치료제 개발이 이루어졌으며, HCV NS3-NS4A 단백질 저해효소(protease inhibitors)로 텔라프레비어(telaprevir)와 보세프레비어(boceprevir)가 승인을 받아 사용되고 있다. 그러나 이 치료제 역시 유전자형 1b에 제한적으로 효과가 나타나는 것으로 알려져 있으며 치료제 저항성이 우려되고 있다.
따라서, HCV 표준치료법이 듣지 않는 환자들에게 적용될 수 있고, 유전자형에 제한없이 적용 가능한 항-HCV 약물의 개발이 절실한 상태이다.
한편, GRIM19은 세포의 죽음과 관련된 유전자로, 최근에는 yeast-2-hybrid 스크리닝을 통해 STAT3와 상호작용을 하는 파트너로 알려져 있고(Zhang J, Yang J, Roy SK, Tininini S, Hu J, Bromberg JF. et al. Proc Natl Acad Sci USA. 2003;100:93429347), 타이로신(tyrosin)과 세린(serine) 잔기의 인산화를 억제하거나 DNA 결합을 방해하지 않으면서 STAT3에 의해 유도되는 전사를 억제하는 역할을 하는 것으로 알려져 있다(Chung CD, Liao J, Liu B, Rao X, Jay P, Berta P. et al. Science. 1997;278:18031805). 하지만, GRIM19는 C형 간염 바이러스와 관련하여 어떠한 내용도 알려진 바가 없다.
이러한 배경 하에, 본 발명자들은 HCV에 의해 만성 간질환이 유발된 환자의 간 조직 및 HCV 감염된 세포에서 GRIM19의 발현이 감소하는 것을 확인하였고, 또한 GRIM19를 과발현시키는 경우 HCV 복제 저해 효과가 있음을 확인하여 본 발명을 완성하였다.
본 발명의 목적은 GRIM19 단백질 또는 이의 단편; 및 상기 단백질 또는 단백질 단편을 코딩하는 유전자로 이루어진 군에서 선택된 1종 이상을 포함하는, C형 간염 바이러스(hepatitis C virus) 감염 질환의 예방 또는 치료용 약학 조성물을 제공하는 것이다.
본 발명의 또 하나의 목적은 GRIM19 단백질 또는 이의 단편; 및 상기 단백질 또는 단백질 단편을 코딩하는 유전자로 이루어진 군에서 선택된 1종 이상을 포함하는, C형 간염 바이러스에 대한 항바이러스용 조성물을 제공하는 것이다.
본 발명의 또 다른 목적은 C형 간염 바이러스 감염 질환이 유발된 개체에 GRIM19 단백질 또는 이의 단편, 및 상기 단백질 또는 단백질 단편을 코딩하는 유전자로 이루어진 군에서 선택된 1종 이상을 투여하는 단계를 포함하는, C형 간염 바이러스 감염 질환의 치료 방법을 제공하는 것이다.
상기 목적을 달성하기 위한 하나의 양태로서, 본 발명은, GRIM19 단백질 또는 단백질 단편; 및 상기 단백질 또는 단백질 단편을 코딩하는 유전자로 이루어진 군에서 선택된 1종 이상을 포함하는, C형 간염 바이러스(hepatitis C virus) 감염 질환의 예방 또는 치료용 약학 조성물에 관한 것이다.
또 하나의 양태로서 본 발명은, GRIM19 단백질 또는 단백질 단편; 및 상기 단백질 또는 단백질 단편을 코딩하는 유전자로 이루어진 군에서 선택된 1종 이상을 포함하는, C형 간염 바이러스에 대한 항바이러스용 조성물에 관한 것이다.
또 다른 양태로서 본 발명은, C형 간염 바이러스 감염 질환이 유발된 개체에 GRIM19 단백질 또는 이의 단편, 및 상기 단백질 또는 단백질 단편을 코딩하는 유전자로 이루어진 군에서 선택된 1종 이상을 투여하는 단계를 포함하는, C형 간염 바이러스 감염 질환의 치료 방법에 관한 것이다.
상기 GRIM19 단백질은 서열번호 2의 아미노산 서열로 이루어진 것일 수 있다.
또한 상기 GRIM19 단백질을 코딩하는 유전자는 서열번호 1의 염기서열로 이루어진 것일 수 있다.
상기 GRIM19 단백질 단편은 서열번호 2 내의 1 내지 36번째 아미노산 서열을 포함하는 단백질 단편; 서열번호 2 내의 37 내지 72번째 아미노산 서열을 포함하는 단백질 단편; 서열번호 2 내의 73 내지 101번째 아미노산 서열을 포함하는 단백질 단편; 및 서열번호 2 내의 102 내지 144번째 아미노산 서열을 포함하는 단백질 단편으로 이루어진 군에서 선택된 1종 이상일 수 있다.
예를 들어, 상기 GRIM19 단백질의 단편은 서열번호 6, 서열번호 8, 서열번호 10 및 서열번호 12으로 이루어진 군에서 선택된 아미노산 서열로 이루어진 것일 수 있다.
또한, 상기 GRIM19 단백질의 단편을 코딩하는 유전자는, 서열번호 1 내의 3 내지 108번째 염기서열을 포함하는 유전자; 서열번호 1 내의 109 내지 216번째 염기서열을 포함하는 유전자; 서열번호 1 내의 217 내지 303번째 염기서열을 포함하는 유전자; 및 서열번호 1 내의 304 내지 432번째 염기서열을 포함하는 유전자로 이루어진 군에서 선택된 1종 이상일 수 있다.
예를 들어, 상기 GRIM19 단백질의 단편을 코딩하는 유전자는 서열번호 7, 서열번호 9, 서열번호 11 및 서열번호 13으로 이루어진 군에서 선택된 염기 서열로 이루어진 것일 수 있다.
상기 GRIM19 단백질 또는 이의 단편은 N-말단, C-말단, 또는 양 말단에 세포 투과성 펩타이드를 추가로 포함하는 것일 수 있다.
예를 들어, 상기 세포 투과성 펩타이드는 서열번호 19, 서열번호 20, 서열번호 21 및 서열번호 22로 이루어진 군에서 선택된 아미노산 서열로 이루어진 것일 수 있다.
상기 GRIM19 단백질 또는 이의 단편을 코딩하는 유전자는 재조합 벡터에 포함된 형태로 제공될 수 있다.
상기 조성물은 DGAT-1(diacyl-glycerol acyltransferase-1)의 발현 또는 활성을 억제하는 물질을 추가로 포함하는 것일 수 있다.
예를 들어, 상기 DGAT-1의 발현 또는 활성을 억제하는 물질은 DGAT-1의 유전자 또는 mRNA에 특이적으로 결합하는 siRNA, shRNA 또는 안티센스 핵산일 수 있다.
예를 들어, 상기 DGAT-1의 발현 또는 활성을 억제하는 물질은 DGAT-1에 특이적으로 결합하는 항체, 압타머 또는 화학식 1의 화합물 또는 이의 염일 수 있다.
[화학식 1]
Figure PCTKR2014010200-appb-I000001
또한, 상기 조성물은 RNA의존성 RNA 중합효소(RNA-dependent RNA polymerase)의 발현 또는 활성을 억제하는 물질을 추가로 포함하는 것일 수 있다.
예를 들어, 상기 RNA의존성 RNA 중합효소의 발현 또는 활성을 억제하는 물질은 화학식 2의 화합물 또는 이의 염일 수 있다.
[화학식 2]
Figure PCTKR2014010200-appb-I000002
또한, 상기 조성물은 AMP-activated protein kinase(AMPK)를 활성화하는 물질을 추가로 포함하는 것일 수 있다.
예를 들어, 상기 AMP-activated protein kinase(AMPK)를 활성화하는 물질은 메트포르민(metformin)일 수 있다.
상기 C형 간염 바이러스 감염 질환은 C형 간염, C형 간염 바이러스에 의한 간섬유화, C형 간염 바이러스에 의한 간경화 및 C형 간염 바이러스에 의한 간암일 수 있다.
이하, 본 발명을 보다 상세하게 설명한다.
본 발명은 HCV에 의해 만성 간질환이 유발된 환자의 간 조직 및 HCV 감염된 세포에서 GRIM19의 발현이 감소하는 것을 기초로, GRIM19를 과발현시키는 경우 HCV 복제 저해 효과가 있음을 확인한 것으로, GRIM19 단백질 또는 단백질 단편, 및 상기 단백질 또는 단백질 단편을 코딩하는 유전자로 이루어진 군에서 선택된 1종 이상을 포함하는 C형 간염 바이러스 감염 질환의 예방 또는 치료용 약학 조성물 또는 C형 간염 바이러스에 대한 항바이러스용 조성물을 제공한다.
아울러, 본 발명은 C형 간염 바이러스 감염 질환이 유발된 개체에 GRIM19 단백질 또는 이의 단편, 및 상기 단백질 또는 단백질 단편을 코딩하는 유전자로 이루어진 군에서 선택된 1종 이상을 투여하는 단계를 포함하는, C형 간염 바이러스 감염 질환의 치료 방법을 제공한다.
본 발명의 구체적인 실시예에서는, HCV에 의해 만성 간질환이 유발된 환자의 간 조직 및 HCV 감염된 세포에서의 GRIM19의 발현 정도를 웨스턴 블랏을 이용하여 측정하였다. 그 결과, HCV에 의해 만성 간질환이 유발된 환자의 조직 및 HCVcc(Hepatitis C Virus cell culture)(in vitro 세포배양으로 확립된 HCV 감염모델을 통해 배양된 세포에서 얻어진 HCV)가 감염된 세포에서 특이적으로 GRIM19의 발현이 감소되어 있는 것을 확인하였다(실시예 1 및 2).
또 다른 실시예에서는, GRIM19의 발현을 인위적으로 증가시켰을 경우 HCV 복제에 대한 효과를 알아보기 위해, GRIM19 과발현 벡터를 제작하여 HCV를 감염시킨 세포에 형질도입시켰다. 그 결과, HCV를 감염시킨 세포에서 약 60~70%의 HCV RNA가 감소하는 것을 확인하였다(실시예 3).
또 다른 실시예에서는 GRIM19 과발현에 의한 HCV 복제 저해와 세포 내 지질 축적과 관련 있는지 확인하기 위하여, GRIM19가 과발현된 세포에 지질을 처리한 후 HCV RNA 수준을 확인하였다. 그 결과, GRIM19가 과발현되는 경우 HCV RNA 수준이 감소하고 Huh7 세포 내의 지질 축적 정도가 감소하였으나, 지질이 처리되는 경우 HCV RNA 수준이 다시 복원되는 것을 확인하였다(실시예 4).
또한, GRIM19가 과발현되는 경우 세포 내의 지질 축적 정도가 감소하는 메커니즘을 확인하기 위하여, 지방산 합성(fatty acid synthesis)을 촉진시키는 효소(enzyme)인 acetyl-CoA carbosylase(Acc)의 발현 변화를 확인하였다. 그 결과, GRIM19가 과발현되는 경우 acetyl-CoA carbosylase의 발현이 감소되는 것을 확인하였다(실시예 5).
또한, GRIM19를 과발현시킨 세포에 acetyl-CoA carbosylase의 활성을 억제시키는 물질을 처리한 경우, HCV RNA 수준을 확인하였다. 그 결과, acetyl-CoA carbosylase의 활성을 억제시키는 물질을 처리한 경우 HCV 억제에 대한 상승적 효과가 나타나는 것을 확인하였다(실시예 6).
또한, GRIM19를 과발현시킨 세포에 DGAT-1의 저해제(inhibitor)를 동시에 처리한 경우, HCV RNA 수준을 quantitative Real-time RT PCR을 통해 확인하였다. 그 결과, DGAT-1의 저해제를 처리한 경우 HCV 억제에 대한 상승적 효과가 나타나는 것을 확인하였다(실시예 7).
본 발명의 또 다른 실시예에서는, GRIM19를 과발현시킨 세포에 RNA-dependent RNA polymerase의 활성을 억제시키는 물질을 처리한 경우, HCV RNA 수준을 확인하였다. 그 결과, GRIM19를 과발현시킨 경우 및 RNA-dependent RNA polymerase의 활성을 억제시키는 물질을 각각 단독으로 처리한 경우에 비하여, GRIM19를 과발현시키고 RNA-dependent RNA polymerase의 활성을 억제시키는 물질을 동시에 처리한 경우 HCV 억제에 대한 상승적 효과가 나타나는 것을 확인하였다(실시예 8).
