WO2014100139A1 - Glycan-modified anti-cd4 antibodies for hiv prevention and therapy - Google Patents

Glycan-modified anti-cd4 antibodies for hiv prevention and therapy Download PDF

Info

Publication number
WO2014100139A1
WO2014100139A1 PCT/US2013/076051 US2013076051W WO2014100139A1 WO 2014100139 A1 WO2014100139 A1 WO 2014100139A1 US 2013076051 W US2013076051 W US 2013076051W WO 2014100139 A1 WO2014100139 A1 WO 2014100139A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
hiv
ibalizumab
light chain
glycan
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2013/076051
Other languages
English (en)
French (fr)
Inventor
Ruijiang Song
David D. Ho
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Rockefeller University
Original Assignee
Rockefeller University
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Rockefeller University filed Critical Rockefeller University
Priority to JP2015549613A priority Critical patent/JP6408487B2/ja
Priority to EP13866337.2A priority patent/EP2934589B1/en
Priority to CN201380073311.4A priority patent/CN105228650B/zh
Priority to ES13866337T priority patent/ES2862950T3/es
Publication of WO2014100139A1 publication Critical patent/WO2014100139A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2812Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/18Antivirals for RNA viruses for HIV
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/40Immunoglobulins specific features characterized by post-translational modification
    • C07K2317/41Glycosylation, sialylation, or fucosylation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding

Definitions

  • Gl can-Modified Anti-CD4 Antibodies for HIV Prevention and Therapy
  • This disclosure generally relates to HIV prevention and treatment.
  • This disclosure also generally relates to glycan modification of antibodies.
  • this disclosure relates to glycan-modified anti-CD4 antibodies useful for HIV prevention and therapy.
  • HIV-1 entry is triggered by interaction of the viral envelope (Env) glycoprotein gpl20 with domain 1 (Dl) of the T-cell receptor CD4.
  • Ibalizumab iMab
  • IMab is a potent and broadly HIV- 1 neutralizing Ab (Jacobson et al., Antimicrob. Agents Chemother. 53:450-457, 2009; Kuritzkes et al., /. Infect. Dis. 189:286-291, 2004), which neutralizes HIV by binding mainly to domain 2 (D2) of the CD4 receptor on host T-cells, thus blocking the ability of HIV to use these CD4 receptors to gain entry into T-cells and produce infection (Burkly et al., /. Immunol.
  • ibalizumab neutralized 92% of all viruses as defined by 50% inhibition of infection, and 47.4% of viruses as defined by 90% inhibition of infection. While ibalizumab can potently inhibit a broad range of HIV isolates, a significant fraction of HIV variants can still escape the inhibitory activity of ibalizumab. It has been reported recently that loss of asparagine-linked glycosylation sites in the variable region 5 of HIV type 1 envelope is associated with resistance to ibalizumab (Toma et al., /. Virology 85(8): 3872-2880, 2011; Pace et al., /. Acquir. Immune Defic. Syndr. Epub ahead of print: September 2012).
  • Antibodies are glycosylated at conserved positions in their constant regions, and the presence and structure of the carbohydrate attached to the constant region can affect antibody activity (see review by Wright and Morrison, TIBTECH 15: 26-32, 1997).
  • the present invention provides a new approach for enhancing the activity of monoclonal antibodies through glycan modification in the variable region of the light chain.
  • the glycan-modified anti-CD4 monoclonal antibodies, expression vectors and cell lines useful for the production of such antibodies, and use of such antibodies for HIV prevention and therapy are provided.
  • the present invention provides a glycan-modified anti-CD4 antibody having one or more N-linked glycans attached to the variable region of said antibody.
  • the N-linked glycans are attached to the variable region of the light chain of said antibody. The attachment of glycans is achieved through one or more genetically engineered N-linked glycosylation sites in the variable region of said antibody.
  • the glycan-modified anti-CD4 antibody is a modified form of an anti-CD4 antibody having an engineered N-linked glycosylation site in its variable region.
  • the engineered N-linked glycosylation site is located in the variable region of the light chain of an anti-CD4 antibody, such as wild type (WT) or modified ibalizumab, ibalizumab mutant or modified anti-CD4 antibody.
  • the engineered N-linked glycosylation site is located at an amino acid position of the light chain of ibalizumab or corresponding positions thereof, which is selected from the group consisting of residues 30E, 52, 53, 54, 60, 65 and 67 and 76, and combination thereof.
  • the glycosylation site is at the amino acid position selected from the group consisting of positions 30E Gin, 52Ser, 53Thr, 54Arg, 60Asp, 65Ser, 67Ser, and 76Ser.
  • the glycosylation site at 30E Gin, 52Ser, 53Thr, 54Arg, 65Ser, or 67Ser provides improved activity.
  • the glycosylation site is at position 52Ser.
  • the anti-CD4 antibody is a modified form of ibalizumab comprising an engineered N-linked glycosylation site in the variable region of the light chain.
  • the glycan-modified anti-CD4 antibody is a modified form of MV1 comprising an engineered N-linked glycosylation site in the variable region of the light chain.
  • the invention provides a glycan-modified anti-CD4 antibody, called as LM52, which is prepared as an IgG 1 antibody with affinity to CD4 (anti-CD4 IgG 1 antibody) modified by an introduction of a N-linked glycan at the position 52.
  • a glycan-modified anti-CD4 antibody with improved recycling of the antibody which has the amino acid sequence of the light chain as set forth in SEQ ID NO: 4, and the heavy chain having the amino acid sequence as set forth in SEQ ID NO: 5.
  • the N-linked glycans attached to the antibody are composed of at least 7 carbohydrate units. In other embodiments, the N-linked glycans are composed of 10-11 carbohydrate units.
  • expression vectors and host cells are provided, which are useful for expressing an anti-CD4 immunoglobulin chain having an engineered N-linked glycosylation site in the variable region.
  • the present invention provides a glycan-modified monoclonal antibody having improved activity, in which the glycan-modified anti-CD4 antibody has N- linked glycans attached to the variable region as defined above.
  • the antibody or antigen binding fragment of the invention is effective for inhibiting, treating or/and preventing infection of target cells by human immunodeficiency virus type 1 ("HIV-l").
  • the present invention provides a pharmaceutical composition comprising a therapeutically effective amount of the glycan-modified anti-CD4 antibody of the invention and at least one pharmaceutically acceptable carrier.
  • the present invention provides a method for inhibiting, treating and/or preventing HIV infection and transmission, which comprises administering a subject in need thereof a pharmaceutical composition comprising a therapeutically effective amount of the glycan-modified anti-CD4 antibody of the invention, and at least one pharmaceutically acceptable carrier.
  • the present invention provides a glycan-modified monoclonal antibody with improved activity comprising N-linked glycans attached to the variable region of said antibody, particularly in the variable region of the light chain of said antibody.
  • Figure 1 shows the number of V5 potential N-linked glycosylation sites (PNGS) associated with Ibalizumab resistance (bar indicates median).
  • PNGS N-linked glycosylation sites
  • Figure 2 shows the loss of V5 N-terminal PNGS conferring HIV resistance to
  • Figure 3 shows the effect of the introduction of a V5 N-terminal PNGS on HIV sensitivity to ibalizumab.
  • Figure 4 provides an image showing the crystal structure of the ibalizumab-CD4 complex as depicted, indicating several sites in the light chain of ibalizumab which were mutated to introduce an N-linked glycosylation site based on their close distance to the V5 of gpl20.
  • Figures 5A and 5B provide a model of glycosylation in V5 of HIV-1 gpl20, in the context of both CD4 and ibalizumab (using PyMOL); where the complex was modeled by superimposing the structure of Dl and D2 of CD4 in complex with gpl20 (Protein Data Bank accession number 2NXY) onto the same domains of CD4 in complex with ibalizumab (PDB 302D); and the glycan (blue) was introduced at the relevant asparagine by superimposing the asparagine with that of a glycan-bound asparagine from PDB 3TYG; and the heavy and L chains of ibalizumab are shown as cyan and magenta ribbons, respectively.
  • the first two domains of human CD4 are green, while HIV-1 gpl20 is tan; wherein Figure 5A shows MansGlcNac 2 at the position 459 of gpl20 in the V5 loop (N-terminal); and Figure 5B shows MansGlcNac 2 at the position of 463 of gpl20 in the V5 loop (C-terminal).
  • Figures 6A-6D show the N-linked glycosylation in the L chain of ibalizumab; where: [0026] Figure 6A shows the ibalizumab L chain mutants (LMs) as constructed, co-transfected into 293A cells with the WT ibalizumab H chain plasmid, purified on a protein-A agarose column, and analyzed by SDS-PAGE (WT ibalizumab was analyzed in the same way).
  • LMs ibalizumab L chain mutants
  • Figure 6B shows the purified WT, LM30E, LM53, and LM52 antibodies that were treated with or without PNGase F at denaturing conditions and analyzed by SDS-PAGE.
  • Figure 6C shows the N-linked glycoforms on the L chain of LM52 produced in 293A cells that were analyzed by mass spectrometry.
  • Figue 6D shows that a positive correlation was observed between the size of the glycan and the neutralization activity.
  • Figure 7 shows the neutralization activities of WT ibalizumab and its LMs; wherein neutralization against a panel of ibalizumab-resistant or partially ibalizumab-resistant pseudo virus or replication-competent HIV-1 strains was measured by TZM-bl assay;
  • 96USHIPs9, BK132/GS009, and 96USHIPs7 were replication-competent;
  • CAAN5342.A2-dd and AC10.0.29-dd were site-directed Env mutants without any PNGS in V5 and were resistant or partially resistant to neutralization by wild-type ibalizumab;
  • 9015-07 Al and 1051-D927 were clade B transmitted founder viruses (data represent three independent experiments).
  • Figures 8A-8C show the influence of glycan size on the HIV-1 neutralization activity of LM52, where:
  • FIG. 8A shows that LM52 was produced in HEK293A cells with or without tunicamycin (LM52 -T) or kifunensine (LM52-K); alternatively, LM52 was produced in the N- acetylglucosaminyltransferase I-negative GnTl(-) HEK293S cells (LM52-G); the purified LM52 proteins, together with unmodified LM52 and WT ibalizumab, were analyzed by SDS- PAGE.
  • Figure 8B shows that the neutralization activities of ibalizumab and different glycan variants of LM52 against three ibalizumab-resistant pseudoviruses, as measured in in TZM-bl cells.
  • Figure 8C shows that the depiction (using PyMOL) of the space filled by glycans of representative conformations and sizes, when tagged on residue 52 of ibalizumab. Depiction is based on the model generated in Figure 5 and colors were the same; wherein the 7-ring N- glycan, MansGlcNac 2 , was extracted from PDB entry 3TYG. An 11-ring N-glycan,
  • Figure 9 shows the neutralization of a panel of 118 HIV-1 Env pseudo viruses; wherein the neutralization by LM52 and WT ibalizumab was measured in a TZM-bl assay; wherein for each virus, black bars indicated maximum percent inhibition (MPI) when tested at Ab
  • viruses were ordered by descending MPI for ibalizumab; given the large of number of viruses being tested, this experiment was done only once.
  • FIG. 10 shows that HIV-1 strain coverage of LM52. Viral coverage of WT ibalizumab, LM52, and PG9, 10E8, VRCOl, and NIH45-46G54W HIV-1 bnAb. LM52 and ibalizumab were tested up to 10 ⁇ g/mL, while the other monoclonal antibodies were tested up to 50 ⁇ g/mL.
  • Figure 11 provides the summary of the neutralization activity of LM52 and ibalizumab against a diverse panel of 118 HIV-1 Env pseudoviruses, as reflected by their IC 50 ⁇ g/mL) and IC 80 ⁇ g/niL); wherein red lines showed the geometric mean values and the 95% confidence interval (each dot represents an individual viral strain).
