WO2014093622A2 - Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications - Google Patents

Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications Download PDF

Info

Publication number
WO2014093622A2
WO2014093622A2 PCT/US2013/074667 US2013074667W WO2014093622A2 WO 2014093622 A2 WO2014093622 A2 WO 2014093622A2 US 2013074667 W US2013074667 W US 2013074667W WO 2014093622 A2 WO2014093622 A2 WO 2014093622A2
Authority
WO
WIPO (PCT)
Prior art keywords
sequence
crispr
tracr
target
guide
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2013/074667
Other languages
French (fr)
Other versions
WO2014093622A3 (en
WO2014093622A8 (en
WO2014093622A9 (en
Inventor
Feng Zhang
Matthias Heidenreich
Fei RAN
Lukasz SWIECH
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Massachusetts Institute of Technology
Broad Institute Inc
Original Assignee
Massachusetts Institute of Technology
Broad Institute Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=49883289&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2014093622(A2) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Application filed by Massachusetts Institute of Technology, Broad Institute Inc filed Critical Massachusetts Institute of Technology
Priority to SG11201504523UA priority Critical patent/SG11201504523UA/en
Priority to EP23192255.0A priority patent/EP4299741A3/en
Priority to EP15179123.3A priority patent/EP3031921B1/en
Priority to HK16102950.6A priority patent/HK1215048B/en
Priority to EP25158109.6A priority patent/EP4549566A3/en
Priority to ES13814362.3T priority patent/ES2658401T3/en
Priority to JP2015547543A priority patent/JP2016501531A/en
Priority to IL293526A priority patent/IL293526A/en
Priority to RU2015128057A priority patent/RU2721275C2/en
Priority to KR1020157018653A priority patent/KR20150105956A/en
Priority to EP17199166.4A priority patent/EP3327127B1/en
Priority to CA2894681A priority patent/CA2894681C/en
Priority to AU2013359199A priority patent/AU2013359199C1/en
Priority to MX2015007550A priority patent/MX389793B/en
Priority to BR112015013784A priority patent/BR112015013784A2/en
Priority to DK13814362.3T priority patent/DK2931897T3/en
Priority to EP13814362.3A priority patent/EP2931897B1/en
Priority to CN201380072752.2A priority patent/CN105164264B/en
Priority to IL239317A priority patent/IL239317B/en
Priority to PCT/US2014/041803 priority patent/WO2014204725A1/en
Priority to KR1020167001293A priority patent/KR20160034901A/en
Priority to SG11201510284XA priority patent/SG11201510284XA/en
Priority to CA2915842A priority patent/CA2915842C/en
Priority to RU2016101200A priority patent/RU2716420C2/en
Priority to HK16111707.3A priority patent/HK1223645B/en
Priority to EP20195409.6A priority patent/EP3825406A1/en
Priority to DK14734710.8T priority patent/DK3011031T3/en
Priority to MX2015017312A priority patent/MX2015017312A/en
Priority to KR1020247039028A priority patent/KR20240172759A/en
Priority to CN201480045707.2A priority patent/CN107995927B/en
Priority to KR1020167001295A priority patent/KR20160030187A/en
Priority to CA2915837A priority patent/CA2915837A1/en
Priority to EP23166208.1A priority patent/EP4245853A3/en
Priority to AU2014281028A priority patent/AU2014281028B2/en
Priority to JP2016521451A priority patent/JP6738728B2/en
Priority to AU2014281027A priority patent/AU2014281027A1/en
Priority to SG10201710486XA priority patent/SG10201710486XA/en
Priority to CN201480045703.4A priority patent/CN105492611A/en
Priority to JP2016521450A priority patent/JP6665088B2/en
Priority to BR112015031608A priority patent/BR112015031608A2/en
Priority to EP14734710.8A priority patent/EP3011031B1/en
Priority to EP14734709.0A priority patent/EP3011030B1/en
Priority to PCT/US2014/041804 priority patent/WO2014204726A1/en
Priority to CN202110793075.XA priority patent/CN113425857B/en
Priority to SG10201710487VA priority patent/SG10201710487VA/en
Priority to CN201480045708.7A priority patent/CN105683379A/en
Priority to CN201480045709.1A priority patent/CN105793425B/en
Priority to CA2915845A priority patent/CA2915845A1/en
Priority to EP14735795.8A priority patent/EP3011032B1/en
Priority to BR122021009076-9A priority patent/BR122021009076B1/en
Priority to RU2016101178A priority patent/RU2725502C2/en
Priority to JP2016521452A priority patent/JP6738729B2/en
Priority to JP2016521453A priority patent/JP6702858B2/en
Priority to SG10201710488TA priority patent/SG10201710488TA/en
Priority to PCT/US2014/041808 priority patent/WO2014204728A1/en
Priority to CA2915795A priority patent/CA2915795C/en
Priority to EP19171576.2A priority patent/EP3620524A1/en
Priority to SG11201510327TA priority patent/SG11201510327TA/en
Priority to AU2014281031A priority patent/AU2014281031B2/en
Priority to PCT/US2014/041809 priority patent/WO2014204729A1/en
Priority to DK14735795.8T priority patent/DK3011032T3/en
Priority to EP14736206.5A priority patent/EP3011034B1/en
Priority to KR1020167001039A priority patent/KR20160019553A/en
Priority to KR1020257000942A priority patent/KR20250012194A/en
Priority to MX2015017311A priority patent/MX374531B/en
Priority to KR1020167001296A priority patent/KR20160056869A/en
Priority to RU2016101198A priority patent/RU2716421C2/en
Priority to BR112015031611A priority patent/BR112015031611A2/en
Priority to BR112015031610-7A priority patent/BR112015031610B1/en
Priority to CN202111206158.0A priority patent/CN114015726B/en
Priority to ES14735795T priority patent/ES2767318T3/en
Priority to AU2014281030A priority patent/AU2014281030B2/en
Priority to SG11201510286QA priority patent/SG11201510286QA/en
Priority to MX2015017313A priority patent/MX374532B/en
Priority to EP19171567.1A priority patent/EP3597755A1/en
Publication of WO2014093622A2 publication Critical patent/WO2014093622A2/en
Publication of WO2014093622A3 publication Critical patent/WO2014093622A3/en
Priority to US14/481,339 priority patent/US20150020223A1/en
Publication of WO2014093622A9 publication Critical patent/WO2014093622A9/en
Publication of WO2014093622A8 publication Critical patent/WO2014093622A8/en
Priority to ZA2015/04132A priority patent/ZA201504132B/en
Anticipated expiration legal-status Critical
Priority to ZA2015/08961A priority patent/ZA201508961B/en
Priority to MX2021001308A priority patent/MX2021001308A/en
Priority to US14/970,967 priority patent/US10946108B2/en
Priority to US14/971,356 priority patent/US10577630B2/en
Priority to US14/971,169 priority patent/US20160153004A1/en
Priority to IL243195A priority patent/IL243195B/en
Priority to US14/972,523 priority patent/US10711285B2/en
Priority to IL243196A priority patent/IL243196B/en
Priority to IL243197A priority patent/IL243197B/en
Priority to US15/349,603 priority patent/US11041173B2/en
Priority to JP2019172819A priority patent/JP2020026438A/en
Priority to JP2019172824A priority patent/JP2020063238A/en
Priority to AU2019283878A priority patent/AU2019283878B2/en
Priority to JP2020025947A priority patent/JP7083364B2/en
Priority to US16/844,548 priority patent/US11597949B2/en
Priority to AU2020286222A priority patent/AU2020286222B2/en
Priority to US17/245,952 priority patent/US12252707B2/en
Priority to JP2021186813A priority patent/JP2022028812A/en
Priority to JP2022031416A priority patent/JP7383062B2/en
Priority to AU2022203759A priority patent/AU2022203759B2/en
Priority to AU2022218558A priority patent/AU2022218558A1/en
Priority to JP2023184342A priority patent/JP2024023194A/en
Priority to JP2023189768A priority patent/JP7682975B2/en
Priority to US19/079,830 priority patent/US20250382642A1/en
Priority to AU2025202331A priority patent/AU2025202331A1/en
Priority to AU2025203782A priority patent/AU2025203782A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/87Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
    • C12N15/90Stable introduction of foreign DNA into chromosome
    • C12N15/902Stable introduction of foreign DNA into chromosome using homologous recombination
    • C12N15/907Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K67/00Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
    • A01K67/027New or modified breeds of vertebrates
    • A01K67/0275Genetically modified vertebrates, e.g. transgenic
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K67/00Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
    • A01K67/027New or modified breeds of vertebrates
    • A01K67/0275Genetically modified vertebrates, e.g. transgenic
    • A01K67/0278Knock-in vertebrates, e.g. humanised vertebrates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/12Drugs for disorders of the urinary system of the kidneys
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/08Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/08Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • A61P19/10Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease for osteoporosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/14Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/14Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • A61P25/16Anti-Parkinson drugs
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/18Antipsychotics, i.e. neuroleptics; Drugs for mania or schizophrenia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/02Ophthalmic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/06Antihyperlipidemics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/18Antivirals for RNA viruses for HIV
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/01Preparation of mutants without inserting foreign genetic material therein; Screening processes therefor
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/10Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/102Mutagenizing nucleic acids
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/10Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/1034Isolating an individual clone by screening libraries
    • C12N15/1082Preparation or screening gene libraries by chromosomal integration of polynucleotide sequences, HR-, site-specific-recombination, transposons, viral vectors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8201Methods for introducing genetic material into plant cells, e.g. DNA, RNA, stable or transient incorporation, tissue culture methods adapted for transformation
    • C12N15/8213Targeted insertion of genes into the plant genome by homologous recombination
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/8509Vectors or expression systems specially adapted for eukaryotic hosts for animal cells for producing genetically modified animals, e.g. transgenic
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/87Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
    • C12N15/90Stable introduction of foreign DNA into chromosome
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • C12N9/22Ribonucleases [RNase]; Deoxyribonucleases [DNase]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/96Stabilising an enzyme by forming an adduct or a composition; Forming enzyme conjugates
    • GPHYSICS
    • G16INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
    • G16BBIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
    • G16B20/00ICT specially adapted for functional genomics or proteomics, e.g. genotype-phenotype associations
    • GPHYSICS
    • G16INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
    • G16BBIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
    • G16B20/00ICT specially adapted for functional genomics or proteomics, e.g. genotype-phenotype associations
    • G16B20/20Allele or variant detection, e.g. single nucleotide polymorphism [SNP] detection
    • GPHYSICS
    • G16INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
    • G16BBIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
    • G16B20/00ICT specially adapted for functional genomics or proteomics, e.g. genotype-phenotype associations
    • G16B20/30Detection of binding sites or motifs
    • GPHYSICS
    • G16INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
    • G16BBIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
    • G16B20/00ICT specially adapted for functional genomics or proteomics, e.g. genotype-phenotype associations
    • G16B20/50Mutagenesis
    • GPHYSICS
    • G16INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
    • G16BBIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
    • G16B30/00ICT specially adapted for sequence analysis involving nucleotides or amino acids
    • G16B30/10Sequence alignment; Homology search
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00Genetically modified animals
    • A01K2217/05Animals comprising random inserted nucleic acids (transgenic)
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00Genetically modified animals
    • A01K2217/05Animals comprising random inserted nucleic acids (transgenic)
    • A01K2217/052Animals comprising random inserted nucleic acids (transgenic) inducing gain of function
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00Genetically modified animals
    • A01K2217/07Animals genetically altered by homologous recombination
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00Genetically modified animals
    • A01K2217/07Animals genetically altered by homologous recombination
    • A01K2217/072Animals genetically altered by homologous recombination maintaining or altering function, i.e. knock in
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2227/00Animals characterised by species
    • A01K2227/10Mammal
    • A01K2227/105Murine
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2267/00Animals characterised by purpose
    • A01K2267/03Animal model, e.g. for test or diseases
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/20Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2320/00Applications; Uses
    • C12N2320/10Applications; Uses in screening processes
    • C12N2320/11Applications; Uses in screening processes for the determination of target sites, i.e. of active nucleic acids
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2320/00Applications; Uses
    • C12N2320/30Special therapeutic applications
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14141Use of virus, viral particle or viral elements as a vector
    • C12N2750/14143Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2800/00Nucleic acids vectors
    • C12N2800/22Vectors comprising a coding region that has been codon optimised for expression in a respective host
    • GPHYSICS
    • G16INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
    • G16BBIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
    • G16B30/00ICT specially adapted for sequence analysis involving nucleotides or amino acids

Definitions

  • the present inventio generally relates to the delivery, engineering, optimization and therapeutic applications of systems, methods, and compositions used for the control of gene expressio involving sequence targeting, such as genome perturbatio or gene-editing, that relate to Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) and components thereof.
  • sequence targeting such as genome perturbatio or gene-editing
  • CRISPR Clustered Regularly Interspaced Short Palindromic Repeats
  • the CRISPR-Cas system does not require the generation of customized proteins to target specific sequences but rather a single Cas enzyme can be programmed by a short. NA molecule to recognize a specific DNA target.
  • Adding the CRISPR-Cas system to the repertoire of genome sequencing techniques and analysis methods may significa tly simplify the methodology and accelerate the ability to catalog and map genetic factors associated with a diverse ra ge of biological functiono s a d diseases.
  • To utilize the CRISPR-Cas system effectively for genome editing without deleterious effects it is critical to understand aspects of engineering, optimization and cell-type/tissue/organ specific deliver ⁇ ' of these genome engineering tools, which are aspects of the claimed invention.
  • An exemplar ⁇ ' CRISPR comple comprises a CRISP R enzyme complexed with a guide sequence hybridized to a target sequence within the target polynucleotide.
  • the guide sequence is linked to a tracr mate sequence, which in turn hybridizes to a tracr sequence.
  • the invention provides methods for using one or more elements of a CRISPR-Cas system.
  • the CR ISPR comple of the invention provides an effective means for modifying a target polynucleotide.
  • the CRISPR complex of the invention has a wide variety of utilities including modifying (e.g., deleting, inserting, translocating, inactivating, activating) a target polynucleotide in a multiplicity of cell types in various tissues and organs.
  • the CRISPR complex of the invention has a broad spectrum of applications in, e.g., gene or genome editing, gene therapy, dr g discovery, drug screening, disease diagnosis, and prognosis.
  • aspects of the invention relate to Cas9 enzymes having improved targeting specificity in a CR1SPR-Cas9 system having guide RNAs having optimal activity, smal ler in length than wild-type Cas9 enzymes and nucleic acid molecules coding therefor, and chimeric Cas9 enzymes, as well as methods of improving the target specificity of a Cas9 enzyme or of designing a CRISPR-Cas9 system comprising designing or preparing guide RNAs having optimal activity and/or selecting or preparing a Cas9 enzyme having a smaller size or length than wild-type Cas9 whereby packaging a nucleic acid coding therefor into a deliver ⁇ ' vector is more advanced as there is less coding therefor in the delivery vector than for wild-type Cas9, and/or generating chimeric Cas9 enzymes.
  • a Cas9 enzyme may comprise one or more mutations and may be used as a generic DNA binding protein with or without fusion to a functional domain.
  • the mutations may be artificially introduced mutations or gain- or loss-of- function mutations.
  • the mutations may include but are not limited to mutations in one of the catalytic domains (D I O and H840) in the RuvC and HNH catalytic domains, respectively. Further mutations have been characterized.
  • the transcriptional activation domain may be VP64.
  • the transcriptional repressor domain may be KRAB or SID4X
  • Other aspects of the invention relate to the mutated Cas 9 enzyme being fused to domains which include but are not limited to a transcriptional activator, repressor, a recombinase, a transposase, a histone remodeler, a demethylase, a DNA methyltransferase, a cryptochrome, a light inducible/controllable domain or a chemically induci b 1 e/contro liable domain .
  • the invention provides for methods to generate mutant tracrl A and direct repeat sequences or mutant chimeric guide sequences that allow for enhancing performance of these RNAs in cells. Aspects of the invention also provide for selection of said sequences.
  • aspects of the invention also provide for methods of simplifying the cloning and delivery of components of the CRISPR. complex.
  • a suitable promoter such as the U6 promoter
  • a DNA oiigo is amplified with a DNA oiigo and added onto the guide RNA.
  • the resulting PGR product can then be transfected into cells to drive expression of the guide RNA.
  • aspects of the invention also relate to the guide RNA being transcribed in vitro or ordered from a synthesis company and directly transfected.
  • the invention provides for methods to improve activity by using a more active polymerase.
  • the expression of guide RNAs under the control of the T7 promoter is driven by the expression of the T7 polymerase in the cell.
  • the cell is a eukaryotic ceil.
  • the eukaryotic cell is a human cell, hi a more preferred embodiment the human cell is a patient specific cell.
  • the invention provides for methods of reducing the toxicity of Cas enzymes.
  • the Cas enzyme is any Cas9 as described herein, for instance any naturally-occurring bacterial Cas9 as well as a y chimaeras, mutants, homo logs or orthologs.
  • the Cas9 is delivered into the ceil in the form of mRNA. This allows for the transient expression of the enzyme thereby reducing toxicity.
  • the invention also provides for methods of expressing Cas9 under the control of an inducible promoter, and the constructs used therein.
  • the invention provides for methods of improving the in vivo applications of the CRISPR-Cas system.
  • the Cas enzyme is wildtype Cas9 or any of the modified versions described herein, including any naturally- occurring bacterial Cas9 as well as any chimaeras, mutants, homologs or orthologs.
  • An advantageous aspect of the invention provides for the selection of Cas9 homologs that are easily packaged into viral vectors for delivery.
  • Cas9 orthologs typically share the general organization of 3-4 RuvC domains and a HNH domain. The 5' most RuvC domain cleaves the non- complementary strand, and the HNH domain cleaves the complementary strand. All notations are in reference to the guide sequence.
  • the catalytic residue in the 5' RuvC' domain is identified through homology comparison of the Cas9 of interest with other Cas9 orthologs (from S. pyogenes type II CRISPR locus, S. tbermopmTus CRISPR locus 1, S. thermoph ius CRISPR locus 3, and Franciscilla novicida type 11 CRISPR locus), and the conserved Asp residue (D10) is mutated to alanine to convert Cas9 into a complementary-strand nicking enzyme. Similarly, the conserved His and Asn residues in the HNH domains are mutated to Alanine to convert Cas9 into a non- complementary-strand nicking enzyme. In some embodiments, both sets of mutations may be made, to convert Cas9 into a non-cutting enzyme.
  • the CRISPR enzyme is a type I or III CRISPR enzyme, preferably a type ⁇ CRI SPR enzyme.
  • This type II CRISPR enzyme may be any Cas enzyme.
  • a preferred Cas enzyme may be identified as Cas9 as this can refer to the general class of enzymes thai share homology to the biggest nuclease with multiple nuclease domains from the type II CRISPR system.
  • the Cas9 enzyme is from, or is derived from, spCas9 or saCas9.
  • Applicants mean that the derived enzyme is largely based, in the sense of having a high degree of sequence homology with, a wildtype enzyme, but that it has been mutated (modified) in some way as described herein
  • Cas and CRISPR enzyme are generally used herein interchangeably, unless otherwise apparent.
  • residue numberings used herein refer to the Cas9 enzyme from the type II CRISPR locus in Streptococcus pyogenes .
  • this invention includes many more Cas9s from other species of microbes, such as SpCas9, SaCas9, StlCas9 and so forth. Further examples are provided herein. The skilled person will be able to determine appropriate corresponding residues in Cas9 enzymes other than SpCas9 by comparison of the relevant amino acid sequences.
  • the invention provides for methods of enhancing the function of Cas9 by generating chimeric Cas9 protems.
  • Chimeric Cas9 proteins chimeric Cas9s may be new Cas9 containing fragments from more than one naturally occurring Cas9. These methods may comprise fusing N-teraiinal fragments of one Cas9 homolog with C-terminal fragments of another Cas9 homolog. These methods also allow for the selection of new properties displayed by the chimeric Cas9 proteins.
  • the modification may occur ex vivo or in vitro, for instance in a cell culture and in some instances not in vivo. In other embodiments, it may occur in vivo,
  • the invention provides a method of modifying an organism or a non- human organism by manipulation of a target sequence in a genomic locus of interest comprising: delivering a non-naturally occurring or engineered composition comprising :
  • RNA sequence comprises:
  • IL a polynucleotide sequence encoding a CRISPR enzyme comprising at least one or more nuclear localization sequences
  • the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence
  • the CRISPR complex comprises the CRISPR enzyme complexed with (1 ) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence and the polynucleotide sequence encoding a CRISPR enzyme is DNA or RNA
  • the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence
  • the CRISPR complex comprises the CRISPR enzyme complexed with (1 ) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence, and the polynucleotide sequence encoding a CRISPR. enzyme is DNA or RNA.
  • any or ail of the polynucleotide sequence encoding a CRISPR enzyme, guide sequence, tracr mate sequence or tracr sequence may be RNA.
  • the polynucleotides encoding the sequence encoding a CRISPR enzyme, the guide sequence, tracr mate sequence or tracr sequence may be RNA and may be delivered via liposomes, nanoparticies, exosomes, micro vesicles, or a gene-gun.
  • the RNA sequence includes the feature.
  • the DNA sequence is or can be transcribed into the RN A including the feature at issue.
  • the feature is a protein, such as the CRISPR enzyme
  • the DNA or RNA sequence referred to is, or can be, translated (and in the case of DNA transcribed first).
  • the invention provides a method of modifying an organism, e.g., mammal including human or a non-human mammal or organism by manipulation of a target sequence in a genomic locus of interest comprising delivering a non- naturally occurring or engineered composition comprising a viral or plasmid vector system comprising one or more viral or plasmid vectors operably encoding a composition for expression thereof wherein the composition comprises: (A) a non-naturally occurring or engineered composition comprising a vector system comprising one or more vectors comprising I.
  • a first regulatory element operably linked to a CRISPR-Cas system chimeric RNA (chiRNA) polynucleotide sequence wherein the polynucleotide sequence comprises (a) a guide sequence capable of hybridizing to a target sequence in a eukaryotic cell, (b) a tracr mate sequence, and (c) a tracr sequence, and II.
  • chiRNA CRISPR-Cas system chimeric RNA
  • a first regulatory element operably linked to (a) a guide sequence capable of hybridizing to a target sequence in a eukaryotic cell, a d (b) at least o e or more tracr mate sequences, II. a second regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme, and III.
  • a third regulatory element operably linked to a tracr sequence wherein components I, II and III are located on the same or different vectors of the system, wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and wherein the CRISPR complex comprises the CRISPR enzyme complexed with (I) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate seque ce that is hybridized to the tracr sequence.
  • components 1, II and III are located on the same vector.
  • components I and II are located on the same vector, while component III is located on another vector.
  • components I and III are located on the same vector, while component II is located on another vector. In other embodiments, components II and III are located on the same vector, while component I is located on another vector. In other embodiments, each of components I, 11 and III is located on different vectors.
  • the invention also provides a viral or plasmid vector system as described herein.
  • the vector is a viral vector, such as a lenti- or baculo- or preferably adeno- viral/adeno-associated viral vectors, but other means of delivery are know (such as yeast systems, microvesic!es, gene guns/means of attaching vectors to gold nanoparticies) and are provided.
  • a viral vector such as a lenti- or baculo- or preferably adeno- viral/adeno-associated viral vectors, but other means of delivery are know (such as yeast systems, microvesic!es, gene guns/means of attaching vectors to gold nanoparticies) and are provided.
  • one or .more of the viral or plasmid vectors may be delivered via liposomes, nanoparticles, exosomes, microvesicles, or a gene-gun.
  • Applicants By manipulation of a target sequence, Applicants also mean the epigenetic manipulation of a target sequence. This may be of the chromatin state of a target sequence, such as by modification of the metliylation state of the target sequence (i.e. addition or removal of methylation or methylation patterns or CpG islands), histone modification, increasing or reducing accessibility to the target sequence, or by promoting 3D folding.
  • the invention provides a method of treating or inhibiting a condition caused by a defect in a target sequence in a genomic locus of interest in a subject (e.g., mammal or human) or a non-human subject (e.g., mammal) in need thereof comprising modifying the subject or a non-human subject by manipulation of the target sequence and wherein the condition is susceptible to treatment or inhibition by manipulation of the target, sequence comprising providing treatment comprising: delivering a non-naturally occurring or engineered composition comprising an AAA'' or lentivirus vector system comprising one or more AAV or lentivirus vectors operably encoding a composition for expression thereof, wherein the target sequence is manipulated by the composition when expressed, wherein the composition comprises: (A) a non-naturally occurring or engineered composition comprising a vector system comprising one or more vectors comprising I.
  • chiRNA CRISPR-Cas system chimeric RNA
  • a first regulatory element operably linked to (a) a guide sequence capable of hybridizing to a target sequence in a eukaryotic cell , and (b) at least one or more tracr mate sequences, II, a second regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme, and III.
  • a third regulatory element operably linked to a tracr sequence wherein components I, II and ( If are located on the same or different vectors of the system, wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence.
  • components I, II and III are located on the same vector. In other embodiments, components I and II are located on the same vector, while component III is located on another " vector.
  • components I and IK are located on the same vector, while component II is located on another vector.
  • components I I and III are located on the same vector, while component I is located on another vector.
  • each of components I, II and 111 is located on different vectors.
  • the invention also provides a viral (e.g. AAV or lentivirus) vector system as described herein. , and can be part of a vector system as described herein.
  • Some methods of the invention can include inducing expression.
  • the organism or subject is a eukaryote (including mammal including human) or a non-human eukaryote or a non-human animal or a non-human mammal.
  • the organism or subject is a non-human animal, and may be an arthropod, for example, an insect, or may be a nematode.
  • the organism or subject is a plant.
  • the organism or subject is a mammal or a non-human mammal.
  • a non-human mammal may be for example a rodent (preferably a mouse or a rat), an ungulate, or a primate.
  • the organism or subject is algae, including microaigae, or is a fungus.
  • the viral vector is an AAV or a lentivirus, and can be part, of a vector system as described herein.
  • the CRISPR enzyme is a Cas9.
  • the expression of the guide sequence is under the control of the T7 promoter and is driven by the expression of T7 polymerase.
  • the invention in some embodiments comprehends a method of delivering a CRISPR enzyme comprising delivering to a ceil mRNA encoding the CRISPR enzyme.
  • the CRISPR enzyme is a Cas9.
  • the invention also provides methods of preparing the vector systems of the invention, in particular the viral vector systems as described herein.
  • the invention in some embodiments comprehends a method of preparing the AAV of the invention comprising transfecting plasmid(s) containing or consisting essentially of nucleic acid molecule(s) coding for the AAV into AAV-mfected cells, and supplying AAV rep and/or cap obligatory for replication and packaging of the AAV.
  • the AAV rep and/or cap obligator ⁇ 7 for replication and packaging of the AA V are supplied by transfecting the cells with helper plasmid(s) or helper virus(es).
  • the helper virus is a poxvirus, adenovirus, herpesvirus or baculovirus.
  • the poxvirus is a vaccinia virus.
  • the cells are mammalian cel ls. And in some embodiments the cells are insect ceils and the helper virus is baculovirus. In other embodiments, the virus is a lentivirus.
  • pathogens are often host-specific.
  • Fusarium oxysporum f. sp. lycopersici causes tomato wilt but attacks only tomato
  • Plants have existing and induced defenses to resist most pathogens. Mutations and recombination events across plant generations lead to genetic variability thai gives rise to susceptibility, especially as pathogens reproduce with more frequency than plants.
  • there can be non-host resistance e.g., the host and pathogen are incompatible.
  • Horizontal Resistance e.g., partial resistance against all races of a pathogen
  • Vertical Resistance e.g., complete resistance to some races of a pathogen but not to other races, typically controlled by a few genes.
  • Plant and pathogens evolve together, and the genetic changes in one balance changes in other. Accordingly, using Natural Variability, breeders combine most useful genes for Yield, Quality, Uniformity, Hardiness, Resistance.
  • the sources of resistance genes include native or foreig Varieties, Heirloom Varieties, Wild Plant Relatives, and Induced Mutations, e.g., treating plant material with mutagenic agents.
  • plant breeders are provided with a new tool to induce mutations. Accordingly, one skilled in the art can analyze the genome of sources of resistance genes, and in Varieties having desired characteristics or traits employ the present invention to induce the rise of resistance genes, with more precision than previous mutagenic agents and hence accelerate and improve plant breeding programs.
  • the invention further comprehends a composition of the invention or a CRISPR. enzyme thereof (including or alternatively mRNA encoding the CRISPR enzyme) for use in medicine or in therapy.
  • the invention comprehends a composition according to the invention or a CRISPR enzyme thereof (including or alternatively mRNA encoding the CRISPR enzyme) for use in a method according to the invention.
  • the invention provides for the use of a composition of the invention or a CRISPR enzyme thereof (including or alternatively mRNA encoding the CRISPR enzyme) in ex vivo gene or genome editing.
  • the invention comprehends use of a composition of the invention or a CRISPR enzyme thereof (including or alternatively mRNA encoding the CRISPR enzyme) in the manufacture of a medicament for ex vivo gene or genome editing or for use in a method according of the invention.
  • the invention comprehends in some embodiments a composition of the Invention or a CRISPR enzyme thereof (including or alternatively mRN A encoding the CRISPR enzyme), wherein the target sequence is flanked at its 3 ' end by a PAM (protospacer adjacent motif) sequence comprising 5 '-motif, especially where the Cas9 is (or is derived from) S. pyogenes or S. aureus Cas9.
  • a suitable PAM is 5 -NRG or 5 -NNGRR (where N is any Nucleotide) for SpCas9 or SaCas9 enzymes (or derived enzymes), respectively, as mentioned below.
  • SpCas9 or SaCas9 are those from or derived from 5. pyogenes or S. aureus Cas9.
  • Apects of the invention comprehend improving the specificity of a CRISPR enzyme, e.g. Cas9, mediated gene targeting and reducing the likelihood of off-target modification by the CRISPR enzyme, e.g. Cas9.
  • the invention in some embodiments comprehends a method of modifying an organism or a non-human organism by minimizing off-target modifications by manipulation of a first and a second target sequence on opposite strands of a DNA duplex in a genomic locus of interest in a cell comprising delivering a noii-naturaily occurring or engineered composition comprising :
  • a first CRISPR-Cas system chimeric RNA (chiRNA) polynucleotide sequence wherein the first polynucleotide sequence comprises:
  • a second CRISPR-Cas system chiRNA polynucleotide sequence wherein the second polynucleotide sequence comprises:
  • a polynucleotide sequence encoding a CRISPR enzyme comprising at least one or more nuclear localization sequences and comprising one or more mutations wherein (a), (b) and (c) are arranged in a 5' to 3' orientation, wherein when transcribed, the first and the second tracr mate sequence hybridize to the first and second tracr sequence respectively and the first and the second guide sequence directs sequence-specific binding of a first and a second CRISPR complex to the first and second target sequences respectively
  • the first CRISPR comple comprises the CRISPR enzyme complexed with (1) the first guide sequence that is hybridized to the first target sequence, and (2) the first tracr mate sequence that is hybridized to the first tracr sequence
  • the second CRISPR complex comprises the CRISPR enzyme complexed with (1) the second guide sequence that is hybridized to the second target sequence, and (2) the second tracr mate sequence that is hybridized to the second tracr sequence, wherein the polynucle
  • any or all of the polynucleotide sequence encoding the CRISPR enzyme, the first and the second guide sequence, the first and the second tracr mate sequence or the first and the second tracr sequence is/are RNA
  • the polynucleotides encoding the sequence encoding the CR ISPR enzyme, the first and the second guide sequence, the first and the second tracr mate sequence or the first and the second tracr sequence is/are RNA and are delivered via liposomes, nanoparticles, exosomes, micro vesicles, or a gene-gun.
  • the first and second tracr mate sequence share 100% identity and/or the first and second tracr sequence share 100% identity.
  • the polynucleotides may be comprised within a vector system comprising one or more vectors.
  • the CRISPR enzyme is a Cas9 enzyme, e.g. SpCas9.
  • the CRISPR enzyme comprises one or more mutations in a catalytic domain, wherein the one or more mutations are selected from the group consisting of D10A, E762A, H840A, N854A, N863A and D986A.
  • the CRISPR enzyme has the DI0A mutation.
  • the first CRISPR enzyme has one or more mutations such thai the enzyme is a complementary strand nicking enzyme
  • the second CRISPR enzyme has one or more mutations such that the enzyme is a non-complementary strand nicking enzyme.
  • the first enzyme may be a non-complementary strand nicking enzyme
  • the second enzyme may be a complementary strand nicking enzyme.
  • the first guide sequence directing cleavage of one strand of the DNA duplex near the first target sequence and the second guide sequence directing cleavage of the other strand near the second target sequence results in a 5' overhang.
  • the 5' overhang is at most 200 base pairs, preferably at most 100 base pairs, or more preferably at most 50 base pairs.
  • the 5' overhang is at least 26 base pairs, preferably at least 30 base pairs or more preferably 34-50 base pairs.
  • the invention in some embodiments comprehends a method of modifying an organism or a non-human organism by minimizing off-target modifications by manipulation of a first and a second target sequence on opposite strands of a DNA duplex in a genomic locus of interest in a cell comprising delivering a non-naturaily occurring or engineered composition comprising a vector system comprising one or more vectors comprising [0045] I. a first regulatory element operabiy linked to
  • the tracr mate sequence hybridizes to the tracr sequence and the first a d the second guide sequence direct sequence-specific binding of a first and a seco d CRISPR complex to the first and second target sequences respectively, wherein the first CRISPR complex comprises the CRISPR enzyme complexed with (1) the first guide seque ce that is hybridized to the first target sequence, and (2) the tracr .mate sequence that is hybridized to the tracr sequence, wherein the second CRISPR complex comprises the CRISPR enzyme complexed with (1) the second guide sequence that is hybridized to the second target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence, wherein the polynucleotide sequence encoding a CRISPR enzyme is DNA or RNA, and wherein the first guide sequence directs cleavage of one strand of the DNA duplex near the first target sequence and the second guide sequence
  • the invention also provides a vector system as described herein.
  • the system may comprise one, two, three or four different vectors.
  • Components I, II, III and IV may thus be located on one, two, three or four different vectors, and all combinations for possible locations of the components are herein envisaged, for example: components I, I I, I II and IV can be located on the same vector; components I, II, III and IV can each be located on different vectors; components I, ( 1, II I and I V may be located on a total of two or three different vectors, with al l combinations of locations envisaged, etc.
  • any or all of the polynucleotide sequence encoding the CRISPR enzyme, the first and the second guide sequence, the first and the second tracr mate sequence or the first and the second tracr sequence is/are RNA,
  • the first and second tracr mate sequence share 100% identity and/or the first and second tracr sequence share 100% identity.
  • the CRISPR enzyme is a Cas9 enzyme, e.g. SpCas9.
  • the CRJSPR enzyme comprises one or more mutations in a catalytic domain, wherein the one or more mutations are selected from the group consisting of DIOA, E762A, H840A, N854A, N863A and D986A.
  • the CRISPR enzyme has the DIOA mutation.
  • the first CRISPR enzyme has one or more mutations such that the enzyme is a complementary strand nicking enzyme
  • the second CRISPR enzyme has one or more mutations such that the enzyme is a non-complementary strand nicking enzyme.
  • the first enzyme may be a non-complementary strand nicking enzyme
  • the second enzyme may be a complementary strand nicking enzyme.
  • one or .more of the viral vectors are delivered via liposomes, nanoparticles, exosomes, micro vesicles, or a gene-gun.
  • the first guide sequence directing cleavage of one strand of the DNA duplex near the first target sequence and the second guide sequence directing cleavage of other strand near the second target sequence results in a 5' overhang.
  • the 5 " overhang is at most 200 base pairs, preferably at most 100 base pairs, or more preferably at most 50 base pairs.
  • the 5' overhang is at least 26 base pairs, preferably at least 30 base pairs or more preferably 34-50 base pairs.
  • the invention in some embodiments comprehends a method of .modifying a genomic locus of interest by minimizing off-target modifications by introducing into a cell containing and expressing a double stranded DNA molecule encoding a gene product of interest an engineered, non-naturally occurring CR ISPR-Cas system comprising a Cas protein having one or more mutations and two guide RNAs that target a first strand and a second strand of the DNA molecule respectively, whereby the guide RNAs target the DNA molecule encoding the gene product and the Cas protein nicks each of the first strand and the second strand of the DNA molecule encoding the gene product, whereby expression of the gene product is altered; and, wherein the Cas protein and the two guide RNAs do not naturally occur together.
  • the Cas protein nicking each of the first stra d and the second strand of the DM A molecule encoding the gene product results in a 5' overhang.
  • the 5' overhang is at most 200 base pairs, preferably at most 100 base pairs, or more preferably at most 50 base pairs.
  • the 5 ' overhang is at least 26 base pairs, preferably at least 30 base pairs or more preferably 34-50 base pairs.
  • Embodiments of the invention also comprehend the guide RNAs comprising a guide sequence fused to a tracr mate sequence and a tract" sequence.
  • the Cas protein is codon optimized for expression in a eukaryotic cel l, preferably a mammalian cell or a human ceil.
  • the Cas protein is a type II CRISPR- Cas protein, e.g. a Cas 9 protein.
  • the Cas protein is a Cas9 protein, e.g. SpCas9.
  • the Cas protein has one or more mutations selected from the group consisting of D10A, E762A, H840A, N854A, N863A and D986A.
  • the Cas protein has the D10A mutation.
  • aspects of the in vention relate to the expression of the gene product being decreased or a template polynucleotide being further introduced into the DNA molecule encoding the gene product or an intervening sequence being excised precisely by allowing the two 5' overhangs to reanneal and ligate or the activity or function of the gene product being altered or the expression of the gene product being increased.
  • the gene product is a protein.
  • the invention also comprehends an engineered, non-naturally occurring CRISPR-Cas system comprising a Cas protein having one or more mutations and two guide RNAs that target a first strand and a second strand respectively of a double stranded DNA molecule encoding a gene product in a cell, whereby the guide RNAs target the DNA molecule encoding the gene product and the Cas protein nicks each of the first strand and the second strand of the DNA molecule encoding the gene product, whereby expression of the gene product is altered; and, wherein the Cas protein and the two guide RNAs do not naturally occur together,
  • the guide RNAs may comprise a guide sequence fused to a tracr mate sequence and a tracr sequence.
  • the Cas protein is a type II CRISPR-Cas protein.
  • the Cas protein is eodon optimized for expression in a eukaryotic cell, preferably a mammalian cell or a human cell.
  • the Cas protein is a type II CRISPR-Cas protein, e.g. a Cas 9 protein.
  • the Cas protein is a Cas9 protein, e.g. SpCas9.
  • the Cas protein has one or more mutations selected from the group consisting of D10A, E762A, H840A, N854A, N863A and D986A.
  • the Cas protein has the D10A mutation.
  • aspects of the in vention relate to the expression of the gene product being decreased or a template polynucleotide being further introduced into the DNA molecule encoding the gene product or an intervening sequence being excised precisely by allowing the two 5' overhangs to reanneal and ligate or the activity or function of the gene product being altered or the expression of the gene product being increased.
  • the gene product is a protein.
  • the invention also comprehends a engineered, noii-naturaily occurring vector system comprising one or more vectors com rising:
  • components (a) and (b) are located on same or different vectors of the system, whereby the guide RNAs target the DNA molecule encoding the gene product a d the Cas protein icks each of the first strand and the second strand of the DNA molecule encoding the gene product, whereby expression of the gene product is altered; and, wherein the Cas protein and the two guide RNAs do not naturally occur together.
  • the guide RNAs may comprise a guide sequence fused to a tracr mate sequence and a tracr sequence.
  • the Cas protein is a type II CRISPR-Cas protein.
  • the Cas protein is codon optimized for expression in a eukaryotic ceil, preferably a mammalian cell or a human cell.
  • the Cas protein is a t pe I I I CR ISPR-Cas protein, e.g. a Cas 9 protein.
  • the Cas protein is a Cas9 protein, e.g. SpCas9.
  • the Cas protein has one or more mutations selected from the group consisting of D10A, E762A, H840A, N854A, N863A and D986A.
  • the Cas protein has the D10A mutation.
  • aspects of the invention relate to the expression of the gene product being decreased or a template polynucleotide being further introduced into the DNA molecule encoding the gene product or an intervening sequence being excised precisely by allowing the two 5' overhangs to reanneal and ligate or the activity or function of the gene product being altered or the expression of the gene product being increased.
  • the gene product is a protein.
  • the vectors of the system are viral vectors.
  • the vectors of the system are delivered via liposomes, nanoparticies, exosomes, microvesicl.es, or a gene-gun.
  • the invention provides a method of modifying a target polynucleotide in a eukaryotic cell.
  • the method comprises allowing a CRISPR complex to bind to the target polynucleotide to effect cleavage of said target polynucleotide thereby modifying the target polynucleotide, wherein the CRISPR complex comprises a CRISPR enzyme compiexed with a guide sequence hybridized to a target sequence within said target polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence.
  • said cleavage comprises cleaving one or two strands at the location of the target sequence by said CRISPR enzyme. In some embodiments, said cleavage results in decreased transcription of a target gene. In some embodiments, the method further comprises repairing said cleaved target polynucleotide by homologous recombination with an exogenous template polynucleotide, wherein said repair results in a mutation comprising an insertion, deletion, or substitution of one or more nucleotides of said target polynucleotide. In some embodiments, said mutation results in one or more amino acid changes in a protein expressed from a gene comprising the target sequence.
  • the method further comprises delivering one or more vectors to said eukaryotic cell, wherein the one or more vectors drive expression of one or more of: the CRISPR enzyme, the guide sequence linked to the tracr mate sequence, and the tracr sequence.
  • said vectors are delivered to the eukaryotic cell in a subject.
  • said modifying takes place in said eukaryotic cell in a cell culture.
  • the method further comprises isolating said eukaryotic cell from a subject prior to said modifying.
  • the method further comprises returning said eukaryotie cell and/or cells derived therefrom to said subject.
  • the invention provides a method of modifying expression of a polynucleotide in a eukaryotie cell.
  • the method comprises allowing a CRISPR complex to bind to the polynucleotide such that said binding results in i creased or decreased expression of said polynucleotide; wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence.
  • the method further comprises delivering one or more vectors to said eukaryotie cells, wherein the one or more vectors drive expression of one or more of: the CRISPR enzyme, the guide sequence linked to the tracr mate sequence, and the tracr sequence.
  • the invention provides a method of generating a model eukaryotie cell comprising a mutated disease gene.
  • a disease gene is any gene associated with an increase in the risk of having or developing a disease.
  • the method comprises (a) introducing one or more vectors into a eukaryotie cell, wherein the one or more vectors drive expression of one or more of: a CRISPR enzyme, a guide sequence linked to a tracr mate sequence, and a tracr sequence; and (b) allowing a CRISPR complex to bind to a target polynucleotide to effect cleavage of the target poly ucleotide within said disease ge e, wherein the CRISPR complex comprises the CRISPR enzyme complexed with (I) the guide sequence that is hybridized to the target sequence within the target poly ucleotide, and (2) the tracr mate sequence that is hybridized to the tracr sequence, thereby generating a model eukaryotie cell comprising a mutated disease gene.
  • said cleavage comprises cleaving one or two strands at the location of the target sequence by said CRISPR enzyme. In some embodiments, said cleavage results in decreased transcription of a target gene. In some embodiments, the method further comprises repairing said cleaved target polynucleotide by homologous recombination with an exogenous template polynucleotide, wherein said repair results in a mutation comprising an insertion, deletion, or substitution of one or more nucleotides of said target polynucleotide. In some embodiments, said mutation results in one or more amino acid changes in a protein expression from a gene comprising the target sequence.
  • the invention provides for a method of selecting one or more prokaryotie cell(s) by introducing one or more mutations in a gene in the one or more prokaryotie cell (s), the method comprising: introducing one or more vectors into the prokaryotie cel l (s), wherein the one or more vectors drive expressio of one or more of: a CRISPR enzyme, a guide sequence linked to a tracr mate sequence, a tracr sequence, and an editing template; wherein the editing template comprises the one or more mutations that abolish CRISPR enzyme cleavage; allowing homologous recombination of the editing template with the target polynucleotide in the cell(s) to be selected; allowing a CRISPR complex to bind to a target polynucleotide to effect cleavage of the target polynucleotide within said gene, wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1) the
  • the CRISPR enzyme is Cas9
  • the cell to be selected may be a eukaryotic cell. Aspects of the invention allow for selection of specific ceils without requiring a selection marker or a two-step process thai may include a counter-selection system,
  • the invention provides for methods of modifying a target polynucleotide in a eukaryotic cell.
  • the method comprises allowing a CRISPR complex to bind to the target polynucleotide to effect cleavage of said target polynucleotide thereby modifying the target polynucleotide, wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said target polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence.
  • this invention provides a method of modifying expression of a polynucleotide in a eukaryotic cell.
  • the method comprises increasing or decreasing expression of a target polynucleotide by using a CRJSPR complex that binds to the polynucleotide.
  • one or more vectors comprising a tracr sequence, a guide sequence linked to the tracr mate sequence, a sequence encoding a CRISPR enzyme is delivered to a cell.
  • the one or more vectors comprises a regulatory element operably linked to an enzyme-coding sequence encoding said CRISPR enzyme comprising a nuclear localization sequence; and a regulatory element operably linked to a tracr mate sequence and one or more insertion sites for inserting a guide sequence upstream of the tracr mate sequence.
  • the guide sequence directs sequence-specific binding of a CRISPR complex to a target sequence in a cell.
  • the CRISPR complex comprises a CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence.
  • a target polynucleotide can be inactivated to effect the modification of the expression in a cell. For example, upon the binding of a CRISPR complex to a target sequence in a cell, the target polynucleotide is inactivated such that the sequence is not transcribed, the coded protein is not produced, or the sequence does not function as the wild-type sequence does. For example, a protein or microRNA coding sequence may be inactivated such that the protein is not produced.
  • the CRISPR enzyme comprises one or more mutations selected from the group consisting of D10A, E762A, H840A, N854A, N863A or D986A and/or the one or more mutations is in a RuvCl or HNH domain of the CRISPR enzyme or is a mutatio as otherwise as discussed herein.
  • the CRISPR. enzyme has one or more mutations in a catalytic domain, wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and wherein the enzyme further comprises a functional domain.
  • the functional domain is a transcriptional activation domain, preferably VP64. In some embodiments, the functional domain is a transcription repression domain, preferably KRAB. In some embodiments, the transcription repression domain is SID, or concatemers of SID (eg SID4X). In some embodiments, the functional domain is an epigenetic modifying domain, such that an epigenetic modifying enzyme is provided. In some embodiments, the functional domain is an activation domain, which may be the P65 activation domain.
  • the CRISPR enzyme is a type I or III CRISPR enzyme, but is preferably a type II CRISPR enzyme.
  • This type I I CRISPR enzyme may be any Cas enzyme.
  • a Cas enzyme may be identified as Cas9 as this can refer to the general class of enzymes that share homology to the biggest nuclease with multiple nuclease domains from the type II CRISPR
  • the Cas9 enzyme is from, or is derived from, spCas9 or saCas9, By derived.
  • Cas and CRISPR enzyme are generally used herein interchangeably, unless otherwise apparent.
  • residue numberings used herein refer to the Cas9 enzyme from the type II CRISPR locus in Streptococcus pyogenes.
  • this invention includes many more Cas9s from other species of microbes, such as SpCas9, SaCa9, Stl Cas9 and so forth.
  • deliver ⁇ .' is in the form of a vector which may be a viral vector, such as a lenti- or baculo- or preferably adeno-viral/adeno-associated viral vectors, but other means of delivery are known (such as yeast systems, microvesicles, gene guns/means of attaching vectors to gold nanopartic!es) and are provided.
  • a vector may mean not only a viral or yeast system (for instance, where the nucleic acids of interest may be operably linked to and under the control of (in terms of expression, such as to ultimately provide a processed RNA) a promoter), but also direct deliver ⁇ ' of nucleic acids into a host cell.
  • the vector may be a viral vector and this is advantageously an AAV
  • viral vectors as herein discussed can be employed, such as lentivirus.
  • baculoviruses may be used for expression in insect cells. These insect cells may, in turn be useful for producing large quantities of further vectors, such as AAV or lentivirus vectors adapted for delivery of the present invention.
  • a method of delivering the present CRISPR enzyme comprising delivering to a ceil niR A encoding the CRISPR enzyme.
  • the CRISPR enzyme is truncated, and/or comprised of less than one thousand amino acids or less than four thousand amino acids, and/or is a nuclease or nickase, and/or is codon-optimized, and/or comprises one or more mutations, and/or comprises a chimeric CR ISPR enzyme, and/or the other options as herein discussed.
  • AAV and lentiviral vectors are preferred.
  • the target sequence is flanked or followed, at its 3' end, by a PAM suitable for the CRISPR enzyme, typically a Cas and in particular a Cas9.
  • a suitable PAM is 5'-NRG or 5'-NNGRR for SpCas9 or SaCas9 enzymes (or derived enzymes), respectively.
  • SpCas9 or SaCas9 are those from or derived from S. pyogenes or S. aureus Cas9.
  • FIG. 1 shows a schematic model of the CRISPR system.
  • the Cas9 nuclease from Streptococcus pyogenes (yellow) is targeted to genomic DNA by a synthetic guide RNA (sgRNA) consisting of a 20-nt guide seque ce (blue) and a scaffold (red).
  • sgRNA synthetic guide RNA
  • the guide sequence base-pairs with the DNA target (blue), directly upstream of a requisite 5'-NGG protospacer adjacent motif (PAM; magenta), and Cas9 mediates a double-stranded break (DSB) ⁇ 3 bp upstream of the P AM (red triangle).
  • PAM magenta
  • DSB double-stranded break
  • Figure 2A-F shows an exemplary CRISPR system, a possible mechanism of action, an example adaptation for expression in eukaryotic cells, and results of tests assessing nuclear localization and CRISPR activity.
  • Figure 3A-D shows results of an evaluation of SpCas9 specificity for an example target.