본 발명의 또 다른 실시예에서는, GRIM19 단백질을 4개의 도메인으로 구분하여 항-HCV 효과가 있는 도메인 확인하였다. 그 결과, 본 발명에서 구분한 4개의 도메인 각각이 HCV 감염된 Huh7 세포에 형질되입되는 경우 모두가 HCV RNA 수준을 의미있게 감소시킬 수 있음을 확인하였다(실시예 9).
또한, GRIM19 단백질의 각 도메인 자체를 세포 내로 투과시키는 경우에도 항-HCV 효과를 나타내는지 확인하기 위하여, 각 도메인에 세포 투과성이 있는 펩타이드 서열(Cell permeable peptide sequence, CP)을 합성하여 HCV 감염 모델에서 효과를 확인하였다. 그 결과, GRIM19 단백질의 각 도메인이 직접 세포 내로 투과되는 경우에도 HCV가 감염된 세포에서 HCV RNA 수준을 현저히 감소시킬 수 있음을 확인하였다(실시예 10).
따라서, 본 발명에서는 GRIM19 단백질 또는 단백질 단편을 직접 처리하거나, GRIM19 단백질 또는 단백질 단편을 과발현시키거나, GRIM19 단백질을 코딩하는 유전자를 도입하여, 세포 내에서 GRIM19의 발현이 증가하는 경우 C형 간염 바이러스의 복제를 억제하여 C형 간염 바이러스 감염 질환의 예방 또는 치료에 이용할 수 있음을 입증하였다.
본 발명에서 용어, "GRIM19"는 인터페론/레티노이드(IFN/retinoid) 처리 시 발생되는 세포자살(apopotosis) 과정에 관여하는 단백질로 규명되었으며 미토콘드리아 호흡 복합체 1(mitochondiral respiratory complex 1)의 구성 요소인 NDUFA13(NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13)으로도 알려져 있다. 또한, GRIM19은 HCV와 관련된 어떠한 내용도 알려진 바가 없다. 서열번호 1의 GRIM19 유전자 서열은 유전자 은행 등록번호 AF286697으로, 서열번호 2의 GRIM19 단백질 아미노산 서열은 AAG28167(NCBI)로 각각 알려져 있다.
표 1
서열번호 1 atggcggcgtcaaaggtgaagcaggacatgcctccgccggggggctatgggcccatcgactacaaacggaacttgccgcgtcgaggactgtcgggctacagcatgctggccatagggattggaaccctgatctacgggcactggagcataatgaagtggaaccgtgagcgcaggcgcctacaaatcgaggacttcgaggctcgcatcgcgctgttgccactgttacaggcagaaaccgaccggaggaccttgcagatgcttcgggagaacctggaggaggaggccatcatcatgaaggacgtgcccgactggaaggtgggggagtctgtgttccacacaacccgctgggtgccccccttgatcggggagctgtacgggctgcgcaccacagaggaggctctccatgccagccacggcttcatgtggtacacgtag
서열번호 2 MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT
하나의 양태로, 본 발명은 GRIM19 단백질 또는 단백질 단편, 및 상기 단백질 또는 단백질 단편을 코딩하는 유전자로 이루어진 군에서 선택된 1종 이상을 포함하는, C형 간염 바이러스(hepatitis C virus) 감염 질환의 예방 또는 치료용 약학 조성물에 관한 것이다.
상기 GRIM19 단백질은 서열번호 2의 아미노산 서열로 이루어진 것일 수 있으나, 본 발명에서 GRIM19 단백질은 분자의 활성을 전체적으로 변경시키지 않는 범위에서 하나 이상의 아미노산 잔기가 변형된 형태도 포함할 수 있다. 분자의 활성을 전체적으로 변경시키지 않는 단백질 및 펩티드에서의 아미노산 교환은 당해 분야에 공지되어 있다. 가장 통상적으로 일어나는 교환은 아미노산 잔기 Ala/Ser, Val/Ile, Asp/Glu, Thr/Ser, Ala/Gly, Ala/Thr, Ser/Asn, Ala/Val, Ser/Gly, Thy/Phe, Ala/Pro, Lys/Arg, Asp/Asn, Leu/Ile, Leu/Val, Ala/Glu, Asp/Gly 간의 교환이다. 경우에 따라서는 인산화(phosphorylation), 황화(sulfation), 아세틸화(acetylation), 당화(glycosylation), 메틸화(methylation), 파렌실화(farnesylation) 등으로 수식(modification)될 수도 있다.
또한, 본 발명은 GRIM19 단백질 활성을 유지하는 한, GRIM19의 아미노산 서열과 70% 이상, 바람직하게는 75%, 보다 바람직하게는 85%, 더욱 바람직하게는 90%, 가장 바람직하게는 95% 이상의 상동성을 갖는 아미노산 서열을 갖는 단백질을 본 발명의 범위에 포함한다.
또한, 상기 단백질 단편은, GRIM19 단백질 전체 서열 중 연속하는 일부 서열을 의미하는 것으로, 예를 들어, GRIM19 단백질 내의 연속하는 29개 내지 144개의 아미노산을 포함하는 단백질 단편; GRIM19 단백질 전체 서열 내의 연속하는 30개 내지 144개의 아미노산을 포함하는 단백질 단편; GRIM19 단백질 전체 서열 내의 연속하는 36개 내지 144개의 아미노산을 포함하는 단백질 단편; GRIM19 단백질 전체 서열 내의 연속하는 37개 내지 144개의 아미노산을 포함하는 단백질 단편; GRIM19 단백질 전체 서열 내의 연속하는 43개 내지 144개의 아미노산을 포함하는 단백질 단편 등일 수 있으나 이에 제한되지 않는다.
또 다른 예로, 상기 단백질 단편은, 서열번호 2 내의 1 내지 36번째 아미노산 서열을 포함하는 단백질 단편; 서열번호 2 내의 37 내지 72번째 아미노산 서열을 포함하는 단백질 단편; 서열번호 2 내의 73 내지 101번째 아미노산 서열을 포함하는 단백질 단편; 서열번호 2 내의 102 내지 144번째 아미노산 서열을 포함하는 포함하는 단백질 단편 등일 수 있으나, 이에 제한되지 않는다.
또 다른 예로, 상기 단백질 단편은 서열번호 6, 8, 10 또는 12일 수 있으나, GRIM19 단백질 단편의 활성을 전체적으로 변경시키지 않는 범위에서 하나 이상의 아미노산 잔기가 변형된 형태도 포함할 수 있다. 또한, GRIM19 단백질 단편의 활성을 유지하는 한, GRIM19 단백질 단편의 아미노산 서열과 70% 이상, 바람직하게는 75%, 보다 바람직하게는 85%, 더욱 바람직하게는 90%, 가장 바람직하게는 95% 이상의 상동성을 갖는 아미노산 서열을 갖는 단백질을 본 발명의 범위에 포함한다.
상기 단백질을 코딩하는 유전자는, GRIM19 단백질을 코딩하는 유전자에 해당하는 한 본 발명의 범위에 포함되고, 일예로, 서열번호 1의 염기서열로 이루어진 것일 수 있으나, 이에 제한되지 않는다.
또한, 본 발명은 GRIM19 단백질 활성을 유지하는 한, 상기 GRIM19 단백질을 코딩하는 유전자 서열과 70% 이상, 바람직하게는 75%, 보다 바람직하게는 85%, 더욱 바람직하게는 90%, 가장 바람직하게는 95% 이상의 상동성을 갖는 DNA 서열을 갖는 유전자를 본 발명의 범위에 포함한다.
상기 단백질 단편을 코딩하는 유전자는, GRIM19 단백질 단편을 코딩하는 유전자에 해당하는 한 본 발명의 범위에 포함되고, 일예로, 서열번호 1 내의 3 내지 108번째 염기서열을 포함하는 유전자; 서열번호 1 내의 109 내지 216번째 염기서열을 포함하는 유전자; 서열번호 1 내의 217 내지 303번째 염기서열을 포함하는 유전자; 서열번호 1 내의 304 내지 432번째 염기서열을 포함하는 유전자 등 일 수 있으나, 이에 제한되지 않는다.
또 다른 예로, 상기 단백질 단편을 코딩하는 유전자는, 서열번호 7, 9, 11 또는 13의 염기서열로 이루어진 것일 수 있으나, 이에 제한되지 않는다.
또한, 본 발명은 GRIM19 단백질 단편의 활성을 유지하는 한, 상기 GRIM19 단백질 단편을 코딩하는 유전자 서열과 70% 이상, 바람직하게는 75%, 보다 바람직하게는 85%, 더욱 바람직하게는 90%, 가장 바람직하게는 95% 이상의 상동성을 갖는 DNA 서열을 갖는 유전자를 본 발명의 범위에 포함한다.
본 발명의 일예로, 상기 단백질 또는 단백질 단편은 N-말단, C-말단, 또는 양 말단에 세포 투과성 펩타이드를 추가로 포함할 수 있다. 상기 단백질 또는 단백질 단편이 세포 투과성 펩타이드를 포함함으로써 HCV가 감염된 세포 내로 효과적으로 들어가 우수한 항-HCV 활성을 나타낼 수 있다.
상기 세포 투과성 펩타이드는 예를 들어, R9 펩타이드(RRRRRRRRR, 서열번호 19), 페너트라틴(Penetratin) 펩타이드(RQIKIWFQNRRMKWKK, 서열번호 20), TAT 펩타이드(GRKKRRQRRRPPQ, 서열번호 21), MTS 펩타이드(AAVALLPAVLLALLAP, 서열번호 22) 일 수 있으나, 세포를 투과할 수 있는 활성이 있는 펩타이드에 해당하는 한 제한없이 본 발명의 범위에 포함된다.
상기 GRIM19 단백질 또는 단백질 단편의 수득 방법은 특별히 제한되지 않는데, 예를 들면 천연에서 추출하거나 합성(Merrifleld, J. Amer. chem. Soc..85:2149-2156, 1963) 또는 DNA 서열을 기본으로 하는 유전자 재조합 방법에 의해 제조될 수 있다.
본 발명에서 GRIM19 단백질 또는 단백질 단편을 코딩하는 유전자는, GRIM19 단백질 또는 단백질 단편의 아미노산 정보를 암호화하는 핵산 분자를 의미하며 이들은 자연에서 분리되거나 인위적으로 합성 변형된 것일 수 있다. 즉, 천연형 DNA에 한정되는 것은 아니며, GRIM19 단백질 또는 단백질 단편을 발현하는 활성을 유지하는 범위 내에서 적절한 변형이 가해지거나 발현 조절을 위한 요소가 부가되거나, 유전공학적 방법 혹은 화학적 방법에 의해 얻어지는지 여부를 불문하고 본 발명의 목적에 적합하게 사용될 수 있는 것을 의미한다.
또한, 본 발명의 GRIM19 단백질 또는 단백질 단편을 코딩하는 유전자는 세포 내 전달을 위한 발현 벡터에 포함되어 제공될 수 있다. 이 경우, GRIM19 단백질 또는 단백질 단편을 코딩하는 유전자는 발현 벡터 내에서 프로모터/인핸서 서열과 같은 발현 조절 서열 및 기타 전사, 해독 또는 프로세싱에 필요한 서열들과 함께 결합될 수 있다. 조절 서열은 뉴클레오타이드의 구성적 발현(constitutive expression)을 지시하는 것뿐만이 아니라 조직-특이적 조절 및/또는 유도성 서열을 포함할 수 있으며, 발현 벡터의 설계는 형질전환시킬 숙주 세포, 목적하는 발현 수준 등과 같은 요소에 의해 결정될 수 있다.
본 발명의 조성물에서 GRIM19 단백질 또는 단백질 단편을 코딩하는 유전자를 삽입할 수 있는 벡터로는 레트로바이러스(retrovirus) 벡터, 아데노바이러스(adenovirus) 벡터, 아데노 관련 바이러스(adeno-associated virus) 벡터 또는 헤르페스 심플렉스 바이러스(herpes simplex virus) 벡터와 같은 바이러스 유래 벡터와, 동물의 체내에서 발현될 수 있는 플라스미드 및 이들의 변형 벡터 등이 이용될 수 있다.