  • Figure 12 shows the ICgo values of LM52 and ibalizumab against ibalizumab-sensitive or ibalizumab-resistant viruses (resistance defined as ICgo > 10 ⁇ g/mL).
  • Figure 13A shows the sizes of H chain and L chain of ibalizumab and its single, double and triple glycan variants as analyzed by SDS-PAGE.
  • Figure 13B shows the neutralization activities of ibalizumab, LM52, and several double or triple glycan mutants against two ibalizumab-resistant pseudoviruses in TZM-bl cells.
  • Figures 14A and 14B provide the results of the analysis of LM52 polyreactivity
  • Figure 14A shows the HEp-2 reactivity of LM52 and ibalizumab as measured by ELISA using Quanta Lite ANA ELISA kit (INOVA Diagnostics); wherein the negative control was an human serum with no antibodies to nuclear and cytoplasmic antigens; and strong and weak positive controls were human sera known to have abundant and small quantities, respectively, of antibodies to nuclear and cytoplasmic antigens.
  • Figure 14B shows LM52 and ibalizumab reactivity to single-stranded DNA, double- stranded DNA, insulin, lipopolysaccharide, KLH, and CD4, as measured by ELISA assay;
  • the present invention has demonstrated for the first time that the function of a monoclonal antibody can be improved through glycan modification in the variable region.
  • grafting glycans onto the variable region of the light chain of an anti-CD4 monoclonal antibody can restore a glycan-mediated interaction between the antibody and HIV, such that the antibody with a glycan modification can potently inhibit infection of viral isolates that normally escape the activity of the parent antibody molecule (without the glycan modification).
  • the present invention provides glycan-modified anti-CD4 monoclonal antibodies, components such as expression vectors and cell lines useful for the production of such antibodies, and use of such antibodies for HIV prevention and therapy.
  • an "antigen” refers to a molecule which contains one or more epitopes and which is capable of eliciting an immunological response.
  • Antigenic molecules are also used in a general sense to refer to molecules that are binding targets of the glycan modified proteins disclosed herein.
  • An "epitope”, also known as antigenic determinant, is the portion of an antigenic molecule or molecules that is recognized by the immune system, i.e., B cells, T cells or antibodies.
  • An epitope can be a conformational epitope or a linear epitope.
  • a conformational epitope is formed by discontinuous sections of an antigenic molecule, or formed by multiple molecules.
  • the antigen is a protein
  • a conformational epitope can be formed by discontinuous amino acid residues of the same protein molecule, or by amino acid residues on different molecules of the protein (e.g., a quaternary epitope formed by a multimer of the protein).
  • a linear epitope is formed by continuous sections of an antigen, e.g., a continuous sequence of amino acids of a protein antigen.
  • antibody is used herein broadly and encompasses intact antibody molecules, which include intact polyclonal, monoclonal, monospecific, polyspecific, chimeric, humanized, human, primatized, single-chain, single-domain, synthetic and recombinant antibodies, and antibody fragments that have a desired activity or function.
  • antibody fragments includes particularly antigen-binding fragments of an intact antibody.
  • antigen-binding fragments include, but are not limited to, Fab fragments (consisting of the VL, VH, CL and CHI domains), Fab' fragments (which differs from Fab fragments by having an additional few residues at the C-terminus of the CHI domain including one or more cysteines from the antibody hinge region), (Fab') 2 fragments (formed by two Fab' fragments linked by a disulphide bridge at the hinge region), Fd fragments (consisting of the VH and CHI domains), Fv fragments (referring to a dimer of one heavy and one light chain variable domain in tight, non-covalent association which contains a complete antigen recognition and binding site), dAb fragments (consisting of a VH domain), single domain fragments (VH domain, VL domain, VHH domain, or VNAR domain), isolated CDR regions, scFv (or "
  • variable region refers to the antigen-binding region of an antibody, which varies greatly between different antibody molecules.
  • the region of an antibody that does not vary the same way and generally engages effector functions of the immune system is called "constant region".
  • the two variable domains of the heavy chain (VH) and the two variable domains of the light chain (VL) make up the variable region of an antibody.
  • the six constant domains of the heavy chain (CH 1; CH 2 , and CH 3 ) and the two constant domains of the light chain (CL) make up the constant region of an antibody.
  • CDR complementarity determining region
  • FR framework region
  • antigen-binding site of an antibody means a conformation and/or
  • VH and VL domains interact to define an antigen-binding site on the surface of the VH-VL dimer.
  • the six CDRs confer antigen-binding specificity to the antibody.
  • a single variable domain i.e., VH or VL
  • VH or VL can also recognize and bind antigen, albeit often less effectively than the whole binding site with all six CDRs.
  • chimeric antibody refers to antibodies containing polypeptides from different sources, e.g., different species or different antibody class or subclass.
  • Examples of chimeric antibodies include an antigen-binding portion of a murine monoclonal antibody fused an Fc fragment of a human immunoglobulin.
  • Methods for making chimeric antibodies are known in the art; for example, methods described in patents by U.S. Patent 4,816,397 to Boss et al. and U.S. Patent 4,816,567 to Cabilly et al.
  • humanized antibody refers to antibodies that contain non-human sequence elements in a human immunoglobulin backbone or framework.
  • humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region (CDRs) of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having a desired specificity, affinity and capacity.
  • donor antibody such as mouse, rat, rabbit or nonhuman primate having a desired specificity, affinity and capacity.
  • framework region (FR) residues of the human immunoglobulin are also replaced by non-human residues.
  • Humanized antibodies may also, in some instances, contain residues that are not found in either the recipient antibody or the donor antibody and introduced to further refine antibody performance.
  • a humanized antibody contains substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable regions correspond to those of a non-human immunoglobulin and all or substantially all of the framework regions are those of a human immunoglobulin sequence.
  • a humanized antibody optionally also contains at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region
  • non-human primatized antibody refers to antibodies that contain human sequence elements or non-primate sequence elements in a non-human primate immunoglobulin backbone or framework.
  • non-human primatized antibodies can be made from a non-human primate immunoglobulin (recipient antibody) by replacing residues in a
  • non-human primatized antibodies can be made suitable for administration to a desirable primate species by using a recipient immunoglobulin having human or non-primate sequences or sequences from a different primate species and introducing the Fc fragment, and/or residues, including particularly framework region residues, from the desirable primate, into the recipient immunoglobulin.
  • non-human primatized antibodies include "monkeynized" antibodies disclosed herein in the Examples section.
  • the term "monospecific antibody” refers to antibodies that recognize and bind to one epitope.
  • polyspecific antibody refers to antibodies formed from at least two separate antibodies and binding to multiple (i.e., two or more) separate epitopes.
  • neutralizing antibody refers to an antibody that inhibits, reduces or completely prevents HIV-1 infection. Whether an antibody is a neutralizing antibody can be determined by in vitro assays described in the Examples section hereinbelow.
  • potent neutralizing antibody refers to an antibody which, when used at a low concentration, reduces HIV-1 infection by at least 50%, 60%, 70%, 80%, 90%, 95%, 99% or greater. Concentrations below 50 ⁇ g/ml, between 1 and 50 ⁇ g/ml, or even below ⁇ g/ml, are considered "low concentrations". In some embodiments, low concentrations are concentrations in the picomolar range, such as 10-900 ng/ml, and include any concentration in that range, such as 800, 700, 600, 500, 400, 300, 200, 100, 75, 50, 25, 10 ng/ml, or even less than 10 ng/ml.
  • narrow neutralizing antibody refers to an antibody which inhibits HIV-1 infection, as defined by a 50% inhibition of infection in vitro, in more than 50%, 60%, 70%, 80%, 90%, 95%, 99% or greater, of a large panel of (greater than 100) HIV-1 envelope pseudotyped viruses and viral isolates; for example, a large panel of isolates representing envelope diversity by geography, clade, tropism, and stage of infection.
  • fragment refers to a physically contiguous portion of the primary structure of a biomolecule.
  • a fragment may be defined by a contiguous portion of the amino acid sequence of a protein and may be at least 3-5 amino acids, at least 6-10 amino acids, at least 11-15 amino acids, at least 16-24 amino acids, at least 25-30 amino acids, at least 30-45 amino acids and up to the full length of the protein minus a few amino acids.
  • a fragment is defined by a contiguous portion of the nucleic acid sequence of a polynucleotide and may be at least 9-15 nucleotides, at least 15-30 nucleotides, at least 31-45 nucleotides, at least 46-74 nucleotides, at least 75-90 nucleotides, and at least 90-130 nucleotides.
  • fragments of biomolecules are immunogenic fragments.
  • a "fusion protein” refers to two or more peptides of different origins connected to each other via a linker or linkers.
  • a fusion protein can include a protein conjugated to an antibody.
  • Other examples include, an antibody conjugated to a different antibody or an antibody conjugated to a Fab fragment.
  • the Fab fragment can be conjugated to the N terminus or C terminus of the heavy or light chain of the antibody, or other regions within the antibody.
  • a "peptide” is any compound formed by the linkage of two or more amino acids by amide (peptide) bonds, usually a polymer of alpha-amino acids in which the alpha-amino group of each amino acid residue (except the NH2 terminus) is linked to the alpha-carboxyl group of the next residue in a linear chain.