  • Figure 4A-G show an exemplary vector system and results for its use in directing homologous recombination in eukaryotic cells.
  • Figure 5 provides a table of protospacer sequences and summarizes modification efficiency results for protospacer targets designed based on exemplary S. pyogenes and S. thermophilus CRISPR systems with corresponding PAMs against loci in human and mouse genomes.
  • Figure 6A-C shows a comparison of different tracrRNA transcripts for Cas9-mediated gene targeting.
  • Figure 7 shows a schematic of a surveyor nuclease assay for detection of double strand break-induced micro-insertions and -deletions.
  • Figure 8A-B shows exemplary bicistronic expression vectors for expression of CRISPR system elements in eukaryotic cel ls.
  • Figure 9A-C shows histograms of distances between adjacent S. pyogenes SF370 locus 1 PAM (NGG) ( Figure 9A) and S. thermophilus LMD9 locus 2 PAM (NNAGAAW) ( Figure 9B) in the human genome; and distances for each PAM by chromosome (Chr) ( Figure 9C).
  • Figure 10A-D shows an exemplary CRISPR. system, an example adaptation for expression in eukaryotic cells, and results of tests assessing CRISPR activity.
  • Figure 11 A-C shows exemplary manipulations of a CRISPR system for targeting of genomic loci in mammalian cells.
  • Figure 12A-B shows the results of a Northern blot analysis of crRNA processing in mammalian cells.
  • Figure 13A-B shows an exemplary selection of protospacers in the human PVALB and mouse Th loci.
  • Figure 14 shows example protospacer and corresponding PAM sequence targets of the S. thermophilus CRISPR. system in the human EMXl locus.
  • Figure 15 provides a table of sequences for primers and probes used for Surveyor, RFLP, genomic sequencing, and Northern blot assays.
  • Figure 16 A-C shows exemplary manipulation of a CRISPR system with chimeric RNAs and results of SURVEYOR assays for system activity in eukaryotic cells.
  • Figure 17A-B shows a graphical representation of the resul ts of SURVEYOR, assays for CRISPR system activity in eukaryotic cells.
  • Figure 18 shows an exemplary visualization of some S. pyogenes Cas9 target sites in the human genome using the UCSC genome browser.
  • Figure 19A-D shows a circular depiction of the phylo genetic analysis revealing five families of Cas9s, including three groups of large Cas9s (- 1400 amino acids) and two of small Cas9s ( ⁇ 1100 amino acids),
  • Figure 20A-F shows the linear depiction of the phylogenetic analysis revealing five families of Cas9s, including three groups of large Cas9s (-1400 amino acids) and two of small Cas9s ( ⁇ .l .100 amino acids).
  • Figure 21A-D shows genome editing via homologous recombination
  • (a) Schematic of SpCas9 nickase, with D10A mutation in the RuvC I catalytic domain (b) Schematic representing homologous recombination (FIR.) at the human EMXl locus using either sense or amisense single stranded oligonucleotides as repair templates.
  • Red arrow above indicates sgRNA cleavage site; PCR primers for genotyping (Tables J and ) are indicated as arrows in right panel
  • d SURVEYOR assay for wildtype (wt) and nickase (D10A) SpCas9-mediated indels at the EM XI target 1 locus (n ⁇ 3). Arrows indicate positions of expected fragment sizes.
  • Figure 22A-B shows single vector designs for SpCas9.
  • Figure 23 shows a graph representing the length distribution of Cas9 ortho!ogs.
  • Figure 24A-M shows sequences where the mutation points are located within the SpCas9 gene.
  • Figure 25A shows the Conditional Cas9, Rosa26 targeting vector map.
  • Figure 25B shows the Constitutive Cas9, Rosa26 targeting vector map.
  • Figure 26 shows a schematic of the important elements in the Constitutive
  • Figure 27 shows delivery and in vivo mouse brain Cas9 expression data.
  • Figure 28 shows RNA delivery of Cas9 and chimeric RNA into cells
  • A Delivery of a GFP reporter as either DNA or mRNA into Neuro-2A. cel ls.
  • B Delivery of Cas9 and chimeric RNA against the Ieam2 gene as RNA results in cutting for one of two spacers tested.
  • C Delivery of Cas9 and chimeric RNA against the F7 gene as RNA results in cutting for one of two spacers tested.
  • Figure 29 shows how DNA double-strand break (DSB) repair promotes gene editing.
  • NHEJ error-prone non-homologous end joining
  • the ends of a DSB are processed by endogenous DNA repair machineries and rejoined together, which can result in random insertion/deletion (indel ) mutations at the site of junction, hide! mutations occurring within the coding region of a gene can result in frame-shift and a premature stop codoii, leading to gene knockout.
  • indel random insertion/deletion
  • a repair template in the form of a plasmid or single-stranded oligodcoxynuelcotides can be suppli ed to leverage the homo logy-directed repair (HDR) pathway, which allows high fidelity and precise editing.
  • HDR homo logy-directed repair
  • Figure 30A-C shows anticipated results for HDR in HEK and HUES9 cells
  • Either a targeting plasmid or an ssODN (sense or antisense) with homology arms can be used to edit the sequence at a target genomic locus cleaved by Cas9 (red triangle).
  • a targeting plasmid or an ssODN (sense or antisense) with homology arms can be used to edit the sequence at a target genomic locus cleaved by Cas9 (red triangle).
  • a Hindlll site red bar
  • Digestion of the PGR. product wit Hindlll reveals the occurrence of HDR events
  • ssODNs oriented in either the sense or the antisense (s or a) direction relative to the locus of interest, can be used in combination with Cas9
  • Figure 31 A-C shows the repair strategy for Cystic Fibrosis delta F508 mutation.
  • Figure 32A-B (a) shows a schematic of the GAA repeat expansion in FXN intron 1 and (b) shows a schematic of the strategy adopted to excise the GAA expansion region using the CRISPR/Cas system.
  • Figure 33 shows a screen for efficient SpCas9 mediated targeting of Tetl-3 and Drsmtl , 3a and 3b gene loci.
  • Surveyor assay on DMA from transfected N2A ceils demonstrates efficient DNA cleavage by using different gRNAs.
  • Figure 34 shows a strategy of multiplex genome targeting using a 2 -vector system in an AAV 1/2 delivery system. Tetl-3 and Dnmtl, 3a and 3b gRNA under the control of the U6 promoter. GFP-KASH under the control of the human synapsin promoter. Restriction sides shows simple gRNA replacement strategy by subcloning. HA-tagged SpCas9 flanked by two nuclear localization signals (NLS) is shown. Both vectors are delivered into the brain by AAV 1/2 virus in a 1 :1 ratio.
  • NLS nuclear localization signals
  • Figure 35 shows verification of multiplex DNMT targeting vector #1 functionality using Surveyor assay.
  • N2A ceils were co-transfected with the DNMT targeting vector #1 (+) and the SpCas9 encoding vector for testing SpCas9 mediated cleavage of DNMTs genes family loci.
  • gRNA only (-) is negative control.
  • Cells were harvested for DNA purification and downstream processing 48 h after transfection.
  • Figure 36 shows verification of multiplex DNMT targeting vector #2 functionality using Surveyor assay.
  • N2A cells were co-transfected with the DNMT targeting vector #1 (+) and the SpCas9 encoding vector for testing SpCas9 mediated cleavage of DNMTs genes family loci.
  • gRNA only (-) is negative control. Cells were harvested for DNA purification and downstream processing 48 h after transfection.
  • Figure 37 shows schematic overview of short promoters and short polyA versions used for HA-SpCas9 expression in vivo. Sizes of the encoding region from L-ITR to R-ITR are shown on the right.
  • Figure 38 shows schematic overview of short promoters and short poiyA versions used for HA-SaCas9 expression in vivo. Sizes of the encoding region from L-ITR to R-ITR are shown on the right.
  • Figure 39 shows expression of SpCas9 and SaCas9 in N2A ceils. Representative Western blot of HA-tagged SpCas9 and SaCas9 versions under the control of different short promoters and with or short polyA (spA) sequences. Tubulin is loading control. mCherry (mCh) is a transfection control. Cells were harvested and further processed for Western blotting 48 h after transfection.
  • spA short polyA
  • Figure 40 shows screen for efficient SaCas9 mediated targeting of Tet.3 gene locus.
  • Surveyor assay on DNA from transfecte N2A cells demonstrates efficient DNA cleavage by using different gRNAs wit NNGGGT PUM sequence.
  • GFP transfected cells and ceils expressing only SaCas9 are controls.
  • Figure 41 shows expression of A-SaCas9 in the mouse brain. Animals were injected into dentate gyri with vims driving expression of HA-SaCas9 under the control of human Synapsin promoter. Animals were sacrificed 2 weeks after surgery. HA tag was detected using rabbit monoclonal antibody C29F4 (Cell Signaling). Cell nuclei stained in blue with DAPI stain.
  • Figure 42 shows expression of SpCas9 and SaCas9 in cortical primary neurons in culture 7 days after transduction. Representative Western blot of HA-tagged SpCas9 and SaCas9 versions under the control of different promoters and with bgh or short polyA (spA) sequences. Tubulin is loading control.
  • Figure 43 shows LIVE DEAD stain of primary cortical neurons 7 days after transduction with AAV 1 particles carrying SpCas9 with different promoters and multiplex gRNAs constructs (example shown on the last panel for DNMTs). Neurons after AAV transduction were compared with control untransduced neurons. Red nuclei indicate permeabilized, dead cells (second line of panels). Live ceils are marked in green color (third line of panels).
  • Figure 44 shows LIVE/DEAD stain of primary cortical neurons 7 days after transduction with AAVl particles carrying SaCas9 with different promoters. Red nuclei indicate permeabilized, dead ceils (second line of panels). Live cells are marked in green color (third line of panels).
  • Figure 45 shows comparison of morphology of neurons after transduction with AAV1 virus carrying SpCas9 and gRNA multiplexes for TETs and DNMTs genes loci. Neurons without transduction are shown as a control.
  • Figure 46 shows verification of multiplex DNMT targeting vector #1 functionality using Surveyor assay in primary cortical neurons.
  • Cells were co -transduced with the DNMT targeting vector #1 and the SpCas9 viruses with different promoters for testing SpCas9 mediated cleavage of DNMTs genes family loci.
  • Figure 47 shows in vivo efficiency of SpCas9 cleavage in the brain.
  • Mice were injected with AAV 1 /2 virus carrying gRNA multiplex targeting DNMT family genes loci together with SpCas9 viruses under control of 2 different promoters: mouse Mecp2 and rat- Map lb.
  • Figure 48 shows purification of GFP-KASH labeled cell nuclei from hippocampal neurons.
  • the outer nuclear membrane (ONM) of the cell nuclear membrane is tagged with, a fusion of GFP and the ASH protein transmembrane domain. Strong GFP expression in the brain after one week of stereotactic surgery and AAV 1/2 injection. Density gradient eentrifugation step to purify cell nuclei from intact brain. Purified nuclei are shown. Chromatin stain by Vybrant® DyeCycleTM Ruby Stain is shown in red, GFP labeled nuclei are green. Representative FACS profile of GFP+ and GFP- cell nuclei (Magenta: Vybrant® DyeCycleTM Ruby Stain, Green: GFP).
  • Figure 49 shows efficiency of SpCas9 cleavage in the mouse brain.
  • Mice were injected with AAV 1/2 virus carrying gRNA multiplex targeting TET family genes loci together with SpCas9 viruses under control of 2 different promoters: mouse Mecp2 and rat Map lb.
  • Figure 50 shows GFP-KASH expression in cortical neurons in culture. Neurons were transduced with AAV1 virus carrying gRNA multiplex constructs targeting TET genes loci. The strongest signal localize around cells nuclei due to KASH domain localization.
  • Figure 51 shows (top) a list of spacing (as indicated by the pattern of arrangement for two PAM sequences) between pairs of guide RNAs. Only guide RNA pairs satisfying patterns 1, 2, 3, 4 exhibited indels when used with SpCas9(D10A) nickase. (bottom) GeS images showing that combination of SpCas9(Dl OA) with pairs of guide RNA satisfying patterns 1, 2, 3, 4 led to the formation of indels in the target site.
  • Figure 52 shows a list of U6 reverse primer sequences used to generate U6-guide RNA expression casssett.es. Each primer needs to be paired with the U6 forward primer "gcactgagggcctatttcccatgattc" to generate amplicons containing U6 and the desired guide RN A.
  • Figure 53 shows a Genomic sequence map from the human Emxl locus showmg the locations of the 24 patterns listed in Figure 33.
  • Figure 54 shows on (right) a gel image indicating the formation of indels at the target site when variable 5' overhangs are present after cleavage by the Cas9 nickase targeted by different pairs of guide RNAs. on (left) a table indicating the lane numbers of the gel on the right and various parameters including identifying the guide RNA pairs used and the length of the 5' overhang present following cleavage by the Cas9 nickase.
  • Figure 55 shows a Genomic sequence map from the human Emxl locus showing the locations of the different pairs of guide RNAs that result in the gel patterns of Fig. 54 (right) and which are further described in Example 35.
  • Figure 56 shows staining of HA-SpCas9 in dorsal and ventral hippocampus 8 weeks after injection of viruses encoding M ecp2-HA-SpCas9 and 3xgRNA-TETS with Syn-KASH- GFP.
  • Figure 57 shows Syn_GFP- ASH expression 8 weeks after 3xgRNA virus injection is specific for neurons (NeuN positive cells) and not for glia cells (GFAP positive).
  • Figure 58 shows behavior tests conducted 5 weeks after CRISPR-mediated KD of TETs and DNMTs in dentate gyrus (ventral and dorsal part) showed increased level of anxiety and learning deficits.
  • E Barnes maze results.
  • F Freezing behavior during contextual fear conditioning.
  • H Trace fear conditioning results for TETs KD and DNMTs KD (1).
  • Figure 59 shows cutting efficiency of Tet loci in the brain, 8 weeks after Mecp_SpCas9 vims injection in compare to control animals mjected with Mecp2_SpCas9 virus only.
  • Figure 61 shows Dnmt3a staining in the brain, 8 weeks after stereotaxic injection of virus encoding Mecp2 SpCas9 and gRNAs targeting Dnmt loci. Bottom panel shows magnification of ROl indicated on the upper panel.
  • Figure 62 shows staining of Syn HA-SaCas9 in the dorsal hippocampus, 4 weeks after injection of virus.
  • First column shows animal injected with Sa-Cas9 only, middle column animal injected with both SaCas9 and gRNAs against TETs loci and the right column represents animal injected with only gRNAs encoding virus.
  • SaCas9 nuclear localization depends on the presence of gRNA.
  • Figure 63 shows SpCas9 in 2a cells.
  • A) Targeting- and SpCas9 expression vector B) Western Blot analysis of N2a cells expressing HA-tagged SpCas9 under the control of different promoters.
  • Figure 64 shows SpCas9 in primary neurons.
  • Figure 65 shows knock down of Dnmt3a in primary neurons.
  • Figure 66 shows knock down of Dnmt3a in vivo.
  • Figure 67 shows expression of SaCas9 in primary neurons.
  • D Nuclear localization of SaCas9 in presence of gRNA .
  • Figure 68 shows gRNA dependent nuclear localization of SaCas9.
  • Figure 69 shows an AAV-Sa-Cas9 vector, a liver-specific AAV-Sa-Cas9 vector and an alternate AAV-Sa-Cas9 vector,
  • Figure 70 shows data on optimized CMV-SaCas9-NLS-U6-sgRNA vector (submitted vector design last time); new data compares N'-term vs C'-term tagged SaCas9 and shows enhanced cleavage efficiency using C'-term NLS tagging.
  • Figure 71 shows SURVEYOR image showing indels generated by new Pcsk9 targets.
  • FIG 72 shows SaCas9 specificity: genome -wide off target sites (GWOTs) are predicted based on 2 criteria: they contain 4 or fewer mismatched bases to intended SaCas9 target and bear the least restrictive PAM for SaCas9, W ' GRR.
  • H i-. 293FT cells are transfected with either SpCas9 or SaCas9 with their corresponding sgRNAs at a target site (EMX1 : T AGGGTT A GG GG CC C C AGGC) that has CGGGGT as a PAM so that it can be cut by either SpCas9 (CGG) or SaCas9 (CGGGGT).
  • DNAs from ceils are harvested and analyzed for indels by Illumina sequencing at on-target and 41 predicted off-target loci (following protocols from Hsu et al. Nature Biotech 2013 and data analysis pipeline developed by David Scott and Josh Wei stein).
  • Figure 73 shows that that SaCas9 may have a higher level of off-target activity than SpCas9 at certain loci
  • the invention relates to the engineering and optimization of systems, methods and compositions used for the control of gene expression involving sequence targeting, such as genome perturbation or gene-editing, that relate to the CRISPR -C as system and components thereof.
  • sequence targeting such as genome perturbation or gene-editing
  • the Cas enzyme is Cas9.
  • An advantage of the present methods is that the CRISPR system avoids off-target binding and its resulting side effects. This is achieved using systems arranged to have a high degree of sequence specificity for the target DNA.
  • Cas9 optimization may be used to enhance function or to develop new functions, one can generate chimeric Cas9 proteins. Examples that the Applicants have generated are provided in Example 6.
  • Chimeric Cas9 proteins can be made by combining fragments from different Cas9 homoSogs. For example, two example chimeric Cas9 proteins from the Cas9s described herein. For example. Applicants fused the N-term of StlCas9 (fragment from this protein is in bold) with C-term of SpCas9.
  • chimeric Cas9s include any or all of: reduced toxicity; improved expression in eukaryotic cells; enhanced specificity; reduced molecular weight of protein, for example, making the protein smaller by combining the smallest domains from different Cas9 homologs; and/or altering the PAM sequence requirement.
  • the Cas9 may be used as a generic DNA binding protein .
  • Cas9 as a generic DNA binding protein by mutating the two catalytic domains (DIG and H840) responsible for cleaving both strands of the DNA target.
  • DIG and H840 catalytic domains
  • VP64 transcriptional activation domain
  • Other transcriptional activation domains are known.
  • transcriptional activation is possible.
  • gene repression in this case of the beta-eatenm gene
  • Cas9 repressor DNA- binding domain
  • Cas9 and one or more guide RNA can be delivered using adeno associated vims (AAV), ientivirus, adenovirus or other plasmid or viral vector types, in particular, using formulations and doses from, for example, US Patents Nos. 8,454,972 (formulations, doses for adenovirus), 8,404,658 (formulations, doses for AAV) and 5,846,946 (formulations, doses for DNA plasmids) and from clinical trials and publications regarding the clinical trials involving Ientivirus, AAV and adenovirus.
  • AAV the route of administration, formulation and dose can be as in US Patent No. 8,454,972 and as in clinical trials involving AAV.
  • the route of administration, formulation and dose can be as in US Patent No. 8,404,658 and as in clinical trials involving adenovirus.
  • the route of administration, formulation and dose can be as in US Patent No 5,846,946 and as in clinical studies involving plasmids.
  • Doses may be based on or extrapolated to an average 70 kg individual, and can be adjusted for patients, subjects, mammals of different weight and species. Frequency of administration is within the ambit of the medical or veterinary practitioner (e.g.. physician, veterinarian), depending on usual factors including the age, sex, general health, other conditions of the patient or subject and the particular condition or symptoms being addressed.
  • the viral vectors can be injected into the tissue of interest.
  • the expression of Cas9 can be driven by a cell-type specific promoter.
  • liver-specific expression might use the Albumin promoter and neuron-specific expression might use the Synapsin I promoter.
  • Transgenic animals are also provided.
  • Preferred examples include animals comprising Cas9, in terms of polynucleotides encoding Cas9 or the protein itself. Mice, rats and rabbits are preferred.
  • To generate transgenic mice with the constructs as exemplified herein one may inject pure, linear DNA into the pronucleus of a zygote from a pseudo pregnant female, e.g. a CB56 female. Founders may then be identified, genotyped, and backcrossed to CB57 mice. The constructs may then be cloned and optionally verified, for instance by Sanger sequencing. Knock outs are envisaged where for instance one or more genes are knocked out in a model.
  • transgenic animals are also provided, as are transgenic plants, especially crops and algae.
  • the transgenic plants may be useful in applications outside of providing a disease model. These may include food or feed production through expression of, for instance, higher protein, carbohydrate, nutrient or vitamin levels than would normally be seen in the wildtypc.
  • transgenic plants especially pulses and tubers, and animals, especially mammals such as livestock (cows, sheep, goats and pigs), but also poultry and edible insects, are preferred.
  • Transgenic algae or other plants such as rape may be particularly useful in the production of vegetable oils or biofuels such as alcohols (especially methanol and ethanol), for instance. These may be engineered to express or overexpress high levels of oil or alcohols for use in the oil or biofuel industries.
  • alcohols especially methanol and ethanol
  • AAV Adeno associated vims
  • AAV In terms of in vivo delivery, AAV is advantageous over other viral vectors for a couple of reasons:
  • AAV has a packaging limit of 4.5 or 4.75 Kb. This means that Cas9 as well as a promoter and transcription terminator have to be all fit into the same viral vector. Constructs larger than 4.5 or 4.75 Kb will lead to significantly reduced vims production. SpCas9 is quite large, the gene itself is over 4.1 Kb, which makes it difficult for packing into AAV. Therefore embodiments of the invention include utilizing homologs of Cas9 that are shorter. For example:
  • Promoter- gl ⁇ NA( N) -terminator (up to size limit of vector)
  • Double virus vector [00176] Double virus vector
  • Vector 1 containing one expression cassette for driving the expression of Cas9 Promoter ⁇ Cas9 coding nucleic acid molecule-temiinator
  • Vector 2 containing one more expression cassettes for driving the expression of one or more guideRNAs
  • Promoter-gRNA(N)-terminator up to size limit of vector
  • Promoter used to drive Cas9 coding nucleic acid molecule expression can include:
  • AAV ITR can serve as a promoter: this is advantageous for eliminating the need for an additional promoter element (which can take up space in the vector). The additional space freed up can be used to drive the expression of additional elements (gRNA, etc.). Also, ITR activity is relatively weaker, so can be used to reduce toxicity due to over expression of Cas9.
  • promoters CMV, CAG, CBh, PGK, SV40, Ferritin heavy or light chains, etc.
  • ICAM ICAM
  • hematopoietic cells can use IFNbeta or CD45.
  • Promoter used to drive guide RNA can include:
  • Pol 10 promoters such as U6 or HI
  • the AAV can be AAV1, AAV2, AAV5 or any combination thereof.
  • AAA'S is useful for delivery to the liver. The above promoters and vectors are preferred individually.
  • RN A delivery is also a useful method of in vivo delivery.
  • Fig, 27 shows delivery and in vivo mouse brain Cas9 expression data. It is possible to deliver Cas9 and gRNA (and, for instance, HR repair template) into cells using liposomes or nanoparticles.
  • delivery of the CRISPR enzyme, such as a Cas9 and/or delivery of the RNAs of the invention may be in RNA form and via microvesicles, liposomes or nanoparticles.
  • Cas9 mRNA and gRNA can be packaged into liposomal particles for delivery in vivo.
  • Liposomal transfection reagents such as lipofectamine from Life Technologies and other reagents on the market can effectively deliver RNA molecules into the liver.
  • Enhancing NHEJ or HR efficiency is also helpful for delivery. It is preferred that NHEJ efficiency is enhanced by co-expressing end-processing enzymes such as Trex2 (Dumitrache et al. Genetics. 2011 August; 188(4): 787-797). It is preferred that HR efficiency is increased by transiently inhibiting NHEJ machineries such as Ku70 and u86. HR efficiency can also be increased by co-expressing prokaryotic or eukaryotic homologous recombination enzymes such as RecBCD, RecA.
  • the CRISPR enzyme for instance a Cas9, and/or any of the present RNAs, for instance a guide RNA, can be delivered using adeno associated virus (AAV), lentivirus, adenovirus or other viral vector types, or combinations thereof.
  • Cas9 and one or more guide RNAs can be packaged into one or more viral vectors.
  • the viral vector is delivered to the tissue of interest by, for example, an intramuscular injection, while other times the viral delivery is via intravenous, transdermal, intranasal, oral, mucosal, or other delivery methods.
  • Such deliver ⁇ ' may be either via a single dose, or multiple doses.
  • the actual dosage to be delivered herein may vary greatly depending upon a variety of factors, such as the vector chose, the target cell, organism, or tissue, the general condition of the subject to be treated, the degree of transformation ⁇ nodification sought, the administration route, the administration mode, the type of transformation/modification sought, etc,
  • Such a dosage may further contain, for example, a carrier (water, saline, ethanol, glycerol, lactose, sucrose, calcium phosphate, gelatin, dextran, agar, pectin, peanut oil, sesame oil, etc.), a diluent, a pharmaceuticaily-acceptable carrier (e.g., phosphate-buffered saline), a pharmaceuticaily-acceptabie excipient, an adjuvant to enhance antigenicity, an immunostimulatory compound or molecule, and/or other compounds known in the art.
  • a carrier water, saline, ethanol, glycerol, lactose, sucrose, calcium phosphate, gelatin, dextran, agar, pectin, peanut oil, sesame oil, etc.
  • a pharmaceuticaily-acceptable carrier e.g., phosphate-buffered saline
  • the adjuvant herein may contain a suspension of minerals (alum, aluminum hydroxide, aluminum phosphate) on which antigen is adsorbed; or water-in-oil emulsion in which antigen solution is emulsified in oil (MF-59, Freund's incomplete adjuvant), sometimes with the inclusion of killed mycobacteria (Freund's complete adjuvant) to further enhance antigenicity (inhibits degradation of antigen and/or causes influx of macrophages).
  • Adjuvants also include immunostimulatory molecules, such as cyiokincs. costimulatory molecules, and for example, immunostimulatory DNA or RNA molecules, such as CpG oligonucleotides.
  • the dosage may further contain one or more pharmaceutically acceptable salts such as, for example, a mineral acid salt such as a hydrochloride, a hydrobromide, a phosphate, a sulfate, etc.; and the salts of organic acids such as acetates, propionates, malonates, benzoates, etc.
  • auxiliary substances such as wetting or emulsifying agents, pH buffering substances, gels or gelling materials, flavorings, colorants, microspheres, polymers, suspension agents, etc. may also be present herein.
  • one or more other conventional pharmaceutical ingredients such as preservatives, humectants, suspending agents, surfactants, antioxidants, antieaking agents, fillers, chelatmg agents, coating agents, chemical stabilizers, etc. may also be present, especially if the dosage form is a reeonstitutable form.
  • Suitable exemplary ingredients include macrocrystalline cellulose, earboxymethyicelhilose sodium, polysorbate 80, phenylethyl alcohol, chlorobutanol, potassium sorbate, sorbic acid, sulfur dioxide, propyl gallate, the parabens, ethyl vanillin, glycerin, phenol, parachlorophenoL gelatin, albumin and a combination thereof.
  • macrocrystalline cellulose earboxymethyicelhilose sodium
  • polysorbate 80 phenylethyl alcohol, chlorobutanol, potassium sorbate, sorbic acid, sulfur dioxide, propyl gallate, the parabens, ethyl vanillin, glycerin, phenol, parachlorophenoL gelatin, albumin and a combination thereof.
  • the delivery is via an adenovirus, which may be at a single booster dose containing at least 1 x 10 5 particles (also referred to as particle units, pu) of adenoviral vector.
  • the dose preferably is at least about 1 x I0 6 particles (for example, about 1 x 10°- 1 x 10 12 particles), more preferably at least about 1 x 10 ' ' particles, more preferably at least about 1 x 10 8 particles (e.g., about 1 x 10 ⁇ -1 x 10 n particles or about 1 x ⁇ ⁇ ' - ⁇ x 10" particles), and most preferably at least about 1 10' particles (e.g., about 1 * x 10 9 -1 x 10 10 particles or about 1 x 10 9 -1 x l Q l/ ⁇ particles), or even at least about 1 x 10 f 0 particles (e.g., about 1 x IQ lU -l x 10 particles)
  • the dose comprises no more than about 1 x 10 f 4 particles, preferably no more than about 1 x lO 1 ' particles, even more preferably no more than about 1 x 10 1 particles, even more preferably no more than about 1 x 10 H particles, and most preferably no more than about 1 x 10'° particles (e.g., no more than about 1 x 10 9 articles).
  • the dose may contain a single dose of adenoviral vector with, for example, about 1 x 10° particle units (pu), about 2 x 10 6 pu, about 4 x 10 6 pu, about 1 x 10 ' pu, about 2 x 10 ' pu, about 4 x 10' pu, about 1 x 10 B pu, about 2 x 10 8 pu, about 4 x 10 8 pu, about 1 x 10 9 pu, about 2 x 1Q 9 pu, about 4 x 10 9 pu, about 1 x 10 10 pu, about 2 X 1() ⁇ ⁇ pu, about 4 x 10 1 pu, about 1 x 10 f 1 pu, about 2 x !
  • adenoviral vector with, for example, about 1 x 10° particle units (pu), about 2 x 10 6 pu, about 4 x 10 6 pu, about 1 x 10 ' pu, about 2 x 10 ' pu, about 4 x 10' pu, about 1 x 10 B pu, about 2 x 10 8 pu, about 4 x 10 8
  • the adenovirus is delivered via multiple doses. [00195] In an embodiment herein, the delivery is via an AAV.
  • a therapeutically effective dosage for in vivo delivery of the AAV to a human is believed to be in the range of from about 20 to about 50 ml of saline solution containing from about I x IQ 1J to about I x I0 1J functional AAV/ml solution.
  • the dosage may be adjusted to balance the therapeutic benefit against any side effects.
  • the AAV dose is generally In the range of concentrations of from about 1 x 10 5 to 1 x 10 50 genomes AAV, from about 1 x 10 8 to 1 x 10"° genomes AAV, from about 1 x 10 i0 to about 1 x 10 i6 genomes, or about 1 x 10 f 1 to about 1 x 10 f 6 genomes AAV.
  • a human dosage may be about 1 x 10 lj genomes AAV. Such concentrations may be delivered in from about 0.001 ml to about 100 ml, about 0.05 to about 50 ml, or about 10 to about 25 ml of a carrier solution. Other effective dosages can be readily established by one of ordinary skill in the art through routine trials establishing dose response curves. See, for example, U.S. Patent No. 8,404,658 B2 to Hajjar, et al, granted on March 26, 2013, at col. 27, lines 45-60.
  • the delivery is via a plasmid.
  • the dosage should be a sufficient amount of plasmid to elicit a response.
  • suitable quantities of plasmid DNA in plasmid compositions can be from about 0. 1 to about 2 mg, or from about I ⁇ 3 ⁇ 4 to about 10 ug.
  • the doses herein are based on an average 70 kg individual.
  • the frequency of administration is within the ambit of the medical or veterinary practitioner (e.g., physician, veterinarian), or scientist skilled in the art.
  • Lentiviruses are complex retroviruses that have the ability to infect and express their genes in both mitotic and post-mitotic cells.
  • the most commonly known lcntivirus is the human immunodeficiency virus (H IV), which uses the envelope glycoproteins of other viruses to target a broad range of cell types.
  • H IV human immunodeficiency virus
  • Lentiviruses may be prepared as follows. After cloning pCasES!O (which contains a lenti viral transfer plasmid backbone), HEK293FT at low passage (p-5) were seeded in a T- 75 flask to 50% confluence the day before transfection in DMEM with 10% fetal bovine serum and without antibiotics. After 20 hours, media was changed to OptiMEM (serum-free) media and transfection was done 4 hours later.
  • Ceils were transfected with 10 iig of lentiviral transfer plasmid (pCasESlO) and the following packaging plasmids: 5 iig of pMD2.G (VSV-g pseudotype), and 7,5ug of psPAX2 (gag/pol/rev/tat). Transfeetion was done in 4mL OptiMEM with a eationie lipid delivery agent (50uL Lipofectamine 2000 and lOOui Plus reagent). After 6 hours, the media was changed to antibiotic-free DMEM with 10% fetal bovine serum.
  • Lenti virus may be purified as follows. Viral supematants were harvested after 48 hours. Supematants were first cleared of debris and filtered through a 0.45um low protein binding (PVDF) filter. They were then spun in a ultracentrifuge for 2 hours at 24,000 rpm. Viraf pellets were resuspended in 50ul of DMEM overnight at 4C. They were then aliquotted and immediately frozen at -80C.
  • PVDF 0.45um low protein binding
  • minimal non-primate lentiviral vectors based on the equine infectious anemia virus are also contemplated, especially for ocular gene therapy (see, e.g., Balagaan, J Gene Med 2006; 8: 275 - 285, Published online 21 November 2005 in Wiley InterScieiice (www.interscience.wiley.com). DOI: 10.1002/jgm.845).
  • EIAV equine infectious anemia virus
  • RetinoStat® an equine infectious anemia virus-based lentiviral gene therapy vector that expresses angiostatic proteins endostain and angiostatin that is delivered via a subretinal injection for the treatment of the web form of age-related macular degeneration
  • RetinoStat® an equine infectious anemia virus-based lentiviral gene therapy vector that expresses angiostatic proteins endostain and angiostatin that is delivered via a subretinal injection for the treatment of the web form of age-related macular degeneration
  • self-inactivating lentiviral vectors with an siRNA targeting a common exon shared by HIV tat/rev, a nucleolar-localizing TAR decoy, and an anti-CCR5- specific hammerhead ribozyme may be used/and or adapted to the CRISPR-Cas system of the present invention.
  • a minimum of 2.5 x 10 6 CD34+ cells per kilogram patient weight may be collected and prestimulated for 16 to 20 hours in X- VIVO 15 medium (Lonza) containing 2mML-glutamine, stem cell factor ( 100 ng/ml), Fit- 3 ligand (Flt-3L) (100 ng/ml), and thrombopoietin (10 ng/ml) (CellGemx) at a density of 2 x 10 6 cells/ml.
  • Prestimulated cells may be transduced with lentiviral at a multiplicity of infection of 5 for 16 to 24 hours in 75-cnr tissue culture flasks coated with fibronectin (25 mg/cm") (Retro Neetm,Takara Bio Inc.).
  • Lentiviral vectors have been disclosed as in the treatment for Parkinson's Disease, see, e.g., US Patent Publication No. 20120295960 and US Patent Nos. 7303910 and 7351585. Lentiviral vectors have also been disclosed for the treatment of ocular diseases, see e.g., US Patent Publication Nos. 20060281 180, 20090007284, US201101 17189; US20090017543; US2G07005496J , US20100317J 09. Lenti viral vectors have also been disclosed for deliveiy to the train, see, e.g., US Patent Publication Nos. US201 10293571; US201 10293571 , US20040013648, US2007G025970, US20090111106 and US Patent No. US7259015.
  • RNA delivery The CRISPR e zyme, for instance a Cas9, a d/or any of the present RNAs, for instance a guide RNA, can also be delivered in the form of RNA.
  • Cas9 mRNA can be generated using in vitro transcription.
  • Cas9 mRNA can be synthesized using a PGR cassette containing the following elements: T7 promoter-kozak sequence (GCCACC)-Cas9-3 ' UTR from beta globin-polyA tail (a string of 120 or more adenines).
  • the cassette can be used for transcription by T7 polymerase.
  • Guide RNAs can also be transcribed using in vitro tra scription from a cassette containing T7_promoter-GG-guide RNA sequence.
  • the CRISPR enzyme and/or guide RNA can be modified using pseudo-U or 5-Methyl-C.
  • mRNA deliveiy methods are especially promising for liver delivery currently.
  • AA.V8 is particularly preferred for delivery to the liver.
  • CRISPR enzyme mRNA and guide RNA may be delivered simultaneously using nanoparticles or lipid envelopes.
  • nanoparticles based on self assembling bioadhesive polymers are contemplated, which may be applied to oral deliveiy of peptides, intravenous deliver ⁇ .' of peptides and nasal delivery of peptides, all to the brain.
  • Other embodiments, such as oral absorption and ocular deliver of hydrophobic drags are also contemplated.
  • the molecular envelope technology involves an engineered polymer envelope which is protected and delivered to the site of the disease (see, e.g., Mazza, M. et al. ACSNano, 2013. 7(2): 1016-1026; Siew, A., et al. Moi Pharm, 2012.
  • nanoparticles that can deliver RNA to a cancer ceil to stop tumor growth developed by Dan Anderson's lab at MIT may be used/and or adapted to the CR1SPR Cas system of the present invention.
  • the Anderson lab developed fully automated, combinatorial systems for the synthesis, purification, characterization, and formulation of new biomaterials and nanoformulations. See, e.g., Alahi et ah, Proc Natl Acad Sci U S A. 2013 Aug 6; 110(32) : 12881 -6; Zhang et al, Adv Mater. 2013 Sep 6;25(33):4641-5; Jiang et al, Na o Lett.
  • US patent application 201 10293703 relates to lipidoid compounds are also particularly useful in the administration of polynucleotides, which may be applied to deliver the CRISPR Cas system of the present invention, in one aspect, the aminoalcohoi lipidoid compounds are combined with an agent to be delivered to a cell or a subject to form microparticles, nanoparticles, liposomes, or micelles.
  • the agent to be delivered by the particles, liposomes, or micelles may be in the form of a gas, liquid, or solid, and the agent may be a polynucleotide, protein, peptide, or small molecule.
  • the minoalcohol lipidoid compounds may be combined with other aminoalcohoi lipidoid compounds, polymers (synthetic or natural), surfactants, cholesterol, carbohydrates, proteins, lipids, etc, to form the particles. These particles may then optionally be combined with a pharmaceutical excipient to form a pharmaceutical composition.
  • US Patent Publication No. 01 10293703 also provides methods of preparing the aminoalcohoi lipidoid compounds.
  • One or more equivalents of an amine are allowed to react with one or more equivalents of an epoxide-termmated compound under suitable conditions to form an aminoalcohol lipidoid compoimd of the present invention, in certain embodiments, all the amino groups of the amine are fully reacted with the epoxide-terminated compound to form tertiary amines.
  • the amino groups of the amine are not fully reacted with the epoxide-terminated compound to form tertiary amines thereby resulting in primary or secondary amines in the aminoalcohol lipidoid compound.
  • These primary or secondary amines are left as is or may be reacted with another electrophile such as a different epoxide-terminated compound.
  • reacting an amine with less than excess of epoxide-terminated compound will result in a plurality of different aminoalcohol lipidoid compounds with various numbers of tails.
  • Certain amines may be fully funetionalizcd with two epoxide-derived compound tails while other .molecules will not be completely functionalized with epoxide-derived compound tails.
  • a diamine or polyamine may include one, two, three, or four epoxide-derived compound tails off the various amino moieties of the molecule resulting in primary, secondary, and tertiary amines. In certain embodiments, all the amino groups are not fully functionalized.
  • two of the same types of epoxide-terminated compounds are used. In other embodiments, two or more different epoxide- terminated compounds are used.
  • the synthesis of the aminoalcohol lipidoid compounds is performed with or without solvent, and the synthesis may be performed at higher temperatures ranging from 30.-100 C, preferably at approximately 50.-90 C.
  • the prepared aminoalcohol lipidoid compounds may be optionally purified.
  • the mixture of aminoalcohol lipidoid compounds may be purified to yield an aminoalcohol lipidoid compound with a particular number of epoxide-derived compound tails. Or the mixture may be purified to yield a particular stereo- or regioisomer.
  • the aminoalcohol lipidoid compounds may also be alkylated using an alky! halide (e.g., methyl iodide) or other alkylating agent, and/or they may be acylated.
  • US Patent Publication No. 0110293703 also provides libraries of aminoalcohol lipidoid compounds prepared by the inventive methods. These aminoalcohol lipidoid compounds may be prepared and/or screened using high-throughput techniques involving liquid handlers, robots, microliter plates, computers, etc. In certain embodiments, the aminoalcohol lipidoid compounds are screened for their ability to transfect polynucleotides or other agents (e.g., proteins, peptides, small molecules) into the cell.
  • agents e.g., proteins, peptides, small molecules
  • US Patent Publication No. 20130302401 relates to a class of poly(beta-amino alcohols) (PBAAs) has been prepared using combinatorial polymerization.
  • PBAAs poly(beta-amino alcohols)
  • the inventive PBAAs may be used in biotechnology and biomedical applications as coatings (such as coatings of films or multilayer films for medical devices or implants), additives, materials, excipients, non- biofouling agents, micropatteming age ts, and cellular encapsulation agents.
  • these PES A As elicited different levels of inflammation, both in vitro and in vivo, depending on their chemical structures.
  • the large chemical diversity of this class of materials allowed us to identify polymer coatings that inhibit macrophage activation in vitro.
  • these coatings reduce the recruitment of inflammatory cells, and reduce fibrosis, foi lowing the subcutaneous implantation, of carboxylated polystyrene microparticles.
  • These polymers may be used to form polyelectrolyte complex capsules for cell encapsulation.
  • the invention may also have many other biological applications such as antimicrobial coatings, DNA or siRNA. delivery, and stem cel l tissue engineering.
  • US Patent Publication No. 20130302401 may be applied to the CRISPR Cas system of the present invention.
  • lipid nanoparticles are contemplated.
  • an antitransthyretin small interfering RNA encapsulated in lipid nanoparticles may be applied to the CRISPR Cas system of the present invention.
  • Doses of about 0.01 to about 1 mg per kg of body weight administered intravenously are contemplated.
  • Medications to reduce the risk of infusion-related reactions are contemplated, such as dexamethasone, acetampinophen, diphenhydramine or cetirizine, and ranitidine are contemplated.
  • Multiple doses of about 0.3 mg per kilogram every 4 weeks for five doses are also contemplated.
  • LNPs have been shown to be highly effective in delivering siRNAs to the liver (see, e.g., Tabemero et a!,, Cancer Discovery, April 2013, Vol. 3, No. 4, pages 363-470) and are therefore contemplated for delivering CRISPR Cas to the liver.
  • a dosage of about four doses of 6 mg/kg of the LNP every two weeks may be contemplated.
  • Tabemero et al. demonstrated that tumor regression was observed after the first 2 cycles of LNPs dosed at 0.7 mg kg, and by the end of 6 cycles the patient had achieved a partial response with complete regression of the lymph node metastasis and substantial shrinkage of the liver tumors.
  • the charge of the LNP must be taken into consideration.
  • cationic lipids combined wit negatively charged lipids to induce rsonbi Saver structures that facilitate intracellular delivery.
  • ionizable cationic lipids with pKa values below 7 were developed (see, e.g., Rosin et ai, Molecular Therapy, vol. 19, no. 12, pages 1286-2200, Dec. 201 1).
  • Negatively charged polymers such as siRNA oligonucleotides may be loaded into LNPs at low pH values (e.g., pH 4) where the ionizable lipids display a positive charge.
  • the LNPs exhibit a low surface charge compatible with longer circulation times.
  • ionizable cationic lipids have been focused upon, namely 1 ,2-dilineoyl ⁇ 3- dimethylammonium-propane (DLinDAP), l,2-dilinoleyloxy-3-N,N-dimethylaminopropane (DLinDMA), 1 ,2-diliiioleyloxy ceto-N,N-dimethyi-3-aminopropaiie (DLinKDMA), and 1 ,2- dilinoleyl-4-(2-dimethylaminoethyl)-[l ,3]-dioxolane (DLinKC2-DMA).
  • DLinDAP ,2-dilineoyl ⁇ 3- dimethylammonium-propane
  • DLinDMA l,2-dilinoleyloxy-3-N,N-dimethylaminopropane
  • LNP siRNA systems containing these lipids exhibit remarkably different gene silencing properties in iiepatocytes in vivo, with potencies varying according to the series DLinKC2- DMA>DLm DMA>DLinDMA>>DLinDAP employing a Factor VI] gene silencing model (see, e.g., Rosin et ai, Molecular Therapy, vol. 19, no. 12, pages 1286-2200, Dec. 201 1).
  • a dosage of 1 ⁇ ' ⁇ ! levels may be contemplated, especially for a formulation containing DLin C2-DMA.
  • Preparation of LN Ps and CRISPR Cas encapsulation may be used/and or adapted from Rosin et al, Molecular Therapy, vol. 19, no. 12, pages 1286-2200, Dec. 201 1).
  • the cationic lipids 1 ,2-di lineoyl-3-dimethylammonium-propaiie (DLinDAP), 1 ,2-dilinoley]oxy ⁇ 3 ⁇ N,N ⁇ dimethylaminopropane (DLinDMA), 1 ,2-dilinoleyioxyketo-N,N-dimethyi-3-aminopropane (DLinK-DMA), l ,2-dilinoleyl-4-(2-dimethylaminoethyl)-[l ,3]-dioxolane (DLinKC2-DMA), (3- o-[2 " -(methoxypolyethyleneglycol 2000) succinoyl]-] ,2-dimyristoyl
  • Cholesterol may be purchased from Sigma (St Louis, MO).
  • the specific CRISPR Cas RNA may be encapsulated in LNPs containing DLinDAP, DLinDMA, DLinK-DMA, and DLin .C2-DMA (cationic lipid:DSPC:CHOL: PEGS-DMG or PEG-C-DOMG at 40: 10:40: 10 molar ratios).
  • 0.2% SP-DiOC1 8 Invitrogen, Burlington, Canada
  • Encapsulation may be performed by dissolving lipid mixtures comprised of cationic lipid:DSPC:cholesterol:PEG-c-DOMG (40: 10:40: 10 molar ratio) in ethanol to a final lipid concentratioii of 10 mmol/l.
  • This ethanol solution of lipid may be added drop-wise to 50 mmol/l citrate, pH 4.0 to form multilamellar vesicles to produce a final concentration of 30% ethanol vol/vol.
  • Large unilamellar vesicles may be formed following extrusion of multilamellar vesicles through two stacked 80 nm Nuclepore polycarbonate filters using the Extruder (Northern Lipids, Vancouver, Canada).
  • Encapsulation may be achieved by adding RNA dissolved at 2 mg ml in 50 mmol/l citrate, pH 4.0 containing 30% ethanol vol/vol drop-wise to extruded preformed large unilamellar vesicles and incubation at 31 °C for 30 minutes with constant mixing to a final RNA/lipid weight ratio of 0.06/1 wt/wt. Removal of ethanol and neutralization of formulation buffer were performed by dialysis agai st phosphate -buffered saline (PBS), pH 7.4 for 16 hours using Spectra/Por 2 regenerated cellulose dialysis membranes.
  • PBS dialysis agai st phosphate -buffered saline
  • Nanoparticle size distribution may be determined by dynamic light scatteri g usi g a NICOMP 370 particle sizer, the vesicle/intensity modes, and Gaussian fitting (Nicomp Particle Sizing, Santa Barbara, CA).
  • the particle size for all three LNP systems may be ⁇ 70 nm in diameter.
  • siRNA encapsulation efficiency may be determined by removal of free siRNA using VivaPureD iniH columns (Sartorius Stedim Biotech) from samples collected before and after dialysis. The encapsulated RNA may be extracted from the eluted nanoparticles and quantified at 260 nm.
  • siRNA to lipid ratio was determined by measurement of cholesterol content in vesicles using the Cholesterol E enzymatic assay from Wako Chemicals LISA (Richmond, VA).
  • Preparation of large LNPs may be used/and or adapted from Rosin et al, Molecular Therapy, vol. 19, no. 12, pages 1286-2200, Dec. 201 1.
  • a lipid prcmix solution (20.4 mg/ml total lipid concentration) may be prepared in ethanol containing DLinKC2 ⁇ DMA, DSPC, and cholesterol at 50: 10:38.5 molar ratios.
  • Sodium acetate may be added to the lipid premix at a molar ratio of 0.75:1 (sodium acetate:DLinKC2-DMA).
  • the lipids may be subsequently hydrated by combining the mixture with 1.85 volumes of citrate buffer (10 mmol/l, pH 3.0) with vigorous stirring, resulting in spontaneous liposome formation in aqueous buffer containing 35% ethanol.
  • the liposome solution may be incubated at 37 °C to al low for time-dependent increase in particle size, Aliquots may be removed at various times during incubation to investigate changes in liposome size by dynamic light scattering (Zeiasizer Nano ZS, Malvern Instruments, Worcestershire, UK).
  • RNA may then be added to the empty liposomes at an siRNA to total lipid ratio of approximately 1 :10 (wt:wt), followed by incubation for 30 minutes at 37 °C to form loaded LNPs.
  • the mixture may be subsequently dialyzed overnight in PBS and filtered with a 0.45- ⁇ syringe filter.
  • Spherical Nucleic Acid (SNATM) constructs and other nanoparticles (particularly gold nanoparticles) are also contemplate as a means to delivery CRJSPR/Cas system to intended targets.
  • Significant data show that AuraSense Therapeutics' Spherical Nucleic Acid (SNATM) constructs, based upon nucleic acid-functionalized gold nanoparticles, are superior to alternative platforms based on multiple key success factors, such as:
  • the constructs can enter a variety of cultured cells, primary cells, and tissues with no apparent toxicity.
  • nucleic acid-based therapeutics may be applicable to numerous disease states, including inflammation and infectious disease, cancer, skin disorders and cardiovascular disease.
  • Citable literature includes: Cutler et al.,. J. Am. Chem, Soc, 2011 133:9254-9257, Hao et al, Small. 2011 7:3158-3162, Zhang et al, ACS Nano. 2011 5:6962-6970, Cutler et al, J. Am. Chem. Soc. 2012 134: 1376-1391, Young et al.,. Nano Lett. 2012 12:3867-71, Zheng et al,, Proc. Natl. Acad. Sci. USA. 2012 109:11975-80, Mirkin, Nanomedicine 2012 7:635-638 Zhang et al., J. Am. Chem. Soc.
  • Self-assembling nanoparticles with siRNA may be constructed with polyethyieneimine (PEI) that is PEGvlated with an Arg-Gly-Asp (RGD) peptide ligand attached at the distal end of the polyethylene glycol (PEG), for example, as a means to target tumor iieovasculature expressing integrins and used to deliver siRNA inhibiting vascular endothelial growth factor receptor-2 (VEGF 2) expression and thereby tumor angiogenesis (see, e.g., Schiffelers et al., Nucleic Acids Research, 2004, Vol. 32, No. 19).