본 발명의 일예로, 본 발명에 따른 조성물은 DGAT-1의 발현 또는 활성을 억제하는 물질을 추가로 포함할 수 있는데, 이를 통해 본 발명에 따른 조성물을 단독으로 처리한 경우보다 C형 간염 바이러스 복제 억제 효과가 상승할 수 있다. DGAT-1은 디아실글리세롤(diacylglycerol) 및 아실-CoA(Acyl-CoA)로부터 트리글리세리드(triglycerides)를 생성하는 효소로 알려져 있으며, 서열번호 17의 DGAT 유전자 서열은 유전자 은행 등록번호 NM_012079.5, GI:525342626(NCBI)으로, 서열번호 18의 DGAT 단백질 아미노산 서열은 NP_036211.2(NCBI)로 각각 알려져 있다.
DGAT-1 발현 또는 활성을 억제하는 물질은 DGAT-1의 합성경로, 반응경로 등을 차단하는 물질을 의미한다. 예를 들어, DGAT-1 유전자의 mRNA에 상보적으로 결합(hybridization)할 수 있는 siRNA, shRNA 또는 안티센스 핵산(antisense oligonucleotide) 등이 될 수 있다. 상기 siRNA, shRNA 또는 안티센스 핵산은 DGAT-1유전자의 mRNA 염기 서열에 특이적으로 결합하고 다른 핵산물질의 염기 서열에는 특이적 결합을 하지 않는 것이 바람직하나, DGAT-1의 합성경로, 반응경로 등을 차단하는 물질에 해당하면 이에 제한되지 않는다.
이때, 상보적으로 결합한다는 것은, 소정의 혼성화 또는 어닐링(annealing) 조건, 바람직하게는 생리학적 조건 하에서 안티센스 핵산이 DGAT-1 유전자의 mRNA 타겟에 선택적으로 혼성화 할 정도로 충분히 상보적인 것을 의미하며, 실질적으로 상보적(substantially complementary) 및 완전히 상보적(perfectly complementary)인 것을 모두 포함하는 의미를 가지며, 바람직하게는 완전히 상보적인 것을 의미한다.
일예로, 본원의 DGAT-1 유전자의 mRNA 타겟에 선택적으로 혼성화 할 정도로 충분히 상보적인 것은 siRNA일 수 있다. 용어, "siRNA"는 특정 mRNA의 절단(cleavage)을 통하여 RNAi(RNA interference) 현상을 유도할 수 있는 짧은 이중사슬 RNA를 의미한다. 표적 유전자의 mRNA와 상동인 서열을 가지는 센스 RNA 가닥과 이와 상보적인 서열을 가지는 안티센스 RNA 가닥으로 구성된다. siRNA는 표적 유전자의 발현을 억제할 수 있기 때문에 효율적인 유전자 넉다운(knockdown) 방법으로서 또는 유전자 치료의 방법으로 제공될 수 있다.
siRNA는 RNA끼리 짝을 이루는 이중사슬 RNA 부분이 완전히 쌍을 이루는 것에 한정되지 않고 미스매치(대응하는 염기가 상보적이지 않음), 벌지(일방의 사슬에 대응하는 염기가 없음) 등에 의하여 쌍을 이루지 않는 부분이 포함될 수 있다. 전체 길이는 10 내지 100 염기, 바람직하게는 15 내지 80 염기, 더욱 바람직하게는 20 내지 70염기이다. siRNA 말단 구조는 표적 유전자의 발현을 RNAi 효과에 의해 억제할 수 있는 것이면 평활(blunt) 말단 또는 점착(cohesive) 말단 모두 가능하다. 점착 말단 구조는 3' 말단 돌출한 구조와 5' 말단 쪽이 돌출한 구조 모두 가능하다. 돌출하는 염기 수는 한정되지 않는다. 또한 siRNA는 표적 유전자의 발현 억제 효과를 유지할 수 있는 범위에서 예를 들어, 한쪽 말단의 돌출 부분에 저분자 RNA(예를 들어, tRNA, rRNA, 바이러스 RNA와 같은 천연의 RNA 분자 또는 인공의 RNA 분자)를 포함할 수 있다. siRNA 말단 구조는 양측 모두 절단 구조를 가질 필요는 없고, 이중 사슬 RNA 일반의 말단 부위가 링커 RNA에 의하여 접속된 스텝 루프형 구조일 수도 있다.
본 발명에서 사용되는 siRNA는 그 자체로 폴리뉴클레오타이드 페어링을 갖는 완전한 형태, 즉 시험관에서 siRNA를 직접 합성한 두 형질전환 과정을 거쳐 세포 안으로 도입되는 형태이거나, 생체 내에 투여된 후 이러한 형태를 갖도록 하나의 단일쇄 올리고뉴클레오타이드 단편과 이의 역방향(reverse) 상보물이 스페이서에 의해 분리된 단일쇄 폴리뉴클레오타이드로부터 유도될 수 있는 형태, 예를 들어 siRNA가 세포 안에서 발현되도록 제조된 siRNA 발현 벡터 또는 PCR-유도된 siRNA 발현 카세트를 형질전환 또는 감염(infection) 과정을 거쳐 세포 안으로 도입되는 형태일 수 있다. siRNA를 제조하고 세포 또는 동물로 도입하는 방법의 결정은 목적 및 표적 유전자 산물의 세포 생물학적 기능에 따라 달라질 수 있다.
다른 일예로, 본원의 DGAT-1 유전자의 mRNA 타겟에 선택적으로 혼성화 할 정도로 충분히 상보적인 것은 shRNA일 수 있다. 용어 "shRNA"는 siRNA의 고가의 생합성 비용, 낮은 세포 형질감염 효율로 인한 RNA 간섭 효과의 단시간 유지 등의 단점을 극복하기 위한 것으로 RNA 중합효소 Ⅲ의 프로모터로부터 아데노 바이러스, 렌티 바이러스 및 플라스미드 발현 벡터 시스템을 이용하여 이를 세포 내로 도입하여 발현시킬 수 있으며, 이러한 shRNA는 세포 내에 존재하는 siRNA 프로세싱 효소(Dicer or Rnase Ⅲ)에 의해 정확한 구조를 갖는 siRNA로 전환되어 목적 유전자의 사일런싱을 유도함이 널리 알려져 있다.
또 다른 일예로, 본원의 DGAT-1 유전자의 mRNA 타겟에 선택적으로 혼성화 할 정도로 충분히 상보적인 것은 안티센스 핵산일 수 있다. 용어 "안티센스 핵산"이란 특정 mRNA 의 서열에 상보적인 핵산 서열을 함유하고 있는 DNA 또는 RNA 또는 이들의 유도체를 의미하고, mRNA 내의 상보적인 서열에 결합하여 mRNA의 단백질로의 번역을 저해하는 특징이 있다. 본 발명의 안티센스 서열은 DGAT-1 유전자의 mRNA에 상보적이고 DGAT-1 유전자의 mRNA에 결합할 수 있는 DNA 또는 RNA 서열을 의미하고, DGAT-1 유전자의 mRNA의 번역, 세포질 내로의 전위(translocation), 성숙(maturation) 또는 다른 모든 전체적인 생물학적 기능에 대한 필수적인 활성을 저해할 수 있다. 안티센스 핵산의 길이는 6 내지 100 염기이고, 바람직하게는 8 내지 60 염기이고, 보다 바람직하게는 10 내지 40 염기이다.
안티센스 RNA의 경우 통상의 방법으로 시험관에서 합성되어 생체 내로 투여하거나, 생체 내에서 안티센스 RNA가 합성되도록 할 수 있다. 시험관에서 안티센스 RNA를 합성하는 한 예는 RNA 폴리머라제Ⅰ를 이용하는 것이다. 생체 내에서 안티센스 RNA가 합성되도록 하는 한 가지 예는 인식부위(MCS)의 기원이 반대 방향에 있는 벡터를 사용하여 안티센스 RNA가 전사되도록 하는 것이다. 이런 안티센스 RNA는 서열 내에 번역 중지 코돈이 존재하도록 하여 펩타이드 서열로 번역되지 않도록 하는 것이 바람직하다.
본 발명의 조성물은 DGAT-1의 siRNA, shRNA 또는 DGAT-1 안티센스 핵산의 1종 이상을 추가로 포함하는 외에, 환자의 C형 간염 바이러스 감염 질환의 예방 또는 치료를 위한 추가의 물질을 포함할 수 있으며, 또는 siRNA 또는 안티센스 핵산 분자의 유입을 촉진시키는 제제, 예를 들어 리포좀(미국 특허 제4,897,355호, 제4,394,448호, 제4,23,871호, 제4,231,877호, 제4,224,179호, 제4,753,788호, 제4,673,567호, 제4,247,411호, 제4,814,270호)을 이용하거나 콜레스테롤, 콜레이트 및 데옥시콜산을 비롯한 다수의 스테롤류 중 1종의 친유성 담체와 함께 배합할 수도 있다. 또한 안티센스 핵산은 세포에 의해 흡수되는 펩티드에 접합시킬 수도 있다. 유용한 펩타이드의 예로는 펩타이드 호르몬, 항원 또는 항체 및 펩타이드 독소 등이 있다.
상기 DGAT-1 발현 또는 활성을 억제하는 물질의 또 다른 예는, DGAT-1에 대한 항체; 압타머; 또는 화학식 1(A922500, MERK)의 화합물 또는 이의 염 일 수 있다.
[화학식 1]
Figure PCTKR2014010200-appb-I000003
용어 "항체"란 당해 분야에서 공지된 용어로서 항원성 부위에 대해서 지시되는 특이적인 단백질 분자를 의미한다. 본 발명의 목적상, 항체는 본 발명의 DGAT-1 단백질에 대해 특이적으로 결합하는 항체를 의미하며, 이러한 항체는, DGAT-1 유전자를 통상적인 방법에 따라 발현벡터에 클로닝(cloning)하여 상기 DGAT-1 유전자에 의해 코딩되는 DGAT-1 단백질을 얻고, 얻어진 DGAT-1 단백질로부터 통상적인 방법에 의해 제조될 수 있다. 여기에는 상기 DGAT-1 단백질에서 만들어질 수 있는 부분 펩티드도 포함되며, 본 발명의 부분 펩티드로는, 최소한 7개 아미노산, 바람직하게는 9개 아미노산, 더욱 바람직하게는 12개 이상의 아미노산을 포함한다. 본 발명의 항체의 형태는 특별히 제한되지 않으며 다클론 항체, 단클론 항체 또는 항원 결합성을 갖는 것이면 그것의 일부도 본 발명의 항체에 포함되고 모든 면역 글로불린 항체가 포함된다. 나아가, 본 발명의 항체에는 인간화 항체 등의 특수 항체도 포함된다.
본 발명의 DGAT-1의 발현 또는 활성을 억제하는 항체는 2개의 전체 길이의 경쇄(light chain) 및 2개의 전체 길이의 중쇄(heavy chain)를 가지는 완전한 형태뿐만 아니라 항체 분자의 기능적인 단편을 포함한다. 항체 분자의 기능적인 단편이란 적어도 항원 결합 기능을 보유하고 있는 단편을 뜻하며 Fab, F(ab'), F(ab')2 및 Fv 등이 있다.
용어 "압타머"는, 소정의 표적 분자에 대한 결합 활성을 갖는 핵산 분자를 말한다. 압타머는, 소정의 표적 분자에 대하여 결합함으로써, 소정의 표적 분자의 활성을 저해할 수 있다. 본 발명의 압타머는, RNA, DNA, 수식 핵산 또는 이들의 혼합물 등의 직쇄상 또는 환상의 형태의 핵산일 수 있다. 압타머는, 파지 디스플레이(phage display) 또는 단일 클론 항체(monoclonal antibodies, "MAbs")에 의해 생성되는 펩티드와 같은 것으로서, 선택된 표적에 특이적으로 결합할 수 있고 표적의 활성을 조절할 수 있으며, 예컨대, 결합을 통해 압타머가 기능에 대한 표적의 능력을 차단할 수 있다. 불규칙 서열 올리고뉴클레오티드의 풀(pool)로부터 시험관내 선택 프로세스에 의해 생성된 것으로서, 압타머는 성장 인자, 전사 인자, 효소, 면역글로불린, 및 수용체를 포함하는 100 이상의 단백질에 걸쳐 생성된 것이다. 전형적인 압타머는 크기가 10-15 kDa(30-45개의 뉴클레오티드)이며, 나노몰 이하(sub-nanomolar)의 친화성으로 그 표적에 결합하며, 그리고 밀접하게 관련된 표적들로부터 구분된다(예컨대, 압타머는 동일한 유전자 패밀리로부터의 다른 단백질과는 전형적으로 결합하지 않는다). 압타머가 갖는 친화성을 유도하는 동일한 유형의 결합 상호작용(예컨대, 수소 결합, 정전기적 상보성, 소수성 접촉, 입체적 배제(steric exclusion))과 항체-항원 복합체에서의 특이성을 통하여 선택된 표적에 특이적으로 결합할 수 있고 표적의 활성을 조절할 수 있으며 표적의 능력을 차단할 수 있다.
본 발명의 "압타머"는 DGAT-1에 대하여 결합 활성을 갖는 압타머이다. 바람직하게, 본 발명의 압타머는 DGAT-1에 결합하여, HCV 입자(particle) 형성을 저해할 수 있다.