  • the terms peptide, polypeptide and poly(amino acid) are used synonymously herein to refer to this class of compounds without restriction as to size, unless indicated to the contrary. Members of this class having a large size are also referred to as proteins and include antibodies.
  • This glycan modification approach disclosed herein is applicable to anti-CD4 monoclonal antibodies, which can be a monoclonal antibody that is a monospecific, polyspecific, chimeric, humanized, human, non-human primatized, single-chain, and/or single-domain antibody.
  • the present approach is also applicable to fragments of anti-CD4 monoclonal antibodies, especially antigen -binding fragments of anti-CD4 monoclonal antibodies.
  • Anti-CD4 antibodies have been described in the art and can also be readily generated as the protein sequence of the CD4 receptor is available to those skilled in the art.
  • CD4 has four immunoglobulin domains (Dl to D4) that are located on the extracellular surface of the cell, and uses its Dl domain to interact with the p 2 -domain of MHC class II molecules.
  • the anti-CD4 antibody binds to one or more of Dl, D1-D2 junction, D2, the BC or
  • anti-CD4 antibodies used in this disclosure are directed principally to the second immunoglobulin-like domain (D2)
  • CD4 have the desirable property of blocking HIV infection without interfering with immune functions mediated by interaction of CD4 with the major histocompatibility complex (MHC) class II molecules.
  • the anti-CD4 antibody used in the present invention binds to an epitope located in the BC-loop of D2 near the D1-D2 junction of the CD4 receptor (amino acids 121-127).
  • the anti-CD4 antibody binds to the FG-loop of D2 (amino acids 163-165) and part of Dl (amino acids 77-96).
  • the amino acid numbering corresponds to positions of the mature form of the CD4 receptor, not including the signal peptide.
  • the amino acid sequence of the human CD4 receptor is set forth in SEQ ID NO: 1, in which amino acids 1-25 represent a signal peptide, amino acids 26-122 constitute Dl, and amino acids 123-205 constitute D2.
  • the anti-CD4 monoclonal antibody is the humanized antibody, ibalizumab or "iMab" (previously known as TNX-355, or hu5A8).
  • Ibalizumab potently blocks infection by a broad spectrum of HIV-1 isolates and targets an epitope located in the BC-loop of D2 near the D1-D2 junction of the CD4 receptor, without interfering with immune functions mediated by interaction of CD4 with the major histocompatibility complex (MHC) class II molecules.
  • MHC major histocompatibility complex
  • One example of the anti-CD4 antibody is that provided in US Patent No. 5,871,732, which is entirely incorporated by reference herein..
  • the anti-CD4 antibody or fragment thereof is a mutant of ibalizumab with improved stability.
  • the anti-CD4 antibody having one or more substitutions in the hinge region that prevent intrachain disulfide bond formation resulting in antibody molecules with surprisingly improved bivalent stability, for instance, those provided in WO2008134046 (Al), published on April 27, 2007, which is incorporated herein by reference.
  • the anti-CD4 antibody may be generated by IgG 4 or IgG 1.
  • an anti-CD4 IgG 1 antibody with binding affinity to CD4 was prepared, designated as MVl.
  • the MVl has a leucine to phenylalanine change at position 234, a leucine to glutamic acid change at position 235 and a proline to serine change at position 331 of the IgG 1 constant region.
  • the MVl has the amino acid sequences for the heavy chain and light chain as set forth in SEQ ID NOS: 2-3, respectively.
  • the anti-CD4 antibody may comprise one or more modifications in the Fc region or FcRn region of the heavy chain to improve recycling of the anti-CD4 antibody.
  • the anti-CD4 antibody comprises an amino acid sequence of heavy chain as set forth in SEQ ID NO: 5.
  • Glycan modification disclosed herein involves adding glycans to an engineered N-linked glycosylation site within the variable region of an anti-CD4 antibody. In eukaryotic cells, glycans are attached to asparagine residues within the consensus sequence Asn-X-Ser/Thr of newly synthesized polypeptides as they emerge from the ribosome.
  • This N-linked glycosylation process is an enzyme-directed process which occurs in the ER and the Golgi apparatus.
  • the Asn residue within a consensus sequence Asn-X-Ser/Thr is referred to as the "N-linked glycosylation site.”
  • the skilled artisan can employ a variety of molecular cloning techniques to engineer an N-linked glycosylation site within the variable region of an anti-CD4 monoclonal antibody, which may include one or more insertions, deletions and/or substitutions of amino acids in order to obtain a consensus N-linked glycosylation sequence Asn-X-Ser/Thr.
  • an N-linked glycosylation site is engineered within the V-domain of the light chain (VL) of an anti-CD4 monoclonal antibody.
  • VL light chain
  • the present invention demonstrates that for ibalizumab or other anti-CD4 antibody, an N-linked glycosylation site can be introduced to a location that is close to the V5 loop of the HIV gpl20 protein bound to CD4 Domain 1 in a 3-D modeling analysis.
  • an N-linked glycosylation site is engineered at an amino acid position of the light chain of ibalizumab or corresponding positions thereof, selected from residues 30E, 52, 53, 54, 60, 65 and 67 and 76, and a combination thereof.
  • the amino acid position is selected from the group consisting of positions 30E Gin, 52Ser, 53Thr, 54Arg, 60Asp, 65Ser, 67Ser, and 76Ser.
  • each of the amino acid changes made to the sequence represented by "30E Gin”, “52Ser”, “53Thr”, “54Arg”, “60Asp”, “65Ser”, “67Ser”, and “76Ser” to introduce a new N-linked glycosylation site at each of these positions is given below:
  • 30E Gin 30E Gin, 31Lys, 32Asn changed to 30E Asn, 31 Ala, 32Thr
  • 54Arg 54Arg, 55Glu, 56Ser changed to 54Asn, 55Ala, 56Thr
  • 60Asp 60Asp, 61Arg, 62Phe changed to 60Asn, 61 Ala, 62Thr 65Ser: 65Ser, 66Gly, 67Ser changed to 65Asn, 66Ala, 67Thr
  • 76Ser 76Ser, 77Ser, 78Val changed to 76Asn, 77Ala, 78Thr.
  • a N-linked glycosylation N-linked glycosylation at either or combination of the positions 30EGln, 52Ser, 53Thr, 54Arg, 65Ser and 67Ser can provide an improved activity.
  • the position is position 52Ser.
  • the numbering of these positions is based on the mature form of the light chain (devoid of the first 16 amino acid signal sequence) of ibalizumab, or the corresponding positions thereof.
  • the N-linked glycosylation site is engineered at one of 30E Gin, 52Ser, or 53Thr of the ibalizumab light chain.
  • the N-linked glycosylation site is engineered at position 52Ser.
  • MV1 a derivative IgGl version of ibalizumab with modifications to improve the stability
  • the heavy chain and light chain of the MV1 have the amino acid sequences set forth in SEQ ID NOS: 2 and 3, respectively.
  • the light chain has an engineered N-linked glycosylation site at position 52, which has the amino acid sequence set forth in SEQ ID NO: 4.
  • the MV1 may have a further modification in the Fc region or FcRn region of the heavy chain to improve recycling of the antibody.
  • a particular example of the present invention provides a glycan-modified anti-CD4 antibody with improved activity and stability comprising the amino acid sequence of light chain as set forth in SEQ ID NO: 4 and the amino acid sequence of heavy chain as set forth in SEQ ID NO: 5.
  • an N-linked glycosylation site has been engineered within the variable region of an anti-CD4 monoclonal antibody
  • glycan-modified forms of such antibody can be readily produced using suitable recombinant expression systems.
  • a cell line suitable for recombinant expression of antibody molecules and capable of N-linked glycosylation can be transfected with expression vector(s) encoding the light chain of an anti-CD4 antibody, wherein at least a variable domain of the light chain has been engineered to include an N-linked glycosylation site.
  • Antibody-containing culture supernatants can be collected and subjected to any appropriate chromatography to obtain a substantially purified antibody preparation.
  • Cell lines suitable for recombinant expression of antibody molecules are readily available to those skilled in the art, and are generally capable of N-linked glycosylation.
  • the N-linked glycosylation process occurs co-translationally and the initial step takes place at the luminal side of the ER membrane, involving the transfer of a Glc3Man 9 GlcNAc 2 oligosaccharide to nascent polypeptide chains.
  • This precursor structure is then further modified by a series of glycosidases and glycosyltransferases. Following the removal of the three glucose residues by glucosidase I and II, one specific terminal cc-l,2-mannose is removed by mannosidase I.
  • Man 8 GlcNAc 2 structures are further trimmed by several cc-1,2- mannosidases.
  • the resulting MansGlcNAc 2 N-linked glycans are subsequently modified by the addition of a -l,2-linked GlcNAc residue in a reaction catalyzed by GlcNAc transferase I (GnT- I), the resulting GlcNAcMgGlcNAc 2 structure leading ultimately to the formation of "hybrid- type" N-linked glycans.
  • the GlcNAcMgGlcNAc 2 structure is acted on by mannosidase II (Man-II) to move two mannoses, and then by GnT-II to add a second ⁇ -1,2- GlcNAc.
  • Man-II mannosidase II
  • GnT-II to add a second ⁇ -1,2- GlcNAc.
  • Glycans with the resulting structure in which both core-cc-mannose residues are modified by at least one GlcNAc residue are called "complex type" N-linked glycans.
  • GnT-IV GnT-IV
  • GnT-V GnT-V
  • GnT- Vis Galactose and sialic acid residues are further added by galactosyltransferases and sialyltransferases, respectively.
  • the N-linked glycans added to the variable region of an anti- CD4 antibody should include at least 7, 8, 9, 10, 11 or 12 carbohydrate units or "rings.”
  • carbohydrate units refers to individual saccharide molecules that are linked to each other to make up the native N-glycans in eukaryotic cells; i.e., they include glucose, mannose, N- acetylglucosamine, galactose, and sialic acid.
  • the precise structure (i.e., the compositions and serial linkage) of the N-glycans on an antibody may not be entirely critical as long as the N- glycans include at least 7 units.
  • Examples of N-linked glycans include those typically seen in mammalian cells, e.g., Man 8 GlcNAc 2 (the GlcNAc at the end being linked to Asn),
  • suitable cells lines for recombinant expression of glycan- modified antibodies are eukaryotic cells, including especially mammalian cell lines such as Chinese hamster ovary (CHO) cells, Baby Hamster Kidney (BHK) cells, (Murine myeloma) NSO cells, Murine myeloma SP2/0 cells, human embryonic kidney 293 (HEK293 or 293) cells, mouse embryonic fibroblast 3T3 cells, and cell lines derived therefrom as long as the derived cells can effectively express a recombinant antibody with N-linked glycosylation. Many of these cells are available through American Tissue Culture Collection (ATCC) or commercial sources.