  • PEI polyethyieneimine
  • RGD Arg-Gly-Asp
  • VEGF 2 vascular endothelial growth factor receptor-2
  • Nanoplexes may be prepared by mixing equal volumes of aqueous solutions of cationic polymer and nucleic acid to give a net molar excess of ionizable nitrogen (polymer) to phosphate (nucleic acid) over the range of 2 to 6.
  • the electrostatic interactions between cationic polymers and nucleic acid resulted in the formation of polyp lex es with average particle size distribution of about 100 nm, hence referred to here as nanoplexes.
  • a dosage of about 100 to 200 mg of CRISPR Cas is envisioned for deliver)? in the self-assembling nanoparticles of Schiffelers et al.
  • the nanoplexes of Bartlett et al. may also be applied to the present invention.
  • the nanoplexes of Bartlett et al. are prepared by mixing equal volumes of aqueous solutions of cationic polymer and nucleic acid to give a net molar excess of ionizable nitrogen (polymer) to phosphate (nucleic acid) over the range of 2 to 6.
  • the electrostatic interactions between cationic polymers and nucleic acid resulted in the formation of poly lexes with average particle size distribution of about 100 nm, hence referred to here as nanoplexes.
  • the DOTA-siRNA of Bartlett et al was synthesized as follows: 1,4,7,10- tetraazacyclododecane- 1 ,4,7, 10-tetraacetic acid mono(N-hydroxysuccinimide ester) (DOTA- NHSester) was ordered from Macrocyclics (Dallas, TX). The amine modified RNA sense strand with a 100-fold molar excess of DOTA-NHS-ester in carbonate buffer (pH 9) was added to a microcentrifuge tube. The contents were reacted by stirring for 4 h at room temperature.
  • the DOTA-RNAsense conjugate was ethanoi-preeipitated, resuspended in water, and annealed to the unmodified antisense strand to yield DGTA -siRNA. All liquids were pretreated with Chelex-100 (Bio-Rad, Hercules, CA) to remove trace metal contaminants. Tf-targeted and nontargeted siRNA nanoparticles may be formed by using cydodextrin-containing polycations. Typically, nanoparticles were formed in water at a charge ratio of 3 (+/-) and an siRNA concentration of 0.5 g/liter.
  • adamantane-PEG molecules on the surface of the targeted nanoparticles were modified with Tf (adamantane-PEG-Tf).
  • the nanoparticles were suspended in a 5% (wt/vol) glucose carrier solution for injection.
  • the nanoparticles consist of a synthetic delivery system containing: (1) a linear, cyciodextrin- based polymer (CDP), (2) a human transferrin protein (TF) targeting ligand displayed on the exterior of the nanoparticle to engage TF receptors (TFR) on the surface of the cancer cells, (3) a hydrophilic polymer (polyethylene glycol (PEG) used to promote nanoparticle stability in biological fluids), and (4) siRNA designed to reduce the expression of the RRM2 (sequence used in the clinic was previously denoted sl R.2B ⁇ 5 ).
  • the TFR has long been known to be upregulated in malignant ceils, and RRM2 is an established anti-cancer target.
  • nanoparticles (clinical version denoted as CALAA-01 ) have been shown to be well tolerated in multi-dosing studies in non-human primates.
  • Davis et al .'s clinical trial is the initial human trial to systemically deliver siRNA with a targeted delivery system and to treat patients with solid cancer.
  • Davis et al. investigated biopsies from three patients from three different dosing cohorts; patients A, B and C, all of whom had metastatic melanoma and received CALAA-01 doses of 18, 24 and 30 mg m " siRNA, respectively.
  • CRISPR Cas system of the present invention Similar doses may also be contemplated for the CRISPR Cas system of the present invention.
  • the delivery of the invention may be achieved with nanoparticles containing a linear, cyclodextrin -based polymer (CDP), a human transferrin protein (TF) targeting ligand displayed on the exterior of the nanoparticle to engage TF receptors (TFR) on the surface of the cancer cells and/or a hydrophilic polymer (for example, polyethylene glycol (PEG) used to promote nanoparticle stability in biological fluids).
  • CDP linear, cyclodextrin -based polymer
  • TF human transferrin protein
  • TFR TF receptors
  • hydrophilic polymer for example, polyethylene glycol (PEG) used to promote nanoparticle stability in biological fluids
  • Exosomes are endogenous nano-vesicles that transport R ' NAs and proteins which can deliver short interfering (si)RNA to the brain in mice.
  • siRNA short interfering
  • RVG-targeted exosomes delivered GAPDH siRNA specifically to neurons, microglia, oligodendrocytes in the brain, resulting in a specific gene knockdown. Pre-exposure to RVG exosomes did not attenuate knockdown, and non-specific uptake in other tissues was not observed. The therapeutic potential of exosome-mediated siRNA delivery was demonstrated by the strong mRNA (60%) and protein (62%) knockdown of BACE l, a therapeutic target in Alzheimer's disease.
  • exosomes produced were physically homogenous, with a size distribution peaking at 80 nm in diameter as determined by nanoparticle tracking analysis (NTA) and electron microscopy.
  • NTA nanoparticle tracking analysis
  • Alvarez-Erviti et al. obtained 6-12 iig of exosomes (measured based on protein concentration) per 10 6 cel ls.
  • siRNA- RVG exosomes induced immune responses in vivo by assessing IL-6, IP- 10, TNFa and IFN-a serum concentrations.
  • siNA-RVG exosome treatment nonsignificant changes in all cytokines were registered similar to siRNA-transfection reagent treatment in contrast to siRNA-RVG-9R, which potentl stimulated I L-6 secretion, confirming the immunologically inert profile of the exosome treatment.
  • exosomes encapsulate only 20% of siRNA
  • delivery with RVG-exosome appears to be more efficient than RVG-9R deliver ⁇ ' as comparable mRNA knockdown and greater protein knockdown was achieved with fivefold less siRNA without the corresponding level of immune stimulation.
  • This experiment demonstrated the therapeutic potential of RVG- exosome technology, which is potentially suited for long-term silencing of genes related to neurodegenerative diseases.
  • the exosome delivery system of Alvarez-Erviti et al. may be applied to deliver the CRISPR-Cas system of the present invention to therapeutic targets, especially neurodegenerative diseases.
  • a dosage of about 100 to 1000 mg of CRISPR Cas encapsulated in about 100 to 1000 mg of RVG exosomes may be contemplated for the present invention.
  • El-Andaloussi et al. discloses how exosomes derived from cultured cells can be harnessed for delivery of siRNA in vitro and in vivo. This protocol first describes the generation of targeted exosomes through transfection of an expressio vector, comprising an exosomal protein fused with a peptide ligand. Next, El-Andaloussi et al, explain how to purify and characterize exosomes from traiisfected ceil supernata t. Next, El- Andaloussi et al, detail crucial steps for loading siRNA into exosomes. Finally, El-Andaloussi et al.
  • exosome-mediated siRNA delivery is evaluated by functional assays and imaging.
  • the entire protocol takes ⁇ 3 weeks. Delivery or administration according to the invention may be performed using exosomes produced from self- derived dendritic cells.
  • the plasma exosomes of Wahlgren et al. are contemplated.
  • Exosomes are nano-sized vesicles (30- 90nm in size) produced by many cell types, including dendritic cells (DC), B cells, T cells, mast cells, epithelial cells and tumor cells. These vesicles are formed by inward budding of late endosomes and are then released to the extracellular environment upon fusion with the plasma membrane. Because exosomes naturally cany RNA between cells, this property might be useful in gene therapy.
  • Exosomes from plasma are prepared by centrifugation of buffy coat at 900g for 20 min to isolate the plasma followed by harvesting ceil supernata ts, centrifuging at 300g for 10 min to eliminate cells and at 16 500g for 30 min followed by filtration through a 0.22 mm filter. Exosomes are pelleted by ultracentrifugation at 120 OOOg for70 min. Chemical transfection of siRNA into exosomes is carried out according to the manufacturer's instructions in RNAi Human Mouse Starter Kit (Quiagen, Hilden, Germany). siRNA is added to 100 ml PBS at a final concentration of 2 mmol/ml.
  • exosomes are re- isolated using aldehyde/ sulfate latex beads.
  • the chemical transfection of CRISPR Cas into exosomes may be conducted similarly to siRNA.
  • the exosomes may be co-cultured with monocytes and lymphocytes isolated from the peripheral blood of healthy donors. Therefore, it may be contemplated that exosomes containing CRISPR Cas may be introduced to monocytes and lymphocytes of and autologously reintroduced into a human. Accordingly, delivery or administration according to the invention may beperformed using plasma exosomes.
  • Liposomes are spherical vesicle structures composed of a uni- or multilamellar lipid bi!ayer surrounding internal aqueous compartments and a relatively impermeable outer lipophilic phospholipid bilayer. Liposomes have gained considerable attention as drug delivery carriers because they are biocompatible, nontoxic, can deliver both hydrophilic and lipophilic drug molecules, protect their cargo from degradation by plasma enzymes, and transport their load across biological membranes and the blood brain barrier (BBB) (see, e.g., Spuch and Navarro, journal of Drug Delivery, vol. 201 1 , Article ID 469679, 12 pages, 2011. doi: 10.1155/2011/469679 for review).
  • BBB blood brain barrier
  • Liposomes can be made from several different types of lipids; however, phospholipids are most commonly used to generate liposomes as drug carriers. Although liposome formation is spontaneous when a lipid film is mixed with an aqueous solution, it can also be expedited by applying force in the form of shaking by using a homogenizer, sonicator, or an extrusion apparatus (see, e.g., Spuch and Navarro, Journal of Drug Deliver ⁇ ', vol. 2011. Article ID 469679, 12 pages, 2011. doi: 10.1155/201 1/469679 for review).
  • liposomes may be added to liposomes in order to modify their structure and properties.
  • either cholesterol or sphingomyelin may be added to the liposomal mixture in order to help stabilize the liposomal structure and to prevent the leakage of the liposomal inner cargo.
  • liposomes are prepared from hydrogenated egg phosphatidylcholine or egg phosphatidylcholine, cholesterol, and dicetyl phosphate, and their mean vesicle sizes were adjusted to about 50 and 100 nm. (see, e.g., Spuch and Navarro, Journal of Drag Delivery, vol. 201 1 , Article ID 469679, 12 pages, 2011. doi: 10.1 155/2011/469679 for review).
  • Addition of cholesterol to conventional formulations reduces rapid release of the encapsulated bioactive compound into the plasma or l,2-dioleoyl-sn-giyeero-3- phosphoethanolamine (DOPE) increases the stability (see, e.g., Spuch and Navarro, Journal, of Drug Delivery, vol. 2011, Article ID 469679, 12 pages, 2011. doL IG. l 155/2011/469679 for review).
  • DOPE l,2-dioleoyl-sn-giyeero-3- phosphoethanolamine
  • Trojan Horse liposomes also known as Molecular Trojan Horses
  • These particles allow delivery of a transgene to the entire brain after an intravascular injection. Without, being bound by limitation, it is believed that neutral lipid particles with specific antibodies conjugated to surface allow crossing of the blood brain barrier via endocytosis.
  • Applicant postulates utilizing Trojan Horse Liposomes to deliver the C ISPR family of nucleases to the brain via an intravascular injection, which would allow whole brain transgenic animals without the need for embryonic manipulation. About 1 -5 g of DNA may be contemplated for in vivo administration in liposomes.
  • the CRISPR Cas system may be administered in liposomes, such as a stable nucleic-acid-lipid particle (SNALP) (see, e.g., Morrissey et al., Nature Biotechnology, Vol. 23, No. 8, August 2005).
  • SNALP stable nucleic-acid-lipid particle
  • Daily intravenous injections of about 1, 3 or 5 mg/kg/day of a specific CRISPR Cas targeted in a SNALP are contemplated.
  • the daily treatment may be over about, three days and then weekly for about five weeks.
  • a specific CRISPR Cas encapsulated SNALP administered by intravenous injection to at doses of abpit 1 or 2.5 rng/ ' kg are also contemplated (see, e.g., Zimmerman et al., Nature Letters, Vol. 441, 4 May 2006).
  • the SNALP formulation may contain the lipids 3-N- [(wmethoxypoly(ethylene glycol) 2000) carbamoyl] -1 ,2-dimyristyloxy-propyiamine (PEG-CDMA), 1 ,2-dilinoIeyloxy-N,N-dimethyI-3-aminopropane (DLinDMA), 1 ,2-distearoy -sn- glycero-3-phosphocholine (DSPC) and cholesterol, in a 2:40:10:48 molar per cent ratio (see, e.g., Zimmerman et al., Nature Letters, Vol. 44.1 , 4 May 2006).
  • SNALPs stable nucleic-acid-lipid particles
  • the SNALP liposomes may be prepared by formulating D-Lin-DMA and PEG-C-DMA with distearoylphosphatidylcholme (DSPC), Cholesterol and siRNA using a 25: 1 lipid/siRNA ratio and a 48/40/10/2 molar ratio of Cholestero!/D-Lin-DMA DSPC/PEG-C-DMA.
  • the resulted SNALP liposomes are about 80-100 nm in size.
  • a SNALP may comprise synthetic cholesterol (Sigma- Aldric , St Louis, MO, USA), dipalmitoylphosphatidylcholine (Avanti Polar Lipids, Alabaster, AL, USA), 3-N-[(w-methoxy polyethylene glycol )2000)carbamo l]- 1 ,2- dimyrestyloxypropylamine, and cationic l,2-dilinoleyioxy-3-N,Ndimethylammopropane (see, e.g., Geisbert et al, Lancet 2010; 375: 1896-905).
  • a dosage of about 2 mg kg total CRISPR Cas per dose administered as, for example, a bolus intravenous infusion may be contemplated.
  • a SN ALP may comprise synthetic cholesterol (Sigma- Aidrich), l,2-distearoyl-sn-glycero-3-phosphocholine (DSPC; Avanti Polar Lipids Inc.), PEG- cDMA, and l,2-dilmoleyloxy-3-(N;N-dimethyl)aminopropane (DLinDMA) (see, e.g., Judge, J. Clin. Invest. 1 19:661-673 (2009)).
  • Formulations used for in vivo studies may comprise a final lipid/RNA mass ratio of about 9: 1.
  • the stable nucleic acid lipid particle is comprised of four different lipids— an ionizable lipid (DLinDMA) that is cationic at low H, a neutral helper lipid, cholesterol, and a diffusible polyethylene glycol (PEG)-iipid.
  • DLinDMA ionizable lipid
  • PEG polyethylene glycol
  • the particle is approximately 80 nm in diameter and is charge-neutral at physiologic pH.
  • the ionizable lipid serves to condense lipid with the anionic siRNA during particle formation.
  • the ionizable lipid When positively charged under increasingly acidic endosomal conditions, the ionizable lipid also mediates the fusion of SNALP with the endosomal membrane enabling release of siRNA into the cytoplasm.
  • the PEG-lipid stabilizes the particle and reduces aggregation during formulation, and subsequently provides a neutral hydrophiiic exterior that improves pharmacokinetic properties.
  • ALN-TTR01 which employs the SNALP technology described above and targets hepatocyte production of both mutant and wild- type TTR to treat TTR amyloidosis (ATTR).
  • TTR amyloidosis TTR amyloidosis
  • FAP familial amyloidotic polyneuropathy
  • I AC familial amyloidotic cardiomyopathy
  • SSA senile systemic amyloidosis
  • ALN-TTROl was administered as a 15- minute IV infusion to 31 patients (23 with study drag and 8 with placebo) within a dose range of 0.01 to 1.0 mg/kg (based on siRNA). Treatmentwaswel! tolerated with no significant increases in liver function tests. Infusion-related reactions were noted in 3 of 23 patients at>0.4 mg kg; all responded to slowing of the infusion rate and all continued on study. Minimal and transient elevations of serum cytokines IL-6, IP- 10 and IL-lra were noted in two patients at the highest dose of 1 mg/kg (as anticipated from preclinical and NHP studies). Lowering of serum TTR, the expected pharmacodynamics effect of ALN-TTROl, was observed at 1 mg/kg.
  • a SNALP may be made by solubilizing a cationic lipid, DSPC, cholesterol and PEG-iipid were solubilized in ethanol at a molar ratio of 40: 10:40: 10, respectively (see, Semple et al., Nature Niotechnology, Volume 28 Number 2 February 2010, pp. 172-177).
  • the lipid mixture was added to an aqueous buffer (50 raM citrate, pH 4) with mixing to a final ethanol and lipid concentration of 30% (vol/vol) and 6.1 mg/ml, respectively, and allowed to equilibrate at 22 °C for 2 min before extrusion.
  • the hydrated lipids were extruded through two stacked 80 nm pore-sized filters (Nuclepore) at 22 °C using a Lipex Extruder (Northern Lipids) until a vesicle diameter of 70-90 nm, as determined by dynamic light scattering analysis, was obtained. This generally required 1-3 passes.
  • the siRNA (solubilized in a 50 mM citrate, pH 4 aqueous solution containing 30% ethanol) was added to the pre- equilibrated (35 °C) vesicles at a rate of ⁇ 5 ml/min with mixing.
  • siRNA/lipid ratio 0.06 (wt/wt) was reached, the mixture was incubated for a further 30 min at 35 °C to allo w vesicle reorganization and encapsulation of the siRNA .
  • the ethanol was then removed and the external buffer replaced with PBS (155 mM NaCl, 3 mM Na2HP04, 1 mM KH2P04, pH 7.5) by either dialysis or tangential flow diafiltration.
  • siRNA were encapsulated in SNALP using a controlled step-wise dilution method process.
  • the lipid constituents of KC2-SNALP were DLm-KC2-DMA (eatiome lipid), dipalmitoylphosphatidyleholine (DPPC; Avanti Polar Lipids), synthetic cholesterol (Sigma) and PEG-C-DMA used at a molar ratio of 57,1 :7.1 :34,3: 1.4.
  • SNALP were dialyzed agamst PBS and filter steri lized through a 0.2 ⁇ filter before use.
  • Mean particle sizes were 75-85 nm and 90-95% of the siRNA was encapsulated within the lipid particles.
  • the final siRNA/lipid ratio in formulations used for in vivo testing was—0.15 (wt wt).
  • LNP-siRNA systems containing Factor VII siRNA were diluted to the appropriate concentrations in sterile PBS immediately before use and the formulations were administered intravenously through the lateral tail vein in a total volume of 10 ml/kg. This method may be extrapolated to the CRISPR Cas system of the present invention.
  • cationic lipids such as amino lipid 2,2-dilinoleyl-4 ⁇ dimethylaminoethyI-[l,3]- dioxolane (DLin- C2-DMA) may be utilized to encapsulate CRISPR Cas similar to SiRNA (see, e.g., Jayaraman, Angew. Chem, Int. Ed, 2012, 51, 8529 -8533).
  • a preformed vesicle with the following lipid composition may be contemplated: amino lipid, distearoylphosphatidyl ioline (DSPC), cholesterol and (R)-2,3-bis(octadecyloxy) propyl- 1- (methoxy poly(ethylene glycol)2000)propylcarbamate (PEG-lipid) in the molar ratio 40/10/40/10, respectively, and a FVII siRNA'total lipid ratio of approximately 0.05 (w/w).
  • DSPC distearoylphosphatidyl ioline
  • R -2,3-bis(octadecyloxy) propyl- 1- (methoxy poly(ethylene glycol)2000)propylcarbamate (PEG-lipid) in the molar ratio 40/10/40/10, respectively, and a FVII siRNA'total lipid ratio of approximately 0.05 (w/w).
  • the particles may be extruded up to three times through 80 nm membranes prior to adding the CRISPR Cas RNA.
  • Particles containing the highly potent amino lipid 16 may be used, in which the molar ratio of the four lipid components 16, DSPC, cholesterol and PEG-lipid (50/10/38.5/1.5) which may be further optimized to enhance in vivo activity,
  • lipids may e formulated with the CRISPR Cas system of the present invention to form lipid nanoparticles (LNPs).
  • Lipids include, but are not limited to, DLin- C2 ⁇ DMA4, C12-200 and colipids disteroylphosphatidyl choline, cholesterol, and PEG- DMG may be formulated with CRISPR Cas instead of siRNA (see, e.g., Novobrantseva, Molecular Therapy-Nucleic Acids (2012) 1, c4; doi: 10.1038/mtna.201 1.3) using a spontaneous vesicle formation procedure.
  • the component molar ratio may be about 50/10/38.5/1.5 (DLin- KC2-DMA or C 12-200/disteroyf phosphatidyl cholme/cholesterol PEG-DMG).
  • the final lipid :siRNA weight ratio may be -12: 1 and 9: 1 in the case of DLin-KC2-DMA and C 12-200 lipid nanopartieles (LNPs), respectively.
  • the formulations may have mean particle diameters of ⁇ 80 urn with >90% entrapment efficiency. A 3 mg/kg dose may be contemplated.
  • Tekmira has a portfolio of approximately 95 patent families, in the U.S. and abroad, that are directed to various aspects of LNPs and LNP formulations (see, e.g., U.S. Pat. Nos. 7,982,027; 7,799,565; 8,058,069; 8,283,333; 7,901,708; 7,745,651 ; 7,803,397; 8,101,741 ; 8,188,263; 7,915,399; 8,236,943 and 7,838,658 and European Pat. Nos .1766035; 1519714; 1781593 and 1664316), all of which may be used/and or adapted to the present invention.
  • the CRISPR Cas system may be delivered encapsulated in PLGA Microspheres such as that further described in US published applications 20130252281 and 20130245107 and 20130244279 (assigned to Modema Therapeutics) which relate to aspects of formulation of compositions comprising modified nucleic acid molecules which may encode a protein, a protein precursor, or a partially or fully processed form of the protein or a protein precursor.
  • the formulation may have a molar ratio 50: 10:38.5: 1.5-3.0 (cationic !ipid:fusogemc iipidxholesterobPEG lipid).
  • the PEG lipid may be selected from, but is not limited to PEG-c- DOMG, PEG-DMG.
  • the fusogenic lipid may be DSPC. See also, Schrum et a!., Delivery and Formulation of Engineered Nucleic Acids, US published application 20120251618.
  • Nanomerics' technology addresses bioavailability challenges for a broad range of therapeutics, including low molecular weight hydrophobic drags, peptides, and nucleic acid based therapeutics (piasmid, siRNA, miRNA).
  • Specific administration routes for which the technology has demonstrated clear advantages include the oral route, transport across the blood- brain-barrier, delivery to solid tumours, as well as to the eye. See, e.g., Mazza et al., 2013, ACS Nano. 2013 Feb 26:7(2 ): 101 -26; Uchegbu and Slew, 2013, J Pharm Sci. 102(2):305-10 and Lalatsa et al, 2012, J Control Release. 2012 Jul 20;161(2):523-36.
  • 00260J US Patent Publication No. 20050019923 describes cationic dendrimers for delivering bioactive molecules, such as polynucleotide molecules, peptides and polypeptides and/or pharmaceutical agents, to a mammalian body.
  • the dendrimers are suitable for targeting the delivery of the bioactive molecules to, for example, the liver, spleen, lung, kidney or heart.
  • Dendrimers are synthetic 3-dimensional maeromolecules that are prepared in a step-wise fashion from simple branched monomer units, the nature and functionality of which can be easily controlled and varied.
  • Dendrimers are synthesised from the repeated addition of building blocks to a multifunctional core (divergent approach to synthesis), or towards a multifunctional core (convergent approach to synthesis) and each addition of a 3-dimensional shell of building blocks leads to the formation of a higher generation of the dendrimers.
  • Polypropylenimine dendrimers start from a diaminobutane core to which is added twice the number of amino groups by a double Michael addition of aerylonitrile to the primary amines followed by the hydrogenation of the nitriies. This results in a doubling of the amino groups.
  • Polypropylenimine dendrimers contai 100% protonable nitrogens and up to 64 terminal amino groups (generation 5, DAB 64).
  • Protoiiable groups are usually amine groups which are able to accept protons at neutral pH.
  • the use of dendrimers as gene deli very agents has l argely focused on the use of the polyamidoamine. and phosphorous containing compounds with a mixture of amine/amide or N--P(0 2 )S as the conjugating units respectively with no work being reported on the use of the lower generation polypropylenimine dendrimers for gene delivery.
  • Polypropylenimine dendrimers have also been studied as pH sensitive controlled release systems for drug delivery and for their encapsulation of guest molecules when chemically modified by peripheral amino acid groups. The cytotoxicity and interaction of polypropylenimine dendrimers with DNA as well as the transfection efficacy of DAB 64 has also been studied.
  • US Patent Publication No. 20050019923 is based upon the observation that, contrary to earlier reports, cationic dendrimers, such as polypropylenimine dendrimers, display suitable properties, such as specific targeting and low toxicity, for use in the targeted delivery of bioactive molecules, such as genetic material. In addition, derivatives of the cationic dendrimer also display suitable properties for the targeted delivery of bioactive molecules.
  • Supercharged proteins are a class of engineered or naturally occurring proteins with unusually high positive or negative net theoretical charge. Both supe negatively and superpositiveiy charged proteins exhibit a remarkable ability to withstand thermally or chemically induced aggregation. Superpositiveiy charged proteins are also able to penetrate mammalian cells. Associating cargo with these proteins, such as plasmid DNA, siRNA, or other proteins, can enable the functional delivery of these macromoiecules into mammalian cells both in vitro and in vivo. David Liu's lab reported the creation and characterization of supercharged proteins in 2007 (Lawrence et ah, 2007, Journal of the American Chemical Society 129, 101 10- 10112).
  • +36 GFP is an effective plasmid delivery reagent in a range of cells.
  • plasmid DNA is a larger cargo than siRNA, proportionately more +36 GFP protein is required to effectively complex p!asmids.
  • Applicants have developed a variant of +36 GFP bearing a C-terminal HA2 peptide tag, a known endosome-disrupting peptide derived from the influenza virus hemagglutinin protein. The following protocol has been effective in a variety of cells, but as above it is advised that plasmid DNA and supercharged protein doses be optimized for specific cell lines and delivery applications.
  • implantable devices are also contemplated for delivery of the CRISPR Cas system.
  • US Patent Publication 201 10195123 discloses an implantable medical device which elutes a drug locally and in prolonged period is provided, including several types of such a device, the treatment modes of implementation and methods of implantation.
  • the device comprising of polymeri c substrate, such as a matrix for exampl e, that is used as the device body, and dmgs, and in some cases additional scaffolding materials, such as metals or additional polymers, and materials to enhance visibility and imaging.
  • RNA interference RNA interference
  • si RJN A si RJN A
  • sh RNA sh RNA
  • antisense RNA/DNA ribozyme and nucleoside analogs. Therefore, this system may be used/and or adapted to the CRISPR Cas system of the present invention.
  • the modes of implantation i some embodiments are existing implantation procedures that are developed and used today for other treatments, including brachytherapy and needle biopsy. In such cases the dimensions of the new implant described in this invention are similar to the original implant. Typical ly a few devices are implanted during the same treatment procedure.
  • a drug delivery implantable or insertable system including systems applicable to a cavity such as the abdominal cavity and/or any other type of administration in which the drug delivery system is not anchored or attached, comprising a biostable and/or degradable and/or bioabsorbable polymeric substrate, which may for example optionally be a matrix. It should be noted that the term "insertion” also includes implantation.
  • the drug delivery system is preferably implemented as a " Loder" as described in US Patent Publication 201 10195 123.
  • the polymer or plurality of polymers are biocompatible, incorporating an agent and/or plurality of agents, enabling the release of agent at a controlled rate, wherein the total volume of the polymeric substrate, such as a matrix for example, in some embodiments Is optionally and preferably no greater than a maximum volume that permits a therapeutic level of the agent to be reached. As a non-limiting example, such a volume is preferably within the range of 0.1 nr to 1000 mm " , as required by the volume for the agent load.
  • the Loder may optionally be larger, for example when incorporated with a device whose size is determined by functionality, for example and without limitation, a knee joint, an infra-uterine or cervical ring and the like,
  • the drug delivery system (for delivering the composition) is designed in some embodiments to preferably employ degradable polymers, wherei the main release mechanism is bulk erosion; or in some embodiments, non degradable, or slowly degraded polymers are used, wherein the main release mechanism is diffusion rather than bulk erosion, so that the outer part functions as membrane, and its internal part functions as a drug reservoir, which practically is not affected by the surroundings for an extended period (for example from about a week to about a few months). Combinations of different polymers with different release mechanisms may also optionally be used.
  • the concentration gradient at the surface is preferably maintained effectively constant during a significant period of the total drug releasing period, a d therefore the diffusion rate is effectively constant (termed "zero mode" diffusion).
  • constant it is meant a diffusion rate that is preferably maintained above the lower threshold of therapeutic effectiveness, but which may still optionally feature an initial burst and/or fluctuate, for example increasing and decreasing to a certain degree.
  • the diffusion rate is preferably so maintained for a prolonged period, and it can be considered constant to a certain level to optimize the therapeutically effective period, for example the effective silencing period.
  • the drug delivery system optionally and preferably is designed to shield the nucleotide based therapeutic agent from degradation, whether chemical in nature or due to attack from enzymes and other factors in the body of the subject,
  • the drug delivery system as described in US Patent Publication 201 10195123 is optionally associated with sensing and/or activation appliances that are operated at and/or after implantation of the device, by non and/or minimally invasive methods of activation and/or acceleration/deceleration, for example optionally including but not limited to thermal heating and cooling, laser beams, and ultrasonic, including focused ultrasound and/or RF (radiofrequency) methods or devices.
  • sensing and/or activation appliances that are operated at and/or after implantation of the device, by non and/or minimally invasive methods of activation and/or acceleration/deceleration, for example optionally including but not limited to thermal heating and cooling, laser beams, and ultrasonic, including focused ultrasound and/or RF (radiofrequency) methods or devices.
  • the site for local deliver ⁇ ' may optionally include target sites characterized by high abnormal proliferation of cells, and suppressed apoptosis, including tumors, active and or chronic inflammation and infectio including autoimmune diseases states, degenerating tissue including muscle and nervous tissue, chronic pain, degenerative sites, and location of bone fractures and other wound locations for enhancement of regeneration of tissue, and injured cardiac, smooth and striated muscle.
  • the site for local deliver ⁇ .' also may optionally include sites enabling performing preventive activities including pregnancy, prevention of infection and aging.
  • the site for implantatio of the composition, or target site preferably features a radius, area and/or volume that is sufficiently small for targeted local delivery.
  • the target site optionally has a diameter in a range of from about 0.1 mm to about 5 cm.
  • the location of the target site is preferably selected for maximum therapeutic efficacy.
  • the composition of the drug delivery system (optionally with a device for implantation as described above) is optionally and preferably implanted within or in the proximity of a tumor environment, or the blood supply associated thereof.
  • composition (optionally with the device) is optionally implanted within or in the proximity to pancreas, prostate, breast, liver, " via the nipple, within the vascular system and so forth.
  • the target location is optionally selected from the group consisting of (as non- limiting examples only, as optionally any site within the body may be suitable for implanting a Loder): 1. brain at degenerative sites like in Parkinson or Alzheimer disease at the basal ganglia, white and gray matter; 2. spine as in the case of amyotrophic lateral sclerosis (ALS); 3. uterine cervix to prevent HPV infection; 4. active and chronic inflammatory joints; 5. dermis as i the case of psoriasis; 6. sympathetic and sensoric nervous sites for analgesic effect; 7. Intra osseous implantation; 8. acute and chronic infection sites; 9. Intra vagi al; 10.
  • ALS amyotrophic lateral sclerosis
  • uterine cervix to prevent HPV infection
  • active and chronic inflammatory joints 5. dermis as i the case of psoriasis; 6. sympathetic and sensoric nervous sites for analgesic effect; 7. Intra osseous implantation; 8. acute and chronic infection sites; 9. Intr
  • Inner ear auditory system, labyrinth of the inner ear, vestibular system; 11. Intra tracheal; 12. Intra-cardiac; coronary, epicardiac; 13. réellery bladder; 14. biliary system; 15. parenchymal tissue including and not limited to the kidney, liver, spleen; 16. lymph nodes; 17. salivary glands; 18. dental gums; 19. Intra-articular (into joints); 20. !ntra-ocuiar; 21. Brain tissue; 22. Brain ventricles; 23. Cavities, including abdominal cavity (for example but without limitation, for ovary cancer); 24. Intra esophageal and 25. Intra rectal.
  • insertion of the system is associated with injection of material to the ECM at the target site and the vicinity of that site to affect local pH and/or temperature and/or other biological factors affecting the diffusion of the drug and/or drug kinetics in the ECM, of the target site and the vicinity of such a site.
  • the release of said agent could be associated with sensing and/or activation appliances that are operated prior and/or at and/or after insertion, by non and/or minimally invasive and/or else methods of activation and/or acceleration/deceleration, including laser beam, radiation, thermal heating and cooling, and ultrasonic, including focused ultrasound and/or RF (radiofrequency) methods or devices, and chemical activators.
  • sensing and/or activation appliances that are operated prior and/or at and/or after insertion, by non and/or minimally invasive and/or else methods of activation and/or acceleration/deceleration, including laser beam, radiation, thermal heating and cooling, and ultrasonic, including focused ultrasound and/or RF (radiofrequency) methods or devices, and chemical activators.
  • the drug preferably comprises a gene silencing biological RNAi drug, for example for localized cancer cases in breast, pancreas, brain, kidney, bladder, lung, and prostate as described below.
  • RNAi drug for example for localized cancer cases in breast, pancreas, brain, kidney, bladder, lung, and prostate as described below.
  • many drugs other than siRNA are applicable to be encapsulated in Loder, and can be used in association with this invention, as long as such drugs can be encapsulated with the Loder substrate, such as a matrix for example.
  • Such drugs include approved drugs that are delivered today by methods other than of this invention, including Amphotericin B for fungal infection; antibiotics such as in osteomyelitis; pain killers such as narcotics; anti degenerative such as in Alzheimer or Parkinson diseases in a Loder implanted in the vicinity of the spine in the case of back pain.
  • Such a system may be used and/or adapted to deliver the CRI SPR Cas system of the present invention .
  • the drug may optionally be siRNA that silence smooth muscle cells, including HI 9 silencing, or a drug selected from the group consisting of taxoi, rapamycin and rapamyein- analogs.
  • the Loder is preferably either a Drug Eluting Stent (DES), with prolonged release at constant rate, or a dedicated device that is implanted separately, in association to the stent. Al l of this may be used/and or adapted to the CRISPR Cas system of the present invention.
  • DES Drug Eluting Stent
  • psychiatric and cognitive disorders are treated with gene modifiers.
  • Gene knockdown with silencing R A is a treatment option.
  • Loders locally delivering nucleotide based agents to central nervous system sites are therapeutic options for psychiatric and cognitive disorders including but not limited to psychosis, bi -polar diseases, neurotic disorders and behavioral maladies.
  • the Loders could also deliver locally drags including small drugs and macromolecules upon implantation at specific brain sites. All of this may be used and/or adapted to the CRISPR Cas system of the present invention.
  • silencing of innate and/or adaptive immune mediators at local sites enables the prevention of organ transplant rejection.
  • Local delivery of silencing R As and immunomodulating reagents with the Loder implanted into the transplanted organ and/or the implanted site renders local immune suppression by repelling immune ceils such as CDS activated against the transplanted organ.
  • Ail of this may be used/and or adapted to the CRISPR Cas system of the present invention.
  • vascular growth factors including VEGFs and angiogenin and others are essential for neovascularization .
  • Local delivery of the factors, peptides, peptidomimetics, or suppressing their repressors is an important therapeutic modality; silencing the repressors and local delivery of the factors, peptides, macromolecules and small drugs stimulating angiogenesis with the Loder is therapeutic for peripheral, systemic and cardiac vascular disease.
  • the method of insertion may optionally already be used for other types of tissue implantation and/or for insertions and/or for sampling tissues, optionally without modifications, or alternatively optionally only with non-major modifications in such methods.
  • Such methods optionally include but are not limited to hrachymerapy methods, biopsy, endoscopy with and/or without ultrasound, such as ERCP, stereotactic methods into the brain tissue, Laparoscopy, including implantation with a laparoscope into joints, abdominal organs, the bladder wall and body cavities.
  • CRISPR enzyme rnRNA and guide RNA might also be delivered separately.
  • CRISPR enzyme mRNA can be delivered prior to the guide RNA.
  • CRISPR enzyme mRNA might be administered 1 -12 hours (preferably around 2-6 hours) prior to the administration of guide RNA.
  • CRISPR enzyme mRNA and guide RNA can be administered together.
  • a second booster dose of guide RNA can be administered 1 -12 hours (preferably around 2-6 hours) after the initial administration of CRISPR enzyme mRNA + guide RNA.
  • CRISPR enzyme mRNA and/or guide RNA might be useful to achieve the most efficient levels of genome modification.
  • CRISPR enzyme mRNA and guide RNA delivered For minimization of toxicity and off-target effect, it will be important to control the concentration of CRISPR. enzyme mRNA and guide RNA delivered.
  • Optimal concentrations of CRISPR enzyme mRNA and guide RNA can be determined by testing different concentrations in a cellular or animal model and using deep sequencing the analyze the extent of modification at potential off-target genomic loci. For example, for the guide sequence targeting 5'- GAGTCCGAGCAGAAGAAGAA-3' in the EMX1 gene of the human genome, deep sequencing can be used to assess the level of modification at the following two off-target loci, 1 : 5 ' -GAGTCCTAGCAGGAGAAGAA-3 ' and 2: 5' -GAGTCTAAGCAGAAGAAGAA-3 ' . The concentration that gives the highest level of on-target modification while minimizing the level of off-target modification should be chosen for in vivo delivery.
  • CRISPR enzyme niekase mRN A for example S. pyogenes Cas9 with the DIOA mutation
  • the two guide RNAs need to be spaced as follows. Guide sequences in red (single underline) and blue (double underline) respectively (these examples are based on the PAM requirement for Streptococcus pyogenes Cas9).
  • the 5' overhang is at most 200 base pairs, preferably at most 100 base pairs, or more preferably at most 50 base pairs.
  • the 5' overhang is at least 26 base pairs, preferably at least 30 base pairs or more preferably 34-50 base pairs or 1 -34 base pairs.
  • the first guide sequence directing cleavage of one strand of the DNA duplex near the first target sequence and the second guide sequence directing cleavage of other strand near the second target sequence results in a blunt cut or a 3' overhang.
  • the 3' overhang is at most 150, 100 or 25 base pairs or at least 15, 10 or 1 base pairs. In preferred embodiments the 3' overhang is 1- 100 basepairs.
  • aspects of the invention relate to the expression of the gene product being decreased or a template polynucleotide being further introduced into the DNA molecule encoding the gene product or an intervening sequence being excised precisely by allowing the two 5' overhangs to reannea! and ligate or the activity or function of the gene product being al tered or the expression of the gene product being increased.
  • the gene product is a protein.
  • PCSK9 Liver, proprotein convertase subtiiisin kexin 9
  • PCSK9 Proprotein convertase subtiiisin kexin 9
  • PCSK9 is a member of the subtiiisin serine protease family.
  • PCSK9 is primarily expressed by the liver and is critical for the down regulation of hepatocyte LDL receptor expression. LDL-C levels in plasma are highly elevated in humans with gain of function mutations in PCSK9, classifying them as having severe hypercholesterolemia. Therefore, PCSK9 is an attractive target for CRISPR.
  • PCS9K-targeted CRISPR may be formulated in a lipid particle and for example administered at about 15, 45, 90, 150, 250 and 400 .ug/kg intraveneously (see, e.g., http://www.ataylam.com/capella/wp ⁇ coriteot mioad / ' iO 13/08/ AI . " N ⁇ PCS0?. ⁇ 001 -Proto ol-l .ancet odf)
  • Ex-vivo somatic cell gene therapy requires an accessible and robust cell type that is amenable to multiple transfections and subject to controlled proliferation.
  • Special problems associated with the use of non-B-cell somatic cells include the processing of proinsulin to insulin, and the conferment of sensitivity to glucose-stimulated proinsulin biosynthesis and regulated insulin release.
  • Preliminary studies using fibroblasts, pituitary cells, kidney (COS) cells and ovarian (CHO) cells suggest that these challenges could be met, and that ex-vivo somatic cell gene therapy offers a feasible approach to insulin replacement therapy.
  • the system of Bailey et al. may be used/and or adapted to the CRISPR Cas system of the present invention for delivery to the liver.
  • Cationic liposomes (Li otrust) containing 0,0'-ditetradecanoyl-N-(a rimethylammonioacetyl) diethanoianiine chloride (DC-6-14) as a cationic lipid, cholesterol and dioleoylphosphatidyiethanolamine at a molar ratio of 4:3:3 (which has shown high transfection efficiency under semmcontaining conditions for in vitro and in vivo gene delivery) were purchased from Hokkaido System Science.
  • the liposomes were manufactured using a freeze- dried empty liposomes method and prepared at a concentration of 1 ratvi (DC -16-4) by addition of double-distilled, water (DDW) to the lyophilized lipid mixture under vortexing before use.
  • V A-coupled liposomes 200 nmoi of vitamin A (retinoi, Sigma) dissolved in DMSO was mixed with the liposome suspensions (100 nmol as DC- 16-4) by vortexing in a 1.5 ml tube at 25 1 C.
  • V A-coupled liposomes carrying siRNAgp46 VA-lip ⁇ siRNAgp46
  • a solution of siRNAgp46 580 pmol/ml in DDW
  • the ratio of siRNA to DC- 16-4 was .1 : 1 .1.5 (mol/mol) and the siRNA to liposome ratio (w ⁇ / t) was 1 :1.
  • any free vitamin A or siRNA that was not taken up by liposomes were separated from liposomal preparations using a mieropartition system (VIVASPIN 2 concentrator 30,000 MWCO PES, VIVASCIENCE).
  • the liposomal suspension was added to the filters and centrifuged at 1 ,500g for 5 mm 3 times at 25 1 C. Fractions were collected and the material trapped in the filter was reconstituted with PBS to achieve the desired dose for in vitro or in -vivo use. Three injections of 0.75 mg/kg si RNA were given every other day to rats.
  • the system of Sato et al. may be used/and or adapted to the CRISPR Cas system of the present invention for delivery to the liver by delivering about 0.5 to 1 mg/kg of CRISPR Cas RNA in the liposomes as described by Sato et al. to humans.
  • SATA-modified siRNAs are synthesized by reaction of 5' ammemodified siRNA with 1 weight equivalents (wt eq) of Nsuccmiinidyi-S-acctylthioacetate (SAT A) reagent (Pierce) and 0.36 wt eq of NaHC0 3 in water at 4°C for 16 h.
  • SAT A Nsuccmiinidyi-S-acctylthioacetate
  • NaHC0 3 NaHC0 3
  • the modified siRNAs are then precipitated by the addition of 9 vol of ethanol and incubation at 80°C for 2 h.
  • the precipitate is resuspended in IX siRNA buffer (Dharmacon) and quantified by measuring absorbanee at the 260-nm wavelength.
  • PBAVE (30 mg/ml in 5mMTAPS, pH 9) is modified by addition of 1.5 wt % SMPT (Pierce). After a 1 -h incubation, 0.8 mg of SMPT-PBAVE was added to 400 ⁇ of isotonic glucose solution containing 5 mM TAPS (pH 9). To this solution was added 50 ug of SATA-modified siRNA. For the dose-response experiments where [PBAVE] was constant, different amounts of siRNA are added. The mixture is then incubated for 16 h. To the solution is then added 5.6 mg of Hepes free base followed by a mixture of 3.7 mg ofCDM-NAGand L9mg of CDM-PEG.
  • CDM-PEG and CDM- NAG are synthesized from the acid chloride generated by using oxalyl chloride.
  • To the acid chloride is added 1.1 molar equivalents polyethylene glycol monomethyl ether (molecular weight average of 450) to generate CDM-PEG or (aminoethoxy)ethoxy-2-(acetylamino)-2-deoxy-P-D- glucopyranoside to generate CDM-NAG.
  • the final product is purified by using reverse-phase HPLC with a 0.1% TFA water/acetonitrile gradient. About 25 to 50 ⁇ of siRNA was delivered to mice.
  • the system of Rozema et al. may be applied to the CRISPR Cas system of the present invention for deiiver to the liver, for example by envisioning a dosage of about 50 to about 200 mg of CRISPR Cas for delivery to a human.
  • Delivery options for the brain include encapsulation of CRISPR enzyme and guide RNA in the form of either D ' NA or RNA into liposomes and conjugating to molecular Trojan horses for trans-blood brain barrier (BBB) deliver ⁇ 7 .
  • Molecular Trojan horses have been shown to be effective for delivery of B-gal expression vectors into the brain of non-human primates.
  • the same approach can be used to delivery vectors containing CRISPR enzyme and guide RNA.
  • Xia CF and Boado RJ, Pardridge WM Antibody-mediated targeting of siRNA. via the human insulin receptor using avidin-biotin technology. Mol Pharm, 2009 May- Jun;6(3):747-51.
  • siRNA short interfering RNA
  • mAb monoclonal antibody
  • avidin-biotin a receptor-specific monoclonal antibody
  • the authors also report that because the bond between the targeting mAb and the siRNA is stable with avidin-biotin technology, and RNAi effects at distant sites such as brain are observed in vivo following an intravenous administration of the targeted siRNA.
  • Zhang et al. (Mol Ther. 2003 Jan;7(l):l l-8.)) describe how expression piasmids encoding reporters such as luciferase were encapsulated in the interior of an "artificial virus" comprised of an 85 ran pegylated immunoiiposome, which was targeted to the rhesus monkey brain in vivo with a monoclonal antibody (MAb) to the human insulin receptor (HIR).
  • MAb monoclonal antibody
  • HIR human insulin receptor
  • the HIRMAb enables the liposome carrying the exogenous gene to undergo transeytosis across the blood-brain barrier and endocyiosis across the neuronal plasma membrane following intravenous injection.
  • the level of luciferase gene expression in the brain was 50-fold higher in the rhesus monkey as compared to the rat.
  • Widespread neuronal expression of the beta-galactosidase gene in primate brain was demonstrated by both histochemistiy and confocal microscopy. The authors indicate that this approach makes feasible reversible adult transgenics in 24 hours. Accordingly, the use of immunoiiposome is preferred. These may be used in conjunction with antibodies to target specific tissues or cell surface proteins.
  • RNA Ribonucleic acid
  • nanoparticles Cho, S., Goldberg, M., Son, S., Xu, Q., Yang, F., Mei, Y., Bogatyrev, S., Langer, R. and Anderson, D., Lipid-! ike nanoparticles for small interfering RNA delivery to endothelial cells, Advanced Functional Materials, 19: 3112-3118, 2010
  • exosomes Schroeder, A., Levins, C, Cortez, C, Langer, R., and Anderson, D., Lipid-based nanotherapeutics for siRNA delivery, Journal of Internal Medicine, 267: 9-21, 2010, PM1D: 20059641).
  • exosomes have been shown to be particularly useful in delivery siRNA, a system with some parallels to the CRISPR system.
  • Ei-Andaloussi S, et al. (“Exosome-mediated delivery of siRNA in vitro and in vivo.” Nat Protoc. 2012 Dec;7(12):2112- 26. doi: 10.1()38/nprot.2012.131. Epub 2012 Nov 15.) describe how exosomes are promising tools for drug delivery across different biological barriers and can be harnessed for delivery of siRNA in vitro and in vivo.
  • Their approach is to generate targeted exosomes through transfection of an expression vector, comprising an exosomal protein fused with a peptide ligand.
  • the exosomes are then purify and characterized from transfected ceil supernatant, then siRNA is loaded into the exosomes. Delivery or administration according to the invention can be performed with exosomes, in particular but not limited to the brain.
  • Vitamin E may be conjugated with CRISPR Cas and delivered to the brain alo g with high density lipoprotein (HDL), for example in a similar ma ner as was do e by Uno et al. (HUMAN GENE THERAPY 22:71 1-719 (June 201 1 )) for delivering short-interfering RNA (siRNA) to the brain.
  • Mice were infused via Osmotic minipumps (model 1007D; Alzet, Cupertino, CA) filled with phosphate -buffered saline (PBS) or free TocsiBACE or Toe- siBA.CE/HDl ⁇ , and connected with Brain Infusion Kit 3 (Alzet).
  • A. brain-infusion cannula was placed about 0.5mm posterior to the bregma at midline for infusion into the dorsal third ventricle. Uno et al. found that as little as 3 nmol of Toc-siRNA with HDL could induce a target reduction in comparable degree by the same ICV infusion method.
  • a similar dosage of CRISPR Cas conjugated to a-tocopheroi and co-administered with HDL targeted to the brain may be contemplated for humans in the present invention, for example, about 3 nmol to about 3 ⁇ of CRISPR Cas targeted to the brain may becontempiated.
  • Zou et al. ( ⁇ HUMAN GENE THERAPY 22:465-475 (April 2011 ⁇ ) describes a method of lentiviral-mediated delivery of short-hairpin RNAs targeting PKCy for in vivo gene silencing in the spinal cord of rats.
  • Zou et al. administered about 10 ⁇ of a recombinant lentivirus having a titer of 1 x 10 9 transducing units (TU)/ml by an intrathecal catheter.
  • a similar dosage of CRISPR Cas expressed in a lenti iral vector targeted to the brain may be contemplated for humans in the present invention, for example, about 10-50 ml of CRISPR Cas targeted to the brain in a lentivirus having a titer of 1 x 10 9 transducing units (TU)/ml may becontempiated.
  • TU transducing units
  • Targeted deletion of genes is preferred. Examples are exemplified in Example 18. Preferred are, therefore, genes involved in cholesterol biosynthesis, fatty acid biosynthesis, and other metabolic disorders, genes encoding mis-folded proteins involved in amyloid and other diseases, oncogenes leading to cellular transformation, latent viral genes, and genes leading to dominant-negative disorders, amongst other disorders.
  • Applicants prefer gene delivery of a CRISPR-Cas system to the liver, brain, ocular, epithelial, hematopoetic, or another tissue of a subject or a patient in need thereof, suffering from metabolic disorders, amyloidosis and protein-aggregation related diseases, cellular transformation arising from genetic mutations and translocations, dominant negative effects of gene mutations, latent viral infections, and other related symptoms, using either viral or nanoparticle delivery system.