본 발명의 또 다른 일예로, 본 발명에 따른 조성물은 RNA의존성 RNA 중합효소의 발현 또는 활성을 억제하는 물질을 추가로 포함할 수 있는데, 이를 통해 본 발명에 따른 조성물을 단독으로 처리한 경우보다 C형 간염 바이러스 복제 억제 효과가 상승할 수 있다.
RNA의존성 RNA 중합효소의 발현 또는 활성을 억제하는 물질은 RNA의존성 RNA 중합효소의 합성경로, 반응경로 등을 차단하는 물질을 의미한다. 예를 들어, 화학식 2의 화합물 또는 이의 염일 수 있다.
[화학식 2]
Figure PCTKR2014010200-appb-I000004
또한, RNA-dependent RNA polymerase의 발현 또는 활성을 억제하는 물질과 관련된 용어의 설명은 상기 DGAT-1 발현 또는 활성을 억제하는 물질에 대한 내용이 적용될 수 있다.
본 발명의 또 다른 일예로, 본 발명에 따른 조성물은 AMP-activated protein kinase(AMPK)를 활성화하는 물질을 추가로 포함할 수 있는데, 이를 통해 본 발명에 따른 조성물을 단독으로 처리한 경우보다 C형 간염 바이러스 복제 억제 효과가 상승할 수 있다.
AMP-activated protein kinase를 활성화하는 물질은 AMP-activated protein kinase의 합성경로, 반응경로 등을 활성화 또는 촉진하는 물질을 의미한다. 예를 들어, 메트포르민(metformin)일 수 있다.
본 발명에서 C형 간염 바이러스 감염 질환이란, C형 간염 바이러스가 감염되어 발생할 수 있는 질환을 말한다. 구체적으로, C형 간염 바이러스에 의해 발생한 C형 간염, 이러한 C형 간염 상태가 만성화 되어 발생될 수 있는 C형 간염 바이러스에 의한 간섬유화, 간경화 및 간암일 수 있으나, 이에 제한되지 않고, C형 간염 바이러스가 감염되어 발생하는 모든 질병일 수 있다.
또 다른 양태로 본 발명은, GRIM19 단백질 또는 이의 단편, 및 상기 단백질 또는 단백질 단편을 코딩하는 유전자로 이루어진 군에서 선택된 1종 이상을 포함하는, C형 간염 바이러스에 대한 항바이러스용 조성물에 관한 것이다.
항바이러스용 조성물과 관련된 용어의 설명은 상기 C형 간염 바이러스 감염 질환의 예방 또는 치료용 약학 조성물에 대한 내용이 적용될 수 있다.
일 구현예로, 본 발명의 조성물은 단독으로 사용할 수 있지만, 치료 효율을 증가시키기 위해 C형 간염 바이러스 감염 질환의 예방 또는 치료에 사용되는 다른 치료법과 병용하여 사용할 수 있다.
본 발명의 조성물은 약제학적으로 허용되는 담체와 함께 투여될 수 있고, 경구 투여시에는 결합체, 활택제, 붕해제, 부형제, 가용화제, 분산제, 안정화제, 현탁화제, 색소, 향료 등을 사용할 수 있으며, 주사제의 경우에는 완충제, 보존제, 무통화제, 가용화제, 등장제, 안정화제 등을 혼합하여 사용할 수 있으며, 국소 투여용의 경우에는 기제, 부형제, 윤활제, 보존제 등을 사용할 수 있다. 본 발명의 조성물의 제형은 상술한 바와 같은 약제학적으로 허용되는 담체와 혼합하여 다양하게 제조될 수 있다. 예를 들어, 경구 투여시에는 정제, 트로키, 캡슐, 엘릭시르, 서스펜션, 시럽, 웨이퍼 등의 형태로 제조할 수 있으며, 주사제의 경우에는 단위 투약 앰플 또는 다수회 투약 형태로 제조될 수 있다.
본 발명에서 사용되는 용어, 투여는 어떠한 적절한 방법으로 환자에게 본 발명의 조성물을 도입하는 것을 의미하며, 본 발명의 조성물의 투여경로는 목적 조직에 도달할 수 있는 한 어떠한 일반적인 경로를 통하여 투여될 수 있다. 경구 투여, 복강 내 투여, 정맥 내 투여, 근육 내 투여, 피하 투여, 피내 투여, 비내 투여, 폐내 투여, 직장내 투여, 강내 투여, 복강 내 투여, 경막 내 투여가 이루어질 수 있으나, 이에 제한되지는 않는다.
본 발명의 조성물의 유효 투여량의 범위는 성별, 체표면적, 질환의 종류 및 중증도, 연령, 약물에 대한 민감도, 투여경로 및 배출비율, 투여시간, 치료기간, 표적세포, 발현 수준 등 기타 의학 분야에 잘 알려진 다양한 요인에 따라 달라질 수 있으며, 당 분야의 전문가들에 의해 용이하게 결정될 수 있다.
본 발명은 GRIM19 단백질 또는 단백질 단편, 및 상기 단백질 또는 단백질 단편을 코딩하는 유전자를 포함하는, C형 간염 바이러스 감염 질환의 예방 또는 치료용 약학 조성물 또는 C형 간염 바이러스에 대한 항바이러스용 조성물을 제공하며, 이를 이용하면, HCV 표준치료법이 듣지 않는 환자들에 대해 치료가 가능하며, 유전자형에 제한없이 C형 간염 바이러스의 복제를 저해하여 C형 간염 바이러스 감염 질환의 예방 또는 치료가 가능하다.
도 1은 HCV에 의해 만성 간질환이 유발된 환자의 간 조직에서 GRIM19의 발현을 분석한 웨스턴 블랏 결과이다. "HCV-infected patients"는 C형 간염 바이러스에 감염된 환자, "HBV-infected patients"는 B형 간염 바이러스에 감염된 환자, "CHC"는 만성 C형 간염(Chronic Hepatitis C virus) 환자의 간 조직, "CHB"는 만성 B형 간염(Chronic Hepatitis B virus)환자의 간 조직, "LC"는 간경화(liver cirrhosis, LC)환자의 간 조직, "HCC"는 간암(Hepatocelluar carcinoma, HCC)환자의 간 조직, "GRIM19"는 GRIM19 단백질의 발현, "β-actin"은 β-actin 단백질의 발현을 나타낸다.
도 2는 HCV에 의해 만성 간질환이 유발된 환자의 간 조직에서 GRIM19의 발현을 상대적으로 비교한 그래프이다. "Normal"은 정상 대조군, "HCV-CLD"는 C형 간염 바이러스에 감염된 만성 C형 간염 환자, "HBV-CLD"는 B형 간염 바이러스에 감염된 만성 B형 간염 환자를 나타낸다.
도 3은 In vitro HCV 감염 모델(infection model)에서 GRIM19의 발현을 분석한 웨스턴 블랏 결과이다. "Huh7"은 HCV에 감염되기 전의 결과, "HCVcc(Days)"는 HCV에 감염된 일 수를 나타낸다.
도 4는 GRIM19를 발현하는 벡터를 형질도입(transfection)시킨 후 GRIM19의 과발현을 확인한 웨스턴 블랏 결과이다. "Mock"은 아무런 처리도 하지 않은 세포, "pcDNA3"은 GRIM19를 발현하지 않는 벡터를 형질도입시킨 세포, "pcDNA3_GRIM19"는 GRIM19를 발현하는 벡터를 도입시킨 세포에서의 단백질 발현 결과를 나타낸다.
도 5a는 Huh7 세포를 HCVcc로 감염시킨 후, pcDNA3_GRIM19을 형질도입하고 48시간 후 HCV RNA 수준 변화를 확인한 결과를 나타낸다.
도 5b는 GRIM19 과발현에 따른 HCV RNA 수준 변화를 보여준다. "Mock"은 아무런 처리도 하지 않은 세포, "pcDNA3_GRIM19"는 GRIM19를 발현하는 벡터를 도입시킨 세포에서의 결과를 나타낸다.
도 6a는 GRIM19를 발현하는 벡터를 형질도입(transfection)시켜 GRIM19가 과발현되는 경우 Huh7 세포 내의 지질 축적 정도의 변화를 나타낸 것이다. "BSA"는 대조군으로 bovine serum albumin을 첨가한 경우, "OA"는 지질(oleic acid)을 첨가한 경우를 나타낸다.
도 6b는 GRIM19를 발현하는 벡터를 형질도입시켜 GRIM19가 과발현되어 감소된 Huh7 세포 내의 감소된 HCV RNA 수준이 지질의 처리를 통하여 복원되는 것을 나타낸 것이다.
도 7a는 pcDNA3_GRIM19가 도입되어 GRIM19가 과발현되는 경우 지방산 합성에 관여하는 단백질들의 발현 변화를 나타낸 것이다. "SIRT"는 sirtuin protein, "p-Acc"는 phospho-acetyl-CoA carboxylase, "Acc"는 acetyl-CoA carboxylase, "p-AMPK"는 phospho- AMP-activated protein kinase, "AMPK"는 AMP-activated protein kinase, "Actin"은 actin 단백질을 의미한다.
도 7b는 pcDNA3_GRIM19가 도입되어 GRIM19가 과발현되는 경우 acetyl-CoA carbosylase(Acc)의 발현 변화를 나타낸 것이다.
도 8은 pcDNA3_GRIM19을 형질도입하여 GRIM19를 과발현시키고 메트포르민을 처리한 경우의 HCV RNA 수준 변화를 나타낸다. "Mock"은 아무런 처리도 하지 않은 세포, "pcDNA3_GRIM19"는 GRIM19를 발현하는 벡터를 형질도입시킨 세포에서의 결과를 나타낸다.
도 9은 pcDNA3_GRIM19가 도입된 세포에 화학식 1의 화합물(DGAT-1 저해제)을 병용 처리한 경우에 HCV RNA 수준 변화를 나타낸다. "DMSO"는 화학식 1의 화합물 대신 DMSO(dimethyl sulfooxide)를 처리한 대조군, "Mock"은 아무런 처리도 하지 않은 세포, "pcDNA3_GRIM19"는 GRIM19를 발현하는 벡터를 형질도입시킨 세포에서의 결과를 나타낸다.
도 10은 pcDNA3_GRIM19가 도입된 세포에 화학식 2의 화합물(RNA-dependent RNA polymerase의 활성 억제제)을 처리한 경우에 HCV RNA 수준 변화를 나타낸다. "Sofosbuvir"는 화학식 2의 화합물을 나타낸다.
도 11a는 본 발명에서 GRIM19 단백질을 4개의 도메인으로 구분한 모식도를 나타낸다.
도 11b는 In vitro HCV 감염 모델에서 GRIM19 단백질 및 본 발명에서 구분한 GRIM19 단백질의 4개 도메인을 각각 형질도입시킨 경우의 HCV RNA 수준 변화를 나타낸다.
도 12는 In vitro HCV 감염 모델에 본 발명에서 구분한 GRIM19 단백질의 4개 도메인에 세포 투과성이 있는 펩타이드 서열(CP)이 결합된 펩타이드를 직접 처리한 경우 HCV RNA 수준 변화를 나타낸다.
도 13은 pJFH-1의 구조를 알 수 있는 개열지도를 나타낸다.
도 14은 pcDNA3를 이용하여 제조된 GRIM19 과발현 벡터의 구조를 나타낸다.
도 15는 pCMV-3Tag-3A 벡터의 구조를 알 수 있는 개열지도를 나타낸다.
이하, 본 발명을 실시예에 의해 상세히 설명한다. 단, 하기 실시예는 본 발명을 예시하는 것일 뿐, 본 발명이 하기 실시예에 의해 한정되는 것은 아니다.
실시예 1. HCV에 의해 만성 간질환이 유발된 환자의 간 조직에서의 GRIM19 발현 감소 확인
만성 간염을 유발하는 주요 바이러스인 HBV와 HCV에 감염되어 만성 간질환이 유발된 환자(chronic liver disease, CLD)의 조직에서 GRIM19의 발현 정도를 알아보기 위해 anti-GRIM19 antibody를 이용한 웨스턴 블랏 분석(western blot anlaysis)을 실시하였다.