  • ATCC American Tissue Culture Collection
  • glycoproteins having altered glycoforms e.g., glycoproteins having a particular class of N-linked glycans (such as bi-antennary complex N- linked oligosaccharides) modified with bisecting N-acetylglucosamine (GlcNAc), as described in U.S. Patent 6,602,684, incorporated herein by reference
  • GlcNAc N-acetylglucosamine
  • Other eukaryotic cells which may be appropriate include insect cells and yeast cells, such as baker yeast S. cerevisiae and methylotrophic yeast such as Pichia pastoris, including particularly yeast strains genetically modified to produce proteins having human N-glycan forms. See, e.g., U.S. Patent 7,029,872, and U.S. Patent 7,449,308, both incorporated herein by reference.
  • the N-linked glycans are attached to an antibody molecule produced from cells by treating the antibody molecule isolated from cell culture with enzymes (e.g., PNGase).
  • enzymes e.g., PNGase
  • a shift in the apparent molecular weight of the antibody indicates that N-linked glycans are indeed attached to the antibody molecule.
  • the size of the N- linked glycans can be estimated by comparing with N-linked glycans of known sizes.
  • the N-linked glycans attached to the antibody can be analyzed by DNA sequencer assisted (DSA), fluorophore assisted carbohydrate electrophoresis (FACE), or MALDI-TOF MS, for example, all of which are techniques well documented in the art.
  • DSA DNA sequencer assisted
  • FACE fluorophore assisted carbohydrate electrophoresis
  • MALDI-TOF MS MALDI-TOF MS
  • N-linked glycans are analyzed with an ABI 3130 DNA sequencer. See, e.g., Laroy et al. (Nat Protoc. 1: 397-405 (2006)), U.S. Patent 6,602,684 for MALDI-TOF MS analysis of N-linked glycans on recombinantly produced proteins, which are incorporated by reference herein.
  • Glycan-modified antibodies can be evaluated in various functional assays to confirm their effectiveness in neutralizing HIV, including assays to determine the breadth and potency of the antibodies against large panels of viral isolates as described in the examples section.
  • a glycan on the N-terminus of gpl20 fills a vacant space between the L chain of ibalizumab and gpl20 V5, and ibalizumab' s effect on HIV-1 entry is sterically mediated by the mass effect of this glycan.
  • ibalizumab mutants with PNGS at various positions in the L chain on the ability to neutralize HIV-1 infectivity in vitro, it was found that ibalizumab mutants bearing a glycan located in close proximity to V5 in the ibalizumab-CD4-gpl20 complex efficiently neutralized HIV-1.
  • ibalizumab mutants also neutralized HIV-1 strains that are resistant to wild-type ibalizumab.
  • an ibalizumab mutant, LM52 neutralized 100% of the tested 118 HIV-1 isolates at a potency more than 10-fold higher than wild-type ibalizumab judging by the geometric mean IC 80 , the antibody concentration required to neutralize 80% of infection. It is indicated that ibalizumab blocks HIV-1 entry through a steric hindrance mechanism, and provide an example of how a strategic placement of an N-linked glycosylation site can be used to improve the activity of a monoclonal antibody.
  • the glycan-addition approach may be adapted to enhance their functional activity of monoclonal antibodies.
  • SAR structural-activity relationship
  • substantially homogeneous it is meant that at least 50%, 60%, 75%, 80%, 85%, 90% or even 95% of the N- linked glycans on the antibody molecules in a preparation are of the same structure, same size (i.e., same molecular weight, or alternatively, same number of carbohydrate “rings"), or same range of size (e.g., 9-12 "rings", or 10-11 “rings”), and/or type.
  • inhibitors include Kifunensine, DMJ (for "deoxymannojirimycin"), and Swainsonine.
  • composition comprising a glycan-modified antibody disclosed herein can be prepared by mixing the antibody with one or more optional pharmaceutically acceptable carriers.
  • Pharmaceutically acceptable carriers include solvents, dispersion media, isotonic agents and the like.
  • the carrier can be liquid, semi-solid, e.g. pastes, or solid carriers.
  • carriers examples include water, saline solutions or other buffers (such as phosphate, citrate buffers), oil, alcohol, proteins (such as serum albumin, gelatin), carbohydrates (such as monosaccharides, disaccharides, and other carbohydrates including glucose, sucrose, trehalose, mannose, mannitol, sorbitol or dextrins), gel, lipids, liposomes, resins, porous matrices, binders, fillers, coatings, stabilizers, preservatives, antioxidants including ascorbic acid and methionine, chelating agents such as EDTA; salt forming counter-ions such as sodium; non-ionic surfactants such as
  • the pharmaceutical composition can contain more than one active compound, e.g., one or more antibodies, in combination with one or more additional beneficial compound for inhibiting, preventing and treating HIV infections.
  • the active ingredients can be combined with the carrier in any convenient and practical manner, e.g., by admixture, solution, suspension, emulsification, encapsulation, absorption and the like, and can be made in formulations such as tablets, capsules, powder (including lyophilized powder), syrup, suspensions that are suitable for injections, ingestions, infusion, or the like. Sustained-release preparations can also be prepared.
  • the glycan modified antibodies disclosed herein are employed for the treatment and prevention of HIV infection in a subject, as well as prevention of HIV transmission.
  • treatment refers to effective inhibition of the HIV infection so as to delay the onset, slow down the progression, reduce viral load, and/or ameliorate the symptoms caused by HIV infection.
  • prevention of HIV infection means the onset of HIV infection is delayed, and/or the incidence or likelihood of HIV infection is reduced or eliminated.
  • prevention of HIV transmission means the incidence or likelihood of HIV being transmitted from one individual to another (e.g., from an HIV-positive woman to the child during pregnancy, labor or delivery, or breastfeeding; or from an HIV-positive subject to an HIV-negative partner) is reduced or eliminated.
  • subject refers to any primate subject, including human and non-human subjects (e.g., rhesus subjects).
  • a therapeutically effective amount of a glycan-modified antibody disclosed herein is administered to a subject in need.
  • the term "therapeutically effective amount” means the dose required to effect an inhibition of HIV infection so as to treat and/or prevent HIV infection.
  • the dosage of an antibody depends on the disease state and other clinical factors, such as weight and condition of the subject, the subject's response to the therapy, the type of formulations and the route of administration.
  • the precise dosage to be therapeutically effective and non-detrimental can be determined by those skilled in the art.
  • a suitable dose of an antibody for the administration to adult humans parenterally is in the range of about 0.1 to 20 mg/kg of patient body weight per day, once a week, or even once a month, with the typical initial range used being in the range of about 2 to 10 mg/kg. Since the antibodies will eventually be cleared from the bloodstream, re-administration may be required.
  • implantation or injection of antibodies provided in a controlled release matrix can be employed.
  • the antibodies can be administered to the subject by standard routes, including the oral, transdermal or parenteral (e.g., intravenous, intraperitoneal, intradermal, subcutaneous or intramuscular).
  • the antibodies can be introduced into the body, by injection or by surgical implantation or attachment such that a significant amount of a desirable antibody is able to enter blood stream in a controlled release fashion.
  • SEQ ID NO: 1 the amino acid sequence of the human CD4 receptor (amino acids
  • SEQ ID NO: 2 the amino acid sequence of the heavy chain of MV1 (471 amino acids, including the first 19 amino acid residues constituting a leader sequence):
  • SEQ ID NO: 3 the amino acid sequence of the light chain of MV1 (238 amino acids, including the first 19 amino acids which constitute a leader sequence):
  • SEQ ID NO: 4 the amino acid sequence of the Light chain of LM52:
  • SEQ ID NO: 5 the amino acid sequence of the heavy chain of a modified MV1 with improved recycling of the_antibody (452 amino acids with two modifications): QVQLQQSGPEVVKPGASVKMSCKASGYTFTSYVIHWVRQKPGQGLDWIGYINPYNDGT
  • TZM-bl cells (catalog no. 8129) were obtained through the AIDS Research and
  • ARRRP Reference Reagent Program
  • NIH NIH
  • This is a genetically engineered HeLa cell line that expresses CD4, CXCR4, and CCR5 and contains Tat-responsive reporter genes for luciferase and ⁇ -galactosidase under the control of an HIV-1 long terminal repeat.
  • the Standard Reference Panels of Subtype B HIV-1 Env clones from acute and early infections and Env-deficient backbone plasmid (SG3AEnv) were also obtained through the NIH ARRRP.
  • HIV-1 env pseudotyped viruses were prepared by co-transfection of 293A cells (Invitrogen) with an Env-expression plasmid and SG3AEnv.
  • Recombinant sCD4 comprising the full-length extracellular domain of human CD4 was obtained from Progenies Pharmaceuticals, Inc. (Tarrytown, NY).
  • Ibalizumab protein was provided by TaiMed Biologies (Irvine, CA).
  • Plasmids pMVl and pLC which encode for ibalizumab H chain and L chain, respectively, were amplified from cDNA and cloned into pCDNA3.1 (+) (Invitrogen).
  • N- acetylglucosaminyltransferase I-negative GnTl(-) human embryonic kidney (HEK) 293S cells were obtained from ATCC (catalog no. CRL-3022).
  • Asn-Ser-Thr (LM52) sequences were introduced by mutagenesis to create mutants at the light (L) chain of the anti-CD4 antibody such as WT ibalizumab or MV1,. Mutagenesis was carried out with Quikchange mutagenesis kit (Stratagene, Santa Clara, VA). The L (light) chain mutants (LM) constructs were generated from anti-CD4 IgGl antibodies (such as MV1), and then were sequenced and transiently transfected into HEK293A cells (1 : 1 ratio of heavy and L chain plasmids) with polyethylenimine (PEI)-DNA complex.
  • PEI polyethylenimine
  • LM proteins were purified with a protein-A agarose (Thermo Scientific, Rockford, IL) column. WT ibalizumab and LM30E, LM52, and LM53 were treated with
  • PNGase F New England Biolabs, Ipswich, MA