  • Therapeutic applications of the CRISPR-Cas system include Glaucoma, Amyloidosis, and Huntington's disease. These are exemplified in Example 20 and the features described therein are preferred alone or in combination.
  • AAV spinocerebellar ataxia type 1
  • SCAl spinocerebellar ataxia type 1
  • AAV1 and AAV5 vectors are preferred a d AAV titers of about 1 x 10" vector genomes/ml are desirable.
  • CRISPR-Cas guide R ' NAs that target the vast majority of the HIV-1 genome while taking into account HIV- 1 strain variants for maximal coverage and effectiveness.
  • host immune cells could be a) isolated, transduced with CRISPR-Cas, selected, and reintroduced in to the host or b) transduced in vivo by systemic delivery of the CRISPR-Cas system.
  • the first approach allows for generation of a resistant immune population whereas the second is more likely to target latent viral reservoirs within the host. This is discussed in more detail in the Examples section.
  • US Patent Publication No. 20130171732 assigned to Sangamo Biosciences, Inc. relates to insertion of an anti-HJV transgene into the genome, methods of which may be applied to the CRISPR Cas system of the present invention.
  • the CXCR4 gene may be targeted and the TALE system of US Patent Publication No. 20100291048 assig ed to Sangamo Biosciences, Inc. may be modified to the CRISPR Cas system of the present invention.
  • the method of US Patent Publication Nos. 20130137104 and 20130122591 assigned to Sangamo Biosciences, Inc. and US Patent Publication No. 20100146651 assigned to Cel Sectis may be more generally applicable for transgene expression as it involves modifying a hypoxanthine-guanine phosphoribosyltransferase (HPRT) locus for increasing the frequency of gene modification.
  • HPRT hypoxanthine-guanine phosphoribosyltransferase
  • the present invention generates a gene knockout cell library.
  • Each cel l may have a single gene knocked out. This is exemplified in Example 23.
  • This library is useful for the screening of gene function in cellular processes as well as diseases.
  • To make this cell library one may integrate Cas9 driven by an inducible promoter (e.g. doxycycline inducible promoter) into the ES cell.
  • an inducible promoter e.g. doxycycline inducible promoter
  • one may integrate a single guide RNA targeting a specific gene in the ES cell.
  • To make the ES cell library one may simply mix ES cells with a library of genes encoding guide NAs targeting each gene in the human genome.
  • each guide RNA gene may be contained on a plasmid that carries of a single attP site. This way BxBl will recombine the attB site in the genome with the attP site on the guide RN A containing plasmid.
  • To generate the ceil library one may take the library of cells thai have single guide RNAs integrated and induce Cas9 expression. After induction, Cas9 mediates double strand break at sites specified by the guide RNA.
  • the immunogenic! ty of protein drugs can be ascribed to a few immunodominant helper T lymphocyte (HTL) epitopes. Reducing the MHC binding affinity of these HTL epitopes contained within these proteins can generate drugs with lower immunogenicity (Tangri S, et al. ("Rationally engineered therapeutic proteins with reduced immunogenicity" J Immunol, 2005 Mar i 5; 174(6):3187-96.)
  • the immunogenicity of the CRISPR enzyme in particular may be reduced following the approach first set out in Tangri et al with respect to erythropoietin and subsequently developed. Accordingly, directed evolution or rational design may be used to reduce the immunogenicity of the CRISPR enzyme (for instance a Cas9) in the host species (human or other species).
  • Example 28 Applicants used 3 guideR As of interest and able to visualize efficient DNA cleavage in vivo occurring only in a small subset of cells. Essentially, what Applicants have shown here is targeted in vivo cleavage. In particular, this provides proof of concept that specific targeting in higher organisms such as mammals can also be achieved. It also highlights multiple aspect in that multiple guide sequences (i.e. separate targets) can be used simultaneously (in the sense of co-delivery). In other words, Applicants used a multiple approach, with several different sequences targeted at the same time, but independently.
  • Example 34 A suitable example of a protocol for producing AAV, a preferred vector of the invention is provided in Example 34.
  • Trinucleotide repeat disorders are preferred conditions to be treated. These are also exemplified herein.
  • US Patent Publication No. 20110016540 describes use of zinc finger nucleases to genetically modify ceils, animals and proteins associated with trinucleotide repeat expansion disorders. Trinucleotide repeat expansion disorders are complex, progressive disorders that involve developmental neurobiology and often affect cognition as well as sensori-motor functions.
  • Trinucleotide repeat expansion proteins are a diverse set of proteins associated with susceptibility for developing a trinucleotide repeat expansion disorder, the presence of a trinucleotide repeat expansion disorder, the severity of a trinucleotide repeat expansion disorder or any combination thereof. Trinucleotide repeat expansion disorders are divided into two categories determined by the type of repeat. The most common repeat is the triplet CAG, which, when present in the coding region of a gene, codes for the amino acid gfutamine (Q).
  • polyglutamine disorders comprise the following diseases: Huntington Disease (HD); Spinobulbar Muscular Atrophy (SBMA); Spinocerebellar Ataxias (SCA types 1, 2, 3, 6, 7, and 17); and Dentatorubro-Pallidoluysian Atrophy (DRPLA).
  • the remaining trinucleotide repeat expansion disorders either do not involve the CAG triplet or the CAG triplet is not in the coding region of the gene and are, therefore, referred to as the non-polyglutamine disorders.
  • the non-polyglutarmne disorders comprise Fragile X Syndrome (FRAXA); Fragile XE Mental Retardation (FRAXE); Friedreich Ataxia (FRDA); Myotonic Dystrophy (DM); and Spinocerebellar Ataxias (SCA types 8, and 12).
  • FAAXA Fragile X Syndrome
  • FAAXE Fragile XE Mental Retardation
  • FRDA Friedreich Ataxia
  • DM Myotonic Dystrophy
  • SCA types 8, and 12 Spinocerebellar Ataxias
  • the proteins associated with trinucleotide repeat expansion disorders are typical ly selected based on an experimental association of the protein associated with a trinucleotide repeat expansion disorder to a trinucleotide repeat expansion disorder.
  • the production rate or circulating concentration of a protein associated with a trinucleotide repeat expansion disorder may be elevated or depressed in a population having a trinucleotide repeat- expansion disorder relative to a population lacking the trinucleotide repeat expansion disorder.
  • Differences in protein levels may be assessed using proteomic techniques including but not limited to Western blot, immunohistochemicaf staining, enzyme linked immunosorbent assay (ELISA), and mass spectrometry.
  • the proteins associated with trinucleotide repeat expansion disorders may be identified by obtaining gene expression profiles of the genes encoding the proteins using genomic techniques including but not limited to DNA microarray analysis, serial analysis of gene expression (S AGE), and quantitative real-time polymerase chai reaction (Q-PCR).
  • genomic techniques including but not limited to DNA microarray analysis, serial analysis of gene expression (S AGE), and quantitative real-time polymerase chai reaction (Q-PCR).
  • Non-limiti g examples of proteins associated with trinucleotide repeat expansion disorders include AR (androgen receptor), FMR1 (fragile X mental retardation 1), HTT (huntmgtin).
  • DMPK distrophia myotonica-protein kinase
  • FXN frataxin
  • ATXN2 ataxin 2
  • ATN1 atrophin 1
  • FEN1 overlap structure-specific endonuc lease 1
  • TNRC6A trinucleotide repeat containing 6 A
  • PABPN 1 poly(A) binding protein, nuclear 1), JPH3 (junctophilin 3), MED 15 (mediator complex subunit 15), ATXNl (ataxin 1), ATXN3 (ataxin 3), TBP (TATA box binding protein), CACNA 1A (calcium channel, voltage-dependent, P/Q type, alpha 1A subunit), ATXN8QS (ATXN8 opposite strand (non-protein coding)
  • G protein guanine nucleotide binding protein
  • beta polypeptide 2 ribosomal protein L14
  • ATXN8 ataxin 8
  • INSR insulin receptor
  • TTR transthyretin
  • EP400 El A binding protein p400
  • GIGYF2 GYF protein 2
  • NCOA3 nuclear receptor coactivator 3
  • ERDA1 expanded repeat domain, CAG/CTG 1
  • TSC1 tuberous sclerosis 1
  • COMP carboxyribonucleic acid
  • GCLC glycosyrene-maleic acid copolymer
  • RRAD Ras-related associated with diabetes
  • SH3 mutant S homolog 3
  • DRD2 dopamine receptor D2
  • CD44 CD44 molecule (Indian blood group)
  • CTCF CCCTC-binding factor (zinc finger protein)
  • CCND1 eye fin Dl
  • CLSPN claspin homolog (Xenopus laevis)
  • MEF2A myocyte enhancer factor 2A
  • PTPRU protein tyrosine phosphatase, receptor type, U
  • GAPDH glycosyrosine phosphatase
  • TRXM22 tripartite motif-containing 22
  • WT1 Wang tumor 1).
  • AHR aryl hydrocarbon receptor
  • GPX1 glutathione peroxidase 1
  • TPMT thiopurine S- methyltransferase
  • NDP Nonrie disease (pseudogiioma)
  • ARX aristaless related homeobox
  • M l S I MUS81 endonuclease homolog
  • GLA galactosidase, alpha
  • CBL Cas-Br- M (murine) ecotropic retroviral transforming sequence
  • FT H I ferritin, heavy polypeptide 1
  • IL12RB2 interleukin 12 receptor, beta 2
  • OTX2 orthodenticle homeobox 2
  • HOXA5 homeobox A5
  • POLG2 polymerase (D A directed), gamma 2, accessory subunit
  • DLX2 distal-less homeobox 2
  • SIRPA signal-regulatory protem alpha
  • OTXI orthodenticle homeobox 1
  • AHRR aryl -hydrocarbon receptor repressor
  • MANF mesencephalic astrocyte- derived neurotrophic factor
  • TMEM 158 transmembrane protein 158 (gene/pseudogene)
  • ENSG00000078687 ENSG00000078687.
  • Preferred proteins associated with trinucleotide repeat expansion disorders include HTT (Huntingtin), AR (androgen receptor), FXN (frataxin), Atxn3 (ataxin), Atxnl (ataxin), Atxn2 (ataxin), Atxn7 (ataxin), AtxnlO (ataxin), DM (dystrophia myotonica-protein kinase), Atnl (atrophin 1), CBP (creb binding protein), VLDLR (very low density lipoprotein receptor), and any combination thereof.
  • a method of gene therapy for the treatment of a subject having a mutation in the CFTR gene comprises administering a therapeutically effective amount of a CRISPR-Cas gene therapy particle, optionally via a biocompatible pharmaceutical carrier, to the cells of a subject.
  • the target DNA comprises the mutation cIeltaF5G8.
  • the mutation is repaired to the wildtype.
  • the mutation is a deletion of the three nucleotides that comprise the codon for phenylalanine (F) at position 508. Accordi gly, repair in this instance requires reiiitroduction of the missing codon into the mutant.
  • an adenovirus/AAV vector system is introduced into the host cell, cells or patient.
  • the system comprises a Cas9 (or Cas9 nickase) and the guide RNA along with a adenovirus/AAV vector system comprising the homology repair template containing the F5Q8 residue.
  • This may be introduced into the subject via one of the methods of deliver ⁇ ' discussed earlier.
  • the CRISPR-Cas system may be guided by the CFTRdelta 508 chimeric guide RNA. It targets a specific site of the CFTR genomic locus to be nicked or cleaved.
  • the repair template is inserted into the cleavage site via homologous recombination correcting the deletion that results in cystic fibrosis or causes cystic fibrosis related symptoms.
  • This strategy to direct delivery and provide systemic introduction of CRISPR systems with appropriate guide RNAs can be employed to target genetic mutations to edit or otherwise manipulate genes that cause metabolic, liver, kidney and protein diseases and disorders such as those in 1 able B.
  • the CR ISPR/Cas9 sy.si.cnr ⁇ > of the present invention can be used to correct genetic mutations that were previously attempted with limited success using TALEN and ZFN,
  • TALEN and ZFN For example, WQ2013163628 A2
  • Genetic Correction of Mutated Genes published application of Duke University describes efforts to correct, for example, a frameshift mutation which causes a premature stop codon and a truncated gene product that can be corrected via nuclease .mediated non-homologous end joining such as those responsible for Duchenne Muscular Dystrophy, ("DMD”) a recessive, fatal, X-linked disorder that results in .muscle degeneration due to mutations in the dystrophin gene.
  • DMD Duchenne Muscular Dystrophy
  • Dystrophin is a cytoplasmic protein that provides structural stability to the dystroglycan complex of the cell membrane that is responsible for regulating muscle cell integrity and function.
  • the dystrophin gene or "DMD gene” as used interchangeably herein is 2.2 megabases at locus Xp21.
  • the primary transcription measures about 2,400 kb with the mature mR ' NA being about 14 kb. 79 exons code for the protein which is over 3500 amino acids.
  • Exon 51 is frequently adjacent to frame-disrupting deletions in DMD patients and has been targeted in clinical trials for oligonucSeotide-based exon skipping.
  • a clinical trial for the exon 51 skipping compound eteplirsen recently reported a significa t functional benefit across 48 weeks, with an average of 47% dystrophin positive fibers compared to baseline. Mutations in exon 51 are ideal ly suited for permanent correction by NHEJ-based genome editing.
  • the present invention also contemplates delivering the CRISPR-Cas system to the blood.
  • the CRISPR Cas system of the present invention is also contemplated to treat hemoglobinopathies, such as thalassemias and sickle cell disease. See, e.g., International Patent Publication No. WO 2013/126794 for potential targets that may be targeted by the CRISPR Cas system of the present invention.
  • US Patent Publication Nos. 20110225664, 20110091441, 20100229252, 20090271881 and 20090222937 assigned to Ceilectis relates to CREI variants , wherein at least one of the two I-Crel monomers has at least two substitutions, one in each of the two functional subdomains of the LAGLIDADG core domain situated respectively from positions 26 to 40 and 44 to 77 of I-Crel, said variant being able to cleave a DNA target sequence from the human interleukin-2 receptor gamma chain (IL2RG) gene also named common cytokine receptor gamma chain gene or gamma C gene.
  • IL2RG human interleukin-2 receptor gamma chain
  • the target sequences identified in US Patent Publication Nos. 20110225664, 20110091441, 20100229252, 20090271881 and 20090222937 may be utilized for the CRJSPR Cas system of the present invention.
  • SCID Severe Combined Immune Deficiency
  • IL2RG encodes the gamma C protein (Noguchi, et al., Cell, 1993, 73, 147-157), a common component of at least five interleukiii receptor complexes. These receptors activate several targets through the J AO kinase (Macchi et al., Nature, 1995, 377, 65-68), which inactivation results in the same syndrome as gamma C inactivation; (ii) mutation in the ADA gene results in a defect in purine metabolism that is lethal for lymphocyte precursors, which in turn results in the quasi absence of B, T and NK cells; (iii) V(D)J recombination is an essential step in the maturation of immunoglobulins and T lymphocytes receptors (TCl s).
  • HSCs Hematopoietic Stem Ceils
  • the present invention also contemplates delivering the CRISPR-Cas system to one or both ears.
  • cochlear implants are looking into whether gene therapy could be used to aid current deafness treatments—namely, cochlear implants. Deafness is often caused by lost or damaged hair cells that cannot relay signals to auditor ⁇ ' neurons. In such cases, cochlear implants may be used to respond to sound and transmit electrical signals to the nerve cells. But these neurons often degenerate and retract from the cochlea as fewer growth factors are released by impaired hair cells.
  • US patent application 20120328580 describes injection of a pharmaceutical composition into the ear (e.g., auricular administration), such as into the luminae of the cochlea (e.g., the Scala media, Sc vestibulae, and Sc tympani), e.g., using a syringe, e.g., a single-dose syringe.
  • a pharmaceutical composition into the ear (e.g., auricular administration), such as into the luminae of the cochlea (e.g., the Scala media, Sc vestibulae, and Sc tympani), e.g., using a syringe, e.g., a single-dose syringe.
  • a syringe e.g., a single-dose syringe.
  • intratympanic injection e.g., into the middle ear
  • injections into the outer, middle, and/or inner ear e
  • Injection can be, for example, through the round window of the ear or through the cochlear capsule.
  • Other inner ear administration methods are known in the art (see, e.g., Salt and Plontke, Drug Discovery Today, 10: 1299-1306, 2005).
  • the pharmaceutical composition in another mode of administratio , can be administered in situ, " via a catheter or pump.
  • a catheter or pump can, for example, direct a pharmaceutical composition into the cochlear luminae or the round window of the ear and/or the lumen of the colon.
  • Exemplary drug delivery apparatus and methods suitable for administering one or more of the compounds described herein into an ear, e.g., a human ear, are described by McKenna et al., (U.S. Publication No. 2006/0030837) and Jacobsen et al., (U.S. Pat. No. 7,206,639).
  • a catheter or pump can be positioned, e.g., in the ear (e.g., the outer, middle, and/or i ner ear) of a patient during a surgical procedure.
  • a catheter or pump can be positioned, e.g., in the ear (e.g., the outer, middle, and/or inner ear) of a patient without the need for a surgical procedure.
  • one or more of the compounds described herein can be administered in combination with a mechanical device such as a cochlear implant or a hearing aid, which is worn in the outer ear.
  • a mechanical device such as a cochlear implant or a hearing aid, which is worn in the outer ear.
  • An exemplary cochlear implant that is suitable for use with the present invention is described by Edge et al., (U.S. Publication No. 2007/0093878).
  • the modes of administration described above may be combined in any order and can be simultaneous or interspersed.
  • the present invention may be administered according to any of the Food and Drug Administration approved methods, for example, as described in CDER Data Standards Manual, version number 004 (which is available at fda.give/cder/dsm DRG/drg00301.htm).
  • the cell therapy methods described in US patent application 20120328580 can be used to promote complete or partial d fferentiation of a cell to or towards a mature cell type of the inner ear (e.g., a hair cell) in vitro. Cells resulting from such methods can then be transplanted or implanted into a patient in need of such treatment.
  • the cell culture methods required to practice these methods including methods for identifying and selecting suitable cell types, methods for promoting complete or partial differentiation of selected cel ls, methods for identifying complete or partially differentiated cell types, and methods for implanting complete or partially differentiated cells are described below.
  • Cells suitable for use in the present invention include, but are not limited to, cells that are capable of differentiating completely or partially into a mature cell of the inner ear, e.g., a hair cel l (e.g., an inner and/or outer hair cel l), when contacted, e.g., in vitro, with one or more of the compounds described herein.
  • a hair cel l e.g., an inner and/or outer hair cel l
  • Exemplary cells that are capable of differentiating into a hair cel l include, but are not limited to stem cells (e.g., inner ear stem cells, adult stem cells, bone marrow derived stem cells, embryonic stem cells, mesenchymal stem cells, skin stem cells, iPS cells, and fat derived stem cells), progenitor cells (e.g., inner ear progenitor cells), support cells (e.g., Deiters' cells, pillar ceils, inner phalangeal cells, tectal cells and Hansen's cells), and/or germ cells.
  • stem cells e.g., inner ear stem cells, adult stem cells, bone marrow derived stem cells, embryonic stem cells, mesenchymal stem cells, skin stem cells, iPS cells, and fat derived stem cells
  • progenitor cells e.g., inner ear progenitor cells
  • support cells e.g., Deiters' cells, pillar ceils, inner phalangeal cells, tectal cells and
  • Such suitable cells can be identified by analyzing (e.g., qualitatively or quantitatively) the presence of one or more tissue specific genes.
  • gene expression can be detected by detecting the protein product of one or more tissue-specific genes.
  • Protein detection techniques involve staining proteins (e.g., using cell extracts or whole cells) using antibodies against the appropriate antigen.
  • the appropriate antigen is the protein product of the tissue-specific gene expression.
  • a first antibody i.e., the antibody that binds the antigen
  • a second antibody directed against the first e.g., an anti-IgG
  • This second antibody is conjugated either with fluorochromes, or appropriate enzymes for coiorimetric reactions, or gold beads (for electron microscopy), or with the biotin-avidin system, so that the location of the primary antibody, and thus the antigen, can be recognized.
  • the CR1SPR Cas molecules of the present invention may be delivered to the ear by direct application of pharmaceutical composition to the outer ear, with compositions modified from US Published application, 201 10142917.
  • the pharmaceutical composition is applied to the ear canal. Delivery to the ear may also be refered to as aural or otic delivery.
  • RNA molecules of the invention are delivered in liposome or !ipofectirs formulations and the like and can be prepared by methods well known to those skilled in the art. Such methods are described, for example, in U.S. Pat. Nos. 5,593,972, 5,589,466, and 5,580,859, which are herein incorporated by reference.
  • siRNA has recently been successfully used for inhibition of gene expression in primates (see for example. Tolentino et al,, Retina 24(4) :660 which may also be applied to the present invention.
  • Qi et al. discloses methods for efficient siRNA transfeetion to the inner ear through the intact round window by a novel proteidic delivery technology which may be applied to the CRISPR Cas system of the present invention (see, e.g., Qi et al, Gene Therapy (2013), 1-9).
  • a novel proteidic delivery technology which may be applied to the CRISPR Cas system of the present invention (see, e.g., Qi et al, Gene Therapy (2013), 1-9).
  • TAT-DRBDs TAT double stranded RNA-binding domains
  • cochlear implant function can be improved by good preservation of the spiral ganglion neurons, which are the target of electrical stimulation by the implant and brain derived neurotrophic factor (BDNF) has previously been shown to enhance spiral ganglion survival in experimentally deafened ears.
  • BDNF brain derived neurotrophic factor
  • Rejaii et al. tested a modified design of the cochlear implant electrode that includes a coating of " fi broblast cel ls transduced by a viral vector with a BDNF gene insert. To accomplish this type of ex vivo gene transfer, Rejaii et al.
  • transduced guinea pig fibroblasts with an adenovirus with a BDNF gene cassette insert and determined that these cells secreted BDNF and then attached BDNF-secreting cells to the cochlear implant electrode via an agarose gel, and implanted the electrode in the scala tympani.
  • Rejaii et al. determined that the BDNF expressing electrodes were able to preserve significantl more spiral ganglion neurons in the basal turns of the cochlea after 48 days of implantation when compared to control electrodes and demonstrated the feasibility of combining cochlear implant therapy with ex vivo gene transfer for enhancing spiral ganglion neuron survival.
  • Such a system may be applied to the CRISPR Cas system of the present invention for delivery to the ear.
  • the present invention also contemplates delivering the CRISPR-Cas system to one or both eyes.
  • the CRISPR-Cas system may be used to correct ocular defects that arise from several genetic mutations further described in Genetic Diseases of the Eye, Second Edition, edited by Elias I. Traboulsi, Oxford University Press, 2012.
  • lentiviral vectors for administration to the eye, lentiviral vectors, in particular equine infectious anemia viruses ( EJAV) are particularly preferred.
  • EJAV equine infectious anemia viruses
  • minimal non-primate lentiviral vectors based on the equine infectious anemia virus are also contemplated, especially for ocular gene therapy (see, e.g., Balagaan, J Gene Med 2006; 8: 275 - 285, Published online 21 November 2005 in Wiley InterScience (www.interscience.wiley.com). DOI: 10.1002/jgm.845).
  • the vectors are contemplated to have cytomegalovirus (CMV) promoter driving expression of the target gene.
  • CMV cytomegalovirus
  • Intraocular injections may be performed with the aid of an operating microscope.
  • eyes may be prolapsed by gentle digital pressure and fundi visualised using a contact lens system consisting of a drop of a coupling medium solution on the cornea covered with a glass microscope slide coverslip.
  • the tip of a I Q-mm 34-gauge needle, mounted on a 5- ⁇ 1 Hamilton syringe may be advanced under direct visualisation through the superior equatorial sclera tangential ly towards the posterior pole until the aperture of the needle was visible in the subretinal space. Then, 2 ⁇ of vector suspension may be injected to produce a superior bullous retinal detachment, thus confirming subretinal vector admin stration.
  • This approach creates a self-sealing sclerotomy allowing the vector suspension to be retained in the subretinal space until it is absorbed by the RPE, usually within 48 h of the procedure.
  • the needle tip may be advanced through the sclera 1 mm posterior to the corneoscleral limbus and 2 ⁇ of vector suspension injected into the vitreous cavity.
  • the needle tip may be advanced through a corneoscleral limbal paracentesis, directed towards the central cornea, and 2 ⁇ of vector suspension may be injected.
  • the needle tip may be advanced through a corneoscleral limbal paracentesis, directed towards the central cornea, and 2 ⁇ of vector suspension may be injected. These vectors may be injected at titres of either 1.0-1.4 x 10'° or 1.0-1.4 x 10 9 transducing units (TU)/ml.
  • RetinoStat® an equine infectious anemia virus-based lentiviral gene therapy vector that expresses angiostatic proteins endostain and angiostatin that is delivered via a subretinal injection for the treatment of the web form of age-related macular degeneration is also contemplated (see, e.g., Binley et al, HUMAN GENE THERAPY 23:980- 991 (September 2012)).
  • a vector may be modified for the C ISPR-Cas system of the present invention.
  • Each eye may be treated with either RctinoStat® at a dose of 1.1 x 10 3 transducing units per eye (TU/eye) in a total volume of 100 ⁇ .
  • an E 1 -, partial E3-, E4-deIeted adenoviral vector may be contemplated for delivery to the eye.
  • Twenty-eight patients with advanced neovaseular age- related macular degeneration (AMD) were given a single intravitreous injection of an E1 -, partial E3-, E4-deleted adenoviral vector expressing human pigment ep- itheiium-derived factor (AdPEDF.ll) (see, e.g., Campochiaro et al,, Human Gene Therapy 17: 167-176 (Februan' 2006)).
  • AdPEDF.ll human pigment ep- itheiium-derived factor
  • Adenoviral vector- mediated ocular gene transfer appears to be a viable approach for the treatment of ocular disorders and could be applied to the CRISPR Cas system.
  • the sd-rxRNA® system of RXi Pharmaceuticals may be used/and or adapted for delivering CRISPR Cas to the eye.
  • a single intravitreal administration of 3 ⁇ g of sd-rxRNA results in sequence-specific reduction of PPIB mRNA levels for 14 days.
  • the the sd-rxRNA® system may be applied to the CRISPR.
  • Cas system of the present invention contemplating a dose of about 3 to 20 mg of CRISPR administered to a human.
  • Miilington-Ward et al. (Molecular Therapy, vol. 19 no. 4, 642-649 apr. 2011) describes adeno-associated vims (AAV) vectors to deliver an RNA interference (RNAi)-based riiodopsin suppressor a d a codon-modified rhodopsin replacement gene resista t to suppression due to nucleotide alterations at degenerate positions over the RNAi target site.
  • RNAi RNA interference
  • An injection of either 6.0 x 10 6 vp or 1.8 x 10'° vp AAV were subretinaliy injected into the eyes by Millington- Ward et al.
  • the AAV vectors of Miilington-Ward et al. may be applied to the CRISPR Cas system of the present invention, contemplating a dose of about 2 x 10 f 1 to about 6 x 10 L ' vp administered to a human.
  • Dalkara et al. also relates to in vivo directed evolutio to fashion an AAV vector that delivers wild-type versio s of defective genes throughout the retina after noninjurious injection into the eyes' vitreous humor.
  • Dalkara describes a a 7mer peptide display library and an AAV library constmcted by DNA shuffling of cap genes from AAVl, 2, 4, 5, 6, 8, and 9.
  • the rcAAV libraries and r.AAV vectors expressing GFP under a CAG or Rho promoter were packaged and and deoxyribomiclease-resistant genomic titers were obtained through quantitative PGR.
  • the libraries were pooled, and two rounds of evolution were performed, each consisting of initial library diversification followed by three in vivo selection steps.
  • P30 rho-GFP mice were intravitrealiy injected with 2 ml of iodixanol-purified, phosphate-buffered saline (PBS)-dialyzed library with a genomic titer of about 1 x 10 1" vg/ml.
  • PBS phosphate-buffered saline
  • the AAV vectors of Dalkara et al. may be applied to the CRI SPR Cas system of the present invention, contemplating a dose of about 1 x 10° to about 1 x 10 i6 vg/ml administered to a human.
  • the rhodopsin gene may be targeted for the treatment of retinitis pigmentosa (RP), wherein the system of US Patent Publication No. 20120204282 assigned to Sangamo Biosciences, Inc. may be modified in accordance of the CRISPR Cas system of the present invention.
  • RP retinitis pigmentosa
  • US Patent Publication No. 20130183282 assigned to Cellectis which is directed to methods of cleaving a target sequence from the human rhodopsin gene, may also be modified to the CRISPR Cas system of the present invention.
  • US Patent Publication No. 20130202678 assigned to Academia Sinica relates to methods for treating retinopathies and sight-threatening ophthalmologic disorders relating to delivering of the Puf-A gene (which is expressed in retinal ganglion and pigmented cells of eye tissues and displays a unique anti-apoptotic activity) to the sub-retinal or intravitreal space in the eye.
  • desirable targets are zgc: 193933, prdmla, spata2, texlO, rbb4, ddx3, zp2.2, Blimp- 1 and HtrA2, all of which may be targeted by the CRISPR Cas system of the present invention.
  • Wu Cell Stem Cell, 13 :659-62, 2013
  • Wu designed a guide RNA that led Cas9 to a single base pair mutation that causes cataracts in mice, where it induced DNA cleavage. Then using either the other wild-type allele or oligos given to the zygotes repair mechanisms corrected the sequence of the broken al lele and corrected the cataract-causing genetic defect in mutant mouse.
  • US Patent Publication No. 20120159653 describes use of zinc finger nucleases to genetically modify cel ls, animals and proteins associated with macular degeration (MD).
  • Macular degeneration is the primary cause of visual impairment in the elderly, but is also a hallmark symptom of childhood diseases such as Stargardt disease, Sorsby fundus, and fatal childhood neurodegenerative diseases, with an age of onset as young as infancy. Macular degeneration results in a loss of vision in the center of the visual field (the macula) because of damage to the retina.
  • Currently existing animal models do not recapitulate major hallmarks of the disease as it is observed in humans.
  • the available animal models comprising mutant genes encoding proteins associated with MD also produce highly variable phenotypes, making translations to human disease and therapy development problematic.
  • US Patent Publication No. 20120159653 relates to editing of any chromosomal sequences that encode proteins associated with MD which may be applied to the CRISPR Cas system of the present invention.
  • the proteins associated with MD are typically selected based on an experimental association of the protein associated with MD to an MD disorder. For example, the production rate or circulating concentration of a protein associated with D may be elevated or depressed in a population having an MD disorder relative to a population lacking the MD disorder. Differences in protein levels may be assessed using proteomic techniques including but not limited to Western blot, immunohistochemical staining, enzyme linked immunosorbent assay (ELISA), and mass spectrometry.
  • the proteins associated with MD may be identified by obtaining gene expression profiles of the genes encoding the proteins using genomic techniques including but not limited to DNA microarray analysis, serial analysis of gene expression (SAGE), and quantitative real-time polymerase chain reaction (Q-PCR).
  • proteins associated with MD include but are not limited to the following proteins: (ABCA4) ATP-binding cassette, sub-family A (ABC1), member 4 ACH 1 achromatopsia (rod monochromacy) 1 ApoE Apolipoprotein E (ApoE) C1 QTNF5 (CTRP5) Clq and tumor necrosis factor related protein 5 (C 1QTNF5) C2 Complement component 2 (C2) C3 Complement components (C3) CCL2 Chemokine (C-C motif) Ligand 2 (CCL2) CCR2 Chemokine (C-C motif) receptor 2 (CCR2) CD36 Cluster of Differentiation 36 CFB Complement factor B CFH Complement factor CFH H CFHR1 complement factor H-related 1 CFHR3 complement factor H -related 3 C GB3 cyclic nucleotide gated channel beta 3 CP cemioplasmin (CP) CRP C reactive protein (CRP) CST3 cystatin C or
  • PRPH2 Peripheri.n-2 RPGR retinitis pigmentosa GTPase regulator SERPINOl serpin peptidase inhibitor, clade G, member 1 (CI- inhibitor) TCOF1 Treacle TIMP3 Metalloproteinase inhibitor 3 (TTMP3) TLR3 Toil-like receptor 3
  • the proteins associated with MD whose chromosomal sequence is edited can and will vary.
  • the proteins associated with MD whose chromosomal sequence is edited may be the ATP-binding cassette, sub-family A (ABC1) member 4 protein (ABCA4) encoded by the ABCR gene, the apolipoprotein E protein (APOE) encoded by the APOE gene, the chemokine (C-C motif) Ligand 2 protei (CCL2) encoded by the CCL2 gene, the chemokine (C-C motif) receptor 2 protein (CCR2) encoded by the CCR2 gene, the cemioplasmin protein (CP) encoded by the CP gene, the cathepsin D protein (CTSD) encoded by the CTSD gene, or the metalloproteinase inhibitor 3 protein (TIMP3) encoded by the T MP3 gene.
  • ABSC1 sub-family A
  • APOE apolipoprotein E protein
  • CCR2 chemokine (C-C motif) Ligand 2 protei
  • the genetically modified animal is a rat
  • the edited chromosomal sequence encoding the protein associated with MD may be: (ABCA4) ATP- binding cassette, NM_000350 sub-family A (ABCl ), member 4 APOE abaipoprotein E NM 138828 (APOE) CCL2 Chemokine (C-C NM 031530 motif) Ligand 2 (CCL2) CCR2 Chemokine (C-C NM_021 S66 motif ⁇ receptor 2 (CCR2) CP ceruiopiasmin (CP) NMJ312532 CTSD Cathepsin D (CTSD) NM 134334 TIMP3 Metalloprotemase NM 012886 inhibitor 3 (TIMP3)
  • the animal or cell may comprise 1, 2, 3, 4, 5, 6, 7 or more disrupted chromosomal sequences encoding a protein associated with MD and zero, 1 , 2, 3, 4, 5, 6, 7 or more chromosomally integrated sequences encoding the disrupted protein associated with MD
  • the edited or integrated chromosomal sequence may be modified to encode an altered protein associated with MD.
  • Several mutations in MD-related chromosomal sequences have been associated with MD.
  • Non-limiting examples of mutations in chromosomal sequences associated with MD include those that may cause MD i cluding in the ABCR protein, E471 (i.e. glutamate at position 471 is changed to lysine), Rl 129L (i.e. arginine at position 1129 is changed to leucine), T1428M (i.e. threonine at position 1428 is changed to methionine), R1517S (i.e. arginine at position 1517 is changed to serine), I1562T (i.e.
  • isoleucine at position 1562 is changed to threonine
  • G1578R i.e. glycine at position 1578 is changed to arginine
  • V64I i.e. valine at position 192 is changed to isoleucine
  • G969B i.e. glycine at position 969 is changed to asparagine or aspartate
  • S156C i.e. serine at position 156 is changed to cysteine
  • G166C i.e. glycine at position 166 is changed to cysteine
  • G167C i.e. glycine at position 167 is changed to cysteine
  • Y168C i.e.
  • tyrosine at position 168 is cha ged to cysteine
  • S170C i.e. serine at position 170 is changed to cysteine
  • YT72C i.e. tyrosine at position 172 is changed to cysteine
  • S1 81C i.e. serine at position 181 is changed to cysteine
  • the present invention also contemplates delivering the CRISPR-Cas system to the heart.
  • a myocardium tropic adena-assoeiated vims (AAVM) is preferred, in particular AAVM41 which showed preferential gene transfer in the heart (see, e.g., Lin-Yanga et ai., PNAS, March 10, 2009, vol. 106, no. 10).
  • Administration may be systemic or local.
  • a dosage of about 1-10 x 10 ' ' vector genomes are contemplated for systemic administration. See also, e.g., Eulalio et al. (2012) Nature 492: 376 and Somasuntharam et al.
  • Cardiovascular diseases generally include high blood pressure, heart attacks, heart failure, and stroke and TLA.
  • Any chromosomal sequence involved in cardiovascular disease or the protein encoded by any chromosomal sequence involved in cardiovascular disease may be utilized in the methods described in this disclosure.
  • the cardiovascular-re Sated proteins are typically selected based on an experimental association of the cardiovascular-related protein to the development of cardiovascular disease. For example, the production rate or circulating concentration of a cardiovascular-related protein may be elevated or depressed in a population having a cardiovascular disorder relative to a population lacking the cardiovascular disorder.
  • Differences in protein levels may be assessed using proteomic techniques including but not limited to Western blot, immunohistochemical staining, enzyme linked immunosorbent assay (ELISA), and mass spectrometry.
  • the cardiovascular-related proteins may be identified by obtaining gene expression profiles of the genes encoding the proteins using genomic techniques including but not limited to DNA microarray analysis, serial analysis of gene expression (SAGE), and quantitative real-time polymerase chain reaction (Q-PCR).
  • the chromosomal sequence may comprise, but is not limited to, IL1B (interieukin 1, beta), XDH (xanthine dehydrogenase), TP53 (tumor protein p53), PTG1S (prostaglandin 12 (prostacyclin) synthase), MB (myoglobin), IL4 (interieukin 4), ANGPT1 (angiopoietin 1 ), ABCG8 (ATP-bindmg cassette, sub-family G (WHITE), member 8), CTSK (cathepsiii K), PTGIR (prostaglandin 12 (prostacyclin) receptor (IP)), CNJ11 (potassium inwardly-rectifying channel, subfamily J, member 1 1), INS (insulin), CRP (C -reactive protein, pentraxm-related), PDGFRB (platelet-derived growth factor receptor, beta polypeptide), CCNA2 (cyclin A2), PDGFB (IL1B (interieukin 1,
  • ACE angiotensin I converting enzyme peptidyl-dipeptidase A) I
  • TNF tumor necrosis factor
  • IL6 interleukin 6 (interferon, beta 2)
  • STN statin
  • SERPINEl seroton peptidase inhibitor
  • clade E nonin, plasminogen activator mhibitor type 1
  • ALB albumin
  • ADIPOQ adiponectin, C1Q and collagen domain containing
  • APOB apolipoprotein B (including Ag(x) antigen)
  • APOE apo lipoprotein E
  • LEP laeptin
  • MTHFR 5,10-methy!enetetrahydrofolate reductase (NADPH)
  • APOAl apolipoprotein A-I
  • EDN1 endothelin 1
  • NPPB natriuretic peptide precursor B
  • NOS3 nitric oxide
  • IGF1 insulin-like growth factor 1 (somatomedin C)
  • SELE selectivein E
  • REN renin
  • PPARA peroxisome proliferator-activated receptor alpha
  • PON1 paraoxoiiase 1
  • KNG1 kininogen 1
  • CCL2 chemokine (C-C motif) ligand 2
  • LPL lipoprotein lipase
  • VWF von Willebrand factor
  • F2 coagulation factor II (thrombin)
  • ICAM1 intercellular adhesion molecule 1
  • TGFB1 transforming growth factor, beta 1
  • NPPA natriuretic peptide precursor A
  • ILIO interleukin 10
  • EPO erythropoietin
  • SOD1 superoxide dismutase 1, soluble
  • VCAM 1 vascular cell adhesion molecule 1
  • IFNG interferon, gamma
  • LPA lipoprotein, Lp(a)
  • MPO mye
  • ABCA l ATP -binding cassette, sub-family A (ABC!), member 1), AGT (angiotensinogen (serpin peptidase inhibitor, clade A, member 8)), LDLR (low density lipoprotein receptor), GPT (glutamic-pyruvate transaminase (alanine aminotransferase)), VEGFA (vascular endothelial growth factor A), R3C2 (nuclear receptor subfamily 3, group C, member 2), IL1 8 (inter!eukirs 18 (interferon-gamma-inducing factor)), NOS1 (nitric oxide synthase 1 (neuronal)), NR3C1 (nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)), FGB (fibrinogen beta chain), GF (hepatocyte growth factor (hepapoietin A; scatter factor)), ILIA (interleukin 1, alpha), RETN (resistin
  • TTR transthyretin
  • FABP4 fatty acid binding protein 4, adipocyte
  • PON3 paraoxonase 3
  • APOC1 apolipoprotein C-I
  • INSR insulin receptor
  • TNFRSF1B tumor necrosis factor receptor superfamily, member IB
  • HTR2A 5-hydroxyrxyptamine (serotonin) receptor 2A
  • CSF3 colony stimulating factor 3 (granulocyte)
  • CYP2C9 cytochrome P450, family 2, subfamily C, polypeptide 9
  • TXN thiorcdo in
  • CYP11 B2 cytochrome P450, family 1 1, subfamily B, polypeptide 2
  • PTH parathyroid hormone
  • CSF2 colony stimulating factor 2 (granulocyte-macrophage)
  • KDR kinase insert domain receptor (a type If f receptor tyrosine kinase)
  • PLA2G2A phospholipase A
  • Notch homoiog 1 transiocation-associated (Drosophila)
  • UGTIA I UDP giucuronosyltransferase 1 family, polypeptide Al
  • IFNAl interferon, alpha 1
  • PPARD peroxisome pro iiferator-activated receptor delta
  • SIRTl sirtuin (silent mating type information regulation 2 homoiog) 1 (S.
  • GNRH1 gonadotrop in-releasing hormone 1 (luteinizing-reieasing hormone)
  • PAPPA pregnancy-associated plasma protein A, pappalysin 1
  • ARR3 arrestin 3, retinal (X-arrestin)
  • NPPC natriuretic peptide precursor C
  • AHSP alpha hemoglobin stabilizing protein
  • PTK2 PTK2 protein tyrosine kinase 2
  • IL13 interleukin 13
  • MTOR mechanistic target of rapamycin (serine/threonine kinase)
  • ITGB2 integratedin, beta 2 (complement component 3 receptor 3 and 4 subunit)
  • GSTTl glutthione S-transferase theta 1
  • IL6ST interleukin 6 signal transducer (gpl30, oncostatin M receptor)
  • CPB2 eyeboxypeptidase B2 (plasma)
  • CYP1A2 cytochromethreonine
  • COLIAI collagen, type I, alpha 1
  • COL1A2 collagen, type I, alpha 2
  • IL2RB interleukin 2 receptor, beta
  • PLA2G10 phospholipase A2, group X
  • ANGPT2 angiopoietin 2
  • PROCR protein C receptor, endothelial (EPCR)
  • NOX4 NADPH oxidase 4
  • HAMP hepcidin antimicrobial peptide
  • PTP 11 protein tyrosine phosphatase, non-receptor type 1 1
  • SLC2A1 solute carrier family 2 (facilitated glucose transporter), member 1)
  • IL2RA interleuki 2 receptor, alpha
  • CCL5 chemokine (C-C motif) ligand 5
  • IRF1 interferon regulatory factor 1
  • CFLAR CASP8 and FADD-like apoptosis regulator
  • CALCA caicitonin-reiated polypeptide alpha
  • EIF ex
  • CAMP cathelicidin antimicrobial peptide
  • ZC3H 12A zinc finger CCCH-type containing 12 A
  • a R1B3 a do-keto reductase family 1 , member Bl (aldose reductase)
  • DBS desmin
  • MMP7 matrix metal lopeptidasc 7 (matrilysin, uterine) ⁇
  • AFJR aryl hydrocarbon receptor
  • CSF3 colony stimulating factor 1 (macrophage)
  • HDAC9 histone deacetylase 9
  • CTGF connective tissue growth factor
  • KCNMA1 potassium large conductance calcium- activated channel, subfamily M, alpha member 1)
  • UGT1A UDP glucuronosyltransferase I family, polypeptide A complex locus
  • PRKCA protein kinase C, alpha
  • COMT catechol- .beta.-methyltransferase
  • coagulation factor XI coagulation factor XI
  • ATP7A AT ase, Cu++ transporting, alpha polypeptide
  • CR1 complement component (3b/4b) receptor 1 (Kiiops blood group)
  • GFAP glial fibrillary acidic protein
  • ROCK1 Rho-associated, coiled-coil containing protein kinase 1
  • MECP2 methyl CpG binding protein 2 (Rett syndrome)
  • MYLK myosin light chain kinase
  • BCHE butyrylcholinesterase
  • LIPE lipase, hormone-sensitive
  • PRDX5 peroxiredoxin 5
  • ADORA1 adenosine Al receptor
  • WRN Werner syndrome, RecQ helicase- iike
  • CXCR3 chemokine (C-X-C motif) receptor 3
  • CD81 CD81 molecule
  • SMAD7 SMAD family member 7
  • LAMC2 laminin, gamma 2
  • the chromosomal sequences and proteins encoded by chromosomal sequences involved in cardiovascular disease may be chosen from CacnalC, Sodl, Pten, Ppar(alpha), Apo E, Leptin, and combinations thereof.
  • the present invention also contemplates delivering the CRISPR-Cas system to the kidney.
  • Delivery strategies to induce cellular uptake of the therapeutic nucleic acid include physical force or vector systems such as viral-, lipid- or complex- based delivery, or nanocarriers. From the initial applications with less possible clinical relevance, when nucleic acids were addressed to renal ceils with hydrodynamic high pressure injection systemicaily, a wide range of gene therapeutic " viral, and non-viral carriers have been applied already to target posttraiiscriptional events in different animal kidney disease models in vivo (Csaba Revesz and Peter Hamar (201 1). Delivery Methods to Target RNAs in the Kidney, Gene Therapy Applications, Prof. Chtinsheng Kang (Ed.), ISBN: 978-953-307-541 -9, InTech, Available from: p:// .nHecbope ⁇
  • DOTAP/DOPE 231 breast Mikhaylova el al., DOTAP/DO Breast adenocancer Cell viability, dancer Gene Therapy
  • nanofiber 144 No. 2, pp.
  • Yuan et al. (Am J Physiol Renal Physiol 295: F605--F617, 2008) investigated whether in vivo delivery of small interfering RNAs (siRNAs) targeting the 12/ 15 -lipoxygenase (12/15- LO) pathway of arachidonate acid metabolism can ameliorate renal injury and diabetic nephropathy (DN) in a streptozotocininjecied mouse model of type 1 diabetes.
  • siRNAs small interfering RNAs
  • DN diabetic nephropathy
  • Yuan et al. used double-stranded 12/15-LO siRNA oligonucleotides conjugated with cholesterol. About 400 ⁇ g of siRNA was injected subcutaneouslv into mice.
  • the method of Yuang et. al. may be applied to the CRISPR Cas system of the present invention contemplating a 1-2 g subcutaneous injection of CRISPR Cas conjugated with cholesterol to a human for delivery to the kidneys.
  • Molitoris et al. J Am Soc Nephrol 20: 1754-1764, 2009
  • the 12 and 20 mg kg cumulative doses provided the best protective effect.
  • the method of Molitoris et al. may be applied to the CRISPR Cas system of the present invention contemplating 12 a d 20 mg kg cumulative doses to a human for deliver ⁇ ' to the kidneys.
  • RNA interference pathway to temporarily inhibit expression of the pro-apoptotic protein p53 and is being developed to protect cells from acute ischemia/reperfusion injuries such as acute kid ey injury that can occur during major cardiac surgery and delayed graft function that can occur fol lowing renal transplantation.
  • siRNA'naiio carrier complexes After intraperitoneal injection of fluorescence-labeled siRNA'naiio carrier complexes, Shimizu et al. detected siRNAs in the blood circulation for a prolonged time.
  • a mitogen-activated protein kinase 1 (MAPKl) siRNA/nanocarrier complex suppressed glomerular MAPKl mRNA and protein expression in a mouse model of glomerulonephritis.
  • MAPKl mitogen-activated protein kinase 1
  • Cy5 -labeled siRNAs complexed with PIC nanocarriers 0.5 ml, 5 nmol of siRNA content
  • naked Cy5-labeled siRNAs 0.5 ml, 5 nmol
  • Cy5-labeled siRN As encapsulated in HVJ-E 0.5 ml, 5 nmol of siRN A content
  • the method of Shimizu et al. may be applied to the CRISPR Cas system of the present invention contemplating a dose of about of 10-20 ⁇ /mo! CRISPR Cas complexed with nanocarriers in about 1-2 liters to a human for intraperitoneal administration and delivery to the kidneys.
  • the present invention also contemplates delivering the CRISPR -Cas system to oneor both lungs.
  • AAV-2-based vectors were originally proposed for CFTR delivery to CF airways, other serotypes such as AAV-1 , AAV -5, AAV-6, and AAV-9 exhibit improved gene transfer efficiency in a variety of models of the lung epithelium (see, e.g., Li et al., Molecular Therapy, vol. 17 no. 12, 2067-2077 Dec 2009).
  • AAV-1 was demonstrated to be -100-fold more efficient than AAV -2 and AAV-5 at transducing human airway epithelial cells in vitro, 5 although AAV- 3 transduced murine tracheal airway epithelia in vivo with an efficiency equal to that of AAV-5.
  • AAV-5 is 50-fold more efficient than AAV-2 at gene delivery to human airway epithelium (HAE) in vitro and significantly more efficient in the mouse lung airway epithelium in vivo.
  • AAV-6 has also been shown to be more efficient than AAV-2 in human airway epithelial cells in vitro and murine airways in vivo.8
  • AAV-9 was shown to display greater gene transfer efficiency than AAV-5 in murine nasal and alveolar epithelia in vivo with gene expression detected for over 9 months suggesting AAV may enable long-term gene expression in vivo, a desirable property for a CFTR gene delivery vector.
  • CF and non- CF HAE cultures may be inoculated on the apical surface with 100 ⁇ of AAV vectors for hours (see, e.g., Li et al., Molecular Therapy, vol. 17 no. 12, 2067-2077 Dec 2009).
  • the MOI may vary from 1 x 10 3 to 4 x 10 5 vector genomes/cell, depending on virus concentration and purposes of the experiments.
  • the above cited vectors are contemplated for the deliver ⁇ ' and/or admin stration of the invention .
  • Zamora et ai (Am J Respir Grit Care Med Vol 183. pp 531-538, 201 1) reported an example of the application of an RNA interference therapeutic to the treatment of human infectious disease and also a randomized trial of an antiviral drug in respiratory syncytial virus (RSV)-infected lung transplant recipients.