서울 성모병원 내원 환자 중 임상시험심사위원회(Institutional Review Board, IRB)에서 승인된 환자에서 HBV 또는 HCV에 감염되어 만성 간염(CHB, CHC), 간경화(LC) 그리고 간암(HCC)가 유발된 환자를 선별하고, 그로부터 생체검사(Biopsy)된 간 조직을 얻었다. 상기 얻은 간 조직(C형 간염 환자의 경우 CHC n=4, LC n=3, HCC n=2, B형 간염 환자의 경우 CHB n=3, LC n=3, HCC n=3)을 20 mg을 PROPREP reaget(INTRON BIOTECHNOLOGY)를 이용하여 용해(lysis)시킨 후 20㎍의 용해물(lysates)을 이용하여 웨스턴 블랏 분석을 수행하였다. Anti-GRIM19 monoclonal antibody는 Abcam사 제품을 사용하였으며 anti-β-actin monoclonal antibody는 Sigma 사 제품을 사용하였다.
실험 결과 HBV에 감염된 환자의 간 조직과 달리 HCV에 의해 만성 간질환이 유발된 환자의 조직에서 특이적으로 GRIM19의 발현이 감소되어 있는 것을 확인하였다(도 1 및 도 2).
실시예 2. In vitro HCV 감염 모델(infection model)에서 GRIM19의 발현 감소 확인
HCV는 마우스(mouse)와 같은 소동물에 감염되지 않고, 유일한 동물 모델이 침팬지(chimpanzee)이기 때문에, 현재 HCV 연구의 대부분은 in vitro 감염 모델(infection model)을 통해 이루어지고 있다.
JFH-1 주(strain)을 이용하여 HCVcc(Hepatitis C Virus cell culture) 시스템을 구축한 일본 국립 전염병 연구소(National Institute of Infectious Diseases) 소속의 타카지 와키타(Takaji Wakita) 교수 연구진으로부터 감염 클론(infectious clone)인 JFH-1 클론을 포함하는 벡터(vector)인 pJFH-1(도 13)을 제공받아 HCVcc 시스템을 구축하였다.
재조합 HCV 감염 모델(Recombinant infectious HCV model)을 구축하기 위하여 in vitro 전사(transcription)을 통해 합성된 감염성 있는(infectious) HCV 게놈(genome)을 전기천공법(electroporation)을 통해 Huh7 세포(한국세포주은행) 에 유입시켰으며 3일 마다 계대하여 세포를 배양하였다.
전기천공 이후 Huh7 세포 내의 HCV RNA는 quantitative Real-time RT PCR를 통해 확인하였다. Trizol LS reagents(Invitrogen)를 이용하여 총 RNA(total RNA)를 추출하고 추출된 RNA 2㎍을 이용하여 cDNA를 합성하였다. 합성된 cDNA, Lightcycler 480 probe master(Roche), HCV 5'-UTR 특이적 형광 probe(서열번호 3)및 프라이머(primers)(서열번호 4 및 5)를 이용하여 quantitative realtime RT PCR을 수행하였다.
표 2
유전자 이름 서열(5'→ 3')
서열번호 3 HCV 5'UTR probe CTGCGGAACCGGTGAGTACAC
서열번호 4 HCV 5'UTR Forward Primer GCGCCTAGCCATGGCGTTAGTATGAGTGTC
서열번호 5 HCV 5'UTR Reverse Primer ACCACAAGGCCTTTCGCAACCCAACGCTAC
전기천공(Electroporation) 수행 3일 이후 총 RNA(total RNA) 1㎍ 당 약 1x106 개(copies)이상이 검출되었으며 세포 배양액으로 배출된 HCVcc의 양을 HCV RNA 수준을 통해 확인해 본 결과 HCV RNA가 배양액 1㎖ 당 RNA 1㎍당 약 1x107 개 수준으로 유지되는 것을 확인하였다. 이를 통해 HCV 연구의 실험적 토대가 되는 in vitro HCV 감염 시스템(infectious system)이 구축된 것을 확인하였다.
in vitro HCV 감염 시스템을 이용하여 HCV 감염에 따른 GRIM19의 발현 변화를 확인하였다. 10-cm 배양접시(culture dish)에 1.5x106개의 Huh7 세포를 식종(seeding)한 후 다음날 HCVcc를 감염시켰다. 이후 3일에 한 번씩 세포와 배양액은 1:4 비율로 계대배양 하였다.
HCVcc 감염 시킨 Huh7 세포를 3, 6, 9 그리고 12일 째 수확(harvest)하여 GRIM19의 발현 수준을 웨스턴 블랏 분석을 통해 확인하였다. 세포는 PROPREP reaget(INTRON BIOTECHNOLOGY)를 이용하여 용해(lysis) 시킨 후 20㎍의 용해물(lysates)를 이용하여 웨스턴 블랏 분석을 수행하였다. Anti-GRIM19 monoclonal antibody는 Abcam사 제품을 사용하였으며 anti-β-actin monoclonal antibody는 Sigma 사 제품을 사용하였다.
실시예 1의 HCV-CLD 조직(C형 간염 바이러스에 감염된 만성 C형 간염 환자)에서와 마찬가지로 HCVcc가 감염된 Huh7에서 GRM19 수준이 감소되는 현상을 확인하였다. 감염 3일 후에는 약 80 %, 6일 이후 약 60% 수준으로 감소하였다(도 3).
실시예 3. GRIM19 과발현에 의한 HCV RNA 수준 감소
실시예 1 및 2를 통하여, HCV 감염된 조직과 세포에서 GRIM19의 발현 감소는 HCV 복제에 유리한 환경을 형성하기 위해 바이러스에 의해 조절된 것이라 추론하여, 이에 근거하여 GRIM19의 발현을 인위적으로 증가시켰을 경우 HCV 복제 저해 효과를 확인하였다.
GRIM19의 과발현을 통한 HCV 복제 저해 효과를 확인하기 위하여 GRIM19 과발현 벡터를 제작하였다. GRIM19의 유전자는 Huh7 세포의 mRNA로부터 RT PCR를 통해 확보하였으며 제한효소 BglⅡ와 HindⅢ를 이용하여 pcDNA3 벡터(invitrogen)(도 14)에 클로닝(cloning) 하였다. GRIM19의 과발현 여부는 웨스턴 블랏 분석을 통해 확인하였다(도 4).
10-cm 배양접시(culture dish)에 1.5x106 Huh7 세포를 식종(seeding)한 후 다음날 HCVcc를 감염시켰다. 이후 3일에 한 번씩 세포와 배양액은 1:4 비율로 계대배양 하였다. 감염 1일째, 4일째, 7일째와 10일째 계대배양 한 세포들은 다음 날 5㎍의 pcDNA3_GRIM19을 FUGENE HD(Promega)를 이용하여 형질도입(transfection)하였다. 형질도입 후 48시간 후에 세포를 수확(harvest)하여 HCV RNA 수준을 quantitative Real-time RT PCR을 통해 확인하였다.
도 5a는 Huh7 세포를 HCVcc로 감염시킨 후, pcDNA3_GRIM19을 형질도입하고 48시간 후 HCV RNA 수준을 확인한 것인데, Huh7 세포를 HCVcc로 감염되더라도 GRIM 19 단백질이 발현되는 경우 HCV RNA가 감소하는 것을 확인하였다.
또한, 도 5b에서 알 수 있는 바와 같이, HCVcc 감염된 Huh7 세포의 경우 3일 째 총 RNA(total RNA) 1㎍당 약 9.5x105 HCV RNA 개(copies), 6일 째 총 RNA(total RNA) 1㎍당 약 6.9.5x106 HCV RNA 개(copies), 9일 째 총 RNA(total RNA) 1㎍당 약 5.0x107 HCV RNA 개(copies), 12일 째 총 RNA 1㎍당 약 1.9x108 HCV RNA 개가 검출되었으며, pcDNA3_GRIM19을 도입시켜 GRIM19를 과발현 시킨 결과 각각 약 5.7x105 HCV RNA 개, 3.5x106 HCV RNA 개, 1.8x107 HCV RNA 개, 3.8x107 HCV RNA 개로 HCV RNA 수준이 감소하였다. 이를 통하여, HCV 감염시킨 Huh7 세포에 GRIM19을 과발현 시킨 결과 약 40~80% HCV RNA가 감소하는 것을 확인하였다.
따라서, HCV가 감염된 세포에 GRIM 19 단백질이 발현되는 경우 항-HCV 활성이 있음을 명확하게 입증하였다.
실시예 4. HCV RNA 수준과 세포 내 지질 축적과의 관계 확인
HCV의 복제는 세포 내 지질(lipid)에 많은 영향을 받는 것으로 알려져 있음을 근거로, GRIM19 과발현에 의한 HCV RNA 감소 효과가 세포 내 지질 축적과 관련 있는지 확인하기 위하여 pcDNA3_GRIM19가 도입된 Huh7 세포에 지질(oleic acid(OA))을 처리 한 후, HCV RNA 수준을 확인하였다.
세포 내 축적되는 지질의 정도는 Nile Red staining 후 fluorescence의 정도를 측정하여 확인하였다. 구체적으로, 6 well plate에 2x105 Huh7 세포를 식종(seeding)한 후 24 시간 후에 pcDNA3_GRIM19을 형질도입시켰다. pcDNA3_GRIM19 형질도입 후 serum free DMEM media를 이용하여 세포를 배양하였다. 24시간 후 pcDNA3_GRIM19이 형질도입된 세포에 1% BSA가 포함된 serum free DMEM media를 이용하여 100 μM의 oleic acid(OA)를 처리하였다. 24 시간 후, OA 처리에 의해 증가된 세포 내 지질 양을 Nile Red staining을 통해 확인하였다. pcDNA3_GRIM19이 과발현 및 OA가 처리가 완료된 세포를 3.7% paraformaldehyde를 이용하여 고정시키고 1 μg/㎖의 Nile Red가 포함된 PBS 용액을 이용하여 세포 내 지질을 형광염색하였다. 세포의 개수에 대한 지질 축적의 정도를 예측하기 위하여 0.2 μg/㎖의 DAPI를 이용하여 핵을 염색하였다. 세포 내 지질 축적 정도를 microplate reader를 통해 측정된 형광의 세기를 통해 확인하였으며 DAPI의 정도를 통해 지질 축적의 정도를 상대적으로 비교 분석하였다.
결과, 도 6a에서 알 수 있는 바와 같이, pcDNA3_GRIM19가 도입되어 GRIM19가 과발현되는 경우 Huh7 세포 내의 지질 축적 정도가 감소하는 것을 확인하였다.
또한, 도 6b에서 확인할 수 있는 바와 같이 pcDNA3_GRIM19가 도입되어 GRIM19가 과발현됨에 따라 감소한 HCV RNA 수준(실시예 3)이 지질(oleic acid(OA))의 처리를 통하여 복원되는 것을 확인하였다. 이를 통하여, GRIM19의 과발현에 의한 HCV RNA 수준 감소는 세포 내 지질 축적과 관련되어 있음을 입증하였다.
실시예 5. GRIM19 과발현에 의한 세포 내 지질 감소 메커니즘 확인
상기 실시예 6에서 알 수 있는 바와 같이, pcDNA3_GRIM19가 도입되어 GRIM19가 과발현되는 경우 Huh7 세포 내의 지질 축적 정도가 감소하는데, 그 메커니즘을 확인하기 위하여 지방산 합성 과정에서 지방산 합성을 촉진시키는 효소인 acetyl-CoA carbosylase(Acc)를 비롯한 지방산 합성 관련 단백질들의 발현 변화를 확인하였다.