  • pseudotyped HIV-1 were prepared in D10 containing DEAE-Dextran (Sigma, St. Louis, MO) and added to the cells. The cells were incubated for 48 h and ⁇ -galactosidase activity was measured using the Galacto-Star System (Applied Biosystems, Cedarville, OH). The percentage of inhibition of viral infectivity was calculated as 1 minus the ratio of antibody-treated wells versus untreated-infected wells multiplied by 100. The IC 50 and ICso values (the antibody concentrations that confer 50% and 80% neutralization, respectively) were calculated by a nonlinear regression analysis. [00114] 4. Surface plasmon resonance
  • Binding affinity analyses were performed with a Biacore T3000 optical biosensor
  • ibalizumab or its mutant variant at a concentration of 2 ⁇ g/mL in 10 mM sodium-acetate buffer, pH 4.5, was allowed to flow over the chip surface at a rate of 10 ⁇ / ⁇ until the desired level of response units of reacted protein (150-200 RU) was achieved. After unreacted protein was washed out, excess active ester groups on the sensor surface were capped by the injection of 35 ⁇ ⁇ of 1 M ethanolamine, pH 8.0, at a flow rate of 5 ⁇ / ⁇ . As background to correct instrument and buffer artifacts, a reference was generated under the same conditions with omission of the protein ligand.
  • Binding experiments were performed at 25°C in HBS-EP buffer (0.01 M HEPES, 0.15M NaCl, 3 mM EDTA, 0.005% vol/vol surfactant P20 (GE Healthcare). Binding kinetics were measured by passing various concentrations of analyte (human sCD4 protein) over the chip surface at a flow rate of 30 ⁇ / ⁇ for 3 min. Dissociation of bound analytes was monitored while the surface was washed for 10 min. Remaining analytes were removed at a flow rate of 50 ⁇ / ⁇ with two 30-sec injections of 10 mM glycine-HCl, pH 2.0. For kinetics data analysis, the kinetic parameters were determined by collectively fitting the overlaid sensograms locally using the BIAevaluation 4.1 software to the 1 : 1 Langmuir binding model.
  • LM52 protein Three micrograms of LM52 protein was dissolved in 50 mM ammonium bicarbonate (ABC)/50% tetrafluoroethylene and reduced by adding 40 mM dithiothreitol (DTT). After incubation at 65°C for 1 h, the protein samples were processed for alkylation by adding 40 mM iodoacetamide and incubating at room temperature for 1 h in the dark. The reaction was quenched by adding 40 mM DTT followed with lh incubation. Then 25 mM ABC was added before trypsin digestion. Protein samples were then treated with 0.2 ⁇ g trypsin (Promega) for overnight.
  • ABS ammonium bicarbonate
  • DTT dithiothreitol
  • the digested protein samples were dried and re-dissolved with 20 ⁇ ⁇ of water before LC-MS/MS analysis.
  • the measured masses of trypsin-digested antibody were compared to a database that combined predicted tryptic peptides and N-linked glycans.
  • the assigned glycopeptides were confirmed by the appearance of glycan fragments in MS/MS spectra.
  • PNGase digestion LM52 was treated with PNGase F (New
  • One wild-type virus (ACIO.0.29) in the panel has two N-linked glycosylation sites in V5 and is naturally sensitive to ibalizumab.
  • the V5 N-linked glycosylation sites in this virus were systematically deleted using site-directed mutagenesis, and the resulting mutant viruses became resistant to ibalizumab (see Figure 2).
  • position "30E” refers to the 5 th amino acid in a stretch of amino acids (30A, 30B, 30C, 30D, 30E, ...) between the positions originally numbered as 30 and 31.
  • Potential N-linked glycosylation sites were introduced at each of these positions ( Figure 4A).
  • Figure 4B the mutant light chains all had higher molecular weights than the wild type light chain (top panel), suggesting the presence of an added glycan in these mutants.
  • PNGase F bottom panel
  • their molecular weights dropped to that of a normal ibalizumab wild type light chain.
  • LMs ibalizumab L chain mutants
  • LM52 routinely produced in 293A cells. Over six forms of complex type N-glycans with 8-12 rings were identified on the L chain, with 80% of these forms having 9-11 rings (Figure 6C).
  • the LM52 mutants differing only in their glycan sizes, were tested in neutralization assays.
  • N-linked glycans were introduced into the desired residues of the ibalizumab L chain.
  • Table 1 The binding kinetics of ibalizumab and its LMs to human CD4
  • LM30E, LM52, LM53, and LM67 were observed for four LMs (LM30E, LM52, LM53, and LM67), with an average MPI of 91-99% and IC 80 of 0.05-0.14 ⁇ g/mL ( Figure 7 and Table 2).
  • LM52 appears to have the best HIV- 1 neutralization potency.
  • Two other variants yielded more modest improvement in virus-neutralization activities compared to ibalizumab.
  • the PNGS in the six LMs that showed improved HIV-1 neutralizing activity are also closer to V5 (459) of gpl20 (Table 2) than the PNGS in LM60 and LM76, which showed HIV-1 neutralizing activity comparable to those of WT ibalizumab.
  • LMs was studied. The study was focused on LM52 because of its superior HIV-1 neutralization profile ( Figure 7). To produce a version of LM52 lacking any N-linked glycan, tunicamycin was added, which inhibited GlcNAc phosphotransferase, to 293A cells immediately after transient transfection with the LM52 construct. Similarly, to produce a version of LM52 tagged with glycans of 10-11 rings (the high Man-type N-glycan Man 8 GlcNAc 2 (Man8) or Man 9 GlcNAc 2 (Man9)) we added kifunensine to 293 A cells.
  • Man8 Man 8 GlcNAc 2
  • Man9 Man 9 GlcNAc 2
  • N- acetylglucosaminyltransferase I-negative GnTl(-) HEK293S cells were used. As shown by SDS- PAGE, although the addition of kifunensine did not noticeably change the size of the L chain, addition of tunicamycin or growth in GnTl(-) cells noticeably reduced the size of the L chain ( Figure 8A).
  • LM52 had no neutralizing activity against the negative control virus (murine leukemia virus) (Table 3), but it neutralized (as defined by >50% inhibition) all HIV-1 strains tested, compared to 92% of strains for WT ibalizumab. In fact, LM52 neutralized 97% of viruses to >95% inhibition, compared to only 31% for WT ibalizumab (Fig. 5, upper panels).
  • LM52 also exhibited IC 50 values of ⁇ 0.1 ⁇ g/mL for all 118 viruses, compared to 75% of viruses for WT ibalizumab (Figure 9, middle panels). Indeed, all of the viruses were neutralized by LM52 with an ICgo ⁇ 0.3 ⁇ g/mL, whereas 36% of the viruses were not neutralized by 80% with WT ibalizumab even at a concentration of 10 ⁇ g/mL ( Figure 9, lower panels). Table 3 In vitro neutralization profiles of ibalizumab and LM52 as expressed by
  • Ce703010054_2A2 C (T/F) 9.01 >10 51 0.062 0.255 88
  • the geometric mean IC 50 value for LM52 was 14 ng/mL, compared to 74 ng/mL for WT ibalizumab, and the geometric mean ICgo value for LM52 was 37 ng/mL, compared to 510 ng/mL for WT ibalizumab (Figure 11).
  • MPL>80 ibalizumab-sensitive
  • MPI ⁇ 80 ibalizumab-resistant strains
  • ICso value for LM52 was 50 ng/mL, compared to almost 10,000 ng/mL for WT ibalizumab.
  • the potency of LM52 was enhanced by about 3-fold even in ibalizumab-sensitive viruses.
  • LM52 The improved activity of LM52 was also evident in a plot comparing its HIV-1 strain coverage across increasing antibody concentrations (Figure 10).
  • the improvement over WT ibalizumab was readily apparent, as was its superiority over mAbs (PG9, VRCOl, 10E8, and NIH45-46G54W) known for their broad and potent HIV- 1 neutralizing activity.
  • LM52 had the greatest viral coverage at all concentrations >0.01 ⁇ g/mL and it reached 100% at a concentration less than 0.1 ⁇ g/mL.
  • ibalizumab inhibits HIV- 1 infection by binding to CD4, while VRCOl, PG9, 10E8, and NIH45-46 G54W inhibit HIV-1 infection by binding directly to the virus. Nonetheless, regardless of whether these mAbs bind viral envelope or CD4, they all neutralize HIV-1 infection by blocking viral entry.
  • a property common to some HIV- 1 -neutralizing mAbs is their cross-reactivity with self-antigens 29 ' 30.
  • LM52 nor ibalizumab bound to HEp-2 epithelial cell extracts Figure 14A
  • neither LM52 nor ibalizumab showed reactivity with single-stranded DNA, double- stranded DNA, insulin, lipopolysaccharide, or keyhole limpet hemocyanin (KLH)
  • KLH keyhole limpet hemocyanin
  • Human CD4 protein, the intended target of ibalizumab was the only self antigen tested that was recognized by LM52. Thus, we find no evidence that LM52 is polyreactive with self-antigens.
  • a superior HIV-1 entry-blocking mAb product generated from the MV1, called as the variant LM52 is provided, which at relatively low concentrations could neutralize all tested HIV- 1 strains tested.
  • the virus-neutralizing properties of LM52 were evidently superior to those of the wild type of ibalizumab as well as of a number of the best anti- Env mAbs reported to date, for example VRCOl, PG9, 10E8, and NIH45-46G54W. Together with the established safety record of the ibalizumab in humans, these observations suggest that
  • LM52 should be a good candidate for clinical development for the treatment or prevention of HIV-1.
  • This modified antibody may be particularly suitable as a long-acting PrEP agent given its expected (based on the known pharmacokinetic properties of the parental ibalizumab) schedule of monthly administration.
  • HIV-1 loses a glycan in the N-terminus of gpl20 V5 to become resistant to ibalizumab. It is suggested that the ibalizumab mechanism of action is mediated by the glycan resulting in a steric clash between the antibody L chain and the viral envelope glycoprotein, thereby sterically disrupting a step in HIV-1 entry.
  • a glycan on the L chain restores the antiviral activity of ibalizumab against ibalizumab-resistant strains, that positioning this glycan on key residues spatially closest to V5 resulted in greatest antiviral effect, and that larger glycans conferred larger effects on virus neutralization collectively support that ibalizumab blocks HIV-1 infection via a steric hindrance mechanism.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Virology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Veterinary Medicine (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • AIDS & HIV (AREA)
  • Animal Behavior & Ethology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
PCT/US2013/076051 2012-12-18 2013-12-18 Glycan-modified anti-cd4 antibodies for hiv prevention and therapy Ceased WO2014100139A1 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
JP2015549613A JP6408487B2 (ja) 2012-12-18 2013-12-18 Hivの防止および療法のためのグリカン修飾された抗cd4抗体
EP13866337.2A EP2934589B1 (en) 2012-12-18 2013-12-18 Glycan-modified anti-cd4 antibodies for hiv prevention and therapy
CN201380073311.4A CN105228650B (zh) 2012-12-18 2013-12-18 用于hiv预防和治疗的聚糖修饰的抗-cd4抗体
ES13866337T ES2862950T3 (es) 2012-12-18 2013-12-18 Anticuerpos anti-CD4 modificados con glicanos para la prevención y terapia del VIH