  • RSV respiratory syncytial virus
  • Zamora et al performed a randomized, double-blind, placebocontrolled trial in LTX recipients with RSV respiratory tract infection. Patients were permitted to receive standard of care for RSV. Aerosolized ALN-RS V01 (0.6 mg kg) or placebo was administered daily for 3 days. This study demonstrates that an RNAi therapeutic targeting RSV can be safely administered to LTX recipients with RSV infection.
  • ALN-RSVG 1 Three daily doses of ALN-RSVG 1 did not result in any exacerbation of respiratory tract symptoms or impairment of lung function and did not exhibit any systemic proinflammatory effects, such as induction of cytokines or GRP. Pharmacokinetics showed only low, transient systemic exposure after inhalation, consistent with preclinical animal data showing that ALN-RSV01, administered intravenous])' or by inhalation, is rapidly cleared from the circulation through exonucleasemediated digestion a d renal excretion.
  • the method of Zamora et al. may be applied to the CR ISPR Cas system of the present invention and an aerosolized CRISPR Cas, for example with a dosage of 0.6 mg/kg, may be contemplated for the present invention.
  • Example 22 demonstrates gene transfer or gene delivery of a CRISPR-Cas system in airways of subject or a patient in need thereof, suffering from cystic fibrosis or from cystic fibrosis (CF) related symptoms, using adeno-associated virus (AAV) particles.
  • AAV adeno-associated virus
  • CF cystic fibrosis
  • suitable patients may include: Human, non-primate human, canine, feline, bovine, equine and other domestic animals.
  • Applica ts utilized a CRISPR-Cas system comprising a Cas9 enzyme to target deltaF508 or other CFTR- inducing mutations.
  • aerosolized AAV vector system per lung endobronchial ⁇ delivered while spontaneously breathing.
  • aerosolized delivery is preferred for AAV delivery in general.
  • An adenovirus or an AAV particle may be used for delivery.
  • Suitable gene constructs, each operably linked to one or more regulatory sequences, may be cloned into the delivery vector.
  • Cbh or EFla promoter for Cas9, U6 or HI promoter for chimeric guide RNA A preferred arrangement is to use a CFTRdelta508 targeting chimeric guide, a repair template for deltaF508 mutation and a codon optimized Cas9 enzyme (preferred Cas9s are those with nuclease or nickase activity) with optionally one or more nuclear localization signal or sequence(s) (NLS(s)), e.g., two (2) NLSs. Constructs without NLS are also envisaged.
  • the PAM may contain a GG or a NNAGAAW motif.
  • the present method comprises manipulation of a target sequence in a genomic locus of interest comprising
  • composition comprising a viral vector system comprising one or more viral vectors operably encoding a composition for expression thereof, wherein the composition comprises:
  • composition comprising a vector system comprising one or more vectors comprising
  • a first regulator ⁇ ' element operably linked to a CRISPR-Cas system chimeric RNA (chiRNA) polynucleotide sequence, wherein the polynucleotide sequence comprises
  • a second regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme comprising at least one or more nuclear localization sequences, wherein (a), (b) and (c) are arranged in a 5' to 3' orientation,
  • components I and II are located on the same or different vectors of the system, wherein when tra scribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence.
  • preferred target DNA sequences comprise the CFTRdelta508 mutation.
  • a preferred PAM is described above.
  • a preferred CRISPR enzyme is any Cas (described herein, but particularly that described in Example 22).
  • Alternatives to CF include any genetic disorder and examples of these are well kno wn.
  • Another preferred method or use of the in vention is for correcting defects in the E P2A and EMP2B genes that have been identified to be associated with Lafora disease.
  • a "guide sequence” may be distinct from “guide RNA”.
  • a guide sequence may refer to an approx. 20bp sequence, within the guide RNA, that specifies the target site.
  • the Cas9 is (or is derived from) SpCas9.
  • preferred mutations are at any or all or positions 10, 762, 840, 854, 863 and/or 986 of SpCas9 or corresponding positions in other Cas9s (which may be ascertained for instance by standard sequence comparison tools.
  • any or ail of the following mutations are preferred in SpCas9: D10A, E762A, H840A, N854A, N863A and/or D986A; as well as conservative substitution for any of the replacement amino acids is also envisaged.
  • the same (or conservative substitutions of these mutations) at corresponding positions in other Cas9s are also preferred.
  • residues corresponding to SpCas9 D10 and H840 are also preferred. These are advantageous as they provide nickase activity.
  • Such mutations may be applied to all aspects of the present invention, not only treat ment of CF.
  • Schwank et al. (Ceil Stem Cell, 13:653-58, 2013) used CRISPR/Cas9 to correct a defect associated with cystic fibrosis in human stem ceils.
  • the team's target was the gene for an ion channel, cystic " fibrosis transmembrane conductor receptor (CFTR).
  • CFTR fibrosis transmembrane conductor receptor
  • a deletion in CFTR causes the protein to misfold in cystic fibrosis patients.
  • CFTR fibrosis transmembrane conductor receptor
  • the present invention also contemplates delivering the CRISPR-Cas system to muscle(s).
  • Bortolanza et al found that a single intravenous injection of 5 x 10 " vg of rAAV6-shlFRGl rescues muscle histopathology and muscle function of FRG1 mice, hi detail, 200 ⁇ containing 2 x 10 1 " or 5 x 10 f vg of vector in physiological solution were injected into the tail vein using a 25 -gauge Terumo syringe.
  • the method of Bortolanza et al. may be applied to an AAV expressing CRJSPR Cas and injected into humans at a dosage of about 2 ⁇ lO 13 or 2 x 10 i 6 vg of vector.
  • Dumonceaux et al. inhibit the myostatin pathway using the technique of RNA interference directed against the myostatin receptor AcvRIIb mRNA (sh-AcvRIIb).
  • the restoration of a quasi-dystrophin was mediated by the vectorized U7 exon-skippirsg technique (U7-DYS).
  • Adeno-associated vectors carrying either the sh-Acvrllb construct alone, the U7-DYS construct alone, or a combination of both constructs were injected in the tibialis anterior (TA) muscle of dystrophic mdx mice. The injections were performed with 10 n AAV viral genomes.
  • the method of Dumonceaux et al. may be applied to an AAV expressing CRJSPR Cas and injected into humans, for example, at a dosage of about 10 l" to about 10 f 5 vg of vector.
  • inouchi et al. reports the effectiveness of in vivo siRNA deliver)? into skeletal muscles of normal or diseased mice through nanoparticfe formation of chemically unmodified siRNAs with atelocoUagen (ATCOL), ATCOL-mediated local application of siRNA targeting myostatin, a negative regulator of skeletal muscle growth, in mouse skeletal muscles or intravenously, caused a marked increase in the muscle mass within a few weeks after application.
  • ATCOL-mediated application of siRNAs is a powerful tool for future therapeutic use for diseases including muscular atrophy.
  • Mst- siRNAs (final concentration, 10 niM) were mixed with ATCOL (final concentration for local administration, 0.5%) (AteioGene, Kohken, Tokyo, Japan) according to the manufacturer's instructions. After anesthesia of mice (20-week-old male C57BL/6) by Nembutal (25 mg/kg, i.p.), the Mst-siRNA/ATCOL complex was injected into the masseter and biceps femoris muscles.
  • the method of Kinouchi et ai. may be applied to CRISPR Cas and injected into a human, for example, at a dosage of about 500 to 1000 ml of a 40 ⁇ solution into the muscle.
  • Hagstrom et al. (Molecular Therapy Vol. 10, No. 2, August 2004) describe an intravascular, nonviral methodology that enables efficient and repeatabie delivery of nucleic acids to muscle cells (myofibers) throughout the limb muscles of mammals.
  • the procedure involves the injection of naked plasmid DNA or siRNA into a distal vein of a limb that is transiently isolated by a tourniquet or blood pressure cuff.
  • Nucleic acid deliver ⁇ .' to myofibers is facilitated by its rapid injection in sufficient volume to enable extravasation of the nucleic acid solution into muscle tissue.
  • High levels of transgene expression in skeletal muscle were achieved in both small and large animals with minimal toxicity.
  • Evidence of siRNA delivery to limb muscle was also obtained.
  • plasmid DNA intravenous injection into a rhesus monkey a threeway stopcock was connected to two syringe pumps (Model PHD 2000; Harvard Instruments), each loaded with a single swinge.
  • pDNA (15.5 to 25.7 mg in 40 -100 ml saline) was injected at a rate of 1.7 or 2.0 mi/s.
  • This could be scaled up for plasmid DNA expressing CRISPR Cas of the present invention with an injection of about 300 to 500 mg in 800 to 2000 ml saline for a human.
  • adenoviral vector injections into a rat 2 x 10 9 infectious particles were injected in 3 ml of normal saline solution (NSS).
  • siRNA a rat was injected into the great saphenous vein with 12.5 ⁇ of a siRNA and a primate was injected injected into the great saphenous vein with 750 ug of a siRNA.
  • the present invention also contemplates delivering the CRISPR-Cas system to the skin.
  • Hickerso et al. Molecular Therapy— Nucleic Acids (2013) 2, el 29
  • sd self-delivery
  • the primary challenge to translating siRNA-based skin therapeutics to the clinic is the development of effective delivery systems. Substantial effort has been invested in a variety of skin delivery technologies with limited success.
  • Microneedles represent an efficient way to deliver large charged cargos including siRNAs across the primary barrier, the stratum corneum, and are generally regarded as less painful than conventional hypodermic needles.
  • MMNA motorized microneedle array
  • Hickerson et al. Motorized "stamp type" microneedle devices, including the motorized microneedle array (MMNA) device used by Hickerson et al., have been shown to be safe in hairless mice studies and cause little or no pain as evidenced by (i) widespread use in the cosmetic industry and (ii) limited testing in which nearly all volunteers found use of the device to be much less painful than a flushot, suggesting siRNA delivery using this device will result in .much less pain than was experienced in the previous clinical trial using hypodermic needle injections.
  • the MMNA device (marketed as Triple-M or Tri-M by Bomtech Electronic Co, Seoul, South Korea) was adapted for delivery of siRNA to mouse and human skin. sd-siRNA solution (up to 300 ⁇ !
  • RNA 0.1 mg ml RNA
  • Tri-M needle cartridge Bomtech
  • deidentified skin obtained immediately following surgical procedures
  • Al l intradermal injections were performed using an insulin syringe with a 28-gauge 0.5-inch needle.
  • the MMNA device and method of Hickerson et al. could be used and/or adapted to deliver the CRISPR Cas of the present invention, for example, a a dosage of up to 300 ⁇ of 0.1 mg/ml CRISPR Cas to the skin.
  • Leachman et al. (Molecular Therapy, vol. 18 no. 2, 442-446 Feb. 2010) relates to a phase lb clinical trial for treatment of a rare skin disorder pachyonychia congenita (PC), an autosomal dominant syndrome that includes a disabling plantar keratoderma, utilizing the first short-interfering RNA (siRNA)-based therapeutic for skin.
  • This siRNA called TD101 , specifically and potently targets the keratin 6a (K6a) N171K mutant mRNA without affecting wild-type K6a mRNA.
  • the dose-escalation schedule is presented below: Week EH5iii fs3 ⁇ 4 Days VoSsiros TD!isi iifstf..3 ⁇ 43 ⁇ 4 TD18 (sag)
  • Zheng et al. show that spherical nucleic acid nanoparticle conjugates (SNA-NCs), gold cores surrounded by a dense shell of highly oriented, covalently immobilized siRNA, freely penetrate almost 100% of keratinocytes in vitro, mouse skin, and human epidermis within hours after application.
  • SNA-NCs spherical nucleic acid nanoparticle conjugates
  • Zheng et al. demonstrated that a single application of 25 nM epidermal growth factor receptor (EGFR) SNA-NCs for 60 h demonstrate effective gene knockdown in human skin.
  • EGFR epidermal growth factor receptor
  • a similar dosage may be contemplated for CRISPR Cas immobilized in SNA-NCs for administration to the skin.
  • the present invention may also be applied to treat hepatitis B virus (HBV).
  • HBV hepatitis B virus
  • the CRISPR Cas system must be adapted to avoid the shortcomings of NAi, such as the risk of oversaving endogenous small RNA pathways, by for example, optimizing dose and sequence (see, e.g., Grimm et al., Nature vol. 441, 26 May 2006).
  • low doses such as about 1 -10 x 10 14 particles per humane are contemplated.
  • the CRISPR Cas system directed against HBV may be administered in liposomes, such as a stable nucleic-acid-lipid particle (SNALP) (see, e.g., Morrissey et al.. Nature Biotechnology, Vol. 23, No. 8, August 2005).
  • SNALP stable nucleic-acid-lipid particle
  • Daily intravenous injections of about 1 , 3 or 5 rag/kg/day of CRISPR Cas targeted to HBV RNA in a SNALP are contemplated.
  • the daily treatment may be over about three days and then weekly for about five weeks.
  • the system of Chen et al. may be used/and or adapted for the CR ISPR.
  • Chen et al. use a double-stranded adenoassociated virus 8-pseudotyped vector (dsAAV2/8) to deliver shRNA.
  • dsAAV2/8 double-stranded adenoassociated virus 8-pseudotyped vector
  • a CRISPR Cas system directed to HBV may be cloned into an AAA' " vector, such as a dsAAV2/8 vector and administered to a human, for example, at a dosage of about I x 10 1 s vector genomes to about 1 x 10 i6 vector genomes per human.
  • Wooddeil et al. (Molecular Therapy vol. 21 no. 5, 973-985 May 2013) may be used/and or adapted to the CRISPR Cas system of the present invention.
  • Woodell et al. show r that simple coinjection of a hepatocyte-targeted, N- acetylgaiactosamine-conj ugated melittin-like peptide (NAG-MLP) with a liver-tropic cholesterol-conjugated siRNA (choi-siR A) targeting coagulation factor VII (F7) results in efficient F7 knockdown i mice and nonhuman primates without changes in clinical chemistry or induction of cytokines.
  • NAG-MLP N- acetylgaiactosamine-conj ugated melittin-like peptide
  • choi-siR A liver-tropic cholesterol-conjugated siRNA
  • F7 coagulation factor VII
  • the present invention may also be applied to treat hepatitis C virus (HCV).
  • HCV hepatitis C virus
  • the methods of Roelvinki et al. may be applied to the CRISPR Cas system.
  • an AAV vector such as AAV8 may be a contemplated vector and for example a dosage of about 1.25 x 10 n to 1.25 lG fJ vector genomes per kilogram body weight (vg/kg) may be contemplated.
  • RNA interference offers therapeutic potential for this disorder by reducing the expression of HTT, the disease-causing gene of Huntington's disease (see, e.g., McBride et al., Molecular Therapy vol. 19 no. 12 Dec. 201 1, pp. 2152-2162), therefore Applicant postulates that it may be used/and or adapted to the CRISPR-Cas system.
  • the CRISPR-Cas system may be generated using an algorithm to reduce the off-targeting potential of antisense sequences.
  • the CRISPR-Cas sequences may target either a sequence in exon 52 of mouse, rhesus or human huntingtin and expressed in a viral vector, such as AAV.
  • Animals, including humans, may be injected with about three microinjections per hemisphere (six injections total): the first 1 mm rostral to the anterior commissure (12 ⁇ ) and the two remaining injections (12 ⁇ and 10 ⁇ , respectively) spaced 3 and 6 mm caudal to the first injection with le!2 vg ml of AAV at a rate of about 1 ⁇ /minute, and the needle was left in place for an additional 5 minutes to allow the injectate to diffuse from the needle tip.
  • DiFiglia et al. (PNAS, October 23, 2007, vol. 104, no. 43, 17204-17209) observed that single administration into the adult striatum of an siRNA targeting Hit can silence nun an! Htt, attenuate neuronal pathology, and delay the abnormal behavioral phenotype observed in a rapid-onset, viral transgenic mouse model of HD.
  • DiFiglia injected mice intrastriatally with 2 ⁇ of Cy3-labeled cc-siRNA-Htt or unconjugated siRNA-Htt at 10 ⁇ .
  • CRISPR Cas targeted to Htt may be contemplated for humans in the present invention, for example, about 5-10 ml of 10 ⁇ CRISPR Cas targeted to Htt may be injected intrastriatally.
  • Boudreau et al. (Molecular Therapy vol, 17 no. 6 June 2009) injects 5 ⁇ of recombinant AAV serotype 2/ 1 vectors expressing htt-specific R Ai virus (at 4 x ⁇ 1" viral genomes/ml) into the straiatum.
  • CRISPR Cas targeted to Htt may be contemplated for humans in the present invention, for example, about 10-20 ml of 4 x 10 f viral genomes/ml) CRISPR Cas targeted to Htt may be injected intrastriatally.
  • a CRISPR Cas targetd to HTT may be administered continuously (see, e.g., Yu et al., Cell 150, 895-908, August 31, 2012). Yu et al. utilizes osmotic pumps delivering 0.25 ml hr (Model 2004) to deliver 300 mg/day of ss-siRNA or phosphate-buffered saline (PBS) (Sigma Aldrich) for 28 days, and pumps designed to deliver 0.5 ⁇ /hr (Model 2002) were used to deliver 75 rng/day of the positive control MOE ASQ for 14 days.
  • CRISPR Cas targeted to Htt were filled with ss-siRNA or MOE diluted in sterile PBS and then incubated at 37 C for 24 or 48 (Model 2004) hours prior to implantatio .
  • Mice were a esthetized with 2.5% isofluorane, and a midline incision was made at the base of the skull.
  • a cannula was implanted into the right lateral ventricle and secured with Loctite adhesive, A catheter attached to an Alzet osmotic mini, pump was attached to the cannula, and the pump was placed subcutaneously in the midscapular area. The incision was closed with 5.0 nylon sutures.
  • a similar dosage of CRISPR Cas targeted to Htt may be contemplated for humans in the present invention, for example, about 500 to 1000 g/day CRISPR Cas targeted to Htt may be administered.
  • the invention uses nucleic acids to bind target DNA sequences. This is advantageous as nucleic acids are much easier and cheaper to produce than proteins, and the specificity can be varied according to the length of the stretch where homology is sought. Complex 3-D positioning of multiple fingers, for example is not required.
  • polynucleotide refers to a polymeric form of nucleotides of any length, either deoxyribonueleotides or ribonucleotides, or analogs thereof.
  • Polynucleotides may have any three dimensional structure, and may perform any function, known or unknown.
  • polynucleotides coding or non-coding regions of a gene or gene fragment, loc (locus) defined from linkage analysis, exons, nitrons, messenger RNA (niRNA), transfer RNA, ribosomal RNA, short interfering RNA (siRNA), short-hairpin RNA (sh A), micro-RNA (miRNA), ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers.
  • loc loc defined from linkage analysis, exons, nitrons, messenger RNA (niRNA), transfer RNA, ribosomal RNA, short interfering RNA (siRNA), short-hairpin RNA (sh A), micro-RNA (miRNA), ribozymes, cDNA, recombinant polynucleotides, branched
  • a polynucleotide may comprise one or more modified nucleotides, such as methylated nucleotides and nucleotide analogs. If present, modifications to the nucleotide structure may be imparted before or after assembly of the polymer.
  • the sequence of nucleotides may be interrupted by non-nucleotide components.
  • a polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component,
  • wild type is a term of the art understood by skilled persons and means the typical form of an organism, strain, gene or characteristic as it occurs in nature as distinguished from mutant or variant forms.
  • variable should be taken to mean the exhibition of qualities that have a pattern that deviates from what occurs in nature.
  • nucleic acid molecules or polypeptides mean that the nucleic acid molecule or the polypeptide is at least substantially free from at least one other component with which they are naturally associated in nature and as found in nature.
  • Complementarity refers to the ability of a nucleic acid to form hydrogen bond(s) with another nucleic acid sequence by either traditional Watson-Crick base pairing or other non- traditional types.
  • a percent complementarity indicates the percentage of residues in a nucleic acid molecule which can form hydrogen bonds (e.g., Watson-Crick base pairing) with a second nucleic acid sequence (e.g., 5, 6, 7, 8, 9, 10 out of 10 being 50%, 60%, 70%, 80%, 90%, and 100% complementary).
  • Perfectly complementary'' means that all the contiguous residues of a nucleic acid sequence will hydrogen bond with the same number of contiguous residues in a second nucleic acid sequence.
  • Substantially complementary refers to a degree of complementarity that is at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 100%, over a region of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, or more nucleotides, or refers to two nucleic acids that hybridize under stringent conditions.
  • stringent conditions for hybridization refer to conditions under which a nucleic acid having complementarity to a target sequence predominantly hybridizes with the target sequence, and substantially does not hybridize to non-target sequences. Stringent conditions are generally sequence-dependent, and vary depending on a number of factors. In general, the longer the sequence, the higher the temperature at which the sequence specifically hybridizes to its target sequence. Non-limiting examples of stringent conditions are described in detail in Tijssen (1993), Laboratory Techniques In Biochemistry And Molecular Biology- Hybridization With Nucleic Acid Probes Part I, Second Chapter “Overview of principles of hybridization and the strategy of nucleic acid probe assay", Elsevier, N.Y.
  • complementary or partially complementary sequences are also envisaged. These are preferably capable of hybridising to the reference sequence under highly stringent conditions.
  • relatively low-stringency hybridization conditions are selected: about 20 to 25° C lower than the thermal melting point (T m ).
  • T m is the temperature at which 50% of specific target sequence hybridizes to a perfectly complementary probe in solution at a defined ionic strength and pH.
  • highly stringent washing conditions are selected to be about 5 to 15° C lower than the T m .
  • moderately-stringent washing conditions are selected to be about 15 to 30° C lower than the T m .
  • Highly permissive (very low stringency) washing co ditions may be as low as 50° C below the T m , allowing a high level of mis-matching between hybridized sequences.
  • Preferred highly stringent conditions comprise incubation in 50% formamide, 5 - SSC, and 1% SDS at 42° C, or incubation in 5xSSC and 1% SDS at 65° C, with wash in 0.2xSSC and 0.1% SDS at 65° C.
  • Hybridization refers to a reaction in which one or more polynucleotides react to form a complex that is stabilized via hydrogen bonding between the bases of the nucleotide residues.
  • the hydrogen bonding may occur by Watson Crick base pairing, Hoogstehi binding, or in any other sequence specific manner.
  • the comple may comprise two strands forming a duplex structure, three or more strands forming a multi stranded complex, a single self- hybridizing strand, or any combination of these.
  • a hybridization reaction may constitute a step in a more extensive process, such as the initiation of PGR, or the cleavage of a polynucleotide by an enzyme.
  • a sequence capable of hybridizing with a given sequence is referred to as the "complement" of the given sequence.
  • genomic locus or “locus” (plural loci) is the specific location of a gene or D A sequence on a chromosome.
  • a “gene” refers to stretches of DNA or RNA that encode a polypeptide or an RNA chain that has functional role to play in an organism and hence is the molecular unit of heredity in living organisms.
  • genes include regions which regulate the production of the gene product, whether or not such regulatory sequences are adjacent to coding and/or transcribed sequences.
  • a gene includes, but is not necessarily limited to, promoter sequences, terminators, translational regulatory sequences such as ribosome binding sites and internal ribosome entry sites, enhancers, silencers, insulators, boundary elements, replication origins, matrix attachment sites and locus control regions.
  • expression of a genomic locus or “gene expression” is the process by which information from a gene is used in the synthesis of a functional gene product.
  • the products of gene expression are often proteins, but in non-protein coding genes such as rRNA genes or tRNA genes, the product is functional RNA.
  • the process of gene expression is used by all known life - eukaryotes (including multicellular organisms), prokaryotes (bacteria and archaea) and viruses to generate functional products to survive.
  • expression of a gene or nucleic acid encompasses not only cellular gene expression, but also the transcription and translation of nucleic acid(s) in cloning systems and in any other context.
  • expression also refers to the process by which a polynucleotide is transcribed from a DNA template (such as into and mRNA or other RNA transcript) and/or the process by which a transcribed mRNA is subsequently translated into peptides, polypeptides, or proteins.
  • Transcripts and encoded polypeptides may be collectively referred to as "gene product.” If the polynucleotide is derived from genomic DN A, expression may include splicing of the mRNA. in a eukaryotie cell.
  • polypeptide refers to polymers of amino acids of any length.
  • the polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non amino acids.
  • the terms also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component.
  • amino acid includes natural and/or unnatural or synthetic amino acids, including glycine and both the D or L optical isomers, and amino acid analogs and peptidomimetics.
  • domain refers to a part of a protein sequence that may exist and function independently of the rest of the protein chain.
  • sequence identity is related to sequence homology. Homology comparisons may be conducted by eye, or more usually, with the aid of readily available sequence comparison programs. These commercially available computer programs may calculate percent (%) homology between two or more sequences and may also calculate the sequence identity shared by two or more amino acid or nucleic acid sequences.
  • the capping region of the dTALEs described herein have sequences that are at least 95% identical or share identity to the capping region amino acid sequences provided herein.
  • Sequence homologies may be generated by any of a number of computer programs known in the art, for example BLAST or FASTA, etc.
  • a suitable computer program for carrying out such an alignment is the GCG Wisconsin Bestfit package (University of Wisconsin, U.S.A; Devereux et ah, 1984, Nucleic Acids Research 12:387).
  • Examples of other software than may perform sequence comparisons include, but are not limited to, the BLAST package (see Ausubei et a!., 1999 ibid - Chapter 18), FASTA (Atschui et ai., 1990, J. Mol. Biol., 403-410) and the GENEWORKS suite of comparison tools. Both BLAST and FASTA are available for offline and online searching (see Ausubei et a!.., 1999 ibid, pages 7-58 to 7-60). However it is preferred to use the GCG Bestfit program.
  • Percentage (%) sequence homology may be calculated over contiguous sequences, i.e., one sequence is aligned with the other sequence and each amino acid or nucleotide in one sequence is directly compared with the corresponding amino acid or nucleotide in the other sequence, one residue at a time. This is called an "ungapped" alignment. Typically, such ungapped alignments are performed only over a relatively short number of residues.
  • BLAST and FASTA are available for offline and online searching (see Ausubel et al., 1999, Short Protocols in Molecular Biology, pages 7-58 to 7-60). However, for some applications, it is preferred to use the GCG Bestfit program.
  • a new tool, called BLAST 2 Sequences is also available for comparing protein and nucleotide sequences (see FEMS Microbiol Lett. 1999 174(2): 247-50; FEMS Microbiol Lett. 1999 177(1): 187-8 and the website of the National Center for Biotechnology information at the website of the National Institutes for Health).
  • the final % homology may be measured in terms of identity, the alignment process itself is typically not based on an all-or-nothing pair comparison. Instead, a scaled similarity score matrix is generally used that assigns scores to each pair-wise comparison based on chemical similarity or evolutionary distance.
  • An example of such a matrix commonly used is the BLOSUM62 matrix - the default matrix for the BLAST suite of programs.
  • GCG Wisconsin programs generally use either the public default values or a custom symbol comparison table, if supplied (see user manual for further details). For some applications, it is preferred to use the public default values for the GCG package, or in the case of other software, the default matrix, such as BLOSUM62.
  • percentage homologies may be calculated using the multiple alignment feature in DNASlS l (Hitachi Software), based on an algorithm, analogous to CLUSTAL (Higgins DG & Sharp PM (1988), Gene 73(1), 237-244). Once the software has produced an optimal alignment, it is possible to calculate % homology, preferably % sequence identity. The software typically does this as part of the sequence comparison and generates a numerical result.
  • sequences may also have deletions, insertions or substitutions of amino acid residues which produce a silent change and result in a functionally equivalent substance.
  • Deliberate amino acid substitutions may be made on the basis of similarity in amino acid properties (such as polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues) and it is therefore useful to group amino acids together in functional groups.
  • Amino acids may be grouped together based on the properties of their side chains alone. However, it is more useful to include mutation data as well.
  • the sets of amino acids thus derived are likely to be conserved for structural reasons. These sets may be described in the form of a Venn diagram (Livingstone CD. and Barton G.J.
  • Embodiments of the invention include sequences (both polynucleotide or polypeptide) which may comprise homologous substitution (substitution and replacement are both used herein to mean the interchange of an existing amino acid residue or nucleotide, with an alternative residue or nucleotide) that may occur i.e., like-for-like substitution in the case of amino acids such as basic for basic, acidic for acidic, polar for polar, etc.
  • Non-homologous substitution may also occur i.e., from one class of residue to another or alternatively involving the inclusion of unnatural amino acids such as ornithine (hereinafter referred to as Z), diaminobutyric acid ornithine (hereinafter referred to as B), norleucine ornithine (hereinafter referred to as O), pyriylalanine, thienylalanine, naphthyl alanine and phenyl-glycine.
  • Z ornithine
  • B diaminobutyric acid ornithine
  • O norleucine ornithine
  • pyriylalanine pyriylalanine
  • thienylalanine naphthyl alanine
  • phenyl-glycine unnatural amino acids
  • Variant amino acid sequences may include suitable spacer groups that .may be inserted between any two amino acid residues of the sequence including alkyl groups such as methyl, ethyl or propyl groups in addition to amino acid spacers such as glycine or ⁇ -alanine residues.
  • alkyl groups such as methyl, ethyl or propyl groups
  • amino acid spacers such as glycine or ⁇ -alanine residues.
  • a further form of variation which involves the presence of one or more amino acid residues in peptoid form, may be well understood by those skilled in the art.
  • the peptoid form is used to refer to variant amino acid residues wherein the a-carbon substituent group is on the residue's nitrogen atom rather than the a-carbon.
  • the invention provides for vectors that are used in the engineering and optimization of CRISPR-Cas systems.
  • a ''vector is a tool that allows or facilitates the transfer of an entity from one environment to another. It is a repiicon, such as a plasmid, phage, or cosmid, into which another DNA segment may be inserted so as to bring about the replication of the inserted segment.
  • a vector is capable of replication when associated with the proper control elements.
  • the term "vector” refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
  • Vectors include, but are not limited to, nucleic acid molecules that are single-stranded, double-stranded, or partially double-stranded; nucleic acid molecules that comprise one or more free ends, no free ends (e.g. circular); nucleic acid molecules that comprise DNA, RNA, or both; and other varieties of polynucleotides known in the art.
  • a ''plasmid refers to a circular double stranded DNA loop into which additional DNA segments can be inserted, such as by standard molecular cloning techniques.
  • viral vector wherein viral ly-derived DNA or RNA sequences are present in the vector for packaging into a virus (e.g.
  • Viral vectors also include polynucleotides carried by a vims for transfection into a host cell.
  • Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g. bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
  • Other vectors e.g., non-episomal mammalian vectors are integrated into the genome of a host ceil upon introduction into the host cell, and thereby are replicated along with the host genome.
  • vectors are capable of directing the expression of genes to which they are operatively-1 inked. Such vectors are refen'ed to herein as "expression vectors.”
  • expression vectors Common expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
  • Recombinant expression vectors can comprise a nucleic acid of the invention in a form suitable for expression of the nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory elements, which may be selected on the basis of the host cells to be used for expression, that is operatively-linked to the nucleic acid sequence to be expressed.
  • "operably linked" is intended to mean that the nucleotide sequence of interest is linked to the regulatory elements) in a manner that allows for expression of the nucleotide sequence (e.g. in an in vitro transcription/translation system or in a host ceil when the vector is introduced into the host ceil).
  • aspects of the invention relate to bicistronic vectors for chimeric RNA and Cas9.
  • Bicistronic expression vectors for chimeric RNA and Cas9 are preferred.
  • Cas9 is preferably driven by the CBh promoter.
  • the chimeric RNA may preferably be driven by a U6 promoter. Ideally the two are combined.
  • the chimeric guide RNA typically consists of a 20bp guide sequence (Ns) and this may be joined to the tracr sequence (running from the first "U" of the lower strand to the end of the transcript). The tracr sequence may be truncated at various positions as indicated.
  • the guide and tracr sequences are separated by the tracr-mate sequence, which may be GUUUUAGAGCUA, This may be followed by the loop sequence GAAA as shown. Both of these are preferred examples.
  • Applicants have demonstrated Cas9-mediated indeis at the human EMXl and PVALB loci by SURVEYOR assays.
  • ChiRNAs are indicated by their "+n" designation, and crRNA refers to a hybrid RNA where guide and tracr sequences are expressed as separate transcripts.
  • chimeric RNA may also be called single guide, or synthetic guide RNA (sgRNA).
  • the loop is preferably GAAA, but it is not limited to this sequence or indeed to being only 4bp in length.
  • preferred loop forming sequences for use in hairpin structures are four nucleotides in length, and most preferably have the sequence GAAA. However, longer or shorter loop sequences may be used, as may alternative sequences.
  • the sequences preferably include a nucleotide triplet (for example, AAA), and an additional nucleotide (for example C or G). Examples of loop forming sequences include CAAA and AAAG.
  • the terrn " ' regulatory element” is intended to include promoters, enhancers, internal ribosomal entry sites (IRES), and other expression control elements (e.g. transcription termination signals, such as polyadenylation signals and poiy-U sequences).
  • regulatory- elements are described, for example, in Goeddel, GENE EXPRESSION TECHNOLOGY : METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Caiif. (1990).
  • Regulatory elements include those that direct constitutive expression of a nucleotide sequence in many types of host ceil and those that direct expression of the nucleotide sequence only in certain host ceils (e.g., tissue-specific regulator ⁇ ' sequences).
  • a tissue-specific promoter may direct expression primarily in a desired tissue of interest, such as muscle, neuron, bone, skin, blood, specific organs (e.g. liver, pancreas), or particular cell types (e.g. lymphocytes). Regulatory elements may also direct expression in a temporal-dependent manner, such as in a cell-cycle dependent or developmental stage-dependent manner, which may or may not also be tissue or cell-type specific.
  • a vector comprises one or more pol III promoter (e.g. 1, 2, 3, 4, 5, or more pol III promoters), one or more pol II promoters (e.g. 1 , 2, 3, 4, 5, or more pol II promoters), one or more pol I promoters (e.g.
  • pol III promoters include, but are not limited to, U6 and HI promoters.
  • pol II promoters include, but are not limited to, the retroviral Rous sarcoma virus (RSV) LTR promoter (optionally with the RSV enhancer), the cytomegalovirus (CMV) promoter (optionally with the CMV enhancer) [see, e.g., Boshart et al, Cell, 41 :521 -530 (1985)], the SV40 promoter, the dihydrofolate reductase promoter, the ⁇ -aethi promoter, the phosphoglycerol kinase (PGK) promoter, and the EE l a promoter.
  • RSV Rous sarcoma virus
  • CMV cytomegalovirus
  • PGK phosphoglycerol kinase
  • enhancer elements such as WPRE; CMV enhancers; the R-U5' segment in LTR of HTLV-I (Moi. Cell. Biol, Vol. 8(1 ), p. 466-472, 1988); SV40 enhancer; and the intron sequence between exons 2 and 3 of rabbit ⁇ -globin (Proe. Natl. Acad. Sci. USA., Vol. 78(3), p. 1527-31 , 1981 ). It will be appreciated by those skilled in the art that the design of the expression vector can depend on such factors as the choice of the host ceil to be transformed, the level of expression desired, etc.
  • a vector can be introduced into host cells to thereby produce transcripts, proteins, or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein (e.g., clustered regularly interspersed short palindromic repeats (CRISPR) transcripts, proteins, enzymes, mutant forms thereof, fusion proteins thereof, etc.).
  • CRISPR clustered regularly interspersed short palindromic repeats
  • Vectors can be designed for expression of CRISPR transcripts (e.g. nucleic acid transcripts, proteins, or enzymes) in prokaryotic or eukaryotic cells.
  • CRISPR transcripts e.g. nucleic acid transcripts, proteins, or enzymes
  • CRISPR transcripts can be expressed in bacterial cells such as Escherichia coli, insect cells (using baculovirus expression vectors), yeast cells, or mammalian cells. Suitable host cells are discussed further in Goeddel, GENE EXPRESSION TECHNOLOGY : METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990).
  • the recombinant expression vector can be transcribed and translated in vitro, for example using T7 promoter regulatory sequences and T7 polymerase.
  • Vectors may be introduced and propagated in a prokaryote or prokaryotic cell
  • a prokaryote is used to amplify copies of a vector to be introduced into a eukaryotic cell or as an intermediate vector in the production of a vector to be introduced into a eukaryotic cell (e.g. amplifying a piasmid as part of a viral vector packaging system).
  • a prokaryote is used to amplify copies of a vector and express one or more nucleic acids, such as to provide a source of one or more proteins for deliver ⁇ ' to a host cell or host organism.
  • Fusion vectors add a number of amino acids to a protein encoded therein, such as to the amino terminus of the recombinant protein.
  • Such fusion vectors may serve one or more purposes, such as: (i) to increase expression of recombinant protein; (ii) to increase the solubility of the recombinant protein; and (iii) to aid in the purification of the recombinant protein by acting as a ligand in affinity purification.
  • a proteolytic cleavage site is introduced at the junction of the fusion moiety and the recombinant protein to enable separation of the recombinant protein from the fusion moiety subsequent to purification of the fusion protem.
  • Such enzymes, and their cognate recognition sequences include Factor Xa, thrombin and enterokinase.
  • Example fusion expression vectors include pGEX (Phannacia Biotech Ine; Smith and Johnson, 1988.
  • GST glutathione S-transferase
  • Examples of suitable inducible non-fusion E. coii expression vectors include pTrc (Amrann et al., (1988) Gene 69:301 -315) and pET l i d (Studier et al, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990) 60-89).
  • a vector is a yeast expression vector.
  • yeast Saceharomyces cerivisae examples include pYepSecl (Baldari, et al., 1987. EMBO J. 6: 229-234), pMFa (Kuijan and Herskowitz, 1982, Cell 30: 933-943), pJRY88 (Schultz et al., 1987. Gene 54: 113-123), pYES2 (Invitrogen Corporation, San Diego, Calif.), and picZ (InVitrogen Corp, San Diego, Calif.),
  • a vector drives protein expression in insect cells using baculovirus expression vectors.
  • Baculovirus vectors available for expression of proteins in cultured insect cells include the pAc series (Smith, et al., 1983. Mol. Cell. Biol. 3: 2156-2165) and the pVL series (Lucklow and Summers, 1989. Virology 170: 31-39).
  • a vector is capable of driving expression of one or more sequences in mammalian cells using a mammalian expression vector.
  • mammalian expression vectors include pCDMS (Seed, 1987. Nature 329: 840) and pMT2PC (Kaufman, et al., 1987. EMBO J. 6: 187-195).
  • the expression vector's control functions are typically provided by one or more regulatory elements.
  • commonly used promoters are derived from polyoma, adenovirus 2, cytomegalovirus, simian virus 40, and others disclosed herein and known in the art.
  • the recombinant mammalian expression vector is capable of directing expression of the nucleic acid preferentially in a particular cell type (e.g., tissue-specific regulatory elements are used to express the nucleic acid).
  • tissue-specific regulatory elements are known in the art.
  • suitable tissue-specific promoters include the albumin promoter (liver-specific; Pinkert, et al, 1987. Genes Dev. 1 : 268-277), lymphoid-speci ic promoters (Calame and Eaton, 1988. Adv. Immunol. 43: 235-275), in. particular promoters of T cell receptors (Winoto and Baltimore, 1989. EMBO J.
  • a regulatory element is operably linked to one or more elements of a CRISPR system so as to drive expression of the one or more elements of the CRISPR system.
  • CRISPRs Clustered Regularly Interspaced Short Palindromic Repeats
  • SPBDRs SPacer Interspersed Direct Repeats
  • SSRs interspersed short sequence repeats
  • the CRISPR loci typically differ from other SSRs by the structure of the repeats, which have been termed short regularly spaced repeats (SRSRs) (Janssen et al., OMICS J. lnteg. Biol., 6:23-33 [2002]; and Mojica et al., Mol. Microbiol, 36:244-246 [2000]).
  • SRSRs short regularly spaced repeats
  • the repeats are short elements that occur in clusters that are regular!)? spaced by unique intervening sequences with a substantially constant length (Mojica et al., [2000], supra).
  • CRISPR loci have been identified in more than 40 prokaryotes (See e.g., Jansen et al, Mol.
  • CRISPR system refers collectively to transcripts and other elements involved in the expression of or directing the activity of CR1 SPR-associated (“Cas") genes, including sequences encoding a Cas gene, a tracr (trans-activating CRISPR) sequence (e.g. tracrRNA or an active partial tracrRNA), a tracr-mate sequence (encompassing a "direct repeat” and a tracrRNA -processed partial direct repeat in the context of an endogenous CRISPR system), a guide sequence (also referred to as a "spacer” in the context of an endogenous CRISPR system), or other sequences and transcripts from a CRISPR locus.
  • a tracr trans-activating CRISPR
  • tracr-mate sequence encompassing a "direct repeat” and a tracrRNA -processed partial direct repeat in the context of an endogenous CRISPR system
  • guide sequence also referred to as a "spacer” in the context of an endogenous C
  • one or more elements of a CRISPR system is derived from a type I, type II, or type III CRISPR system.
  • one or more elements of a CRISPR system is derived from a particular organism comprising an endogenous CRISPR system, such as Streptococcus pyogenes.
  • a CRISPR system is characterized by elements that promote the formation of a CRISPR complex at the site of a target sequence (also referred to as a protospacer in the context of an endogenous CRISPR system).
  • target sequence refers to a sequence to which a guide sequence is designed to have complementarity, where hybridization between a target sequence and a guide sequence promotes the formation of a CRISPR complex.
  • a target sequence may comprise any polynucleotide, such as DNA or RNA polynucleotides.
  • a target sequence is located in the nucleus or cytoplasm of a cell.
  • direct repeats may be identified in silico by searching for repetitive motifs that fulfill any or all of the following criteria:
  • 2 of these criteria may be used, for instance 1 and 2, 2 and 3, or 1 and 3.
  • ail 3 criteria may be used.
  • candidate tracrRNA may be subsequently predicted b - sequences that fulfill any or all of the following criteria:
  • 2 of these criteria may be used, for instance I and 2, 2 and 3, or 1 and 3.
  • ail 3 criteria may be used.
  • chimeric synthetic guide RNAs designs may incorporate at least 12 bp of duplex structure between the direct repeat a d tracrRNA.
  • the CRISPR system is a type II CRISPR system and the Cas enzyme is Cas9, which catalyzes DNA cleavage.
  • Enzymatic action by Cas9 derived from Streptococcus pyogenes or any closely related Cas9 generates double stranded breaks at target site sequences which hybridize to 20 nucleotides of the guide sequence and that have a protospacer-adjacent motif (PAM) sequence (examples include NGG NRG or a PAM that can be determined as described herein) following the 20 nucleotides of the target sequence.
  • PAM protospacer-adjacent motif
  • CRISPR activity through Cas9 for site-specific DNA recognition and cleavage is defined by the guide sequence, the traer sequence thai hybridizes in part to the guide sequence and the PAM sequence. More aspects of the CRISPR system are described in arginov and Hannon, The CRISPR system: small RNA-guided defence in bacteria and archaea, Mole Cell 2010, January 15; 37(1): 7.
  • the type II CRISPR locus from Streptococcus pyogenes SF370 which contains a cluster of four genes Cas9, Casl , Cas2, and Csnl, as well as two non-coding RNA elements, tracrRNA and a characteristic array of repetitive sequences (direct repeats) interspaced by short stretches of non-repetitive sequences (spacers, about 30bp each).
  • DSB targeted DNA double-strand break
  • tracrRNA hybridizes to the direct repeats of pre-crRNA, which is then processed into mature crRNAs containing individual spacer sequences.
  • the mature crRNA:tracrRNA complex directs Cas9 to the DNA target consisting of the protospacer and the corresponding PAM via heteroduplex formation between the spacer region of the crRNA and the protospacer DNA.
  • Cas9 mediates cleavage of target DNA upstream of PAM to create a DSB within the protospacer (Fig. 2 A).
  • Fig. 2B demonstrates the nuclear localization of the codon optimized Cas9.
  • the RNA polymerase Il l-based U6 promoter was selected to drive the expression of tracrRNA (Fig. 2C).
  • a U6 promoter-based construct was developed to express a pre-crRNA array consisting of a single spacer flanked by two direct repeats (DRs, also encompassed by the term "tracr-mate sequences"; Fig, 2C).
  • the initial spacer was designed to target a 33 -base-pair (bp) target site (30-bp protospacer plus a 3 -bp CRISPR motif (PA M) sequence satisfying the NGG recognition motif of Cas9) in the human EMX1 locus (Fig. 2C), a key gene in the d evelopment of the cerebral cortex.
  • a CRISPR complex comprising a guide sequence hybridized to a target sequence and complexed with one or more Cas proteins
  • formation of a CRISPR complex results in cleavage of one or both strands in or near (e.g. within 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 50, or more base pairs from) the target sequence.
  • the traer sequence which may comprise or consist of all or a portion of a wild- type tracr sequence (e.g.
  • one or more vectors driving expression of one or more elements of a CRISPR system are introduced into a host cell such that expression of the elements of the CRISPR system direct formation of a CRISPR complex at one or more target sites.
  • a Cas enzyme, a guide sequence linked to a tracr-mate sequence, and a tracr sequence could each be operably linked to separate regulatory elements on separate vectors.
  • two or more of the elements expressed from the same or different regulatory elements may be combined in a single vector, with one or more additional vectors providing any components of the CRISPR system not included in the first vector.
  • CRISPR system elements that are combined in a single vector may be arranged in any suitable orientation, such as one element located 5 ' with respect to ("upstream" of) or 3' with respect to ("downstream" of) a second element.
  • the coding sequence of one element may ⁇ be located on the same or opposite strand of the coding sequence of a second element, and oriented in the same or opposite direction.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Chemical & Material Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Veterinary Medicine (AREA)
  • Medicinal Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Physics & Mathematics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Biophysics (AREA)
  • Microbiology (AREA)
  • Biochemistry (AREA)
  • Plant Pathology (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Virology (AREA)
  • Environmental Sciences (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Bioinformatics & Computational Biology (AREA)
  • Theoretical Computer Science (AREA)
  • Analytical Chemistry (AREA)
  • Spectroscopy & Molecular Physics (AREA)
  • Medical Informatics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Evolutionary Biology (AREA)
  • Rheumatology (AREA)

Abstract

The invention provides for delivery, engineering and optimization of systems, methods, and compositions for manipulation of sequences and/or activities of target sequences. Provided are deliver systems and tissues or organ which are targeted as sites for delivery. Also provided are vectors and vector systems some of which encode one or more components of a CRISPR complex, as well as methods for the design and use of such vectors. Also provided are methods of directing CRISPR complex formation in eukaryotic ceils to ensure enhanced specificity for target recognition and avoidance of toxicity and to edit or modify a target site in a genomic locus of interest to alter or improve the status of a disease or a condition.

Description

DELIVERY, ENGINEERING AND OPTIMIZATION
OF SYSTEMS, METHODS AND COMPOSITIONS FOR SEQUENCE MANIPULATION AND THERAPEUTIC APPLICATIONS
RELATED APPLICATIONS AND INC RPORATION BY REFERENCE
[0001] This application claims benefit of and priority to US provisional patent application numbers 61/736,527 filed December 12, 2012; 61/748,427 filed January 2, 2013; 61/758,468 filed January 30, 2013, 61/769,046 filed February 25, 2013; 61/791,409 and 61/802,174 filed March 15, 2013, 61/806,375 filed March 28, 2013; 61/814,263 filed April 20, 2013; 61/819,803 filed May 6, 2013; 61/828,130 filed May 28, 2013; 61/835,931 and 61/836,123 filed June 17, 2013 and 61/847,537 filed July 17, 2013.
[0002] Reference is also made to LIS provisional patent application numbers 61/799,800 filed March 15, 2013; 61 /835,931, 61/835,936, 61/836,127, 61/836, 101, 61/836,080 and 61/835,973 filed June 17, 2013; 61/862,468 and 61/862,355 filed on August 5, 2013; 61/871,301 filed on August 28, 2013; 61/960,777 filed on September 25, 2013 and 61/961,980 filed on October 28, 2013.
[0003] The foregoing applications, and all documents cited therein or during their prosecution ("appln cited documents") and all documents cited or referenced in the appln cited documents, and all documents cited or referenced herein ("'herein cited documents"), and all documents cited or referenced in herein cited documents, together with any manufacturer's instructions, descriptions, product specifications, and product sheets for any products mentioned herein or in any document incorporated by reference herein, are hereby incorporated herein by reference, and may be employed in the practice of the invention. More specifically, all referenced documents are incorporated by reference to the same extent as if each individual document was specifically and individually indicated to be incorporated by reference.
FIELD OF THE INVENTION
[0004] The present inventio generally relates to the delivery, engineering, optimization and therapeutic applications of systems, methods, and compositions used for the control of gene expressio involving sequence targeting, such as genome perturbatio or gene-editing, that relate to Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) and components thereof. STATEMENT AS TO FEDERALLY SPONSORED RESEARCH
[0005] This invention was made with government support under the NIL! Pioneer Award (1 DPI MH 100706) awarded by the National Institutes of Health. The government has certain rights in the invention.
BACKGROUND OF THE INVENTION
[0006] Recent advances in genome sequencing techniques and analysis methods have significantly accelerated the ability to catalog and map ge etic factors associated with a diverse range of biological functions and diseases. Precise genome targeting technologies are needed to enable systematic reverse engineering of causal genetic variations by allowing selective perturbation of individual genetic elements, as well as to advance synthetic biology, biotechnological, and medical applications. Although genome-editing techniques such as designer zinc fingers, transcription activator-like effectors (TALEs), or homing meganucleases are available for producing targeted genome perturbations, there remains a need for new genome engineering technologies that are affordable, easy to set up, scalable, and amenable to targeting multiple positions within the eukaryotic genome.
SUMMARY OF THE INVENTION
[0ΘΘ7] The CRISPR-Cas system does not require the generation of customized proteins to target specific sequences but rather a single Cas enzyme can be programmed by a short. NA molecule to recognize a specific DNA target. Adding the CRISPR-Cas system to the repertoire of genome sequencing techniques and analysis methods may significa tly simplify the methodology and accelerate the ability to catalog and map genetic factors associated with a diverse ra ge of biological functio s a d diseases. To utilize the CRISPR-Cas system effectively for genome editing without deleterious effects, it is critical to understand aspects of engineering, optimization and cell-type/tissue/organ specific deliver}' of these genome engineering tools, which are aspects of the claimed invention.