10-cm 배양접시(culture dish)에 1.5x106 Huh7 세포를 식종(seeding)한 후 serum free DMEM을 이용하여 배양하였다. 24시간 이후 pcDNA3_GRIM19을 형질도입시켰으며, 48 시간 후 세포를 수확하여 웨스턴블랏을 수행하였다. 수확된 세포에 iNtRON BIOTECHNOLOGY사의 PRO-PREPTM Protein Extraction Solution 제품을 처리하여 protein lysates를 얻었다. 30 μg의 protein lysates를 8% SDS-PAGE를 통하여 size별로 분리한 후, nitrocellulose membrane으로 transfer 시킨 후, ACC 특이적 antibody를 이용하여 ACC의 발현 정도를 확인하였다. Anti-ACC antibody는 Cell Signaling 사에서 구매하여 사용하였다. 단백질의 발현 정도는 chemiluminescence system(Amersham Pharmacia Biotech)을 통하여 가시화시켰으며 가시화된 ACC proteins bands 및 loading control인 β-actin band의 density를 분석을 통하여 ACC 발현 정도를 상대적으로 비교하였다.
도 7a 및 도 7b에서 확인할 수 있는 바와 같이, pcDNA3_GRIM19가 도입되어 GRIM19가 과발현되는 경우 acetyl-CoA carbosylase의 발현이 감소되는 것을 확인하였다.
C형 간염 바이러스에 감염된 경우, 세포 내 지질이 축적되는 현상이 나타나며, 이러한 경우, SIRT1의 활성이 감소되며, 이에 따라 AMPK의 활성도 감소되는 현상이 나타나고 그에 따라 ACC의 활성이 높아져 세포 내 지질 생산이 촉진되는 것으로 보고되어 있는데, 도 7a에서 알 수 있는 바와 같이, SIRT1 및 AMPK의 활성이 감소하였음에도 불구하고 ACC의 활성도 감소하였음을 확인할 수 있으며, 이는 GRIM19의 과발현에 의해 감소되는 것이라는 것을 확인할 수 있었다.
이를 통하여, HCV에 의해 세포 내 지질 대사 과정에 관여하는 주요 효소 중 ACC 의 발현 수준이 GRIM19의 과발현에 의해 감소되고, 그에 따라 세포 내 지질이 감소되는 것임을 입증하였다.
실시예 6. GRIM19 과발현과 Acc 활성 억제 물질의 병용 처리를 통한 HCV에 대한 상승적 억제 효과
상기 실시예 5에서 GRIM19가 과발현되는 경우 acetyl-CoA carbosylase(Acc)의 발현이 감소되는 것을 확인하였으므로, ACC의 활성을 억제시키는 AMP-activated protein kinase(AMPK)의 활성제(activator)인 메트포르민(metformin)(Sigama Aldrich, Cat. D150959)을 병용 투여하는 경우의 HCV RNA 카피 변화를 확인하였다
도 8에서 알 수 있는 바와 같이, pcDNA3_GRIM19을 형질도입하여 GRIM19를 과발현시키고 메트포르민을 처리한 경우가 메트포르민을 단독으로 투여한 경우에 비하여 HCV RNA 증가 수준이 현저히 낮아 HCV에 대하여 상승적 억제 효과가 있음을 확인하였다.
이를 통하여, GRIM19 과발현에 의한 HCV RNA 수준 감소 메커니즘에 AMPK와Acc 단백질을 포함하는 지방산 합성 과정의 조절이 관여되어 있음을 입증하였다.
실시예 7. GRIM19 과발현과 DGAT-1 inhibitor 병용 처리를 통한 HCV에 대한 상승적 억제 효과
HCV의 복제 복합체 형성은 지질막(lipid membrane)에 의존적으로 일어나며 HCV 입자(particle) 형성 역시 지방 방울(lipid droplet)이 중요한 역할을 담당하고 있다는 것을 근거로, HCVcc 감염된 Huh7 세포에서 GRIM19를 과발현시킨 세포에 DGAT-1의 저해제인 화학식 1의 화합물(A922500, MERK) 40μM를 동시에 처리한 결과, HCV 복제 억제에 대한 상승적 효과가 나타나는 것을 확인하였다(도 9).
[화학식 1]
Figure PCTKR2014010200-appb-I000005
실시예 8. In vitro HCV 감염 모델에서 RNA-dependent RNA polymerase 활성 억제 화합물 처리를 통한 통한 HCV에 대한 상승적 억제 효과
상기 실시예 3에서와 같이 HCCcc 감염된 Huh7 세포에, pcDNA3_GRIM19을 FUGENE HD를 이용하여 형질도입하거나, HCV의 RNA-dependent RNA polymerase의 활성을 억제시키는 화합물인 소포스부비르(sofosbuvir)(PharmaBLOCK R&D Co. Ltd.)(화학식 2)를 처리하거나, pcDNA3_GRIM19을 형질도입하고 소포스부비르를 처리하고, HCV RNA 카피의 변화를 확인하였다
[화학식 2]
Figure PCTKR2014010200-appb-I000006
도 10에서 알 수 있는 바와 같이, DMSO(dimethyl sulfoxide)를 처리한 대조군을 제외하고 모두 3일째까지 HCV RNA 카피 수준이 감소되었다가 다시 증가되는 양상을 확인하였다. 또한, pcDNA3_GRIM19을 형질도입하고 소포스부비르를 처리한 경우, 소포스부비르를 단독으로 처리한 경우에 비하여 HCV RNA 증가 수준이 낮아 HCV에 대하여 상승적 억제 효과가 있음을 확인하였고, 9일째에는 약 45% 이상 현저히 낮게 나타나는 것을 확인하였다.
실시예 9. GRIM19 단백질에서 항-HCV 효과가 있는 도메인 확인
GRIM19 단백질은 144개의 아미노산으로 이루어져 있는데, 아래 표 1과 같이 4개의 도메인(domain)으로 구분하여 항-HCV 효과가 있는 도메인을 확인하였다(도 11a).
표 3
도메인 아미노산 서열 유전자 서열(5'→3')
GRIM19-D1 (aa 1-36) MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSML(서열번호 6) atggcggcgtcaaaggtgaagcaggacatgcctccgccggggggctatgggcccatcgactacaaacggaacttgccgcgtcgaggactgtcgggctacagcatgctg(서열번호 7)
GRIM19-D2 (aa 37-72) MAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALL(서열번호 8) atggccatagggattggaaccctgatctacgggcactggagcataatgaagtggaaccgtgagcgcaggcgcctacaaatcgaggacttcgaggctcgcatcgcgctgttg(서열번호 9)
GRIM19-D3 (aa 73-101) MPLLQAETDRRTLQMLRENLEEEAIIMKDV(서열번호 10) atgccactgttacaggcagaaaccgaccggaggaccttgcagatgcttcgggagaacctggaggaggaggccatcatcatgaaggacgtg(서열번호 11)
GRIM19-D4(aa 102-144) MDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT(서열번호 12) atgcccgactggaaggtgggggagtctgtgttccacacaacccgctgggtgccccccttgatcggggagctgtacgggctgcgcaccacagaggaggctctccatgccagccacggcttcatgtggtacacg(서열번호 13)
상기 GRIM19-D1(aa 1-36), GRIM19-D2(aa 37-72), GRIM19-D3(aa 73-101), GRIM19-D4(aa 102-144)를 발현시킬 수 있는 발현 벡터를 제작하였으며, 실시예 2의 In vitro HCV 감염 모델에서 각 도메인의 효과를 확인하였다.
상기 발현 벡터의 제작을 위해, GRIM19의 각 도메인에 대한 유전자는 pcDNA3_GRIM19 발현 vector를 template로 한 PCR을 통해 확보하였으며, EcoRI과 SalI 제한효소 절단위치(restriction site)를 이용하여 각 도메인을 pCMV-3Tag-3A 벡터(Agilent Technologies, Inc.)에 subcloning하였다. GRIM19-D2, GRIM19-D3, GRIM19-D4의 경우 벡터 내에서 발현을 위하여 실제 대응하는 GRIM19 유전자 서열의 5' 앞에 개시코돈이 추가되었으며, 그에 따라 각 단백질 단편은 실제 대응하는 GRIM19 아미노산 서열의 N 말단 앞에 메티오닌이 추가되었다.
도 11b에서 알 수 있는 바와 같이, In vitro HCV 감염 모델에서 상기 제작한 각 도메인을 발현시킬 수 있는 발현 벡터를 형질도입시켜 GRIM19-D1, GRIM19-D2, GRIM19-D3, GRIM19-D4 도메인을 과발현시키는 경우, 모든 도메인에서 HCV RNA 수준이 의미있게 감소되는 것을 확인하였다. 또한, GRIM19 단백질을 발현시킨 경우보다 상기 각 도메인을 과발현시키는 경우에 HCV RNA 수준이 현저히 낮게 감소하는 것을 확인하였다.
따라서, GRIM19 단백질뿐 아니라 상기 GRIM19의 4가지 도메인을 각각 발현하는 경우에도 항-HCV 활성이 우수하게 나타나는 것을 입증하였다.
실시예 10. GRIM19 단백질 각 도메인의 항-HCV 효과 확인
GRIM19 단백질의 각 도메인 자체를 세포 내로 투과시키는 경우에도 항-HCV 효과를 나타내는지 확인하기 위하여, 실시예 8의 GRIM19의 각 도메인의 N 말단 쪽에 세포 투과성이 있는 펩타이드 서열(CP)이 결합된 펩타이드를 합성하여 In vitro HCV 감염 모델에서 효과를 확인하였다. 합성한 세포 투과성이 있는 펩타이드 서열을 포함하는 GRIM19 각 도메인 서열은 하기 표 2에 정리하였다.
표 4
아미노산 서열
CP-GRIM19-D1 RRRRRRRRRMAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSML(서열번호 14)
CP-GRIM19-D2 RRRRRRRRRAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALL(서열번호 15)
CP-GRIM19-D3 RRRRRRRRRPLLQAETDRRTLQMLRENLEEEAIIMKDV(서열번호 16)
실시예 2의 In vitro HCV 감염 모델을 통하여 HCVcc 감염시킨 Huh7 세포에 CP-GRIM19-D1, CP-GRIM19-D2 및 CP-GRIM19-D3 10μM을 48 시간 처리 후, HCV의 RNA 수준을 조사하였다.
도 12에서 확인할 수 있는 바와 같이, CP-GRIM19-D1, CP-GRIM19-D2 및 CP-GRIM19-D3를 처리하는 경우 HCV가 감염된 세포에서 HCV RNA 수준이 현저히 감소되는 것을 확인하였다.
따라서, GRIM19 단백질 또는 GRIM19 단백질의 도메인이 형질도입되어 세포 내에서 직접 발현되는 경우 외에, 세포 밖에서 GRIM19 단백질 또는 GRIM19 단백질의 도메인이 직접 처리되는 경우에도 우수한 항-HCV 효과가 있음을 입증하였다.
본 발명은 하기 연구개발사업 프로그램의 지원에 의해 수행되었다.
1) 지원기관 : 서울성모병원
2) 사업명 : 임상의학연구비, 우수연구자 사업 등 해당 사업명 작성
3) 과제명 : STAT3 활성 억제제를 이용한 C형 간염바이러스 복제 제어 연구
4) 연구책임자 : 윤승규
5) 연구기간 : 2013.11.01 - 2014. 10.31
본 발명의 GRIM19 단백질 또는 단백질 단편, 및 상기 단백질 또는 단백질 단편을 코딩하는 유전자를 포함하는, C형 간염 바이러스 감염 질환의 예방 또는 치료용 약학 조성물 또는 C형 간염 바이러스에 대한 항바이러스용 조성물은 HCV 표준치료법이 듣지 않는 환자들에 대해 치료가 가능하며, 유전자형에 제한없이 C형 간염 바이러스의 복제를 저해하여 C형 간염 바이러스 감염 질환의 예방 또는 치료가 가능하므로, C형 간염 치료 분야에서 유용하게 쓰일 수 있다.