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201261738777P 2012-12-18 2012-12-18
US61/738,777 2012-12-18
US201361864942P 2013-08-12 2013-08-12
US61/864,942 2013-08-12

Publications (1)

Publication Number Publication Date
WO2014100139A1 true WO2014100139A1 (en) 2014-06-26

Family

ID=50979141

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2013/076051 Ceased WO2014100139A1 (en) 2012-12-18 2013-12-18 Glycan-modified anti-cd4 antibodies for hiv prevention and therapy

Country Status (7)

Country Link
US (1) US9790276B2 (enExample)
EP (1) EP2934589B1 (enExample)
JP (1) JP6408487B2 (enExample)
CN (1) CN105228650B (enExample)
ES (1) ES2862950T3 (enExample)
TW (1) TWI630215B (enExample)
WO (1) WO2014100139A1 (enExample)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9587012B2 (en) 2013-12-02 2017-03-07 Aaron Diamond Aids Research Center Bispecific HIV-1 neutralizing antibodies
JP2018513692A (ja) * 2015-02-27 2018-05-31 アイセル・ジーン・セラピューティクス・エルエルシー 血液系腫瘍を標的としたキメラ抗体受容体(CARs)の構成およびその使用方法
CN108884139A (zh) * 2015-11-02 2018-11-23 戊瑞治疗有限公司 Cd80胞外域多肽及其在癌症治疗中的用途
US10308707B2 (en) 2013-12-02 2019-06-04 Aaron Diamond Aids Research Center Bispecific HIV-1-neutralizing antibodies
US11472889B2 (en) 2017-10-14 2022-10-18 Cytomx Therapeutics, Inc. Antibodies, activatable antibodies, bispecific antibodies, and bispecific activatable antibodies and methods of use thereof

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9587022B2 (en) 2012-12-18 2017-03-07 The Rockefeller University Glycan-modified anti-CD4 antibody with improved HIV-1 neutralizing activity
CN114269778B (zh) * 2019-08-19 2024-10-01 洛克菲勒大学 具改良药物动力学的经酸碱度依赖性抗原结合活性工程化的抗人类免疫缺乏病毒抗体

Citations (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816397A (en) 1983-03-25 1989-03-28 Celltech, Limited Multichain polypeptides or proteins and processes for their production
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US5871732A (en) 1990-11-27 1999-02-16 Biogen, Inc. Anti-CD4 antibody homologs useful in prophylaxis and treatment of AIDS, ARC and HIV infection
US6602684B1 (en) 1998-04-20 2003-08-05 Glycart Biotechnology Ag Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity
US7029872B2 (en) 2000-06-28 2006-04-18 Glycofi, Inc Methods for producing modified glycoproteins
WO2006125207A2 (en) 2005-05-19 2006-11-23 Amgen Inc. Compositions and methods for increasing the stability of antibodies
WO2008134046A1 (en) 2007-04-27 2008-11-06 Genentech, Inc. Potent, stable and non-immunosuppressive anti-cd4 antibodies
US7449308B2 (en) 2000-06-28 2008-11-11 Glycofi, Inc. Combinatorial DNA library for producing modified N-glycans in lower eukaryotes
EP2377886A1 (en) 2005-12-12 2011-10-19 F. Hoffmann-La Roche AG Antibody glycosylation in the variable region
US20120121597A1 (en) * 2010-11-12 2012-05-17 The Rockefeller University Fusion proteins for hiv therapy

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9156912B2 (en) * 2008-12-12 2015-10-13 The University Of Tokyo Immunological reconstitution promoter or prophylactic agent for infections each of which maintains graft-versus-tumor effect
WO2011116387A1 (en) * 2010-03-19 2011-09-22 Tetragenetics, Inc. Production of aglycosylated monoclonal antibodies in ciliates
US9587022B2 (en) 2012-12-18 2017-03-07 The Rockefeller University Glycan-modified anti-CD4 antibody with improved HIV-1 neutralizing activity