[ΟΘ08] There exists a pressing need for alternative and robust systems and techniques for nucleic sequence targeting with a wide array of applications. Aspects of this invention address this need and provide related advantages. An exemplar}' CRISPR comple comprises a CRISP R enzyme complexed with a guide sequence hybridized to a target sequence within the target polynucleotide. The guide sequence is linked to a tracr mate sequence, which in turn hybridizes to a tracr sequence.
[0009] In one aspect, the invention provides methods for using one or more elements of a CRISPR-Cas system. The CR ISPR comple of the invention provides an effective means for modifying a target polynucleotide. The CRISPR complex of the invention has a wide variety of utilities including modifying (e.g., deleting, inserting, translocating, inactivating, activating) a target polynucleotide in a multiplicity of cell types in various tissues and organs. As such the CRISPR complex of the invention has a broad spectrum of applications in, e.g., gene or genome editing, gene therapy, dr g discovery, drug screening, disease diagnosis, and prognosis.
[0010] Aspects of the invention relate to Cas9 enzymes having improved targeting specificity in a CR1SPR-Cas9 system having guide RNAs having optimal activity, smal ler in length than wild-type Cas9 enzymes and nucleic acid molecules coding therefor, and chimeric Cas9 enzymes, as well as methods of improving the target specificity of a Cas9 enzyme or of designing a CRISPR-Cas9 system comprising designing or preparing guide RNAs having optimal activity and/or selecting or preparing a Cas9 enzyme having a smaller size or length than wild-type Cas9 whereby packaging a nucleic acid coding therefor into a deliver}' vector is more advanced as there is less coding therefor in the delivery vector than for wild-type Cas9, and/or generating chimeric Cas9 enzymes.
[0011] Also provided are uses of the present sequences, vectors, enzymes or systems, in medicine. Al so provided are uses of the same in gene or genome editin g.
[0012] In an additional aspect of the invention, a Cas9 enzyme may comprise one or more mutations and may be used as a generic DNA binding protein with or without fusion to a functional domain. The mutations may be artificially introduced mutations or gain- or loss-of- function mutations. The mutations may include but are not limited to mutations in one of the catalytic domains (D I O and H840) in the RuvC and HNH catalytic domains, respectively. Further mutations have been characterized. In one aspect of the invention, the transcriptional activation domain may be VP64. In other aspects of the invention, the transcriptional repressor domain may be KRAB or SID4X, Other aspects of the invention relate to the mutated Cas 9 enzyme being fused to domains which include but are not limited to a transcriptional activator, repressor, a recombinase, a transposase, a histone remodeler, a demethylase, a DNA methyltransferase, a cryptochrome, a light inducible/controllable domain or a chemically induci b 1 e/contro liable domain .
[0013] In a further embodiment, the invention provides for methods to generate mutant tracrl A and direct repeat sequences or mutant chimeric guide sequences that allow for enhancing performance of these RNAs in cells. Aspects of the invention also provide for selection of said sequences.
[0014] Aspects of the invention also provide for methods of simplifying the cloning and delivery of components of the CRISPR. complex. In the preferred embodiment of the invention, a suitable promoter, such as the U6 promoter, is amplified with a DNA oiigo and added onto the guide RNA. The resulting PGR product can then be transfected into cells to drive expression of the guide RNA. Aspects of the invention also relate to the guide RNA being transcribed in vitro or ordered from a synthesis company and directly transfected.
[0015] in one aspect, the invention provides for methods to improve activity by using a more active polymerase. In a preferred embodiment, the expression of guide RNAs under the control of the T7 promoter is driven by the expression of the T7 polymerase in the cell. In an advantageous embodiment, the cell is a eukaryotic ceil. In a preferred embodiment the eukaryotic cell is a human cell, hi a more preferred embodiment the human cell is a patient specific cell.
[0016] In one aspect, the invention provides for methods of reducing the toxicity of Cas enzymes. In certain aspects, the Cas enzyme is any Cas9 as described herein, for instance any naturally-occurring bacterial Cas9 as well as a y chimaeras, mutants, homo logs or orthologs. In a preferred embodiment, the Cas9 is delivered into the ceil in the form of mRNA. This allows for the transient expression of the enzyme thereby reducing toxicity. In another preferred embodiment, the invention also provides for methods of expressing Cas9 under the control of an inducible promoter, and the constructs used therein.
[0017] In another aspect, the invention provides for methods of improving the in vivo applications of the CRISPR-Cas system. In the preferred embodiment, the Cas enzyme is wildtype Cas9 or any of the modified versions described herein, including any naturally- occurring bacterial Cas9 as well as any chimaeras, mutants, homologs or orthologs. An advantageous aspect of the invention provides for the selection of Cas9 homologs that are easily packaged into viral vectors for delivery. Cas9 orthologs typically share the general organization of 3-4 RuvC domains and a HNH domain. The 5' most RuvC domain cleaves the non- complementary strand, and the HNH domain cleaves the complementary strand. All notations are in reference to the guide sequence.
[0018] The catalytic residue in the 5' RuvC' domain is identified through homology comparison of the Cas9 of interest with other Cas9 orthologs (from S. pyogenes type II CRISPR locus, S. tbermopmTus CRISPR locus 1, S. thermoph ius CRISPR locus 3, and Franciscilla novicida type 11 CRISPR locus), and the conserved Asp residue (D10) is mutated to alanine to convert Cas9 into a complementary-strand nicking enzyme. Similarly, the conserved His and Asn residues in the HNH domains are mutated to Alanine to convert Cas9 into a non- complementary-strand nicking enzyme. In some embodiments, both sets of mutations may be made, to convert Cas9 into a non-cutting enzyme.
[0019] In some embodiments, the CRISPR enzyme is a type I or III CRISPR enzyme, preferably a type Π CRI SPR enzyme. This type II CRISPR enzyme may be any Cas enzyme. A preferred Cas enzyme may be identified as Cas9 as this can refer to the general class of enzymes thai share homology to the biggest nuclease with multiple nuclease domains from the type II CRISPR system. Most preferably, the Cas9 enzyme is from, or is derived from, spCas9 or saCas9. By derived, Applicants mean that the derived enzyme is largely based, in the sense of having a high degree of sequence homology with, a wildtype enzyme, but that it has been mutated (modified) in some way as described herein
[0020] It will be appreciated that the terms Cas and CRISPR enzyme are generally used herein interchangeably, unless otherwise apparent. As mentioned above, many of the residue numberings used herein refer to the Cas9 enzyme from the type II CRISPR locus in Streptococcus pyogenes . However, it will be appreciated that this invention includes many more Cas9s from other species of microbes, such as SpCas9, SaCas9, StlCas9 and so forth. Further examples are provided herein. The skilled person will be able to determine appropriate corresponding residues in Cas9 enzymes other than SpCas9 by comparison of the relevant amino acid sequences. Thus, where a specific amino acid replacement is referred to using the SpCas9 numbering, then, unless the context makes it apparent this is not intended to refer to other Cas9 enzymes, the disclosure is intended to encompass corresponding modifications in other Cas9 enzymes. [0021] An example of a codon optimized sequence, in this instance optimized for humans (i.e. being optimized for expression in humans) is provided herein, see the SaCas9 human codon optimized sequence. Whilst this is preferred, it will be appreciated that other examples are possible and codon optimization for a host species is known.
[0022] In further embodiments, the invention provides for methods of enhancing the function of Cas9 by generating chimeric Cas9 protems. Chimeric Cas9 proteins chimeric Cas9s may be new Cas9 containing fragments from more than one naturally occurring Cas9. These methods may comprise fusing N-teraiinal fragments of one Cas9 homolog with C-terminal fragments of another Cas9 homolog. These methods also allow for the selection of new properties displayed by the chimeric Cas9 proteins.
[0023] It will be appreciated that in the present methods, where the organism is an animal or a plant, the modification may occur ex vivo or in vitro, for instance in a cell culture and in some instances not in vivo. In other embodiments, it may occur in vivo,
[0024] In one aspect, the invention provides a method of modifying an organism or a non- human organism by manipulation of a target sequence in a genomic locus of interest comprising: delivering a non-naturally occurring or engineered composition comprising :
A) ~ I. a CRISPR-Cas system chimeric RNA (chiRNA) polynucleotide sequence, wherein the polynucleotide sequence comprises:
(a) a guide sequence capable of hybridizing to a target sequence in a eukaryotic ceil,
(b) a tracr mate sequence, and
(c) a tracr sequence, and
IL a polynucleotide sequence encoding a CRISPR enzyme comprising at least one or more nuclear localization sequences,
wherein (a), (b) and (c) are arranged in a 5' to 3' orientation,
wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1 ) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence and the polynucleotide sequence encoding a CRISPR enzyme is DNA or RNA,
or (B) I, polynucleotides comprising:
(a) a guide sequence capable of hybridizing to a target sequence in a cukaryotie cell, and
(b) at least one or more tracr mate sequences,
II, a polynucleotide sequence encoding a CRISPR enzyme, and
III. a polynucleotide sequence comprising a tracr sequence,
wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1 ) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence, and the polynucleotide sequence encoding a CRISPR. enzyme is DNA or RNA.
[0025] Any or ail of the polynucleotide sequence encoding a CRISPR enzyme, guide sequence, tracr mate sequence or tracr sequence, may be RNA. The polynucleotides encoding the sequence encoding a CRISPR enzyme, the guide sequence, tracr mate sequence or tracr sequence may be RNA and may be delivered via liposomes, nanoparticies, exosomes, micro vesicles, or a gene-gun.
[0026] It will be appreciated that where reference is made to a polynucleotide, which is RNA and is said to 'comprise' a feature such a tracr mate sequence, the RNA sequence includes the feature. Where the polynucleotide is DNA and is said to comprise a feature such a tracr mate sequence, the DNA sequence is or can be transcribed into the RN A including the feature at issue. Where the feature is a protein, such as the CRISPR enzyme, the DNA or RNA sequence referred to is, or can be, translated (and in the case of DNA transcribed first).
[0027] Accordingly, in certain embodiments the invention provides a method of modifying an organism, e.g., mammal including human or a non-human mammal or organism by manipulation of a target sequence in a genomic locus of interest comprising delivering a non- naturally occurring or engineered composition comprising a viral or plasmid vector system comprising one or more viral or plasmid vectors operably encoding a composition for expression thereof wherein the composition comprises: (A) a non-naturally occurring or engineered composition comprising a vector system comprising one or more vectors comprising I. a first regulatory element operably linked to a CRISPR-Cas system chimeric RNA (chiRNA) polynucleotide sequence, wherein the polynucleotide sequence comprises (a) a guide sequence capable of hybridizing to a target sequence in a eukaryotic cell, (b) a tracr mate sequence, and (c) a tracr sequence, and II. a second regulatory element operably linked to an enzyme -coding sequence encodi g a CRISPR enzyme comprising at least one or more nuclear localizatio sequences (or optionally at least one or more nuclear localization sequences as some embodiments can involve o NLS), wherei (a), (b) and (c) are arranged in a 5' to 3' orientation, wherem components I and I I are located on the same or different "vectors of the system, wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1 ) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence, or (B) a non -naturally occurring or engineered composition comprising a vector system comprising one or more vectors comprising I. a first regulatory element operably linked to (a) a guide sequence capable of hybridizing to a target sequence in a eukaryotic cell, a d (b) at least o e or more tracr mate sequences, II. a second regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme, and III. a third regulatory element operably linked to a tracr sequence, wherein components I, II and III are located on the same or different vectors of the system, wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and wherein the CRISPR complex comprises the CRISPR enzyme complexed with (I) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate seque ce that is hybridized to the tracr sequence. In some embodiments, components 1, II and III are located on the same vector. In other embodiments, components I and II are located on the same vector, while component III is located on another vector. In other embodiments, components I and III are located on the same vector, while component II is located on another vector. In other embodiments, components II and III are located on the same vector, while component I is located on another vector. In other embodiments, each of components I, 11 and III is located on different vectors. The invention also provides a viral or plasmid vector system as described herein.
0028j Preferably, the vector is a viral vector, such as a lenti- or baculo- or preferably adeno- viral/adeno-associated viral vectors, but other means of delivery are know (such as yeast systems, microvesic!es, gene guns/means of attaching vectors to gold nanoparticies) and are provided. In some embodiments, one or .more of the viral or plasmid vectors may be delivered via liposomes, nanoparticles, exosomes, microvesicles, or a gene-gun.
[0029] By manipulation of a target sequence, Applicants also mean the epigenetic manipulation of a target sequence. This may be of the chromatin state of a target sequence, such as by modification of the metliylation state of the target sequence (i.e. addition or removal of methylation or methylation patterns or CpG islands), histone modification, increasing or reducing accessibility to the target sequence, or by promoting 3D folding.
[0030] It will, be appreciated that where reference is made to a method of modifying an organism or mammal including human or a non-human mammal or organism by manipulation of a target, sequence in a genomic locus of interest, this may apply to the organism (or mammal) as a whole or just a single cell or population of cells from that, organism (if the organism is multicellular). In the case of humans, for instance, Applicants envisage, inter alia, a single ceil or a population of cells and these may preferabl be modified ex vivo and then re-introduced. In this case, a biopsy or other tissue or biological fluid sample may be necessary. Stem ceils are also particularly preferred in this regard. But, of course, in vivo embodiments are also envisaged.
[0031] In certain embodiments the invention provides a method of treating or inhibiting a condition caused by a defect in a target sequence in a genomic locus of interest in a subject (e.g., mammal or human) or a non-human subject (e.g., mammal) in need thereof comprising modifying the subject or a non-human subject by manipulation of the target sequence and wherein the condition is susceptible to treatment or inhibition by manipulation of the target, sequence comprising providing treatment comprising: delivering a non-naturally occurring or engineered composition comprising an AAA'' or lentivirus vector system comprising one or more AAV or lentivirus vectors operably encoding a composition for expression thereof, wherein the target sequence is manipulated by the composition when expressed, wherein the composition comprises: (A) a non-naturally occurring or engineered composition comprising a vector system comprising one or more vectors comprising I. a first regulatory element operably linked to a CRISPR-Cas system chimeric RNA (chiRNA.) polynucleotide sequence, wherein the polynucleotide sequence comprises (a) a guide sequence capable of hybridizing to a target sequence in a eukaryotic cell, (b) a tracr mate sequence, and (c) a tracr sequence, and Π. a second regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme comprising at least one or more nuclear localization sequences (or optionally at least one or more nuclear localization sequences as some embodiments can involve no NLS) wherein (a), (b) and (c) are arranged in a 5' to 3' orientation, wherein components I and II are located on the same or different vectors of the system, wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence, or (B) a non- naturally occurring or engineered composition comprising a vector system comprising one or more vectors comprising I. a first regulatory element operably linked to (a) a guide sequence capable of hybridizing to a target sequence in a eukaryotic cell , and (b) at least one or more tracr mate sequences, II, a second regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme, and III. a third regulatory element operably linked to a tracr sequence, wherein components I, II and ( If are located on the same or different vectors of the system, wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence. In some embodiments, components I, II and III are located on the same vector. In other embodiments, components I and II are located on the same vector, while component III is located on another "vector. In other embodiments, components I and IK are located on the same vector, while component II is located on another vector. In other embodiments, components I I and III are located on the same vector, while component I is located on another vector. In other embodiments, each of components I, II and 111 is located on different vectors. The invention also provides a viral (e.g. AAV or lentivirus) vector system as described herein. , and can be part of a vector system as described herein.
[0032] Some methods of the invention can include inducing expression. In some methods of the invention the organism or subject is a eukaryote (including mammal including human) or a non-human eukaryote or a non-human animal or a non-human mammal. In some embodiments, the organism or subject is a non-human animal, and may be an arthropod, for example, an insect, or may be a nematode. In some methods of the invention the organism or subject is a plant. In some methods of the invention the organism or subject is a mammal or a non-human mammal. A non-human mammal may be for example a rodent (preferably a mouse or a rat), an ungulate, or a primate. In some methods of the invention the organism or subject is algae, including microaigae, or is a fungus. In some methods of the mvention the viral vector is an AAV or a lentivirus, and can be part, of a vector system as described herein. In some methods of the invention the CRISPR enzyme is a Cas9. In some methods of the invention the expression of the guide sequence is under the control of the T7 promoter and is driven by the expression of T7 polymerase.
[0033] The invention in some embodiments comprehends a method of delivering a CRISPR enzyme comprising delivering to a ceil mRNA encoding the CRISPR enzyme. In some of these methods the CRISPR enzyme is a Cas9.
|0034| The invention also provides methods of preparing the vector systems of the invention, in particular the viral vector systems as described herein. The invention in some embodiments comprehends a method of preparing the AAV of the invention comprising transfecting plasmid(s) containing or consisting essentially of nucleic acid molecule(s) coding for the AAV into AAV-mfected cells, and supplying AAV rep and/or cap obligatory for replication and packaging of the AAV. In some embodiments the AAV rep and/or cap obligator}7 for replication and packaging of the AA V are supplied by transfecting the cells with helper plasmid(s) or helper virus(es). In some embodiments the helper virus is a poxvirus, adenovirus, herpesvirus or baculovirus. In some embodiments the poxvirus is a vaccinia virus. In some embodiments the cells are mammalian cel ls. And in some embodiments the cells are insect ceils and the helper virus is baculovirus. In other embodiments, the virus is a lentivirus.
[0035] In plants, pathogens are often host-specific. For example, Fusarium oxysporum f. sp. lycopersici causes tomato wilt but attacks only tomato, and F. oxysporum f. dianthii Puccinia graminis f. sp. tritici attacks only wheat. Plants have existing and induced defenses to resist most pathogens. Mutations and recombination events across plant generations lead to genetic variability thai gives rise to susceptibility, especially as pathogens reproduce with more frequency than plants. In plants there can be non-host resistance, e.g., the host and pathogen are incompatible. There can also be Horizontal Resistance, e.g., partial resistance against all races of a pathogen, typically control led by many genes and Vertical Resistance, e.g., complete resistance to some races of a pathogen but not to other races, typically controlled by a few genes. In a Gene-for-Gene level, plants and pathogens evolve together, and the genetic changes in one balance changes in other. Accordingly, using Natural Variability, breeders combine most useful genes for Yield, Quality, Uniformity, Hardiness, Resistance. The sources of resistance genes include native or foreig Varieties, Heirloom Varieties, Wild Plant Relatives, and Induced Mutations, e.g., treating plant material with mutagenic agents. Using the present invention, plant breeders are provided with a new tool to induce mutations. Accordingly, one skilled in the art can analyze the genome of sources of resistance genes, and in Varieties having desired characteristics or traits employ the present invention to induce the rise of resistance genes, with more precision than previous mutagenic agents and hence accelerate and improve plant breeding programs.
[0036] The invention further comprehends a composition of the invention or a CRISPR. enzyme thereof (including or alternatively mRNA encoding the CRISPR enzyme) for use in medicine or in therapy. In some embodiments the invention comprehends a composition according to the invention or a CRISPR enzyme thereof (including or alternatively mRNA encoding the CRISPR enzyme) for use in a method according to the invention. In some embodiments the invention provides for the use of a composition of the invention or a CRISPR enzyme thereof (including or alternatively mRNA encoding the CRISPR enzyme) in ex vivo gene or genome editing. In certain embodiments the invention comprehends use of a composition of the invention or a CRISPR enzyme thereof (including or alternatively mRNA encoding the CRISPR enzyme) in the manufacture of a medicament for ex vivo gene or genome editing or for use in a method according of the invention. The invention comprehends in some embodiments a composition of the Invention or a CRISPR enzyme thereof (including or alternatively mRN A encoding the CRISPR enzyme), wherein the target sequence is flanked at its 3 ' end by a PAM (protospacer adjacent motif) sequence comprising 5 '-motif, especially where the Cas9 is (or is derived from) S. pyogenes or S. aureus Cas9. For example, a suitable PAM is 5 -NRG or 5 -NNGRR (where N is any Nucleotide) for SpCas9 or SaCas9 enzymes (or derived enzymes), respectively, as mentioned below.
[0037] It will be appreciated that SpCas9 or SaCas9 are those from or derived from 5. pyogenes or S. aureus Cas9.
[0038] Apects of the invention comprehend improving the specificity of a CRISPR enzyme, e.g. Cas9, mediated gene targeting and reducing the likelihood of off-target modification by the CRISPR enzyme, e.g. Cas9. The invention in some embodiments comprehends a method of modifying an organism or a non-human organism by minimizing off-target modifications by manipulation of a first and a second target sequence on opposite strands of a DNA duplex in a genomic locus of interest in a cell comprising delivering a noii-naturaily occurring or engineered composition comprising :
[0039] I. a first CRISPR-Cas system chimeric RNA (chiRNA) polynucleotide sequence, wherein the first polynucleotide sequence comprises:
(a) a first guide sequence capable of hybridizing to the first target sequence,
(b) a first tracr mate sequence, and
(c) a first tracr sequence,
[0040] II. a second CRISPR-Cas system chiRNA polynucleotide sequence, wherein the second polynucleotide sequence comprises:
(a) a second guide sequence capable of hybridizing to the second target sequence,
(h) a second tracr mate sequence, and
(c) a second tracr seque ce, and
[0041] III. a polynucleotide sequence encoding a CRISPR enzyme comprising at least one or more nuclear localization sequences and comprising one or more mutations, wherein (a), (b) and (c) are arranged in a 5' to 3' orientation, wherein when transcribed, the first and the second tracr mate sequence hybridize to the first and second tracr sequence respectively and the first and the second guide sequence directs sequence-specific binding of a first and a second CRISPR complex to the first and second target sequences respectively, wherein the first CRISPR comple comprises the CRISPR enzyme complexed with (1) the first guide sequence that is hybridized to the first target sequence, and (2) the first tracr mate sequence that is hybridized to the first tracr sequence, wherein the second CRISPR complex comprises the CRISPR enzyme complexed with (1) the second guide sequence that is hybridized to the second target sequence, and (2) the second tracr mate sequence that is hybridized to the second tracr sequence, wherein the polynucleotide sequence encoding a CRISPR enzyme is DNA or RNA, and wherein the first guide sequence directs cleavage of one strand of the DNA duplex near the first target sequence and the second guide sequence directs cleavage of the other strand near the second target sequence inducing a double strand break, thereby modifying the organism or the non-human organism by minimizing off-target modifications. [0042] In some methods of the invention any or all of the polynucleotide sequence encoding the CRISPR enzyme, the first and the second guide sequence, the first and the second tracr mate sequence or the first and the second tracr sequence, is/are RNA, In further embodiments of the invention the polynucleotides encoding the sequence encoding the CR ISPR enzyme, the first and the second guide sequence, the first and the second tracr mate sequence or the first and the second tracr sequence, is/are RNA and are delivered via liposomes, nanoparticles, exosomes, micro vesicles, or a gene-gun. In certain embodiments of the invention, the first and second tracr mate sequence share 100% identity and/or the first and second tracr sequence share 100% identity. In some embodiments, the polynucleotides may be comprised within a vector system comprising one or more vectors. In preferred embodiments of the invention the CRISPR enzyme is a Cas9 enzyme, e.g. SpCas9. In an aspect of the in vention the CRISPR enzyme comprises one or more mutations in a catalytic domain, wherein the one or more mutations are selected from the group consisting of D10A, E762A, H840A, N854A, N863A and D986A. In a highly preferred embodiment the CRISPR enzyme has the DI0A mutation. In preferred embodiments, the first CRISPR enzyme has one or more mutations such thai the enzyme is a complementary strand nicking enzyme, and the second CRISPR enzyme has one or more mutations such that the enzyme is a non-complementary strand nicking enzyme. Alternatively the first enzyme may be a non-complementary strand nicking enzyme, and the second enzyme may be a complementary strand nicking enzyme.
1 043| In preferred methods of the invention the first guide sequence directing cleavage of one strand of the DNA duplex near the first target sequence and the second guide sequence directing cleavage of the other strand near the second target sequence results in a 5' overhang. In embodiments of the invention the 5' overhang is at most 200 base pairs, preferably at most 100 base pairs, or more preferably at most 50 base pairs. In embodiments of the invention the 5' overhang is at least 26 base pairs, preferably at least 30 base pairs or more preferably 34-50 base pairs.
[0044] The invention in some embodiments comprehends a method of modifying an organism or a non-human organism by minimizing off-target modifications by manipulation of a first and a second target sequence on opposite strands of a DNA duplex in a genomic locus of interest in a cell comprising delivering a non-naturaily occurring or engineered composition comprising a vector system comprising one or more vectors comprising [0045] I. a first regulatory element operabiy linked to
(a) a first guide sequence capable of hybridizing to the first target sequence, and
(b) at least one or more tracr mate sequences,
[0046] II. a second regulatory element operabiy linked to
(a) a second guide sequence capable of hybridizing to the second target sequence, and
(b) at least one or more tracr mate sequences,
[0047] III. a third regulatory element operabiy linked to an enzyme-coding sequence encoding a CRISPR enzyme, and
[0048] IV. a fourth regulatory element operabiy linked to a tracr sequence,
[0049] wherein components L II, III and IV are located on the same or different vectors of the system, when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the first a d the second guide sequence direct sequence-specific binding of a first and a seco d CRISPR complex to the first and second target sequences respectively, wherein the first CRISPR complex comprises the CRISPR enzyme complexed with (1) the first guide seque ce that is hybridized to the first target sequence, and (2) the tracr .mate sequence that is hybridized to the tracr sequence, wherein the second CRISPR complex comprises the CRISPR enzyme complexed with (1) the second guide sequence that is hybridized to the second target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence, wherein the polynucleotide sequence encoding a CRISPR enzyme is DNA or RNA, and wherein the first guide sequence directs cleavage of one strand of the DNA duplex near the first target sequence and the second guide sequence directs cleavage of the other strand near the second target sequence inducing a double strand break, thereby modifying the organism or the non-human organism by minimizing off- target modifications.
[0050] The invention also provides a vector system as described herein. The system may comprise one, two, three or four different vectors. Components I, II, III and IV may thus be located on one, two, three or four different vectors, and all combinations for possible locations of the components are herein envisaged, for example: components I, I I, I II and IV can be located on the same vector; components I, II, III and IV can each be located on different vectors; components I, ( 1, II I and I V may be located on a total of two or three different vectors, with al l combinations of locations envisaged, etc. [0051] In some methods of the invention any or all of the polynucleotide sequence encoding the CRISPR enzyme, the first and the second guide sequence, the first and the second tracr mate sequence or the first and the second tracr sequence, is/are RNA, In further embodiments of the invention the first and second tracr mate sequence share 100% identity and/or the first and second tracr sequence share 100% identity. In preferred embodiments of the invention the CRISPR enzyme is a Cas9 enzyme, e.g. SpCas9. in an aspect of the invention the CRJSPR enzyme comprises one or more mutations in a catalytic domain, wherein the one or more mutations are selected from the group consisting of DIOA, E762A, H840A, N854A, N863A and D986A. In a highly preferred embodiment the CRISPR enzyme has the DIOA mutation. In preferred embodiments, the first CRISPR enzyme has one or more mutations such that the enzyme is a complementary strand nicking enzyme, and the second CRISPR enzyme has one or more mutations such that the enzyme is a non-complementary strand nicking enzyme. Alternatively the first enzyme may be a non-complementary strand nicking enzyme, and the second enzyme may be a complementary strand nicking enzyme. In a further embodiment of the invention, one or .more of the viral vectors are delivered via liposomes, nanoparticles, exosomes, micro vesicles, or a gene-gun.
[0052] In preferred methods of the invention the first guide sequence directing cleavage of one strand of the DNA duplex near the first target sequence and the second guide sequence directing cleavage of other strand near the second target sequence results in a 5' overhang. In embodiments of the invention the 5" overhang is at most 200 base pairs, preferably at most 100 base pairs, or more preferably at most 50 base pairs. In embodiments of the invention the 5' overhang is at least 26 base pairs, preferably at least 30 base pairs or more preferably 34-50 base pairs.
[0053] The invention in some embodiments comprehends a method of .modifying a genomic locus of interest by minimizing off-target modifications by introducing into a cell containing and expressing a double stranded DNA molecule encoding a gene product of interest an engineered, non-naturally occurring CR ISPR-Cas system comprising a Cas protein having one or more mutations and two guide RNAs that target a first strand and a second strand of the DNA molecule respectively, whereby the guide RNAs target the DNA molecule encoding the gene product and the Cas protein nicks each of the first strand and the second strand of the DNA molecule encoding the gene product, whereby expression of the gene product is altered; and, wherein the Cas protein and the two guide RNAs do not naturally occur together.
[0054] In preferred methods of the invention the Cas protein nicking each of the first stra d and the second strand of the DM A molecule encoding the gene product results in a 5' overhang. I embodiments of the invention the 5' overhang is at most 200 base pairs, preferably at most 100 base pairs, or more preferably at most 50 base pairs. In embodiments of the invention the 5 ' overhang is at least 26 base pairs, preferably at least 30 base pairs or more preferably 34-50 base pairs.
[0055] Embodiments of the invention also comprehend the guide RNAs comprising a guide sequence fused to a tracr mate sequence and a tract" sequence. In an aspect of the invention the Cas protein is codon optimized for expression in a eukaryotic cel l, preferably a mammalian cell or a human ceil. In further embodiments of the invention the Cas protein is a type II CRISPR- Cas protein, e.g. a Cas 9 protein. In a highly preferred embodiment the Cas protein is a Cas9 protein, e.g. SpCas9. In aspects of the invention the Cas protein has one or more mutations selected from the group consisting of D10A, E762A, H840A, N854A, N863A and D986A. In a highly preferred embodiment the Cas protein has the D10A mutation.
[0056] Aspects of the in vention relate to the expression of the gene product being decreased or a template polynucleotide being further introduced into the DNA molecule encoding the gene product or an intervening sequence being excised precisely by allowing the two 5' overhangs to reanneal and ligate or the activity or function of the gene product being altered or the expression of the gene product being increased. In an embodiment of the invention, the gene product is a protein.
[0057] The invention also comprehends an engineered, non-naturally occurring CRISPR-Cas system comprising a Cas protein having one or more mutations and two guide RNAs that target a first strand and a second strand respectively of a double stranded DNA molecule encoding a gene product in a cell, whereby the guide RNAs target the DNA molecule encoding the gene product and the Cas protein nicks each of the first strand and the second strand of the DNA molecule encoding the gene product, whereby expression of the gene product is altered; and, wherein the Cas protein and the two guide RNAs do not naturally occur together,
[0058] In aspects of the invention the guide RNAs may comprise a guide sequence fused to a tracr mate sequence and a tracr sequence. In an embodiment of the invention the Cas protein is a type II CRISPR-Cas protein. In an aspect of the invention the Cas protein is eodon optimized for expression in a eukaryotic cell, preferably a mammalian cell or a human cell. In further embodiments of the invention the Cas protein is a type II CRISPR-Cas protein, e.g. a Cas 9 protein. In a highly preferred embodiment the Cas protein is a Cas9 protein, e.g. SpCas9. In aspects of the invention the Cas protein has one or more mutations selected from the group consisting of D10A, E762A, H840A, N854A, N863A and D986A. In a highly preferred embodiment the Cas protein has the D10A mutation.
[0059] Aspects of the in vention relate to the expression of the gene product being decreased or a template polynucleotide being further introduced into the DNA molecule encoding the gene product or an intervening sequence being excised precisely by allowing the two 5' overhangs to reanneal and ligate or the activity or function of the gene product being altered or the expression of the gene product being increased. In an embodiment of the invention, the gene product is a protein.
[0060] The invention also comprehends a engineered, noii-naturaily occurring vector system comprising one or more vectors com rising:
a) a first regulatory element operably linked to each of two CRISPR-Cas system guide RNAs that target a first strand and a second strand respectively of a double stranded DNA. molecule encoding a gene product,
b) a second regulatory element operably linked to a Cas protein,
wherein components (a) and (b) are located on same or different vectors of the system, whereby the guide RNAs target the DNA molecule encoding the gene product a d the Cas protein icks each of the first strand and the second strand of the DNA molecule encoding the gene product, whereby expression of the gene product is altered; and, wherein the Cas protein and the two guide RNAs do not naturally occur together.
[0061] In aspects of the invention the guide RNAs may comprise a guide sequence fused to a tracr mate sequence and a tracr sequence. In an embodimen t of the invention the Cas protein is a type II CRISPR-Cas protein. In an aspect of the invention the Cas protein is codon optimized for expression in a eukaryotic ceil, preferably a mammalian cell or a human cell. In further embodiments of the invention the Cas protein is a t pe I I CR ISPR-Cas protein, e.g. a Cas 9 protein. In a highly preferred embodiment the Cas protein is a Cas9 protein, e.g. SpCas9. In aspects of the invention the Cas protein has one or more mutations selected from the group consisting of D10A, E762A, H840A, N854A, N863A and D986A. In a highly preferred embodiment the Cas protein has the D10A mutation.
[0062] Aspects of the invention relate to the expression of the gene product being decreased or a template polynucleotide being further introduced into the DNA molecule encoding the gene product or an intervening sequence being excised precisely by allowing the two 5' overhangs to reanneal and ligate or the activity or function of the gene product being altered or the expression of the gene product being increased. In an embodiment of the invention, the gene product is a protein. In preferred embodiments of the invention the vectors of the system are viral vectors. In a further embodiment, the vectors of the system are delivered via liposomes, nanoparticies, exosomes, microvesicl.es, or a gene-gun.
10063| In one aspect, the invention provides a method of modifying a target polynucleotide in a eukaryotic cell. In some embodiments, the method comprises allowing a CRISPR complex to bind to the target polynucleotide to effect cleavage of said target polynucleotide thereby modifying the target polynucleotide, wherein the CRISPR complex comprises a CRISPR enzyme compiexed with a guide sequence hybridized to a target sequence within said target polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence. In some embodiments, said cleavage comprises cleaving one or two strands at the location of the target sequence by said CRISPR enzyme. In some embodiments, said cleavage results in decreased transcription of a target gene. In some embodiments, the method further comprises repairing said cleaved target polynucleotide by homologous recombination with an exogenous template polynucleotide, wherein said repair results in a mutation comprising an insertion, deletion, or substitution of one or more nucleotides of said target polynucleotide. In some embodiments, said mutation results in one or more amino acid changes in a protein expressed from a gene comprising the target sequence. In some embodiments, the method further comprises delivering one or more vectors to said eukaryotic cell, wherein the one or more vectors drive expression of one or more of: the CRISPR enzyme, the guide sequence linked to the tracr mate sequence, and the tracr sequence. In some embodiments, said vectors are delivered to the eukaryotic cell in a subject. In some embodiments, said modifying takes place in said eukaryotic cell in a cell culture. In some embodiments, the method further comprises isolating said eukaryotic cell from a subject prior to said modifying. In some embodiments, the method further comprises returning said eukaryotie cell and/or cells derived therefrom to said subject.
[0064] In one aspect, the invention provides a method of modifying expression of a polynucleotide in a eukaryotie cell. In some embodiments, the method comprises allowing a CRISPR complex to bind to the polynucleotide such that said binding results in i creased or decreased expression of said polynucleotide; wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence. In some embodiments, the method further comprises delivering one or more vectors to said eukaryotie cells, wherein the one or more vectors drive expression of one or more of: the CRISPR enzyme, the guide sequence linked to the tracr mate sequence, and the tracr sequence.
[CI065] i one aspect, the invention provides a method of generating a model eukaryotie cell comprising a mutated disease gene. In some embodiments, a disease gene is any gene associated with an increase in the risk of having or developing a disease. In some embodiments, the method comprises (a) introducing one or more vectors into a eukaryotie cell, wherein the one or more vectors drive expression of one or more of: a CRISPR enzyme, a guide sequence linked to a tracr mate sequence, and a tracr sequence; and (b) allowing a CRISPR complex to bind to a target polynucleotide to effect cleavage of the target poly ucleotide within said disease ge e, wherein the CRISPR complex comprises the CRISPR enzyme complexed with (I) the guide sequence that is hybridized to the target sequence within the target poly ucleotide, and (2) the tracr mate sequence that is hybridized to the tracr sequence, thereby generating a model eukaryotie cell comprising a mutated disease gene. In some embodiments, said cleavage comprises cleaving one or two strands at the location of the target sequence by said CRISPR enzyme. In some embodiments, said cleavage results in decreased transcription of a target gene. In some embodiments, the method further comprises repairing said cleaved target polynucleotide by homologous recombination with an exogenous template polynucleotide, wherein said repair results in a mutation comprising an insertion, deletion, or substitution of one or more nucleotides of said target polynucleotide. In some embodiments, said mutation results in one or more amino acid changes in a protein expression from a gene comprising the target sequence. [0066] In one aspect the invention provides for a method of selecting one or more prokaryotie cell(s) by introducing one or more mutations in a gene in the one or more prokaryotie cell (s), the method comprising: introducing one or more vectors into the prokaryotie cel l (s), wherein the one or more vectors drive expressio of one or more of: a CRISPR enzyme, a guide sequence linked to a tracr mate sequence, a tracr sequence, and an editing template; wherein the editing template comprises the one or more mutations that abolish CRISPR enzyme cleavage; allowing homologous recombination of the editing template with the target polynucleotide in the cell(s) to be selected; allowing a CRISPR complex to bind to a target polynucleotide to effect cleavage of the target polynucleotide within said gene, wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence within the target polynucleotide, and (2) the tracr mate sequence that is hybridized to the tracr sequence, wherein binding of the CRISPR complex to the target polynucleotide induces cell death, thereby allowing one or more prokaryotie cell(s) in which one or more mutations have been introduced to be selected. In a preferred embodiment, the CRISPR enzyme is Cas9, In another aspect of the invention the cell to be selected may be a eukaryotic cell. Aspects of the invention allow for selection of specific ceils without requiring a selection marker or a two-step process thai may include a counter-selection system,
[0067] In one aspect, the invention provides for methods of modifying a target polynucleotide in a eukaryotic cell. In some embodiments, the method comprises allowing a CRISPR complex to bind to the target polynucleotide to effect cleavage of said target polynucleotide thereby modifying the target polynucleotide, wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said target polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence.
[0068] In other embodiments, this invention provides a method of modifying expression of a polynucleotide in a eukaryotic cell. The method comprises increasing or decreasing expression of a target polynucleotide by using a CRJSPR complex that binds to the polynucleotide.
[0069] Where desired, to effect the modification of the expression in a cell, one or more vectors comprising a tracr sequence, a guide sequence linked to the tracr mate sequence, a sequence encoding a CRISPR enzyme is delivered to a cell. In some methods, the one or more vectors comprises a regulatory element operably linked to an enzyme-coding sequence encoding said CRISPR enzyme comprising a nuclear localization sequence; and a regulatory element operably linked to a tracr mate sequence and one or more insertion sites for inserting a guide sequence upstream of the tracr mate sequence. When expressed, the guide sequence directs sequence-specific binding of a CRISPR complex to a target sequence in a cell. Typically, the CRISPR complex comprises a CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence.
[0070] In some methods, a target polynucleotide can be inactivated to effect the modification of the expression in a cell. For example, upon the binding of a CRISPR complex to a target sequence in a cell, the target polynucleotide is inactivated such that the sequence is not transcribed, the coded protein is not produced, or the sequence does not function as the wild-type sequence does. For example, a protein or microRNA coding sequence may be inactivated such that the protein is not produced.
[0071] In certain embodiments, the CRISPR enzyme comprises one or more mutations selected from the group consisting of D10A, E762A, H840A, N854A, N863A or D986A and/or the one or more mutations is in a RuvCl or HNH domain of the CRISPR enzyme or is a mutatio as otherwise as discussed herein. In some embodiments, the CRISPR. enzyme has one or more mutations in a catalytic domain, wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and wherein the enzyme further comprises a functional domain. In some embodiments, the functional domain is a transcriptional activation domain, preferably VP64. In some embodiments, the functional domain is a transcription repression domain, preferably KRAB. In some embodiments, the transcription repression domain is SID, or concatemers of SID (eg SID4X). In some embodiments, the functional domain is an epigenetic modifying domain, such that an epigenetic modifying enzyme is provided. In some embodiments, the functional domain is an activation domain, which may be the P65 activation domain.
[0072] In some embodiments, the CRISPR enzyme is a type I or III CRISPR enzyme, but is preferably a type II CRISPR enzyme. This type I I CRISPR enzyme may be any Cas enzyme. A Cas enzyme may be identified as Cas9 as this can refer to the general class of enzymes that share homology to the biggest nuclease with multiple nuclease domains from the type II CRISPR
99 system. Most preferably, the Cas9 enzyme is from, or is derived from, spCas9 or saCas9, By derived. Applicants mean that the derived enzyme is largely based, in the sense of having a high degree of sequence homology with, a wlidtype enzyme, but that it has been mutated (modified) in some way as described herein.
[0073] It will be appreciated that the terms Cas and CRISPR enzyme are generally used herein interchangeably, unless otherwise apparent. As mentioned above, many of the residue numberings used herein refer to the Cas9 enzyme from the type II CRISPR locus in Streptococcus pyogenes. However, it will be appreciated that this invention includes many more Cas9s from other species of microbes, such as SpCas9, SaCa9, Stl Cas9 and so forth.
[0074] An example of a codon optimized sequence, in this instance optimized for humans (i.e. being optimized for expression in humans) is provided herein, see the SaCas9 human codon optimized sequence. Whilst this is preferred, it will be appreciated that other examples are possible and codon optimization for a host species is known.
[0075] Preferably, deliver}.' is in the form of a vector which may be a viral vector, such as a lenti- or baculo- or preferably adeno-viral/adeno-associated viral vectors, but other means of delivery are known (such as yeast systems, microvesicles, gene guns/means of attaching vectors to gold nanopartic!es) and are provided. A vector may mean not only a viral or yeast system (for instance, where the nucleic acids of interest may be operably linked to and under the control of (in terms of expression, such as to ultimately provide a processed RNA) a promoter), but also direct deliver}' of nucleic acids into a host cell. While in herein methods the vector may be a viral vector and this is advantageously an AAV, other viral vectors as herein discussed can be employed, such as lentivirus. For example, baculoviruses may be used for expression in insect cells. These insect cells may, in turn be useful for producing large quantities of further vectors, such as AAV or lentivirus vectors adapted for delivery of the present invention. Also envisaged is a method of delivering the present CRISPR enzyme comprising delivering to a ceil niR A encoding the CRISPR enzyme. It will be appreciated that in certain embodiments the CRISPR enzyme is truncated, and/or comprised of less than one thousand amino acids or less than four thousand amino acids, and/or is a nuclease or nickase, and/or is codon-optimized, and/or comprises one or more mutations, and/or comprises a chimeric CR ISPR enzyme, and/or the other options as herein discussed. AAV and lentiviral vectors are preferred. [0076] In certain embodiments, the target sequence is flanked or followed, at its 3' end, by a PAM suitable for the CRISPR enzyme, typically a Cas and in particular a Cas9.
[0077] For example, a suitable PAM is 5'-NRG or 5'-NNGRR for SpCas9 or SaCas9 enzymes (or derived enzymes), respectively.
[0078] It will be appreciated that SpCas9 or SaCas9 are those from or derived from S. pyogenes or S. aureus Cas9.
[0079] Accordingly, it is an object of the invention to not encompass within the invention any previously known product, process of making the product, or method of using the product such that Applicants reserve the right and hereby disclose a disclaimer of any previously known product, process, or method. It is further noted that the invention does not intend to encompass within the scope of the invention any product, process, or making of the product or method of using the product, which does not meet the written description and enablement requirements of the USPTO (35 U.S.C. § 1 12, first paragraph) or the EPO (Article 83 of the EPC), such that Applicants reserve the right and hereby disclose a disclaimer of any previously described product, process of making the product, or method of using the product.
[0080] It is noted that in this disclosure and particularly in the claims and/or paragraphs, terms such as "comprises", ''comprised", "comprising" and the like can have the meaning attributed to it in U.S. Patent law; e.g., they can mean "includes", "included", "including", and the like; and that terms such as "consisting essentially of and "consists essentially of have the meaning ascribed to them in U.S. Patent law, e.g., they allow for elements not explicitly recited, but exclude elements that are found in the prior art or that affect a basic or novel characteristic of the invention.
[0081] These and other embodiments are disclosed or are obvious from and encompassed by, the following Detailed Description.
BRIEF DESCRIPTION OF THE DRAWINGS
[CI082] The novel features of the invention are set forth with particularity i the appended claims. A better understanding of the features and advantages of the present invention will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the Invention are utilized, and the accompanying drawings of which: [0083] Figure 1 shows a schematic model of the CRISPR system. The Cas9 nuclease from Streptococcus pyogenes (yellow) is targeted to genomic DNA by a synthetic guide RNA (sgRNA) consisting of a 20-nt guide seque ce (blue) and a scaffold (red). The guide sequence base-pairs with the DNA target (blue), directly upstream of a requisite 5'-NGG protospacer adjacent motif (PAM; magenta), and Cas9 mediates a double-stranded break (DSB) ~3 bp upstream of the P AM (red triangle).
[0084] Figure 2A-F shows an exemplary CRISPR system, a possible mechanism of action, an example adaptation for expression in eukaryotic cells, and results of tests assessing nuclear localization and CRISPR activity.
[0085] Figure 3A-D shows results of an evaluation of SpCas9 specificity for an example target.
[0086] Figure 4A-G show an exemplary vector system and results for its use in directing homologous recombination in eukaryotic cells.
[0087] Figure 5 provides a table of protospacer sequences and summarizes modification efficiency results for protospacer targets designed based on exemplary S. pyogenes and S. thermophilus CRISPR systems with corresponding PAMs against loci in human and mouse genomes. Cells were transfected with Cas9 and either pre-crRNA/tracrRNA or chimeric RNA, and analyzed 72 hours after transfection. Percent indels are calculated based on Surveyor assay results from indicated ceil lines (N=3 for all protospacer targets, errors are S.E.M., N.D. indicates not detectable using the Surveyor assay, and N.T. indicates not tested in this study).
[0088] Figure 6A-C shows a comparison of different tracrRNA transcripts for Cas9-mediated gene targeting.
[0089] Figure 7 shows a schematic of a surveyor nuclease assay for detection of double strand break-induced micro-insertions and -deletions.
[0090] Figure 8A-B shows exemplary bicistronic expression vectors for expression of CRISPR system elements in eukaryotic cel ls.
[00 J ] Figure 9A-C shows histograms of distances between adjacent S. pyogenes SF370 locus 1 PAM (NGG) (Figure 9A) and S. thermophilus LMD9 locus 2 PAM (NNAGAAW) (Figure 9B) in the human genome; and distances for each PAM by chromosome (Chr) (Figure 9C). [0092] Figure 10A-D shows an exemplary CRISPR. system, an example adaptation for expression in eukaryotic cells, and results of tests assessing CRISPR activity.
[0093] Figure 11 A-C shows exemplary manipulations of a CRISPR system for targeting of genomic loci in mammalian cells.
[0094] Figure 12A-B shows the results of a Northern blot analysis of crRNA processing in mammalian cells.
[0095] Figure 13A-B shows an exemplary selection of protospacers in the human PVALB and mouse Th loci.
[0096] Figure 14 shows example protospacer and corresponding PAM sequence targets of the S. thermophilus CRISPR. system in the human EMXl locus.
[0097] Figure 15 provides a table of sequences for primers and probes used for Surveyor, RFLP, genomic sequencing, and Northern blot assays.
[0098] Figure 16 A-C shows exemplary manipulation of a CRISPR system with chimeric RNAs and results of SURVEYOR assays for system activity in eukaryotic cells.
[0099] Figure 17A-B shows a graphical representation of the resul ts of SURVEYOR, assays for CRISPR system activity in eukaryotic cells.
[00100] Figure 18 shows an exemplary visualization of some S. pyogenes Cas9 target sites in the human genome using the UCSC genome browser.
[00101] Figure 19A-D shows a circular depiction of the phylo genetic analysis revealing five families of Cas9s, including three groups of large Cas9s (- 1400 amino acids) and two of small Cas9s (~1100 amino acids),
[00102] Figure 20A-F shows the linear depiction of the phylogenetic analysis revealing five families of Cas9s, including three groups of large Cas9s (-1400 amino acids) and two of small Cas9s (~.l .100 amino acids).
[00103] Figure 21A-D shows genome editing via homologous recombination, (a) Schematic of SpCas9 nickase, with D10A mutation in the RuvC I catalytic domain, (b) Schematic representing homologous recombination (FIR.) at the human EMXl locus using either sense or amisense single stranded oligonucleotides as repair templates. Red arrow above indicates sgRNA cleavage site; PCR primers for genotyping (Tables J and ) are indicated as arrows in right panel, (c) Sequence of region modified by HR. d, SURVEYOR assay for wildtype (wt) and nickase (D10A) SpCas9-mediated indels at the EM XI target 1 locus (n~3). Arrows indicate positions of expected fragment sizes.
[00104] Figure 22A-B shows single vector designs for SpCas9.
[00105] Figure 23 shows a graph representing the length distribution of Cas9 ortho!ogs.
[00106] Figure 24A-M shows sequences where the mutation points are located within the SpCas9 gene.
[00107] Figure 25A shows the Conditional Cas9, Rosa26 targeting vector map.
[00108] Figure 25B shows the Constitutive Cas9, Rosa26 targeting vector map.
[00109] Figure 26 shows a schematic of the important elements in the Constitutive and
Conditional Cas9 constructs.
[00110] Figure 27 shows delivery and in vivo mouse brain Cas9 expression data.
[00111] Figure 28 shows RNA delivery of Cas9 and chimeric RNA into cells (A) Delivery of a GFP reporter as either DNA or mRNA into Neuro-2A. cel ls. (B) Delivery of Cas9 and chimeric RNA against the Ieam2 gene as RNA results in cutting for one of two spacers tested. (C) Delivery of Cas9 and chimeric RNA against the F7 gene as RNA results in cutting for one of two spacers tested.