Claims (36)

  1. GRIM19(Genes-associated with Reinoid-Interferon induced Morality 19) 단백질 또는 이의 단편, 및 상기 단백질 또는 단백질 단편을 코딩하는 유전자로 이루어진 군에서 선택된 1종 이상을 포함하는, C형 간염 바이러스(hepatitis C virus) 감염 질환의 예방 또는 치료용 약학 조성물.
  2. 청구항 1에 있어서,
    상기 GRIM19 단백질은 서열번호 2의 아미노산 서열로 이루어진 것인, 약학 조성물.
  3. 청구항 1에 있어서,
    상기 GRIM19 단백질을 코딩하는 유전자는 서열번호 1의 염기서열로 이루어진 것인, 약학 조성물.
  4. 청구항 1에 있어서,
    상기 GRIM19 단백질의 단편은
    서열번호 2 내의 1 내지 36번째 아미노산 서열을 포함하는 단백질 단편;
    서열번호 2 내의 37 내지 72번째 아미노산 서열을 포함하는 단백질 단편;
    서열번호 2 내의 73 내지 101번째 아미노산 서열을 포함하는 단백질 단편; 및
    서열번호 2 내의 102 내지 144번째 아미노산 서열을 포함하는 단백질 단편으로 이루어진 군에서 선택된 1종 이상인, 약학 조성물.
  5. 청구항 1에 있어서,
    상기 GRIM19 단백질의 단편은 서열번호 6, 서열번호 8, 서열번호 10 및 서열번호 12으로 이루어진 군에서 선택된 아미노산 서열로 이루어진 것인, 약학 조성물.
  6. 청구항 1에 있어서,
    상기 GRIM19 단백질의 단편을 코딩하는 유전자는
    서열번호 1 내의 3 내지 108번째 염기서열을 포함하는 유전자;
    서열번호 1 내의 109 내지 216번째 염기서열을 포함하는 유전자;
    서열번호 1 내의 217 내지 303번째 염기서열을 포함하는 유전자; 및
    서열번호 1 내의 304 내지 432번째 염기서열을 포함하는 유전자로 이루어진 군에서 선택된 1종 이상인, 약학 조성물.
  7. 청구항 1에 있어서,
    상기 GRIM19 단백질의 단편을 코딩하는 유전자는 서열번호 7, 서열번호 9, 서열번호 11 및 서열번호 13으로 이루어진 군에서 선택된 염기 서열로 이루어진 것인, 약학 조성물.
  8. 청구항 1에 있어서,
    상기 GRIM19 단백질 또는 이의 단편은 N-말단, C-말단, 또는 양 말단에 세포 투과성 펩타이드를 추가로 포함하는 것인, 약학 조성물.
  9. 청구항 8항에 있어서,
    상기 세포 투과성 펩타이드는 서열번호 19, 서열번호 20, 서열번호 21 및 서열번호 22로 이루어진 군에서 선택된 아미노산 서열로 이루어진 것인, 약학 조성물.
  10. 청구항 1에 있어서,
    상기 GRIM19 단백질 또는 이의 단편을 코딩하는 유전자는 재조합 벡터에 포함된 형태로 제공되는 것인, 약학 조성물.
  11. 청구항 1에 있어서,
    상기 조성물은 DGAT-1(diacyl-glycerol acyltransferase-1)의 발현 또는 활성을 억제하는 물질을 추가로 포함하는 것인, 약학 조성물.
  12. 청구항 11에 있어서,
    상기 DGAT-1의 발현 또는 활성을 억제하는 물질은 DGAT-1의 유전자 또는 mRNA에 특이적으로 결합하는 siRNA, shRNA 또는 안티센스 핵산인, 약학 조성물.
  13. 청구항 11에 있어서,
    상기 DGAT-1의 발현 또는 활성을 억제하는 물질은 DGAT-1에 특이적으로 결합하는 항체, 압타머 또는 화학식 1의 화합물 또는 이의 염인, 약학 조성물:
    [화학식 1]
    Figure PCTKR2014010200-appb-I000007
  14. 청구항 1에 있어서,
    상기 조성물은 RNA의존성 RNA 중합효소(RNA-dependent RNA polymerase)의 발현 또는 활성을 억제하는 물질을 추가로 포함하는 것인, 약학 조성물.
  15. 청구항 14에 있어서,
    상기 RNA의존성 RNA 중합효소의 발현 또는 활성을 억제하는 물질은 화학식 2의 화합물 또는 이의 염인, 약학 조성물:
    [화학식 2]
    Figure PCTKR2014010200-appb-I000008
  16. 청구항 1에 있어서,
    상기 조성물은 AMP-activated protein kinase(AMPK)를 활성화하는 물질을 추가로 포함하는 것인, 약학 조성물.
  17. 청구항 16에 있어서,
    상기 AMP-activated protein kinase(AMPK)를 활성화하는 물질은 메트포르민(metformin)인, 약학 조성물.
  18. 청구항 1에 있어서,
    상기 C형 간염 바이러스(hepatitis C virus) 감염 질환은 C형 간염, C형 간염 바이러스에 의한 간섬유화, C형 간염 바이러스에 의한 간경화 및 C형 간염 바이러스에 의한 간암인, 약학 조성물.
  19. GRIM19 단백질 또는 이의 단편, 및 상기 단백질 또는 단백질 단편을 코딩하는 유전자로 이루어진 군에서 선택된 1종 이상을 포함하는, C형 간염 바이러스에 대한 항바이러스용 조성물.
  20. 청구항 19에 있어서,
    상기 GRIM19 단백질은 서열번호 2의 아미노산 서열로 이루어진 것인, 항바이러스용 조성물.
  21. 청구항 19에 있어서,
    상기 GRIM19 단백질을 코딩하는 유전자는 서열번호 1의 염기서열로 이루어진 것인, 항바이러스용 조성물.
  22. 청구항 19에 있어서,
    상기 GRIM19 단백질의 단편은
    서열번호 2 내의 1 내지 36번째 아미노산 서열을 포함하는 단백질 단편;
    서열번호 2 내의 37 내지 72번째 아미노산 서열을 포함하는 단백질 단편;
    서열번호 2 내의 73 내지 101번째 아미노산 서열을 포함하는 단백질 단편; 및
    서열번호 2 내의 102 내지 144번째 아미노산 서열을 포함하는 단백질 단편으로 이루어진 군에서 선택된 1종 이상인, 항바이러스용 조성물.
  23. 청구항 19에 있어서,
    상기 GRIM19 단백질의 단편은 서열번호 6, 서열번호 8, 서열번호 10 및 서열번호 12으로 이루어진 군에서 선택된 아미노산 서열로 이루어진 것인, 항바이러스용 조성물.
  24. 청구항 19에 있어서,
    상기 GRIM19 단백질의 단편을 코딩하는 유전자는
    서열번호 1 내의 3 내지 108번째 염기서열을 포함하는 유전자;
    서열번호 1 내의 109 내지 216번째 염기서열을 포함하는 유전자;
    서열번호 1 내의 217 내지 303번째 염기서열을 포함하는 유전자; 및
    서열번호 1 내의 304 내지 432번째 염기서열을 포함하는 유전자로 이루어진 군에서 선택된 1종 이상인, 항바이러스용 조성물.
  25. 청구항 19에 있어서,
    상기 GRIM19 단백질의 단편을 코딩하는 유전자는 서열번호 7, 서열번호 9, 서열번호 11 및 서열번호 13으로 이루어진 군에서 선택된 염기 서열로 이루어진 것인, 항바이러스용 조성물.
  26. 청구항 19에 있어서,
    상기 GRIM19 단백질 또는 이의 단편은 N-말단, C-말단, 또는 양 말단에 세포 투과성 펩타이드를 추가로 포함하는 것인, 항바이러스용 조성물.
  27. 청구항 26에 있어서,
    상기 세포 투과성 펩타이드는 서열번호 19, 서열번호 20, 서열번호 21 및 서열번호 22로 이루어진 군에서 선택된 아미노산 서열로 이루어진 것인, 항바이러스용 조성물.
  28. 청구항 19에 있어서,
    상기 GRIM19 단백질 또는 이의 단편을 코딩하는 유전자는 재조합 벡터에 포함된 형태로 제공되는 것인, 항바이러스용 조성물.
  29. 청구항 19에 있어서,
    상기 조성물은 DGAT-1(diacyl-glycerol acyltransferase-1)의 발현 또는 활성을 억제하는 물질을 추가로 포함하는 것인, 항바이러스용 조성물.
  30. 청구항 29에 있어서,
    상기 DGAT-1의 발현 또는 활성을 억제하는 물질은 DGAT-1의 유전자 또는 mRNA에 특이적으로 결합하는 siRNA, shRNA 또는 안티센스 핵산인, 항바이러스용 조성물.
  31. 청구항 29에 있어서,
    상기 DGAT-1의 발현 또는 활성을 억제하는 물질은 DGAT-1에 특이적으로 결합하는 항체, 압타머 또는 화학식 1의 화합물 또는 이의 염인, 항바이러스용 조성물:
    [화학식 1]
    Figure PCTKR2014010200-appb-I000009
  32. 청구항 19에 있어서,
    상기 조성물은 RNA의존성 RNA 중합효소(RNA-dependent RNA polymerase)의 발현 또는 활성을 억제하는 물질을 추가로 포함하는 것인, 항바이러스용 조성물.
  33. 청구항 32에 있어서,
    상기 RNA의존성 RNA 중합효소의 발현 또는 활성을 억제하는 물질은 화학식 2의 화합물 또는 이의 염인, 항바이러스용 조성물:
    [화학식 2]
    Figure PCTKR2014010200-appb-I000010
  34. 청구항 19에 있어서,
    상기 조성물은 AMP-activated protein kinase(AMPK)를 활성화하는 물질을 추가로 포함하는 것인, 항바이러스용 조성물.
  35. 청구항 34에 있어서,
    상기 AMP-activated protein kinase(AMPK)를 활성화하는 물질은 메트포르민(metformin)인, 항바이러스용 조성물.
  36. C형 간염 바이러스 감염 질환이 유발된 개체에 GRIM19 단백질 또는 이의 단편, 및 상기 단백질 또는 단백질 단편을 코딩하는 유전자로 이루어진 군에서 선택된 1종 이상을 투여하는 단계를 포함하는, C형 간염 바이러스 감염 질환의 치료 방법.
PCT/KR2014/010200 2013-10-29 2014-10-28 C형 간염 바이러스 감염 질환의 예방 또는 치료용 약학 조성물 WO2015065020A1 (ko)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US15/032,717 US10195166B2 (en) 2013-10-29 2014-10-28 Methods for treating hepatitis C virus infectious disease