Patent Citations (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816397A (en) 1983-03-25 1989-03-28 Celltech, Limited Multichain polypeptides or proteins and processes for their production
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US5871732A (en) 1990-11-27 1999-02-16 Biogen, Inc. Anti-CD4 antibody homologs useful in prophylaxis and treatment of AIDS, ARC and HIV infection
US6602684B1 (en) 1998-04-20 2003-08-05 Glycart Biotechnology Ag Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity
US7029872B2 (en) 2000-06-28 2006-04-18 Glycofi, Inc Methods for producing modified glycoproteins
US7449308B2 (en) 2000-06-28 2008-11-11 Glycofi, Inc. Combinatorial DNA library for producing modified N-glycans in lower eukaryotes
WO2006125207A2 (en) 2005-05-19 2006-11-23 Amgen Inc. Compositions and methods for increasing the stability of antibodies
EP2377886A1 (en) 2005-12-12 2011-10-19 F. Hoffmann-La Roche AG Antibody glycosylation in the variable region
WO2008134046A1 (en) 2007-04-27 2008-11-06 Genentech, Inc. Potent, stable and non-immunosuppressive anti-cd4 antibodies
US20120121597A1 (en) * 2010-11-12 2012-05-17 The Rockefeller University Fusion proteins for hiv therapy

Non-Patent Citations (18)

* Cited by examiner, † Cited by third party
Title
BURKLY ET AL., J. IMMUNOL., vol. 149, 1992, pages 1779 - 178
HIROFUMI ET AL., CYTOTECHNOLOGY, vol. 23, no. 1, 1 January 1997 (1997-01-01), pages 151 - 159
JACOBSON ET AL., ANTIMICROB. AGENTS CHEMOTHER., vol. 53, 2009, pages 450 - 457
KURITZKES ET AL., J. INFECT. DIS., vol. 189, 2004, pages 286 - 291
LAROY ET AL., NAT PROTOC., vol. 1, 2006, pages 397 - 405
LEUNG ET AL.: "Engineering a Unique Glycosylation Site for Site-Specific Conjugation of Haptens to Antibody Fragments'.", JOURNAL OF IMMUNOLOGY, vol. 154, no. 11, 1 June 1995 (1995-06-01), pages 5919 - 5926, XP002666319 *
MOLECULAR IMMUNOLOGY, vol. 32, no. 13, 1 January 1995 (1995-01-01), pages 831 - 940
PACE ET AL., J. ACQUIR. IMMUNE DEFIC. SYNDR., September 2012 (2012-09-01)
PEPINSKY ET AL., PROTEIN SCI, vol. 19, 2010, pages 954 - 966
See also references of EP2934589A4 *
SHARKEY ET AL.: "Evaluation of a Complementarity-Determining Region-Grafted (Humanized) Anti-Carcinoembryonic Antigen Monoclonal Antibody in Preclinical and Clinical Studies.", CANCER RESEARCH, vol. 55, 1 December 1995 (1995-12-01), pages 5935 - 5945, XP008054789 *
SHUI-ON ET AL., THE JOURNAL OF IMMUNOLOGY, vol. 154, no. 11, 11 January 1995 (1995-01-11), pages 5919 - 5926
SONG ET AL.: "Abstract of 'Strategic addition of an N-linked glycan to a monoclonal antibody improves its HIV-1-neutralizing activity'.", NATURE BIOTECHNOLOGY, vol. 3, no. ISSUE, 6 October 2013 (2013-10-06), pages 1047 - 52, XP055256099 *
TOMA ET AL., J. VIROLOGY, vol. 85, no. 8, 2011, pages 3872 - 2880
WRIGHT ET AL., EMBO JOURNAL, vol. 10, no. 10, 1 October 1991 (1991-10-01), pages 2717 - 2713
WRIGHT; MORRISON, TIBTECH, vol. 15, 1997, pages 26 - 32
WU ET AL., PROTEIN ENG DES SEL, vol. 23, 2010, pages 643 - 651
WU ET AL., PROTEIN ENGINEERING DESIGN AND SELECTION, vol. 23, no. 8, 11 June 2010 (2010-06-11), pages 643 - 651

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9587012B2 (en) 2013-12-02 2017-03-07 Aaron Diamond Aids Research Center Bispecific HIV-1 neutralizing antibodies
US9884905B2 (en) 2013-12-02 2018-02-06 Aaron Diamond Aids Research Center Bispecific HIV-1 neutralizing antibodies
US10308707B2 (en) 2013-12-02 2019-06-04 Aaron Diamond Aids Research Center Bispecific HIV-1-neutralizing antibodies
US12098187B2 (en) 2013-12-02 2024-09-24 The Trustees Of Columbia University In The City Of New York Bispecific HIV-1-neutralizing antibodies
JP2018513692A (ja) * 2015-02-27 2018-05-31 アイセル・ジーン・セラピューティクス・エルエルシー 血液系腫瘍を標的としたキメラ抗体受容体(CARs)の構成およびその使用方法
JP7237449B2 (ja) 2015-02-27 2023-03-13 アイセル・ジーン・セラピューティクス・エルエルシー 血液系腫瘍を標的としたキメラ抗体受容体(CARs)の構成およびその使用方法
CN108884139A (zh) * 2015-11-02 2018-11-23 戊瑞治疗有限公司 Cd80胞外域多肽及其在癌症治疗中的用途
US11098103B2 (en) 2015-11-02 2021-08-24 Five Prime Therapeutics, Inc. CD80 extracellular domain polypeptides and their use in cancer treatment
US11472889B2 (en) 2017-10-14 2022-10-18 Cytomx Therapeutics, Inc. Antibodies, activatable antibodies, bispecific antibodies, and bispecific activatable antibodies and methods of use thereof
US11859010B2 (en) 2017-10-14 2024-01-02 Cytomx Therapeutics, Inc. Antibodies, activatable antibodies, bispecific antibodies, and bispecific activatable antibodies and methods of use thereof
US12460017B2 (en) 2017-10-14 2025-11-04 Cytomx Therapeutics, Inc. Antibodies, activatable antibodies, bispecific antibodies, and bispecific activatable antibodies and methods of use thereof

Also Published As

Publication number Publication date
US9790276B2 (en) 2017-10-17
US20160362493A9 (en) 2016-12-15
JP6408487B2 (ja) 2018-10-24
EP2934589B1 (en) 2021-01-13
CN105228650B (zh) 2018-11-16
CN105228650A (zh) 2016-01-06
EP2934589A1 (en) 2015-10-28
TWI630215B (zh) 2018-07-21
ES2862950T3 (es) 2021-10-08
US20150166662A1 (en) 2015-06-18
TW201441258A (zh) 2014-11-01
EP2934589A4 (en) 2016-08-10
JP2016503059A (ja) 2016-02-01

Similar Documents

Publication Publication Date Title
US9587022B2 (en) Glycan-modified anti-CD4 antibody with improved HIV-1 neutralizing activity
US8637024B2 (en) Fusion antibodies for HIV therapy
US9790276B2 (en) Glycan-modified anti-CD4 antibodies for HIV prevention and therapy
US12338277B2 (en) Broadly neutralizing antibodies that target HIV ENV V3 N-glycans
Song et al. Strategic addition of an N-linked glycan to a monoclonal antibody improves its HIV-1–neutralizing activity
US20200002430A1 (en) Fn14 Binding Proteins and Uses Thereof
WO2021245184A1 (en) HUMAN ANTIBODIES AGAINST SEVERE ACUTE RESPIRATORY SYNDROME CORONAVIRUS-2 (SARS-CoV-2)
US11578138B2 (en) Anti-human TLR7 antibody
CN119698429A (zh) Fcrn结合分子及使用方法
WO2017011413A1 (en) Bispecific molecules comprising an hiv-1 envelope targeting arm
JP7728591B2 (ja) 抗htlv-1抗体
US20250353925A1 (en) Coronavirus-inhibiting antibodies
US12012451B2 (en) Engineering pH-dependent antigen binding activity into anti-HIV antibodies with improved pharmacokinetics
US20220281959A1 (en) Antibodies and the uses thereof
HK40121247A (zh) 抗序列相似家族19成员a5的抗体在治疗神经性疼痛中的用途
WO2022006562A1 (en) Multispecific coronavirus antibodies
HK1212935B (en) Broadly-neutralizing anti-hiv antibodies

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 201380073311.4

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13866337

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2015549613

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2013866337

Country of ref document: EP