[001 12] Figure 29 shows how DNA double-strand break (DSB) repair promotes gene editing. In the error-prone non-homologous end joining (NHEJ) pathway, the ends of a DSB are processed by endogenous DNA repair machineries and rejoined together, which can result in random insertion/deletion (indel ) mutations at the site of junction, hide! mutations occurring within the coding region of a gene can result in frame-shift and a premature stop codoii, leading to gene knockout. Alternatively, a repair template in the form of a plasmid or single-stranded oligodcoxynuelcotides (ssODN) can be suppli ed to leverage the homo logy-directed repair (HDR) pathway, which allows high fidelity and precise editing.
[00113] Figure 30A-C shows anticipated results for HDR in HEK and HUES9 cells, (a) Either a targeting plasmid or an ssODN (sense or antisense) with homology arms can be used to edit the sequence at a target genomic locus cleaved by Cas9 (red triangle). To assay the efficiency of HDR, we introduced a Hindlll site (red bar) into the target locus, which was PCR-amplified with primers that anneal outside of the region of homology. Digestion of the PGR. product wit Hindlll reveals the occurrence of HDR events, (b) ssODNs, oriented in either the sense or the antisense (s or a) direction relative to the locus of interest, can be used in combination with Cas9
77 to achieve efficient BDR-mediated editing at the target locus. A minimal homology region of 40 bp, and preferably 90 bp, is recommended on either side of the modification (red bar), (c) Example of the effect of ssODNs on HDR in the EMX1 locus is shown using both wild-type Cas9 and Cas9 nickase (D10A). Each ssODN contains homology arms of 90 bp flanking a 12-bp insertion of two restriction sites
[00114] Figure 31 A-C shows the repair strategy for Cystic Fibrosis delta F508 mutation.
[00115] Figure 32A-B (a) shows a schematic of the GAA repeat expansion in FXN intron 1 and (b) shows a schematic of the strategy adopted to excise the GAA expansion region using the CRISPR/Cas system.
[00116] Figure 33 shows a screen for efficient SpCas9 mediated targeting of Tetl-3 and Drsmtl , 3a and 3b gene loci. Surveyor assay on DMA from transfected N2A ceils demonstrates efficient DNA cleavage by using different gRNAs.
[001 J T] Figure 34 shows a strategy of multiplex genome targeting using a 2 -vector system in an AAV 1/2 delivery system. Tetl-3 and Dnmtl, 3a and 3b gRNA under the control of the U6 promoter. GFP-KASH under the control of the human synapsin promoter. Restriction sides shows simple gRNA replacement strategy by subcloning. HA-tagged SpCas9 flanked by two nuclear localization signals (NLS) is shown. Both vectors are delivered into the brain by AAV 1/2 virus in a 1 :1 ratio.
[00118] Figure 35 shows verification of multiplex DNMT targeting vector #1 functionality using Surveyor assay. N2A ceils were co-transfected with the DNMT targeting vector #1 (+) and the SpCas9 encoding vector for testing SpCas9 mediated cleavage of DNMTs genes family loci. gRNA only (-) is negative control. Cells were harvested for DNA purification and downstream processing 48 h after transfection.
[00119] Figure 36 shows verification of multiplex DNMT targeting vector #2 functionality using Surveyor assay. N2A cells were co-transfected with the DNMT targeting vector #1 (+) and the SpCas9 encoding vector for testing SpCas9 mediated cleavage of DNMTs genes family loci. gRNA only (-) is negative control. Cells were harvested for DNA purification and downstream processing 48 h after transfection.
[00120] Figure 37 shows schematic overview of short promoters and short polyA versions used for HA-SpCas9 expression in vivo. Sizes of the encoding region from L-ITR to R-ITR are shown on the right. [00121] Figure 38 shows schematic overview of short promoters and short poiyA versions used for HA-SaCas9 expression in vivo. Sizes of the encoding region from L-ITR to R-ITR are shown on the right.
[00122] Figure 39 shows expression of SpCas9 and SaCas9 in N2A ceils. Representative Western blot of HA-tagged SpCas9 and SaCas9 versions under the control of different short promoters and with or short polyA (spA) sequences. Tubulin is loading control. mCherry (mCh) is a transfection control. Cells were harvested and further processed for Western blotting 48 h after transfection.
[00123] Figure 40 shows screen for efficient SaCas9 mediated targeting of Tet.3 gene locus. Surveyor assay on DNA from transfecte N2A cells demonstrates efficient DNA cleavage by using different gRNAs wit NNGGGT PUM sequence. GFP transfected cells and ceils expressing only SaCas9 are controls.
[00124] Figure 41 shows expression of A-SaCas9 in the mouse brain. Animals were injected into dentate gyri with vims driving expression of HA-SaCas9 under the control of human Synapsin promoter. Animals were sacrificed 2 weeks after surgery. HA tag was detected using rabbit monoclonal antibody C29F4 (Cell Signaling). Cell nuclei stained in blue with DAPI stain.
[00125] Figure 42 shows expression of SpCas9 and SaCas9 in cortical primary neurons in culture 7 days after transduction. Representative Western blot of HA-tagged SpCas9 and SaCas9 versions under the control of different promoters and with bgh or short polyA (spA) sequences. Tubulin is loading control.
[00126] Figure 43 shows LIVE DEAD stain of primary cortical neurons 7 days after transduction with AAV 1 particles carrying SpCas9 with different promoters and multiplex gRNAs constructs (example shown on the last panel for DNMTs). Neurons after AAV transduction were compared with control untransduced neurons. Red nuclei indicate permeabilized, dead cells (second line of panels). Live ceils are marked in green color (third line of panels).
[00127] Figure 44 shows LIVE/DEAD stain of primary cortical neurons 7 days after transduction with AAVl particles carrying SaCas9 with different promoters. Red nuclei indicate permeabilized, dead ceils (second line of panels). Live cells are marked in green color (third line of panels). [00128] Figure 45 shows comparison of morphology of neurons after transduction with AAV1 virus carrying SpCas9 and gRNA multiplexes for TETs and DNMTs genes loci. Neurons without transduction are shown as a control.
[00129] Figure 46 shows verification of multiplex DNMT targeting vector #1 functionality using Surveyor assay in primary cortical neurons. Cells were co -transduced with the DNMT targeting vector #1 and the SpCas9 viruses with different promoters for testing SpCas9 mediated cleavage of DNMTs genes family loci.
[00130] Figure 47 shows in vivo efficiency of SpCas9 cleavage in the brain. Mice were injected with AAV 1 /2 virus carrying gRNA multiplex targeting DNMT family genes loci together with SpCas9 viruses under control of 2 different promoters: mouse Mecp2 and rat- Map lb. Two weeks after injection brain tissue was extracted and nuclei were prepped and sorted using FACS, based on the GFP expression driven by Synapsin promoter from gRNA multiplex construct. After gDNA extraction Surveyor assay was run. + indicates GFP positive nuclei and - control, GFP -negative nuclei from the same animal. Numbers on the gel indicate assessed SpCas9 efficiency.
[00131 ] Figure 48 shows purification of GFP-KASH labeled cell nuclei from hippocampal neurons. The outer nuclear membrane (ONM) of the cell nuclear membrane is tagged with, a fusion of GFP and the ASH protein transmembrane domain. Strong GFP expression in the brain after one week of stereotactic surgery and AAV 1/2 injection. Density gradient eentrifugation step to purify cell nuclei from intact brain. Purified nuclei are shown. Chromatin stain by Vybrant® DyeCycle™ Ruby Stain is shown in red, GFP labeled nuclei are green. Representative FACS profile of GFP+ and GFP- cell nuclei (Magenta: Vybrant® DyeCycle™ Ruby Stain, Green: GFP).
[00.1.32] Figure 49 shows efficiency of SpCas9 cleavage in the mouse brain. Mice were injected with AAV 1/2 virus carrying gRNA multiplex targeting TET family genes loci together with SpCas9 viruses under control of 2 different promoters: mouse Mecp2 and rat Map lb. Three weeks after injection brain tissue was extracted, nuclei were prepped and sorted using FACS, based on the GFP expression driven by Synapsin promoter from gRNA multiplex construct. After gDNA extraction Surveyor assay was run. + indicates GFP positive nuclei and - control, GFP-negative nuclei from the same animal. Numbers on the gel indicate assessed SpCas9 efficiency. [00133] Figure 50 shows GFP-KASH expression in cortical neurons in culture. Neurons were transduced with AAV1 virus carrying gRNA multiplex constructs targeting TET genes loci. The strongest signal localize around cells nuclei due to KASH domain localization.
[00134] Figure 51 shows (top) a list of spacing (as indicated by the pattern of arrangement for two PAM sequences) between pairs of guide RNAs. Only guide RNA pairs satisfying patterns 1, 2, 3, 4 exhibited indels when used with SpCas9(D10A) nickase. (bottom) GeS images showing that combination of SpCas9(Dl OA) with pairs of guide RNA satisfying patterns 1, 2, 3, 4 led to the formation of indels in the target site.
[00135] Figure 52 shows a list of U6 reverse primer sequences used to generate U6-guide RNA expression casssett.es. Each primer needs to be paired with the U6 forward primer "gcactgagggcctatttcccatgattc" to generate amplicons containing U6 and the desired guide RN A.
[00136] Figure 53 shows a Genomic sequence map from the human Emxl locus showmg the locations of the 24 patterns listed in Figure 33.
[00137] Figure 54 shows on (right) a gel image indicating the formation of indels at the target site when variable 5' overhangs are present after cleavage by the Cas9 nickase targeted by different pairs of guide RNAs. on (left) a table indicating the lane numbers of the gel on the right and various parameters including identifying the guide RNA pairs used and the length of the 5' overhang present following cleavage by the Cas9 nickase.
[00138] Figure 55 shows a Genomic sequence map from the human Emxl locus showing the locations of the different pairs of guide RNAs that result in the gel patterns of Fig. 54 (right) and which are further described in Example 35.
[00139] Figure 56 shows staining of HA-SpCas9 in dorsal and ventral hippocampus 8 weeks after injection of viruses encoding M ecp2-HA-SpCas9 and 3xgRNA-TETS with Syn-KASH- GFP.
[00140] Figure 57 shows Syn_GFP- ASH expression 8 weeks after 3xgRNA virus injection is specific for neurons (NeuN positive cells) and not for glia cells (GFAP positive).
[00141] Figure 58 shows behavior tests conducted 5 weeks after CRISPR-mediated KD of TETs and DNMTs in dentate gyrus (ventral and dorsal part) showed increased level of anxiety and learning deficits. A) time spend in the open arm during elevated plus maze test. B) open field test, time spent in the center of arena vs time in the corners was measured. C) Novel object recognition test, results were measured 3h after familiarization phase. D) Barnes maze; efficiency in finding escape within 3 days of training. E) Barnes maze results. F) Freezing behavior during contextual fear conditioning. G) Latency to first freezing episode during contextual fear conditioning. H) Trace fear conditioning results for TETs KD and DNMTs KD (1). Control - animals injected with SpCas9 virus and GFP- ASH construct without g NAs. TETs - animals injected with both SpCas9 and construct encoding gRNAs against Tetl, Tet2 and Tet3. DNMTs - animals injected wit both SpCas9 and construct encoding gRNAs against Dnmt l , Dnmt3a and Dnmt3b.
[00142] Figure 59 shows cutting efficiency of Tet loci in the brain, 8 weeks after Mecp_SpCas9 vims injection in compare to control animals mjected with Mecp2_SpCas9 virus only.
[00143 J Figure 60 shows cutting efficiency of Dnmt loci in the brain, 8 weeks after Mecp SpCas9 virus injection in compare to control animals injected with Mecp2 SpCas9 virus only,
[00144] Figure 61 shows Dnmt3a staining in the brain, 8 weeks after stereotaxic injection of virus encoding Mecp2 SpCas9 and gRNAs targeting Dnmt loci. Bottom panel shows magnification of ROl indicated on the upper panel.
[00145] Figure 62 shows staining of Syn HA-SaCas9 in the dorsal hippocampus, 4 weeks after injection of virus. First column shows animal injected with Sa-Cas9 only, middle column animal injected with both SaCas9 and gRNAs against TETs loci and the right column represents animal injected with only gRNAs encoding virus. SaCas9 nuclear localization depends on the presence of gRNA.
[00146] Figure 63 shows SpCas9 in 2a cells. A) Targeting- and SpCas9 expression vector, B) Western Blot analysis of N2a cells expressing HA-tagged SpCas9 under the control of different promoters. C) Cutting efficiency of Dnmt loci. D) Western blot analysis demonstrating efficient knock down of Dnmt3a. e) Cutting efficiency of Tet loci.
[00147] Figure 64 shows SpCas9 in primary neurons. A) Schematic overview of SpCas9 cloning strategies used in this study. Short promoters and short polyA for efficient packaging into AAV delivering system. B) Schematic overview of combined multiplex targeting and nuclear envelope labeling strategy. C) Western blot analysis showing expression of HA-tagged SpCas9 under the control of rMaplb and HiMecp2 promoter and bGH and spA signal. D) Immunocytochemistry demonstrating co-expression of SpCas9 and GFP-KASH in primary neurons, SpCas9 under the control of the mMecp2 promoter is expressed in neurons (Map lb, NeiiN) but not in astroglia cells (GFAP).
[00148] Figure 65 shows knock down of Dnmt3a in primary neurons. A) Immunocytochemistry demonstrating efficient knock down of Dnmt3a after targeting with multiplex targeting vector and mMeep2-SpCas9, B) Quantification of Dnmt3a antibody staining in control and targeted neurons. C) Western blot analysis demonstrating reduced Dnmt3a protein level. D) Quantification of W'"estcrn Blot analysis demonstrating a total knock down of Dnmt3a protein level of approx. 75% in a mixed primary neuron culture (neurons and astroglia).
[00149] Figure 66 shows knock down of Dnmt3a in vivo. A) Cutting efficiency of Dnmt loci in the brain, 8 weeks after Mecp SpCas9 virus injection in compare to control animals injected with Mecp2_SpCas9 vims only. B) Western blot analysis showing reduced Dnmt3a protein level in targeted neuronal nuclei (KASH-GFP positive) compared to control nuclei (RubyDye positive) after sorting cell nuclei using FACS.
[00150] Figure 67 shows expression of SaCas9 in primary neurons. A) Size of SaCas9 expression vector using hSynapsin promoter and bGH signal. B) Expression of SaCas9 in primary neurons (NeuN) but not in astroglia (GFAP). C) Extranuclear localization of SaCas9 in absence of gRNA. C Higher magnification of SaCas9 positive neurons shown in C). D) Nuclear localization of SaCas9 in presence of gRNA . D') Higher magnification of SaCas9 positive neurons shown in D). E) Western blot analysis demonstrating expression of HA-tagged SaCas9 and GFP- ASH. F) Cutting efficie cy of Dnmt foci 1 week after AAV infection.
[00151] Figure 68 shows gRNA dependent nuclear localization of SaCas9. A) Confocal imaging analysis demonstrating extranuclear localization of SaCas9 in absence of gRNA in primary neurons. B) Nuclear localization of SaCas9 in presence of gRNA. C) Line Scan analysis of confocal picture A) showing extranuclear localization of SaCas9 in absence of gRNA (red, SaCas9 signal; blue, DAPI signal; green, GFP-KASH signal . D) Line Scan analysis of confocal picture B) showing nuclear localization of SaCas9 in presence of gRNA (red, SaCas9 signal; blue, DAPI signal; green, GFP-KASH signal). E) Subcellular localization of SaCas9 and SpCas9 under conditions without (-) and with (+) gRNA in N2a cells. SaCas9 signal at 250 kDa in the cytoplasm fraction (Tubulin positive) indicating dirnerization of SaCas9 in the cytoplasm. In the presence of gRNA a shift of SaCas9 protein into the nuclear fraction (Sun2 positive) is visible. SaCas9 signal at 100 kDa indicates a gRNA dependent formation of SaCas9 homomers and transport into the cell nucleus. In contrast, SpCas9 is mainly present as homomer and its nuclear localization is independent of gRNA.
[00152] Figure 69 shows an AAV-Sa-Cas9 vector, a liver-specific AAV-Sa-Cas9 vector and an alternate AAV-Sa-Cas9 vector,
[00153] Figure 70 shows data on optimized CMV-SaCas9-NLS-U6-sgRNA vector (submitted vector design last time); new data compares N'-term vs C'-term tagged SaCas9 and shows enhanced cleavage efficiency using C'-term NLS tagging.
[00154] Figure 71 shows SURVEYOR image showing indels generated by new Pcsk9 targets.
[00155] Figure 72 shows SaCas9 specificity: genome -wide off target sites (GWOTs) are predicted based on 2 criteria: they contain 4 or fewer mismatched bases to intended SaCas9 target and bear the least restrictive PAM for SaCas9, W'GRR. H i-. 293FT cells are transfected with either SpCas9 or SaCas9 with their corresponding sgRNAs at a target site (EMX1 : T AGGGTT A GG GG CC C C AGGC) that has CGGGGT as a PAM so that it can be cut by either SpCas9 (CGG) or SaCas9 (CGGGGT). DNAs from ceils are harvested and analyzed for indels by Illumina sequencing at on-target and 41 predicted off-target loci (following protocols from Hsu et al. Nature Biotech 2013 and data analysis pipeline developed by David Scott and Josh Wei stein).
[00156] Figure 73 shows that that SaCas9 may have a higher level of off-target activity than SpCas9 at certain loci,
|00157| The figures herein are for illustrative purposes only and are not necessarily drawn to scale.
DETAILED DESCRIPTION OF THE INVENTION
[00158] The invention relates to the engineering and optimization of systems, methods and compositions used for the control of gene expression involving sequence targeting, such as genome perturbation or gene-editing, that relate to the CRISPR -C as system and components thereof. In advantageous embodiments, the Cas enzyme is Cas9.
[00159] An advantage of the present methods is that the CRISPR system avoids off-target binding and its resulting side effects. This is achieved using systems arranged to have a high degree of sequence specificity for the target DNA.
Cas9 [00160] Cas9 optimization may be used to enhance function or to develop new functions, one can generate chimeric Cas9 proteins. Examples that the Applicants have generated are provided in Example 6. Chimeric Cas9 proteins can be made by combining fragments from different Cas9 homoSogs. For example, two example chimeric Cas9 proteins from the Cas9s described herein. For example. Applicants fused the N-term of StlCas9 (fragment from this protein is in bold) with C-term of SpCas9. The benefit of making chimeric Cas9s include any or all of: reduced toxicity; improved expression in eukaryotic cells; enhanced specificity; reduced molecular weight of protein, for example, making the protein smaller by combining the smallest domains from different Cas9 homologs; and/or altering the PAM sequence requirement.
[00161] The Cas9 may be used as a generic DNA binding protein . For example, and as shown in Example 7, Applicants used Cas9 as a generic DNA binding protein by mutating the two catalytic domains (DIG and H840) responsible for cleaving both strands of the DNA target. In order to upreguSate gene transcription at a target locus Applicants fused a transcriptional activation domain (VP64) to Cas9. Other transcriptional activation domains are known. As shown in Example 17, transcriptional activation is possible. As also shown in Example 1 7, gene repression (in this case of the beta-eatenm gene) is possible using a Cas9 repressor (DNA- binding domain) that binds to the target gene sequence, thus repressing its activity.
[00162] Cas9 and one or more guide RNA can be delivered using adeno associated vims (AAV), ientivirus, adenovirus or other plasmid or viral vector types, in particular, using formulations and doses from, for example, US Patents Nos. 8,454,972 (formulations, doses for adenovirus), 8,404,658 (formulations, doses for AAV) and 5,846,946 (formulations, doses for DNA plasmids) and from clinical trials and publications regarding the clinical trials involving Ientivirus, AAV and adenovirus. For examples, for AAV, the route of administration, formulation and dose can be as in US Patent No. 8,454,972 and as in clinical trials involving AAV. For Adenovirus, the route of administration, formulation and dose can be as in US Patent No. 8,404,658 and as in clinical trials involving adenovirus. For plasmid delivery, the route of administration, formulation and dose can be as in US Patent No 5,846,946 and as in clinical studies involving plasmids. Doses may be based on or extrapolated to an average 70 kg individual, and can be adjusted for patients, subjects, mammals of different weight and species. Frequency of administration is within the ambit of the medical or veterinary practitioner (e.g.. physician, veterinarian), depending on usual factors including the age, sex, general health, other conditions of the patient or subject and the particular condition or symptoms being addressed.
[00163] The viral vectors can be injected into the tissue of interest. For cell-type specific genome modification, the expression of Cas9 can be driven by a cell-type specific promoter. For example, liver-specific expression might use the Albumin promoter and neuron-specific expression might use the Synapsin I promoter.
Transgenic animals and plants
[00164] Transgenic animals are also provided. Preferred examples include animals comprising Cas9, in terms of polynucleotides encoding Cas9 or the protein itself. Mice, rats and rabbits are preferred. To generate transgenic mice with the constructs, as exemplified herein one may inject pure, linear DNA into the pronucleus of a zygote from a pseudo pregnant female, e.g. a CB56 female. Founders may then be identified, genotyped, and backcrossed to CB57 mice. The constructs may then be cloned and optionally verified, for instance by Sanger sequencing. Knock outs are envisaged where for instance one or more genes are knocked out in a model. However, are knockins are also envisaged (alone or in combination). An example knoekin Cas9 mouse was generated and this is exemplified, but Cas9 knockins are preferred. To generate a Cas9 knock in mice one may target the same constitutive and conditional constructs to the Rosa26 locus, as described herein (Figs. 25A-B and 26). Methods of US Patent Publication os. 20120017290 and 20110265198 assigned to Sangamo Biosciences, Inc. directed to targeting the Rosa locus may be modified to utilize the CRISPR Cas system of the present invention. In another embodiment, the methods of US Patent Publication No. 20130236946 assigned to Cellectis directed to targeting the Rosa locus may also be modified to utilize the CRISPR Cas system of the presen t invention .
[00165] Utility of the conditional Cas9 mouse: Applicants have shown in 293 cells that the Cas9 conditional expression construct can be activated by co-expression with Cre. Applicants also show that the correctly targeted Rl mESCs can have active Cas9 when Cre is expressed. Because Cas9 is fol lowed by the P2A peptide cleavage sequence and then EGFP Applicants identify successful expression by observing EGFP. Applicants have shown Cas9 activation in mESCs. This same concept is what makes the conditional Cas9 mouse so useful. Applicants may cross their conditional Cas9 mouse with a mouse that ubiquitously expresses Cre (ACTB-Cre line) and may arrive at a mouse that expresses Cas9 in every cell . It should only take the deliver}' of chimeric RNA to induce genome editing in embryonic or adult mice. Interestingly, if the conditional Cas9 mouse is crossed with a mouse expressing Cre under a tissue specific promoter, there should only be Cas9 in the tissues that also express Cre. This approach may be used to edit the genome in only precise tissues by delivering chimeric RNA to the same tissue.
[00166] As mentioned above, transgenic animals are also provided, as are transgenic plants, especially crops and algae. The transgenic plants may be useful in applications outside of providing a disease model. These may include food or feed production through expression of, for instance, higher protein, carbohydrate, nutrient or vitamin levels than would normally be seen in the wildtypc. In this regard, transgenic plants, especially pulses and tubers, and animals, especially mammals such as livestock (cows, sheep, goats and pigs), but also poultry and edible insects, are preferred.
[00167] Transgenic algae or other plants such as rape may be particularly useful in the production of vegetable oils or biofuels such as alcohols (especially methanol and ethanol), for instance. These may be engineered to express or overexpress high levels of oil or alcohols for use in the oil or biofuel industries.
Adeno associated vims (AAV)
[00168] In terms of in vivo delivery, AAV is advantageous over other viral vectors for a couple of reasons:
[00169] Low toxicity (this may be due to the purification method not requiring ultra eentrifugation of cel l particles that can activate the immune response)
[00170] Low probability of causing insertional mutagenesis because it doesn't integrate into the host genome.
[00171] AAV has a packaging limit of 4.5 or 4.75 Kb. This means that Cas9 as well as a promoter and transcription terminator have to be all fit into the same viral vector. Constructs larger than 4.5 or 4.75 Kb will lead to significantly reduced vims production. SpCas9 is quite large, the gene itself is over 4.1 Kb, which makes it difficult for packing into AAV. Therefore embodiments of the invention include utilizing homologs of Cas9 that are shorter. For example:
Species Cas9 Size
Corynebacter diphtheriae 3252 Eubacterium ventriosum
Streptococcus pasteurianus 3390
Lactobacillus farciminis 3378 Sphaerochaeta globus 3537 3504
3150
3246
3420
3111
3159
3396
3009
3396
[00172] These species are therefore, in general, preferred Cas9 species. Applicants have shown delivery and in vivo mouse brai Cas9 expression data.
[00173] Two ways to package Cas9 coding nucleic acid molecules, e.g., DNA, into viral vectors to mediate genome modification in vivo are preferred:
[00174] To achieve NHEJ-mediated gene knockout:
[00175] Single virus vector:
Vector containing two or more expression cassettes:
Promoter-Cas9 coding nucleic acid molecule -terminator
Promoter-gRNA 1 -terminator
Promoter~gRNA2-terminator
Promoter- gl^NA( N) -terminator (up to size limit of vector)
[00176] Double virus vector;
Vector 1 containing one expression cassette for driving the expression of Cas9 Promoter~Cas9 coding nucleic acid molecule-temiinator
Vector 2 containing one more expression cassettes for driving the expression of one or more guideRNAs
Promoter-gR A 1 -terminator
Promoter-gRNA(N)-terminator (up to size limit of vector)
[00177] To mediate homology-directed repair. In addition to the single and double vims vector approaches described above, an additional vector is used to deliver a homology-direct repair template.
[00178] Promoter used to drive Cas9 coding nucleic acid molecule expression can include:
[00179] AAV ITR can serve as a promoter: this is advantageous for eliminating the need for an additional promoter element (which can take up space in the vector). The additional space freed up can be used to drive the expression of additional elements (gRNA, etc.). Also, ITR activity is relatively weaker, so can be used to reduce toxicity due to over expression of Cas9.
[00180] For ubiquitous expression, can use promoters: CMV, CAG, CBh, PGK, SV40, Ferritin heavy or light chains, etc.
[00181] For brain expression, can use promoters: Synapsinl for all neurons, CaMKIIalpha for excitatory neurons, GAD67 or GAD65 or VGAT for G ABAergic neurons, etc.
[00182] For liver expression, can use Albumin promoter.
[00183] For lung expression, can use SP~B.
[00184] For endothelial cells, can use ICAM.
[00185] For hematopoietic cells can use IFNbeta or CD45.
[00186] For Osteoblasts can use OG-2.
[00187] Promoter used to drive guide RNA can include:
Pol 10 promoters such as U6 or HI
Use of Pol II promoter and mtronic cassettes to express gRNA
[00188] As to AAV, the AAV can be AAV1, AAV2, AAV5 or any combination thereof. One can select the AAV of the AAV with regard to the cells to be targeted; e.g., one can select AAV serotypes 1, 2, 5 or a hybrid or capsid AAV J , AAV2, AAV5 or any combination thereof for targeting brain or neuronal cells; and one can select AAV4 for targeting cardiac tissue. AAA'S is useful for delivery to the liver. The above promoters and vectors are preferred individually.
[00189] RN A delivery is also a useful method of in vivo delivery. Fig, 27 shows delivery and in vivo mouse brain Cas9 expression data. It is possible to deliver Cas9 and gRNA (and, for instance, HR repair template) into cells using liposomes or nanoparticles. Thus delivery of the CRISPR enzyme, such as a Cas9 and/or delivery of the RNAs of the invention may be in RNA form and via microvesicles, liposomes or nanoparticles. For example, Cas9 mRNA and gRNA can be packaged into liposomal particles for delivery in vivo. Liposomal transfection reagents such as lipofectamine from Life Technologies and other reagents on the market can effectively deliver RNA molecules into the liver.
[00190] Enhancing NHEJ or HR efficiency is also helpful for delivery. It is preferred that NHEJ efficiency is enhanced by co-expressing end-processing enzymes such as Trex2 (Dumitrache et al. Genetics. 2011 August; 188(4): 787-797). It is preferred that HR efficiency is increased by transiently inhibiting NHEJ machineries such as Ku70 and u86. HR efficiency can also be increased by co-expressing prokaryotic or eukaryotic homologous recombination enzymes such as RecBCD, RecA.
[00191] Various means of delivery are described herein, and further discussed in this section.
[001 2] Viral deliver)?: The CRISPR enzyme, for instance a Cas9, and/or any of the present RNAs, for instance a guide RNA, can be delivered using adeno associated virus (AAV), lentivirus, adenovirus or other viral vector types, or combinations thereof. Cas9 and one or more guide RNAs can be packaged into one or more viral vectors. In some embodiments, the viral vector is delivered to the tissue of interest by, for example, an intramuscular injection, while other times the viral delivery is via intravenous, transdermal, intranasal, oral, mucosal, or other delivery methods. Such deliver}' may be either via a single dose, or multiple doses. One skilled in the art understands that the actual dosage to be delivered herein may vary greatly depending upon a variety of factors, such as the vector chose, the target cell, organism, or tissue, the general condition of the subject to be treated, the degree of transformation^nodification sought, the administration route, the administration mode, the type of transformation/modification sought, etc,
[00193] Such a dosage may further contain, for example, a carrier (water, saline, ethanol, glycerol, lactose, sucrose, calcium phosphate, gelatin, dextran, agar, pectin, peanut oil, sesame oil, etc.), a diluent, a pharmaceuticaily-acceptable carrier (e.g., phosphate-buffered saline), a pharmaceuticaily-acceptabie excipient, an adjuvant to enhance antigenicity, an immunostimulatory compound or molecule, and/or other compounds known in the art. The adjuvant herein may contain a suspension of minerals (alum, aluminum hydroxide, aluminum phosphate) on which antigen is adsorbed; or water-in-oil emulsion in which antigen solution is emulsified in oil (MF-59, Freund's incomplete adjuvant), sometimes with the inclusion of killed mycobacteria (Freund's complete adjuvant) to further enhance antigenicity (inhibits degradation of antigen and/or causes influx of macrophages). Adjuvants also include immunostimulatory molecules, such as cyiokincs. costimulatory molecules, and for example, immunostimulatory DNA or RNA molecules, such as CpG oligonucleotides. Such a dosage formulation is readily ascertainable by one skilled in the art. The dosage may further contain one or more pharmaceutically acceptable salts such as, for example, a mineral acid salt such as a hydrochloride, a hydrobromide, a phosphate, a sulfate, etc.; and the salts of organic acids such as acetates, propionates, malonates, benzoates, etc. Additionally, auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, gels or gelling materials, flavorings, colorants, microspheres, polymers, suspension agents, etc. may also be present herein. In addition, one or more other conventional pharmaceutical ingredients, such as preservatives, humectants, suspending agents, surfactants, antioxidants, antieaking agents, fillers, chelatmg agents, coating agents, chemical stabilizers, etc. may also be present, especially if the dosage form is a reeonstitutable form. Suitable exemplary ingredients include macrocrystalline cellulose, earboxymethyicelhilose sodium, polysorbate 80, phenylethyl alcohol, chlorobutanol, potassium sorbate, sorbic acid, sulfur dioxide, propyl gallate, the parabens, ethyl vanillin, glycerin, phenol, parachlorophenoL gelatin, albumin and a combination thereof. A thorough discussion of pharmaceutically acceptable excipienis is available in REMINGTON'S PHARMACEUTICAL SCIENCES (Mack Pub. Co., N.J. 1991) which is incorporated by reference herein.
[00194] In an embodiment herein the delivery is via an adenovirus, which may be at a single booster dose containing at least 1 x 105 particles (also referred to as particle units, pu) of adenoviral vector. In an embodiment herein, the dose preferably is at least about 1 x I06 particles (for example, about 1 x 10°- 1 x 1012 particles), more preferably at least about 1 x 10'' particles, more preferably at least about 1 x 108 particles (e.g., about 1 x 10δ-1 x 10n particles or about 1 x Ι Ο' -Ι x 10" particles), and most preferably at least about 1 10' particles (e.g., about 1 * x 109-1 x 1010 particles or about 1 x 109-1 x l Ql/~ particles), or even at least about 1 x 10f 0 particles (e.g., about 1 x IQlU-l x 10 particles) of the adenoviral vector. Alternatively, the dose comprises no more than about 1 x 10f 4 particles, preferably no more than about 1 x lO1 ' particles, even more preferably no more than about 1 x 10 1 particles, even more preferably no more than about 1 x 10H particles, and most preferably no more than about 1 x 10'° particles (e.g., no more than about 1 x 109 articles). Thus, the dose may contain a single dose of adenoviral vector with, for example, about 1 x 10° particle units (pu), about 2 x 106 pu, about 4 x 106 pu, about 1 x 10 ' pu, about 2 x 10 ' pu, about 4 x 10' pu, about 1 x 10B pu, about 2 x 108 pu, about 4 x 108 pu, about 1 x 109 pu, about 2 x 1Q9 pu, about 4 x 109 pu, about 1 x 1010 pu, about 2 X 1()ϊ ύ pu, about 4 x 101 pu, about 1 x 10f 1 pu, about 2 x ! Q5 i pu, about 4 x 10n pu, about 1 x 10'2 pu, about 2 x 10f / pu, or about 4 x 1012 pu of adenoviral vector. See, for example, the adenoviral vectors in U.S. Patent No. 8,454,972 B2 to Nabel, et. al, granted on June 4, 2013; incorporated by reference herein, and the dosages at col 29, lines 36-58 thereof. In an embodiment herein, the adenovirus is delivered via multiple doses. [00195] In an embodiment herein, the delivery is via an AAV. A therapeutically effective dosage for in vivo delivery of the AAV to a human is believed to be in the range of from about 20 to about 50 ml of saline solution containing from about I x IQ1J to about I x I01J functional AAV/ml solution. The dosage may be adjusted to balance the therapeutic benefit against any side effects. In an embodiment herein, the AAV dose is generally In the range of concentrations of from about 1 x 105 to 1 x 1050 genomes AAV, from about 1 x 108 to 1 x 10"° genomes AAV, from about 1 x 10i0 to about 1 x 10i6 genomes, or about 1 x 10f 1 to about 1 x 10f 6 genomes AAV. A human dosage may be about 1 x 10lj genomes AAV. Such concentrations may be delivered in from about 0.001 ml to about 100 ml, about 0.05 to about 50 ml, or about 10 to about 25 ml of a carrier solution. Other effective dosages can be readily established by one of ordinary skill in the art through routine trials establishing dose response curves. See, for example, U.S. Patent No. 8,404,658 B2 to Hajjar, et al, granted on March 26, 2013, at col. 27, lines 45-60.
[00196] In an embodiment herein the delivery is via a plasmid. In such plasmid compositions, the dosage should be a sufficient amount of plasmid to elicit a response. For instance, suitable quantities of plasmid DNA in plasmid compositions can be from about 0. 1 to about 2 mg, or from about I μ¾ to about 10 ug.
[00197] The doses herein are based on an average 70 kg individual. The frequency of administration is within the ambit of the medical or veterinary practitioner (e.g., physician, veterinarian), or scientist skilled in the art.
Lenti virus
[001 8] Lentiviruses are complex retroviruses that have the ability to infect and express their genes in both mitotic and post-mitotic cells. The most commonly known lcntivirus is the human immunodeficiency virus (H IV), which uses the envelope glycoproteins of other viruses to target a broad range of cell types.
[00199] Lentiviruses may be prepared as follows. After cloning pCasES!O (which contains a lenti viral transfer plasmid backbone), HEK293FT at low passage (p-5) were seeded in a T- 75 flask to 50% confluence the day before transfection in DMEM with 10% fetal bovine serum and without antibiotics. After 20 hours, media was changed to OptiMEM (serum-free) media and transfection was done 4 hours later. Ceils were transfected with 10 iig of lentiviral transfer plasmid (pCasESlO) and the following packaging plasmids: 5 iig of pMD2.G (VSV-g pseudotype), and 7,5ug of psPAX2 (gag/pol/rev/tat). Transfeetion was done in 4mL OptiMEM with a eationie lipid delivery agent (50uL Lipofectamine 2000 and lOOui Plus reagent). After 6 hours, the media was changed to antibiotic-free DMEM with 10% fetal bovine serum.
[0020Θ] Lenti virus may be purified as follows. Viral supematants were harvested after 48 hours. Supematants were first cleared of debris and filtered through a 0.45um low protein binding (PVDF) filter. They were then spun in a ultracentrifuge for 2 hours at 24,000 rpm. Viraf pellets were resuspended in 50ul of DMEM overnight at 4C. They were then aliquotted and immediately frozen at -80C.
[00201] In another embodiment, minimal non-primate lentiviral vectors based on the equine infectious anemia virus (EIAV) are also contemplated, especially for ocular gene therapy (see, e.g., Balagaan, J Gene Med 2006; 8: 275 - 285, Published online 21 November 2005 in Wiley InterScieiice (www.interscience.wiley.com). DOI: 10.1002/jgm.845). In another embodiment, RetinoStat®, an equine infectious anemia virus-based lentiviral gene therapy vector that expresses angiostatic proteins endostain and angiostatin that is delivered via a subretinal injection for the treatment of the web form of age-related macular degeneration is also contemplated (see, e.g., Binley et al, HUMAN GENE THERAPY 23:980-991 (September 2012)) may be modified for the CRISPR-Cas system of the present invention.
[00202] In another embodiment, self-inactivating lentiviral vectors with an siRNA targeting a common exon shared by HIV tat/rev, a nucleolar-localizing TAR decoy, and an anti-CCR5- specific hammerhead ribozyme (see, e.g., DiGiusto et al. (2010) Sci Trans! Med 2:36ra43) may be used/and or adapted to the CRISPR-Cas system of the present invention. A minimum of 2.5 x 106 CD34+ cells per kilogram patient weight may be collected and prestimulated for 16 to 20 hours in X- VIVO 15 medium (Lonza) containing 2mML-glutamine, stem cell factor ( 100 ng/ml), Fit- 3 ligand (Flt-3L) (100 ng/ml), and thrombopoietin (10 ng/ml) (CellGemx) at a density of 2 x 106 cells/ml. Prestimulated cells may be transduced with lentiviral at a multiplicity of infection of 5 for 16 to 24 hours in 75-cnr tissue culture flasks coated with fibronectin (25 mg/cm") (Retro Neetm,Takara Bio Inc.).
[00203] Lentiviral vectors have been disclosed as in the treatment for Parkinson's Disease, see, e.g., US Patent Publication No. 20120295960 and US Patent Nos. 7303910 and 7351585. Lentiviral vectors have also been disclosed for the treatment of ocular diseases, see e.g., US Patent Publication Nos. 20060281 180, 20090007284, US201101 17189; US20090017543; US2G07005496J , US20100317J 09. Lenti viral vectors have also been disclosed for deliveiy to the train, see, e.g., US Patent Publication Nos. US201 10293571; US201 10293571 , US20040013648, US2007G025970, US20090111106 and US Patent No. US7259015.
RNA delivery
[00204] RNA delivery: The CRISPR e zyme, for instance a Cas9, a d/or any of the present RNAs, for instance a guide RNA, can also be delivered in the form of RNA. Cas9 mRNA can be generated using in vitro transcription. For example, Cas9 mRNA can be synthesized using a PGR cassette containing the following elements: T7 promoter-kozak sequence (GCCACC)-Cas9-3 ' UTR from beta globin-polyA tail (a string of 120 or more adenines). The cassette can be used for transcription by T7 polymerase. Guide RNAs can also be transcribed using in vitro tra scription from a cassette containing T7_promoter-GG-guide RNA sequence.
[0Θ205] To enhance expression and reduce toxicity, the CRISPR enzyme and/or guide RNA can be modified using pseudo-U or 5-Methyl-C.
[00206] mRNA deliveiy methods are especially promising for liver delivery currently. In particular, for AA.V8 is particularly preferred for delivery to the liver.
Nartoparticles
[00207J CRISPR enzyme mRNA and guide RNA may be delivered simultaneously using nanoparticles or lipid envelopes.
[00208] For example, Su X, Fricke J, Kavanagh DG, Irvine DJ ("In vitro and in vivo mRNA delivery using Hpid-enveloped pH-responsive polymer nanoparticles" Mof Pharm. 2011 Jun 6;8(3):774-87. doi: 10.1021/mpl00390w. Epub 2011 Apr I) describes biodegradable core-shell structured nanoparticles with a poly(p-amino ester) (PBAE) core enveloped by a phospholipid bilayer shell. These were developed for in vivo mRNA delivery. The pH -responsive PBAE component was chosen to promote endosome disruption, while the lipid surface layer was selected to minimize toxicity of the polycation core. Such are, therefore, preferred for delivering RNA of the present invention.
[00209] In one embodiment, nanoparticles based on self assembling bioadhesive polymers are contemplated, which may be applied to oral deliveiy of peptides, intravenous deliver}.' of peptides and nasal delivery of peptides, all to the brain. Other embodiments, such as oral absorption and ocular deliver of hydrophobic drags are also contemplated. The molecular envelope technology involves an engineered polymer envelope which is protected and delivered to the site of the disease (see, e.g., Mazza, M. et al. ACSNano, 2013. 7(2): 1016-1026; Siew, A., et al. Moi Pharm, 2012. 9( 1): 14-28; Lalatsa, A., et al. J Contr Rel, 2012, 161(2):523-36; Lalatsa, A., et al., Mol Pharm, 2012. 9(6): 1665-80; Lalatsa, A., et al. Mol Pharm, 2012. 9(6): 1764-74; Garrett, .L., et al. J Biophotomcs, 2012. 5{5-6):458-68; Garrett, N.L., et al. J Raman Spect, 2012. 43(5):681-688; Ahmad, S., et al. J Royal Soc Interface 2010. 7:8423-33; Uchegbu, IF. Expert Opin Drug Deliv, 2006. 3(5):629-40; Qu, X.,et al. Biomacromoiecul.es, 2006. 7(12):3452- 9 and Uchegbu, I.F., et al. Int J Pharm, 2001. 224: 185-199). Doses of about 5 mg/kg are contem lated, with single or multiple doses, depending on the target tissue.
[00210] In one embodiment, nanoparticles that can deliver RNA to a cancer ceil to stop tumor growth developed by Dan Anderson's lab at MIT may be used/and or adapted to the CR1SPR Cas system of the present invention. In particular, the Anderson lab developed fully automated, combinatorial systems for the synthesis, purification, characterization, and formulation of new biomaterials and nanoformulations. See, e.g., Alahi et ah, Proc Natl Acad Sci U S A. 2013 Aug 6; 110(32) : 12881 -6; Zhang et al, Adv Mater. 2013 Sep 6;25(33):4641-5; Jiang et al, Na o Lett. 2013 Mar 13;13(3):1059-64; aragiannis et al, ACS Nano. 2012 Oct 23;6(30):8484-7; Whitehead et al., ACS Nano. 2012 Aug 28;6(8):6922-9 and Lee et al, Nat Nanotechnol. 2012 Jun 3;7(6):389-93.
[00211] US patent application 201 10293703 relates to lipidoid compounds are also particularly useful in the administration of polynucleotides, which may be applied to deliver the CRISPR Cas system of the present invention, in one aspect, the aminoalcohoi lipidoid compounds are combined with an agent to be delivered to a cell or a subject to form microparticles, nanoparticles, liposomes, or micelles. The agent to be delivered by the particles, liposomes, or micelles may be in the form of a gas, liquid, or solid, and the agent may be a polynucleotide, protein, peptide, or small molecule. The minoalcohol lipidoid compounds may be combined with other aminoalcohoi lipidoid compounds, polymers (synthetic or natural), surfactants, cholesterol, carbohydrates, proteins, lipids, etc, to form the particles. These particles may then optionally be combined with a pharmaceutical excipient to form a pharmaceutical composition.
[00212 j US Patent Publication No. 01 10293703 also provides methods of preparing the aminoalcohoi lipidoid compounds. One or more equivalents of an amine are allowed to react with one or more equivalents of an epoxide-termmated compound under suitable conditions to form an aminoalcohol lipidoid compoimd of the present invention, in certain embodiments, all the amino groups of the amine are fully reacted with the epoxide-terminated compound to form tertiary amines. In other embodiments, ail the amino groups of the amine are not fully reacted with the epoxide-terminated compound to form tertiary amines thereby resulting in primary or secondary amines in the aminoalcohol lipidoid compound. These primary or secondary amines are left as is or may be reacted with another electrophile such as a different epoxide-terminated compound. As will be appreciated by one skilled in the art, reacting an amine with less than excess of epoxide-terminated compound will result in a plurality of different aminoalcohol lipidoid compounds with various numbers of tails. Certain amines may be fully funetionalizcd with two epoxide-derived compound tails while other .molecules will not be completely functionalized with epoxide-derived compound tails. For example, a diamine or polyamine may include one, two, three, or four epoxide-derived compound tails off the various amino moieties of the molecule resulting in primary, secondary, and tertiary amines. In certain embodiments, all the amino groups are not fully functionalized. In certain embodiments, two of the same types of epoxide-terminated compounds are used. In other embodiments, two or more different epoxide- terminated compounds are used. The synthesis of the aminoalcohol lipidoid compounds is performed with or without solvent, and the synthesis may be performed at higher temperatures ranging from 30.-100 C, preferably at approximately 50.-90 C. The prepared aminoalcohol lipidoid compounds may be optionally purified. For example, the mixture of aminoalcohol lipidoid compounds may be purified to yield an aminoalcohol lipidoid compound with a particular number of epoxide-derived compound tails. Or the mixture may be purified to yield a particular stereo- or regioisomer. The aminoalcohol lipidoid compounds may also be alkylated using an alky! halide (e.g., methyl iodide) or other alkylating agent, and/or they may be acylated.
[00213] US Patent Publication No. 0110293703 also provides libraries of aminoalcohol lipidoid compounds prepared by the inventive methods. These aminoalcohol lipidoid compounds may be prepared and/or screened using high-throughput techniques involving liquid handlers, robots, microliter plates, computers, etc. In certain embodiments, the aminoalcohol lipidoid compounds are screened for their ability to transfect polynucleotides or other agents (e.g., proteins, peptides, small molecules) into the cell.
[00214] US Patent Publication No. 20130302401 relates to a class of poly(beta-amino alcohols) (PBAAs) has been prepared using combinatorial polymerization. The inventive PBAAs may be used in biotechnology and biomedical applications as coatings (such as coatings of films or multilayer films for medical devices or implants), additives, materials, excipients, non- biofouling agents, micropatteming age ts, and cellular encapsulation agents. When used as surface coatings, these PES A As elicited different levels of inflammation, both in vitro and in vivo, depending on their chemical structures. The large chemical diversity of this class of materials allowed us to identify polymer coatings that inhibit macrophage activation in vitro. Furthermore, these coatings reduce the recruitment of inflammatory cells, and reduce fibrosis, foi lowing the subcutaneous implantation, of carboxylated polystyrene microparticles. These polymers may be used to form polyelectrolyte complex capsules for cell encapsulation. The invention may also have many other biological applications such as antimicrobial coatings, DNA or siRNA. delivery, and stem cel l tissue engineering. The teachings of US Patent Publication No. 20130302401 may be applied to the CRISPR Cas system of the present invention.
[002 J 5] in another embodiment, lipid nanoparticles (LNPs) are contemplated. In particular, an antitransthyretin small interfering RNA encapsulated in lipid nanoparticles (see, e.g., Coeiho et a!., N Engl J Med 2013;369:819-29) may be applied to the CRISPR Cas system of the present invention. Doses of about 0.01 to about 1 mg per kg of body weight administered intravenously are contemplated. Medications to reduce the risk of infusion-related reactions are contemplated, such as dexamethasone, acetampinophen, diphenhydramine or cetirizine, and ranitidine are contemplated. Multiple doses of about 0.3 mg per kilogram every 4 weeks for five doses are also contemplated.
[00216] LNPs have been shown to be highly effective in delivering siRNAs to the liver (see, e.g., Tabemero et a!,, Cancer Discovery, April 2013, Vol. 3, No. 4, pages 363-470) and are therefore contemplated for delivering CRISPR Cas to the liver. A dosage of about four doses of 6 mg/kg of the LNP every two weeks may be contemplated. Tabemero et al. demonstrated that tumor regression was observed after the first 2 cycles of LNPs dosed at 0.7 mg kg, and by the end of 6 cycles the patient had achieved a partial response with complete regression of the lymph node metastasis and substantial shrinkage of the liver tumors. A complete response was obtained after 40 doses in this patient, who has remained in remission and completed treatment after receiving doses over 26 months. Two patients with RCC and extrahepatic sites of disease including kidney, lung, and lymph nodes that were progressing following prior therapy with VEGF pathway inhibitors had stable disease at all sites for approximately 8 to 12 months, and a patient with PNET and liver metastases continued on the extension study for 18 months (36 doses) with stable disease.
[00217] However, the charge of the LNP must be taken into consideration. As cationic lipids combined wit negatively charged lipids to induce rsonbi Saver structures that facilitate intracellular delivery. Because charged LNPs are rapidly cleared from circulation following intravenous injection, ionizable cationic lipids with pKa values below 7 were developed (see, e.g., Rosin et ai, Molecular Therapy, vol. 19, no. 12, pages 1286-2200, Dec. 201 1). Negatively charged polymers such as siRNA oligonucleotides may be loaded into LNPs at low pH values (e.g., pH 4) where the ionizable lipids display a positive charge. However, at physiological pH values, the LNPs exhibit a low surface charge compatible with longer circulation times. Four species of ionizable cationic lipids have been focused upon, namely 1 ,2-dilineoyl~3- dimethylammonium-propane (DLinDAP), l,2-dilinoleyloxy-3-N,N-dimethylaminopropane (DLinDMA), 1 ,2-diliiioleyloxy ceto-N,N-dimethyi-3-aminopropaiie (DLinKDMA), and 1 ,2- dilinoleyl-4-(2-dimethylaminoethyl)-[l ,3]-dioxolane (DLinKC2-DMA). It has been shown that LNP siRNA systems containing these lipids exhibit remarkably different gene silencing properties in iiepatocytes in vivo, with potencies varying according to the series DLinKC2- DMA>DLm DMA>DLinDMA>>DLinDAP employing a Factor VI] gene silencing model (see, e.g., Rosin et ai, Molecular Therapy, vol. 19, no. 12, pages 1286-2200, Dec. 201 1). A dosage of 1 μ^'Ίη! levels may be contemplated, especially for a formulation containing DLin C2-DMA.