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
KR20130129139 2013-10-29
KR10-2013-0129139 2013-10-29
KR1020140144534A KR101638156B1 (ko) 2013-10-29 2014-10-23 C형 간염 바이러스 감염 질환의 예방 또는 치료용 약학 조성물
KR10-2014-0144534 2014-10-23

Publications (1)

Publication Number Publication Date
WO2015065020A1 true WO2015065020A1 (ko) 2015-05-07

Family

ID=53004540

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2014/010200 WO2015065020A1 (ko) 2013-10-29 2014-10-28 C형 간염 바이러스 감염 질환의 예방 또는 치료용 약학 조성물

Country Status (1)

Country Link
WO (1) WO2015065020A1 (ko)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN112111520A (zh) * 2020-09-22 2020-12-22 重庆医科大学附属儿童医院 Grim-19基因过表达的腺相关病毒表达载体及其在抑制肝纤维化病理进程中的应用

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101215670B1 (ko) * 2010-02-08 2012-12-26 가톨릭대학교 산학협력단 Ｇｒｉｍ19을 유효성분으로 함유하는 면역질환의 예방 또는 치료용 조성물

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101215670B1 (ko) * 2010-02-08 2012-12-26 가톨릭대학교 산학협력단 Ｇｒｉｍ19을 유효성분으로 함유하는 면역질환의 예방 또는 치료용 조성물

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
JUN ZHANG ET AL.: "The cell death regulator GRIM-19 is an inhibitor of signal transducer and activator of transcription 3", PNAS, vol. 100, no. 16, 5 August 2003 (2003-08-05), pages 9342 - 9347 *
KEIGO MACHIDA ET AL.: "c-Jun Mediates Hepatitis C Virus Hepatocarcinogenesis Through Signal Transducer and Activator of Transcription 3 and Nitric Oxide-Dependent Impairment of Oxidative DNA Repair", HEPATOLOGY, vol. 52, no. 2, 2010, pages 480 - 492 *
LI F. ET AL.: "Downregulation of GRIM-19 is associated with hyperactivation of p-STAT3 in hepatocellular carcinoma", MED. ONCOL., vol. 29, no. 5, 11 April 2012 (2012-04-11), pages 3046 - 3054 *

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN112111520A (zh) * 2020-09-22 2020-12-22 重庆医科大学附属儿童医院 Grim-19基因过表达的腺相关病毒表达载体及其在抑制肝纤维化病理进程中的应用

Similar Documents

Publication Publication Date Title
WO2013169077A1 (ko) 악액질 예방 또는 치료용 조성물
WO2014046478A1 (ko) 세포 투과성 펩티드, 그를 포함한 컨쥬게이트 및 그를 포함한 조성물
WO2014046490A1 (ko) 세포 투과성 펩티드, 그를 포함한 컨쥬게이트 및 그를 포함한 조성물
KR101048316B1 (ko) 근육 및 심장 강화제의 타겟으로서 ｔｒｉｍ72의 용도
EP3322428B1 (en) Modulation of hepatitis b virus replication
JP7218403B2 (ja) 抗ウイルス活性効能を有するペプチド及びこれを含む組成物
KR20090111320A (ko) 항종양 활성을 갖는 신규한 폴리펩티드
WO2015005723A1 (ko) 세포 투과성 펩티드 및 이를 포함하는 컨쥬게이트
US10195166B2 (en) Methods for treating hepatitis C virus infectious disease
Lu et al. An immediate-early protein of white spot syndrome virus modulates the phosphorylation of focal adhesion kinase of shrimp
Xirong et al. Hepatitis B virus can be inhibited by DNA methyltransferase 3a via specific zinc-finger-induced methylation of the X promoter
WO2021177518A1 (ko) 혈중 콜레스테롤 저하용, 심혈관 대사질환의 예방 또는 치료용 및 항염용 약학적 조성물
WO2015065020A1 (ko) C형 간염 바이러스 감염 질환의 예방 또는 치료용 약학 조성물
WO2009151304A2 (ko) 에이케이에이피일이를 함유하는 조성물 및 동물 모델로서 에이케이에이피일이 돌연변이 제브라피쉬의 용도
WO2010137770A1 (ko) 신규한 ｇｐｃｒ 단백질 및 이의 용도
Qu et al. C/EBPα Epigenetically Modulates TFF1 Expression via mC-6 Methylation in the Jejunum Inflammation Induced by a Porcine Coronavirus
WO2011087343A2 (ko) Ｈｐｖ 감염과 관련된 암의 치료용 조성물
WO2021194186A1 (ko) Vgll1 펩타이드를 포함하는 암 치료용 조성물
WO2012036507A2 (ko) Ｈｃｖ 감염 세포에서 특이적으로 마이크로 ｒｎａ에 대한 안티센스를 방출하는 엡타자임 및 이의 이용
WO2017061828A1 (ko) Plrg1 (pleiotropic regulator 1) 억제제를 유효성분으로 포함하는 암의 예방 또는 치료용 약학 조성물
KR20170056902A (ko) C형 간염 바이러스 감염 또는 감염과 관련된 질병의 예방 또는 치료용 약학 조성물
WO2017164486A1 (ko) Tesk1 억제제를 포함하는 항암제 내성 억제용 조성물 및 tesk1 억제제의 스크리닝 방법
WO2020235936A1 (ko) Pd-1의 발현을 억제하는 비대칭 sirna
KR102259320B1 (ko) 인플루엔자 바이러스 감염 질환의 예방 또는 치료용 약학 조성물
CN111148752B (zh) 肽衍生物和包含其的药物组合物

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 14857540

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 15032717

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 14857540

Country of ref document: EP

Kind code of ref document: A1