[00218] Preparation of LN Ps and CRISPR Cas encapsulation may be used/and or adapted from Rosin et al, Molecular Therapy, vol. 19, no. 12, pages 1286-2200, Dec. 201 1). The cationic lipids 1 ,2-di lineoyl-3-dimethylammonium-propaiie (DLinDAP), 1 ,2-dilinoley]oxy~3~N,N~ dimethylaminopropane (DLinDMA), 1 ,2-dilinoleyioxyketo-N,N-dimethyi-3-aminopropane (DLinK-DMA), l ,2-dilinoleyl-4-(2-dimethylaminoethyl)-[l ,3]-dioxolane (DLinKC2-DMA), (3- o-[2 " -(methoxypolyethyleneglycol 2000) succinoyl]-] ,2-dimyristoyl-sii-glycol (PEG-S-DMG), and R-3-[(o')-methoxy-poly(ethyiene glycol )2000) carbamoyl]- l ,2-dimyristyloxlpropyl-3-amme (PEG-C-DOMG) may be provided by Tekmira Pharmaceuticals (Vancouver, Canada) or synthesized. Cholesterol may be purchased from Sigma (St Louis, MO). The specific CRISPR Cas RNA may be encapsulated in LNPs containing DLinDAP, DLinDMA, DLinK-DMA, and DLin .C2-DMA (cationic lipid:DSPC:CHOL: PEGS-DMG or PEG-C-DOMG at 40: 10:40: 10 molar ratios). When required, 0.2% SP-DiOC1 8 (Invitrogen, Burlington, Canada) may be incorporated to assess cellular uptake, intracellular delivery, and biodistribution. Encapsulation may be performed by dissolving lipid mixtures comprised of cationic lipid:DSPC:cholesterol:PEG-c-DOMG (40: 10:40: 10 molar ratio) in ethanol to a final lipid concentratioii of 10 mmol/l. This ethanol solution of lipid may be added drop-wise to 50 mmol/l citrate, pH 4.0 to form multilamellar vesicles to produce a final concentration of 30% ethanol vol/vol. Large unilamellar vesicles may be formed following extrusion of multilamellar vesicles through two stacked 80 nm Nuclepore polycarbonate filters using the Extruder (Northern Lipids, Vancouver, Canada). Encapsulation may be achieved by adding RNA dissolved at 2 mg ml in 50 mmol/l citrate, pH 4.0 containing 30% ethanol vol/vol drop-wise to extruded preformed large unilamellar vesicles and incubation at 31 °C for 30 minutes with constant mixing to a final RNA/lipid weight ratio of 0.06/1 wt/wt. Removal of ethanol and neutralization of formulation buffer were performed by dialysis agai st phosphate -buffered saline (PBS), pH 7.4 for 16 hours using Spectra/Por 2 regenerated cellulose dialysis membranes. Nanoparticle size distribution may be determined by dynamic light scatteri g usi g a NICOMP 370 particle sizer, the vesicle/intensity modes, and Gaussian fitting (Nicomp Particle Sizing, Santa Barbara, CA). The particle size for all three LNP systems may be ~70 nm in diameter. siRNA encapsulation efficiency may be determined by removal of free siRNA using VivaPureD iniH columns (Sartorius Stedim Biotech) from samples collected before and after dialysis. The encapsulated RNA may be extracted from the eluted nanoparticles and quantified at 260 nm. siRNA to lipid ratio was determined by measurement of cholesterol content in vesicles using the Cholesterol E enzymatic assay from Wako Chemicals LISA (Richmond, VA).
[002 J 9] Preparation of large LNPs may be used/and or adapted from Rosin et al, Molecular Therapy, vol. 19, no. 12, pages 1286-2200, Dec. 201 1. A lipid prcmix solution (20.4 mg/ml total lipid concentration) may be prepared in ethanol containing DLinKC2~DMA, DSPC, and cholesterol at 50: 10:38.5 molar ratios. Sodium acetate may be added to the lipid premix at a molar ratio of 0.75:1 (sodium acetate:DLinKC2-DMA). The lipids may be subsequently hydrated by combining the mixture with 1.85 volumes of citrate buffer (10 mmol/l, pH 3.0) with vigorous stirring, resulting in spontaneous liposome formation in aqueous buffer containing 35% ethanol. The liposome solution may be incubated at 37 °C to al low for time-dependent increase in particle size, Aliquots may be removed at various times during incubation to investigate changes in liposome size by dynamic light scattering (Zeiasizer Nano ZS, Malvern Instruments, Worcestershire, UK). Once the desired particle size is achieved, an aqueous PEG lipid solution (stock = 10 mg ml PEG-DMG in 35% (vol/vol) ethanol) may be added to the liposome mixture to yield a final PEG molar concentration of 3,5% of total lipid. Upon addition of PEG-lipids, the liposomes should their size, effectively quenching further growth, RNA may then be added to the empty liposomes at an siRNA to total lipid ratio of approximately 1 :10 (wt:wt), followed by incubation for 30 minutes at 37 °C to form loaded LNPs. The mixture may be subsequently dialyzed overnight in PBS and filtered with a 0.45-μη syringe filter.
[00220] Spherical Nucleic Acid (SNA™) constructs and other nanoparticles (particularly gold nanoparticles) are also contemplate as a means to delivery CRJSPR/Cas system to intended targets. Significant data show that AuraSense Therapeutics' Spherical Nucleic Acid (SNA™) constructs, based upon nucleic acid-functionalized gold nanoparticles, are superior to alternative platforms based on multiple key success factors, such as:
[00221] High in vivo stability. Due to their dense loading, a majority of cargo (DNA or siRNA) remains bound to the constructs inside cells, conferring nucleic acid stability and resistance to enzymatic degradation.
[00222] Deliverability. For all cell types studied (e.g., neurons, tumor cell lines, etc.) the constructs demonstrate a transfection efficiency of 99% with no need for carriers or transfection agents.
[00223] Therapeutic targeting. The unique target binding affinity and specificity of the constructs allow exquisite specificity for matched target sequences (i.e., limited off-target effects).
[00224] Superior efficacy. The constructs significantly outperform leading conventional transfection reagents (Lipofectamine 2000 and Cytofectin).
[00225] Low toxicity. The constructs can enter a variety of cultured cells, primary cells, and tissues with no apparent toxicity.
[00226] No significant immune response. The constructs elicit minimal changes in global gene expression as measured by whole-genome microarray studies and cytokine-specifi.c protein assays.
[00227J Chemical tailorability. Any number of single or combinatorial agents (e.g., proteins, peptides, small molecules) can be used to tailor the surface of the constructs. [00228] This platform for nucleic acid-based therapeutics may be applicable to numerous disease states, including inflammation and infectious disease, cancer, skin disorders and cardiovascular disease.
[00229] Citable literature includes: Cutler et al.,. J. Am. Chem, Soc, 2011 133:9254-9257, Hao et al, Small. 2011 7:3158-3162, Zhang et al, ACS Nano. 2011 5:6962-6970, Cutler et al, J. Am. Chem. Soc. 2012 134: 1376-1391, Young et al.,. Nano Lett. 2012 12:3867-71, Zheng et al,, Proc. Natl. Acad. Sci. USA. 2012 109:11975-80, Mirkin, Nanomedicine 2012 7:635-638 Zhang et al., J. Am. Chem. Soc. 2012 134: 16488-1691, Weintraub, Nature 2013 495:S14-S16, Choi et al, Proc. Natl. Acad. Sci. USA. 2013 1 10< 19):7625-7630, Jensen et al., Sci. Transi. Med. 5, 209ral 52 (2013) and Mirkin, et al, Small, doi.org/10.1002/smll.201302143.
[00230] Self-assembling nanoparticles with siRNA may be constructed with polyethyieneimine (PEI) that is PEGvlated with an Arg-Gly-Asp (RGD) peptide ligand attached at the distal end of the polyethylene glycol (PEG), for example, as a means to target tumor iieovasculature expressing integrins and used to deliver siRNA inhibiting vascular endothelial growth factor receptor-2 (VEGF 2) expression and thereby tumor angiogenesis (see, e.g., Schiffelers et al., Nucleic Acids Research, 2004, Vol. 32, No. 19). Nanoplexes may be prepared by mixing equal volumes of aqueous solutions of cationic polymer and nucleic acid to give a net molar excess of ionizable nitrogen (polymer) to phosphate (nucleic acid) over the range of 2 to 6. The electrostatic interactions between cationic polymers and nucleic acid resulted in the formation of polyp lex es with average particle size distribution of about 100 nm, hence referred to here as nanoplexes. A dosage of about 100 to 200 mg of CRISPR Cas is envisioned for deliver)? in the self-assembling nanoparticles of Schiffelers et al.
[00231] The nanoplexes of Bartlett et al. (PNAS, September 25, 2007,vol. 104, no. 39) may also be applied to the present invention. The nanoplexes of Bartlett et al. are prepared by mixing equal volumes of aqueous solutions of cationic polymer and nucleic acid to give a net molar excess of ionizable nitrogen (polymer) to phosphate (nucleic acid) over the range of 2 to 6. The electrostatic interactions between cationic polymers and nucleic acid resulted in the formation of poly lexes with average particle size distribution of about 100 nm, hence referred to here as nanoplexes. The DOTA-siRNA of Bartlett et al was synthesized as follows: 1,4,7,10- tetraazacyclododecane- 1 ,4,7, 10-tetraacetic acid mono(N-hydroxysuccinimide ester) (DOTA- NHSester) was ordered from Macrocyclics (Dallas, TX). The amine modified RNA sense strand with a 100-fold molar excess of DOTA-NHS-ester in carbonate buffer (pH 9) was added to a microcentrifuge tube. The contents were reacted by stirring for 4 h at room temperature. The DOTA-RNAsense conjugate was ethanoi-preeipitated, resuspended in water, and annealed to the unmodified antisense strand to yield DGTA -siRNA. All liquids were pretreated with Chelex-100 (Bio-Rad, Hercules, CA) to remove trace metal contaminants. Tf-targeted and nontargeted siRNA nanoparticles may be formed by using cydodextrin-containing polycations. Typically, nanoparticles were formed in water at a charge ratio of 3 (+/-) and an siRNA concentration of 0.5 g/liter. One percent of the adamantane-PEG molecules on the surface of the targeted nanoparticles were modified with Tf (adamantane-PEG-Tf). The nanoparticles were suspended in a 5% (wt/vol) glucose carrier solution for injection.
[00232J Davis et al. (Nature, Vol 464, 15 April 2010) conducts a siRNA clinical trial that uses a targeted naiioparticle-deiivery system (clinical trial registration number NCT00689065). Patients with solid cancers refractory to standard-of-care therapies are administered doses of targeted nanoparticles on days L 3, 8 and 10 of a 21 -day cycle by a 30-min intravenous infusion. The nanoparticles consist of a synthetic delivery system containing: (1) a linear, cyciodextrin- based polymer (CDP), (2) a human transferrin protein (TF) targeting ligand displayed on the exterior of the nanoparticle to engage TF receptors (TFR) on the surface of the cancer cells, (3) a hydrophilic polymer (polyethylene glycol (PEG) used to promote nanoparticle stability in biological fluids), and (4) siRNA designed to reduce the expression of the RRM2 (sequence used in the clinic was previously denoted sl R.2B · 5 ). The TFR has long been known to be upregulated in malignant ceils, and RRM2 is an established anti-cancer target. These nanoparticles (clinical version denoted as CALAA-01 ) have been shown to be well tolerated in multi-dosing studies in non-human primates. Although a single patient with chronic myeloid leukaemia has been administered siRNAby liposomal delivery, Davis et al .'s clinical trial is the initial human trial to systemically deliver siRNA with a targeted delivery system and to treat patients with solid cancer. To ascertain whether the targeted delivery system can provide effective delivery of functional siRNA to human tumours, Davis et al. investigated biopsies from three patients from three different dosing cohorts; patients A, B and C, all of whom had metastatic melanoma and received CALAA-01 doses of 18, 24 and 30 mg m" siRNA, respectively. Similar doses may also be contemplated for the CRISPR Cas system of the present invention. The delivery of the invention may be achieved with nanoparticles containing a linear, cyclodextrin -based polymer (CDP), a human transferrin protein (TF) targeting ligand displayed on the exterior of the nanoparticle to engage TF receptors (TFR) on the surface of the cancer cells and/or a hydrophilic polymer (for example, polyethylene glycol (PEG) used to promote nanoparticle stability in biological fluids).
Exosomes
[00233] Exosomes are endogenous nano-vesicles that transport R'NAs and proteins which can deliver short interfering (si)RNA to the brain in mice. To reduce immimogcnieity, Alvarez -Erviti et ai. (2011, Nat Biotecimol 29: 341) used self-derived dendritic cells for exosorne production. Targeting was achieved by engineering the dendritic cells to express Lamp2b, an exosomal membrane protein, fused to the neuron-specific RVG peptides. Purified exosomes were loaded with exogenous siRNA by electroporation. Intravenously injected RVG-targeted exosomes delivered GAPDH siRNA specifically to neurons, microglia, oligodendrocytes in the brain, resulting in a specific gene knockdown. Pre-exposure to RVG exosomes did not attenuate knockdown, and non-specific uptake in other tissues was not observed. The therapeutic potential of exosome-mediated siRNA delivery was demonstrated by the strong mRNA (60%) and protein (62%) knockdown of BACE l, a therapeutic target in Alzheimer's disease.
[00234] To obtain a pool of immunologically inert exosomes, Alvarez-Erviti et ai. harvested bone marrow from inbred C57BL/6 mice with a homogenous major histocompatibility complex (MHC) haplotype. As immature dendritic ceils produce large quantities of exosomes devoid of T-celi activators such as MHC-I I and CD86, Alvarez-Erviti et al, selected for dendritic cel ls with granulocyte/macrophage-colony stimulating factor (GM-CSF) for 7 d. Exosomes were purified from the culture supernatant the following day using well-established ultracentrifugation protocols. The exosomes produced were physically homogenous, with a size distribution peaking at 80 nm in diameter as determined by nanoparticle tracking analysis (NTA) and electron microscopy. Alvarez-Erviti et al. obtained 6-12 iig of exosomes (measured based on protein concentration) per 106 cel ls.
[00235] Next, Alvarez-Erviti et al. investigated the possibility of loading modified exosomes with exogenous cargoes using electroporation protocols adapted for nanoscale applications. As electroporation for membrane particles at the nanometer scale is not well -characterized, nonspecific Cy5-labeled siRNA was used for the empirical optimization of the electroporation protocol. The amount of encapsulated siRNA was assayed after ultracentrifugation and lysis of exosomes. Electroporation at 400 V and 125 μΕ resulted in the greatest retention of siRNA and was used for all subsequent experiments.
[00236] Alvarez-Erviti et ai. administered 150 μ§ of each BACEl siRNA encapsulated in 150 p.g of VG exosomes to normal C57BL/6 mice and compared the knockdown efficiency to four controls: untreated mice, mice injected with RVG exosomes only, mice injected with BACEl siRNA complexed to an in vivo eationie liposome reagent and mice injected with BACEl siRNA comple ed to RVG-9R, the RVG pep tide conjugated to 9 D-arginines that electrostatically binds to the siRNA. Cortical tissue samples were analyzed 3 d after administration and a significant protein knockdown (45%, P < 0.05, versus 62%, P < 0.01 ) in both siRNA-RVG-9R-treated and siRNARVG exosome-treated mice was observed, resulting from a significant decrease in BACEl mRNA levels (66% [+ or -] 15%, P < 0.001 and 61 % [+ or -] 13% respectively, P < 0.01). Moreover, Applicants demonstrated a significant decrease (55%), P < 0.05) in the total [betaj-amyloid 1-42 levels, a main component of the amyloid plaques in Alzheimer's pathology, in the RVG-exosome-treated animals. The decrease observed was greater than the β-amyloid 1- 40 decrease demonstrated in normal mice after intraventricular injection of BACEl inhibitors. Alvarez-Erviti et al. carried out 5 -rapid amplification of cDNA ends (RACE) on BACEl cleavage product, which provided evidence of RNAi-mediated knockdown by the siRNA..
[00237] Finally, Alvarez-Erviti et al. investigated whether siRNA- RVG exosomes induced immune responses in vivo by assessing IL-6, IP- 10, TNFa and IFN-a serum concentrations. Following si NA-RVG exosome treatment, nonsignificant changes in all cytokines were registered similar to siRNA-transfection reagent treatment in contrast to siRNA-RVG-9R, which potentl stimulated I L-6 secretion, confirming the immunologically inert profile of the exosome treatment. Given that exosomes encapsulate only 20% of siRNA, delivery with RVG-exosome appears to be more efficient than RVG-9R deliver}' as comparable mRNA knockdown and greater protein knockdown was achieved with fivefold less siRNA without the corresponding level of immune stimulation. This experiment demonstrated the therapeutic potential of RVG- exosome technology, which is potentially suited for long-term silencing of genes related to neurodegenerative diseases. The exosome delivery system of Alvarez-Erviti et al. may be applied to deliver the CRISPR-Cas system of the present invention to therapeutic targets, especially neurodegenerative diseases. A dosage of about 100 to 1000 mg of CRISPR Cas encapsulated in about 100 to 1000 mg of RVG exosomes may be contemplated for the present invention. [00238] El-Andaloussi et al. (Nature Protocols 7,2112-2126(2012)) discloses how exosomes derived from cultured cells can be harnessed for delivery of siRNA in vitro and in vivo. This protocol first describes the generation of targeted exosomes through transfection of an expressio vector, comprising an exosomal protein fused with a peptide ligand. Next, El-Andaloussi et al, explain how to purify and characterize exosomes from traiisfected ceil supernata t. Next, El- Andaloussi et al, detail crucial steps for loading siRNA into exosomes. Finally, El-Andaloussi et al. outline how to use exosomes to efficiently deliver siRNA in vitro and in vivo in mouse brain. Examples of anticipated results in which exosome-mediated siRNA delivery is evaluated by functional assays and imaging are also provided. The entire protocol takes ~3 weeks. Delivery or administration according to the invention may be performed using exosomes produced from self- derived dendritic cells.
[00239] In another embodiment, the plasma exosomes of Wahlgren et al. (Nucleic Acids Research, 2012, Vol. 40, No. 17 el30) are contemplated. Exosomes are nano-sized vesicles (30- 90nm in size) produced by many cell types, including dendritic cells (DC), B cells, T cells, mast cells, epithelial cells and tumor cells. These vesicles are formed by inward budding of late endosomes and are then released to the extracellular environment upon fusion with the plasma membrane. Because exosomes naturally cany RNA between cells, this property might be useful in gene therapy.
[00240] Exosomes from plasma are prepared by centrifugation of buffy coat at 900g for 20 min to isolate the plasma followed by harvesting ceil supernata ts, centrifuging at 300g for 10 min to eliminate cells and at 16 500g for 30 min followed by filtration through a 0.22 mm filter. Exosomes are pelleted by ultracentrifugation at 120 OOOg for70 min. Chemical transfection of siRNA into exosomes is carried out according to the manufacturer's instructions in RNAi Human Mouse Starter Kit (Quiagen, Hilden, Germany). siRNA is added to 100 ml PBS at a final concentration of 2 mmol/ml. After adding HiPerFect transfectio reagent, the mixture is incubated for 10 min at RT. In order to remove the excess of micelles, the exosomes are re- isolated using aldehyde/ sulfate latex beads. The chemical transfection of CRISPR Cas into exosomes may be conducted similarly to siRNA. The exosomes may be co-cultured with monocytes and lymphocytes isolated from the peripheral blood of healthy donors. Therefore, it may be contemplated that exosomes containing CRISPR Cas may be introduced to monocytes and lymphocytes of and autologously reintroduced into a human. Accordingly, delivery or administration according to the invention may beperformed using plasma exosomes.
Liposomes
[00241] Delivery or administration according to the invention can be performed with liposomes. Liposomes are spherical vesicle structures composed of a uni- or multilamellar lipid bi!ayer surrounding internal aqueous compartments and a relatively impermeable outer lipophilic phospholipid bilayer. Liposomes have gained considerable attention as drug delivery carriers because they are biocompatible, nontoxic, can deliver both hydrophilic and lipophilic drug molecules, protect their cargo from degradation by plasma enzymes, and transport their load across biological membranes and the blood brain barrier (BBB) (see, e.g., Spuch and Navarro, journal of Drug Delivery, vol. 201 1 , Article ID 469679, 12 pages, 2011. doi: 10.1155/2011/469679 for review).
[00242] Liposomes can be made from several different types of lipids; however, phospholipids are most commonly used to generate liposomes as drug carriers. Although liposome formation is spontaneous when a lipid film is mixed with an aqueous solution, it can also be expedited by applying force in the form of shaking by using a homogenizer, sonicator, or an extrusion apparatus (see, e.g., Spuch and Navarro, Journal of Drug Deliver}', vol. 2011. Article ID 469679, 12 pages, 2011. doi: 10.1155/201 1/469679 for review).
[00243] Several other additives may be added to liposomes in order to modify their structure and properties. For instance, either cholesterol or sphingomyelin may be added to the liposomal mixture in order to help stabilize the liposomal structure and to prevent the leakage of the liposomal inner cargo. Further, liposomes are prepared from hydrogenated egg phosphatidylcholine or egg phosphatidylcholine, cholesterol, and dicetyl phosphate, and their mean vesicle sizes were adjusted to about 50 and 100 nm. (see, e.g., Spuch and Navarro, Journal of Drag Delivery, vol. 201 1 , Article ID 469679, 12 pages, 2011. doi: 10.1 155/2011/469679 for review).
[00244] Conventional liposome formulation is main!)? comprised of natural phospholipids and lipids such as 1, 2-distearoryl-sn-giycero-3 -phosphatidyl choline (DSPC), sphingomyelin, egg phosphatidylcholines and monosialoganglioside. Since this formulation is made up of phospholipids only, liposomal formulations have encountered many challenges, one of the ones being the instability in plasma. Several attempts to overcome these challenges have been made, specifically in the manipulation of the lipid membrane. One of these attempts focused on the manipulation of cholesterol. Addition of cholesterol to conventional formulations reduces rapid release of the encapsulated bioactive compound into the plasma or l,2-dioleoyl-sn-giyeero-3- phosphoethanolamine (DOPE) increases the stability (see, e.g., Spuch and Navarro, Journal, of Drug Delivery, vol. 2011, Article ID 469679, 12 pages, 2011. doL IG. l 155/2011/469679 for review).
0Θ245] In a particularly advantageous embodiment, Trojan Horse liposomes (also known as Molecular Trojan Horses) are desirable and protocols may be found at bi{p://cshpro ocois sh)p.org/content/2010/4/pdb.prot5407,long. These particles allow delivery of a transgene to the entire brain after an intravascular injection. Without, being bound by limitation, it is believed that neutral lipid particles with specific antibodies conjugated to surface allow crossing of the blood brain barrier via endocytosis. Applicant postulates utilizing Trojan Horse Liposomes to deliver the C ISPR family of nucleases to the brain via an intravascular injection, which would allow whole brain transgenic animals without the need for embryonic manipulation. About 1 -5 g of DNA may be contemplated for in vivo administration in liposomes.
[00246] In another embodiment, the CRISPR Cas system may be administered in liposomes, such as a stable nucleic-acid-lipid particle (SNALP) (see, e.g., Morrissey et al., Nature Biotechnology, Vol. 23, No. 8, August 2005). Daily intravenous injections of about 1, 3 or 5 mg/kg/day of a specific CRISPR Cas targeted in a SNALP are contemplated. The daily treatment may be over about, three days and then weekly for about five weeks. In another embodiment, a specific CRISPR Cas encapsulated SNALP) administered by intravenous injection to at doses of abpit 1 or 2.5 rng/'kg are also contemplated (see, e.g., Zimmerman et al., Nature Letters, Vol. 441, 4 May 2006). The SNALP formulation may contain the lipids 3-N- [(wmethoxypoly(ethylene glycol) 2000) carbamoyl] -1 ,2-dimyristyloxy-propyiamine (PEG-CDMA), 1 ,2-dilinoIeyloxy-N,N-dimethyI-3-aminopropane (DLinDMA), 1 ,2-distearoy -sn- glycero-3-phosphocholine (DSPC) and cholesterol, in a 2:40:10:48 molar per cent ratio (see, e.g., Zimmerman et al., Nature Letters, Vol. 44.1 , 4 May 2006).
[00247] In another embodiment, stable nucleic-acid-lipid particles (SNALPs) have proven to be effective delivery molecules to highly vascularized HepG2 -derived liver tumors but not in poorly vascularized HCT-116 derived liver tumors (see, e.g., Li, Gene Therapy (2012) 19, 775- 780). The SNALP liposomes may be prepared by formulating D-Lin-DMA and PEG-C-DMA with distearoylphosphatidylcholme (DSPC), Cholesterol and siRNA using a 25: 1 lipid/siRNA ratio and a 48/40/10/2 molar ratio of Cholestero!/D-Lin-DMA DSPC/PEG-C-DMA. The resulted SNALP liposomes are about 80-100 nm in size.
[00248] in yet another embodiment, a SNALP may comprise synthetic cholesterol (Sigma- Aldric , St Louis, MO, USA), dipalmitoylphosphatidylcholine (Avanti Polar Lipids, Alabaster, AL, USA), 3-N-[(w-methoxy polyethylene glycol )2000)carbamo l]- 1 ,2- dimyrestyloxypropylamine, and cationic l,2-dilinoleyioxy-3-N,Ndimethylammopropane (see, e.g., Geisbert et al, Lancet 2010; 375: 1896-905). A dosage of about 2 mg kg total CRISPR Cas per dose administered as, for example, a bolus intravenous infusion may be contemplated.
[00249] In yet another embodiment, a SN ALP may comprise synthetic cholesterol (Sigma- Aidrich), l,2-distearoyl-sn-glycero-3-phosphocholine (DSPC; Avanti Polar Lipids Inc.), PEG- cDMA, and l,2-dilmoleyloxy-3-(N;N-dimethyl)aminopropane (DLinDMA) (see, e.g., Judge, J. Clin. Invest. 1 19:661-673 (2009)). Formulations used for in vivo studies may comprise a final lipid/RNA mass ratio of about 9: 1.
[00250] The safety profile of RNAi nanomedicin.es has been reviewed by Barros and Gollob of Alnylam Pharmaceuticals (see, e.g., Advanced Drug Delivery Reviews 64 (2012) 1730-1737). The stable nucleic acid lipid particle (SNALP) is comprised of four different lipids— an ionizable lipid (DLinDMA) that is cationic at low H, a neutral helper lipid, cholesterol, and a diffusible polyethylene glycol (PEG)-iipid. The particle is approximately 80 nm in diameter and is charge-neutral at physiologic pH. During formulation, the ionizable lipid serves to condense lipid with the anionic siRNA during particle formation. When positively charged under increasingly acidic endosomal conditions, the ionizable lipid also mediates the fusion of SNALP with the endosomal membrane enabling release of siRNA into the cytoplasm. The PEG-lipid stabilizes the particle and reduces aggregation during formulation, and subsequently provides a neutral hydrophiiic exterior that improves pharmacokinetic properties.
[00251] To date, two clinical programs have been initiated using SNALPsiRNA formulations. Tekmira Pharmaceuticals recently completed a phase I single-dose study of SNALP-ApoB in adult volunteers with elevated LDL cholesterol. ApoB is predominantly expressed in the liver and jejunum and is essential for the assembly and secretion of VLDL and LDL. Seventeen subjects received a single dose of SNALP -ApoB (dose escalation across 7 dose levels). There was no evidence of liver toxicity (anticipated as the potential dose-limiting toxicity based on preclinical studies). One (of two) subjects at the highest dose experienced flu-like symptoms consistent with immune system stimulation, and the decision was made to conclude the trial .
[00252] Alnyiam Pharmaceuticals has similarly advanced ALN-TTR01, which employs the SNALP technology described above and targets hepatocyte production of both mutant and wild- type TTR to treat TTR amyloidosis (ATTR). Three ATTR syndromes have been described: familial amyloidotic polyneuropathy (FAP) and familial amyloidotic cardiomyopathy (I AC) both caused by autosomal dominant mutations in TTR; and senile systemic amyloidosis (SSA) cause by wild type TTR. A placebo-controlled, single dose-escalation phase I trial of ALN- TTR01 was recently completed in patients with ATTR. ALN-TTROl was administered as a 15- minute IV infusion to 31 patients (23 with study drag and 8 with placebo) within a dose range of 0.01 to 1.0 mg/kg (based on siRNA). Treatmentwaswel! tolerated with no significant increases in liver function tests. Infusion-related reactions were noted in 3 of 23 patients at>0.4 mg kg; all responded to slowing of the infusion rate and all continued on study. Minimal and transient elevations of serum cytokines IL-6, IP- 10 and IL-lra were noted in two patients at the highest dose of 1 mg/kg (as anticipated from preclinical and NHP studies). Lowering of serum TTR, the expected pharmacodynamics effect of ALN-TTROl, was observed at 1 mg/kg.
[00253] In yet another embodiment, a SNALP may be made by solubilizing a cationic lipid, DSPC, cholesterol and PEG-iipid were solubilized in ethanol at a molar ratio of 40: 10:40: 10, respectively (see, Semple et al., Nature Niotechnology, Volume 28 Number 2 February 2010, pp. 172-177). The lipid mixture was added to an aqueous buffer (50 raM citrate, pH 4) with mixing to a final ethanol and lipid concentration of 30% (vol/vol) and 6.1 mg/ml, respectively, and allowed to equilibrate at 22 °C for 2 min before extrusion. The hydrated lipids were extruded through two stacked 80 nm pore-sized filters (Nuclepore) at 22 °C using a Lipex Extruder (Northern Lipids) until a vesicle diameter of 70-90 nm, as determined by dynamic light scattering analysis, was obtained. This generally required 1-3 passes. The siRNA (solubilized in a 50 mM citrate, pH 4 aqueous solution containing 30% ethanol) was added to the pre- equilibrated (35 °C) vesicles at a rate of ~5 ml/min with mixing. After a final target siRNA/lipid ratio of 0.06 (wt/wt) was reached, the mixture was incubated for a further 30 min at 35 °C to allo w vesicle reorganization and encapsulation of the siRNA . The ethanol was then removed and the external buffer replaced with PBS (155 mM NaCl, 3 mM Na2HP04, 1 mM KH2P04, pH 7.5) by either dialysis or tangential flow diafiltration. siRNA were encapsulated in SNALP using a controlled step-wise dilution method process. The lipid constituents of KC2-SNALP were DLm-KC2-DMA (eatiome lipid), dipalmitoylphosphatidyleholine (DPPC; Avanti Polar Lipids), synthetic cholesterol (Sigma) and PEG-C-DMA used at a molar ratio of 57,1 :7.1 :34,3: 1.4. Upon formation of the loaded particles, SNALP were dialyzed agamst PBS and filter steri lized through a 0.2 μηι filter before use. Mean particle sizes were 75-85 nm and 90-95% of the siRNA was encapsulated within the lipid particles. The final siRNA/lipid ratio in formulations used for in vivo testing was—0.15 (wt wt). LNP-siRNA systems containing Factor VII siRNA were diluted to the appropriate concentrations in sterile PBS immediately before use and the formulations were administered intravenously through the lateral tail vein in a total volume of 10 ml/kg. This method may be extrapolated to the CRISPR Cas system of the present invention.
Other Lipids
[00254] Other cationic lipids, such as amino lipid 2,2-dilinoleyl-4~dimethylaminoethyI-[l,3]- dioxolane (DLin- C2-DMA) may be utilized to encapsulate CRISPR Cas similar to SiRNA (see, e.g., Jayaraman, Angew. Chem, Int. Ed, 2012, 51, 8529 -8533). A preformed vesicle with the following lipid composition may be contemplated: amino lipid, distearoylphosphatidyl ioline (DSPC), cholesterol and (R)-2,3-bis(octadecyloxy) propyl- 1- (methoxy poly(ethylene glycol)2000)propylcarbamate (PEG-lipid) in the molar ratio 40/10/40/10, respectively, and a FVII siRNA'total lipid ratio of approximately 0.05 (w/w). To ensure a narrow particle size distribution in the range of 70-90 nm and a low polydispersity index of 0.11_0.04 (u 56}. the particles may be extruded up to three times through 80 nm membranes prior to adding the CRISPR Cas RNA. Particles containing the highly potent amino lipid 16 may be used, in which the molar ratio of the four lipid components 16, DSPC, cholesterol and PEG-lipid (50/10/38.5/1.5) which may be further optimized to enhance in vivo activity,
[00255] Michael S D ormann et al. ("Expression of therapeutic proteins after delivery of chemically modified mRNA. in mice: Nature Biotechnology, Volume:29, Pages: 154-157 (2011) Published online 09 January 201 1 ) describes the use of lipid envelopes to deliver RNA. Use of lipid envelopes is also preferred in the present invention.
[00256] In another embodiment, lipids may e formulated with the CRISPR Cas system of the present invention to form lipid nanoparticles (LNPs). Lipids include, but are not limited to, DLin- C2~DMA4, C12-200 and colipids disteroylphosphatidyl choline, cholesterol, and PEG- DMG may be formulated with CRISPR Cas instead of siRNA (see, e.g., Novobrantseva, Molecular Therapy-Nucleic Acids (2012) 1, c4; doi: 10.1038/mtna.201 1.3) using a spontaneous vesicle formation procedure. The component molar ratio may be about 50/10/38.5/1.5 (DLin- KC2-DMA or C 12-200/disteroyf phosphatidyl cholme/cholesterol PEG-DMG). The final lipid :siRNA weight ratio may be -12: 1 and 9: 1 in the case of DLin-KC2-DMA and C 12-200 lipid nanopartieles (LNPs), respectively. The formulations may have mean particle diameters of ~80 urn with >90% entrapment efficiency. A 3 mg/kg dose may be contemplated.
[00257] Tekmira has a portfolio of approximately 95 patent families, in the U.S. and abroad, that are directed to various aspects of LNPs and LNP formulations (see, e.g., U.S. Pat. Nos. 7,982,027; 7,799,565; 8,058,069; 8,283,333; 7,901,708; 7,745,651 ; 7,803,397; 8,101,741 ; 8,188,263; 7,915,399; 8,236,943 and 7,838,658 and European Pat. Nos .1766035; 1519714; 1781593 and 1664316), all of which may be used/and or adapted to the present invention.
[00258] The CRISPR Cas system may be delivered encapsulated in PLGA Microspheres such as that further described in US published applications 20130252281 and 20130245107 and 20130244279 (assigned to Modema Therapeutics) which relate to aspects of formulation of compositions comprising modified nucleic acid molecules which may encode a protein, a protein precursor, or a partially or fully processed form of the protein or a protein precursor. The formulation may have a molar ratio 50: 10:38.5: 1.5-3.0 (cationic !ipid:fusogemc iipidxholesterobPEG lipid). The PEG lipid may be selected from, but is not limited to PEG-c- DOMG, PEG-DMG. The fusogenic lipid may be DSPC. See also, Schrum et a!., Delivery and Formulation of Engineered Nucleic Acids, US published application 20120251618.
[00259] Nanomerics' technology addresses bioavailability challenges for a broad range of therapeutics, including low molecular weight hydrophobic drags, peptides, and nucleic acid based therapeutics (piasmid, siRNA, miRNA). Specific administration routes for which the technology has demonstrated clear advantages include the oral route, transport across the blood- brain-barrier, delivery to solid tumours, as well as to the eye. See, e.g., Mazza et al., 2013, ACS Nano. 2013 Feb 26:7(2 ): 101 -26; Uchegbu and Slew, 2013, J Pharm Sci. 102(2):305-10 and Lalatsa et al, 2012, J Control Release. 2012 Jul 20;161(2):523-36.
00260J US Patent Publication No. 20050019923 describes cationic dendrimers for delivering bioactive molecules, such as polynucleotide molecules, peptides and polypeptides and/or pharmaceutical agents, to a mammalian body. The dendrimers are suitable for targeting the delivery of the bioactive molecules to, for example, the liver, spleen, lung, kidney or heart. Dendrimers are synthetic 3-dimensional maeromolecules that are prepared in a step-wise fashion from simple branched monomer units, the nature and functionality of which can be easily controlled and varied. Dendrimers are synthesised from the repeated addition of building blocks to a multifunctional core (divergent approach to synthesis), or towards a multifunctional core (convergent approach to synthesis) and each addition of a 3-dimensional shell of building blocks leads to the formation of a higher generation of the dendrimers. Polypropylenimine dendrimers start from a diaminobutane core to which is added twice the number of amino groups by a double Michael addition of aerylonitrile to the primary amines followed by the hydrogenation of the nitriies. This results in a doubling of the amino groups. Polypropylenimine dendrimers contai 100% protonable nitrogens and up to 64 terminal amino groups (generation 5, DAB 64). Protoiiable groups are usually amine groups which are able to accept protons at neutral pH. The use of dendrimers as gene deli very agents has l argely focused on the use of the polyamidoamine. and phosphorous containing compounds with a mixture of amine/amide or N--P(02)S as the conjugating units respectively with no work being reported on the use of the lower generation polypropylenimine dendrimers for gene delivery. Polypropylenimine dendrimers have also been studied as pH sensitive controlled release systems for drug delivery and for their encapsulation of guest molecules when chemically modified by peripheral amino acid groups. The cytotoxicity and interaction of polypropylenimine dendrimers with DNA as well as the transfection efficacy of DAB 64 has also been studied.
[00261] US Patent Publication No. 20050019923 is based upon the observation that, contrary to earlier reports, cationic dendrimers, such as polypropylenimine dendrimers, display suitable properties, such as specific targeting and low toxicity, for use in the targeted delivery of bioactive molecules, such as genetic material. In addition, derivatives of the cationic dendrimer also display suitable properties for the targeted delivery of bioactive molecules. See also, Bioactive Polymers, US published application 20080267903, which discloses "Various polymers, including cationic polyamine polymers and dendrimeric polymers, are shown to possess anti-proliferative activity, and may therefore be useful for treatment of disorders characterised by undesirable cellular proliferation such as neoplasms and tumours, inflammatory disorders (including autoimmune disorders), psoriasis and atherosclerosis. The polymers may be used alone as active agents, or as delivery vehicles for other therapeutic agents, such as drug molecules or nucleic acids for gene therapy. In such cases, the polymers' own intrinsic anti- tumour activity may complement the activity of the agent to he delivered."
Supercharged proteins
[00262] Supercharged proteins are a class of engineered or naturally occurring proteins with unusually high positive or negative net theoretical charge. Both supe negatively and superpositiveiy charged proteins exhibit a remarkable ability to withstand thermally or chemically induced aggregation. Superpositiveiy charged proteins are also able to penetrate mammalian cells. Associating cargo with these proteins, such as plasmid DNA, siRNA, or other proteins, can enable the functional delivery of these macromoiecules into mammalian cells both in vitro and in vivo. David Liu's lab reported the creation and characterization of supercharged proteins in 2007 (Lawrence et ah, 2007, Journal of the American Chemical Society 129, 101 10- 10112).
[00263] The nonviral delivery of siRNA and plasmid DNA into mammalian cel ls are valuable both for research and therapeutic applications (Akiiic et al, 2010, Nat. Biotech. 26, 561-569). Purified +36 GFP protein (or other superpositiveiy charged protein) is mixed with siRNAs in the appropriate serum-free media and allowed to complex prior addition to cells. Inclusion of serum at this stage inhibits formation of the supercharged protein-siRNA complexes and reduces the effectiveness of the treatment. The following protocol has been found to be effective for a variety of cell lines (McNaughton et al., 2009, Proc. Natl. Acad. Sci. USA 106, 6111-6116). However, pilot experiments varying the dose of protein and siRN A should be performed to optimize the procedure for specific ceil lines.
(1) One day before treatment, plate I x 10J cel ls per well in a 48-well plate.
(2) On the day of treatment, dilute purified +36 GFP protein in serumfree media to a final concentration 200nM. Add siRNA to a final concentration of 50nM. Vortex to mix and incubate at room temperature for lOmin.
(3) During incubation, aspirate media from cells and wash once with PBS.
(4) Following incubation of +36 GFP and siRN A, add the protein-siRNA complexes to ceils.
(5) Incubate cells with complexes at 37 C for 4h. (6) Following incubation, aspirate the media and wash three times with 20 U/raL heparin PBS. Incubate cells with serum -containing media for a further 48h or longer depending upon the assay for knockdown.
(7) Analyze cells by miniunoblot, qPCR, phenotypic assay, or other appropriate method.
ΘΘ264] David Lars lab has further found +36 GFP to be an effective plasmid delivery reagent in a range of cells. As plasmid DNA is a larger cargo than siRNA, proportionately more +36 GFP protein is required to effectively complex p!asmids. For effective plasmid delivery Applicants have developed a variant of +36 GFP bearing a C-terminal HA2 peptide tag, a known endosome-disrupting peptide derived from the influenza virus hemagglutinin protein. The following protocol has been effective in a variety of cells, but as above it is advised that plasmid DNA and supercharged protein doses be optimized for specific cell lines and delivery applications.
(1) One day before treatment plate 1 x 10' per well in a 48- well plate.
(2) On the day of treatment, dilute purified p36 GFP protein in serumfree media to a final concentration 2 niM. Add Img of plasmid DNA. Vortex to mix and incubate at room temperature for lOmin.
(3) During incubation, aspirate media from ceils and wash once with PBS.
(4) Following incubation of b36 GFP and plasmid DNA, gently add the protein-DNA complexes to cells.
(5) Incubate cells with complexes at 37 C for 4h.
(6) Following incubation, aspirate the media and wash with PBS. Incubate cel ls in seami-containing media and incubate for a further 24-48h.
(7) Analyze plasmid delivery (e.g., by plasmid-driven gene expression) as appropriate.
[00265] See also, e.g., McNaughton et al, Proc. Natl. Acad. Sci. USA 106, 61 11-6116 (2009); Cronican et al., ACS Chemical Biology 5, 747-752 (2010); Cronican et ah, Chemistry & Biology 18, 833-838 (2011); Thompson et al, Methods in Enzymology 503, 293-319 (2012); Thompson, D.B., et al, Chemistry & Biology 19 (7), 831 -843 (2012). The methods of the super charged proteins may be used and/or adapted for delivery of the CRISPR Cas system of the present invention.
Figure imgf000067_0001
[00266] In another embodiment, implantable devices are also contemplated for delivery of the CRISPR Cas system. For example, US Patent Publication 201 10195123 discloses an implantable medical device which elutes a drug locally and in prolonged period is provided, including several types of such a device, the treatment modes of implementation and methods of implantation. The device comprising of polymeri c substrate, such as a matrix for exampl e, that is used as the device body, and dmgs, and in some cases additional scaffolding materials, such as metals or additional polymers, and materials to enhance visibility and imaging. The selection of drug is based on the advantageous of releasing drug locally and in prolonged period, where drug is released directly to the extracellular .matrix (ECM) of the diseased area such as tumor, inflammation, degeneration or for symptomatic objectives, or to injured smooth muscle cells, or for prevention. One kind of drug is the gene silencing drugs based on RNA interference (RNAi), including but not limited to si RJN A, sh RNA, or antisense RNA/DNA, ribozyme and nucleoside analogs. Therefore, this system may be used/and or adapted to the CRISPR Cas system of the present invention. The modes of implantation i some embodiments are existing implantation procedures that are developed and used today for other treatments, including brachytherapy and needle biopsy. In such cases the dimensions of the new implant described in this invention are similar to the original implant. Typical ly a few devices are implanted during the same treatment procedure.
[00267] As described in US Patent Publication 201 10195123, there is provided a drug delivery implantable or insertable system, including systems applicable to a cavity such as the abdominal cavity and/or any other type of administration in which the drug delivery system is not anchored or attached, comprising a biostable and/or degradable and/or bioabsorbable polymeric substrate, which may for example optionally be a matrix. It should be noted that the term "insertion" also includes implantation. The drug delivery system is preferably implemented as a " Loder" as described in US Patent Publication 201 10195 123.
[00268] The polymer or plurality of polymers are biocompatible, incorporating an agent and/or plurality of agents, enabling the release of agent at a controlled rate, wherein the total volume of the polymeric substrate, such as a matrix for example, in some embodiments Is optionally and preferably no greater than a maximum volume that permits a therapeutic level of the agent to be reached. As a non-limiting example, such a volume is preferably within the range of 0.1 nr to 1000 mm" , as required by the volume for the agent load. The Loder may optionally be larger, for example when incorporated with a device whose size is determined by functionality, for example and without limitation, a knee joint, an infra-uterine or cervical ring and the like,
[00269] The drug delivery system (for delivering the composition) is designed in some embodiments to preferably employ degradable polymers, wherei the main release mechanism is bulk erosion; or in some embodiments, non degradable, or slowly degraded polymers are used, wherein the main release mechanism is diffusion rather than bulk erosion, so that the outer part functions as membrane, and its internal part functions as a drug reservoir, which practically is not affected by the surroundings for an extended period (for example from about a week to about a few months). Combinations of different polymers with different release mechanisms may also optionally be used. The concentration gradient at the surface is preferably maintained effectively constant during a significant period of the total drug releasing period, a d therefore the diffusion rate is effectively constant (termed "zero mode" diffusion). By the term "constant" it is meant a diffusion rate that is preferably maintained above the lower threshold of therapeutic effectiveness, but which may still optionally feature an initial burst and/or fluctuate, for example increasing and decreasing to a certain degree. The diffusion rate is preferably so maintained for a prolonged period, and it can be considered constant to a certain level to optimize the therapeutically effective period, for example the effective silencing period.
[00270] The drug delivery system optionally and preferably is designed to shield the nucleotide based therapeutic agent from degradation, whether chemical in nature or due to attack from enzymes and other factors in the body of the subject,
[00271] The drug delivery system as described in US Patent Publication 201 10195123 is optionally associated with sensing and/or activation appliances that are operated at and/or after implantation of the device, by non and/or minimally invasive methods of activation and/or acceleration/deceleration, for example optionally including but not limited to thermal heating and cooling, laser beams, and ultrasonic, including focused ultrasound and/or RF (radiofrequency) methods or devices.
[00272] According to some embodiments of US Patent Publication 20110195123, the site for local deliver}' may optionally include target sites characterized by high abnormal proliferation of cells, and suppressed apoptosis, including tumors, active and or chronic inflammation and infectio including autoimmune diseases states, degenerating tissue including muscle and nervous tissue, chronic pain, degenerative sites, and location of bone fractures and other wound locations for enhancement of regeneration of tissue, and injured cardiac, smooth and striated muscle. The site for local deliver}.' also may optionally include sites enabling performing preventive activities including pregnancy, prevention of infection and aging.
[00273] The site for implantatio of the composition, or target site, preferably features a radius, area and/or volume that is sufficiently small for targeted local delivery. For example, the target site optionally has a diameter in a range of from about 0.1 mm to about 5 cm.
[00274] The location of the target site is preferably selected for maximum therapeutic efficacy. For example, the composition of the drug delivery system (optionally with a device for implantation as described above) is optionally and preferably implanted within or in the proximity of a tumor environment, or the blood supply associated thereof.
[00275] For example the composition (optionally with the device) is optionally implanted within or in the proximity to pancreas, prostate, breast, liver, "via the nipple, within the vascular system and so forth.
[00276] The target location is optionally selected from the group consisting of (as non- limiting examples only, as optionally any site within the body may be suitable for implanting a Loder): 1. brain at degenerative sites like in Parkinson or Alzheimer disease at the basal ganglia, white and gray matter; 2. spine as in the case of amyotrophic lateral sclerosis (ALS); 3. uterine cervix to prevent HPV infection; 4. active and chronic inflammatory joints; 5. dermis as i the case of psoriasis; 6. sympathetic and sensoric nervous sites for analgesic effect; 7. Intra osseous implantation; 8. acute and chronic infection sites; 9. Intra vagi al; 10. Inner ear— auditory system, labyrinth of the inner ear, vestibular system; 11. Intra tracheal; 12. Intra-cardiac; coronary, epicardiac; 13. urmary bladder; 14. biliary system; 15. parenchymal tissue including and not limited to the kidney, liver, spleen; 16. lymph nodes; 17. salivary glands; 18. dental gums; 19. Intra-articular (into joints); 20. !ntra-ocuiar; 21. Brain tissue; 22. Brain ventricles; 23. Cavities, including abdominal cavity (for example but without limitation, for ovary cancer); 24. Intra esophageal and 25. Intra rectal.
[00277] Optionally insertion of the system (for example a device containing the composition) is associated with injection of material to the ECM at the target site and the vicinity of that site to affect local pH and/or temperature and/or other biological factors affecting the diffusion of the drug and/or drug kinetics in the ECM, of the target site and the vicinity of such a site. [00278] Optionally, according to some embodiments, the release of said agent could be associated with sensing and/or activation appliances that are operated prior and/or at and/or after insertion, by non and/or minimally invasive and/or else methods of activation and/or acceleration/deceleration, including laser beam, radiation, thermal heating and cooling, and ultrasonic, including focused ultrasound and/or RF (radiofrequency) methods or devices, and chemical activators.
[0Θ279] According to other embodiments of US Patent Publication 201 10195123, the drug preferably comprises a gene silencing biological RNAi drug, for example for localized cancer cases in breast, pancreas, brain, kidney, bladder, lung, and prostate as described below. Moreover, many drugs other than siRNA are applicable to be encapsulated in Loder, and can be used in association with this invention, as long as such drugs can be encapsulated with the Loder substrate, such as a matrix for example. Such drugs include approved drugs that are delivered today by methods other than of this invention, including Amphotericin B for fungal infection; antibiotics such as in osteomyelitis; pain killers such as narcotics; anti degenerative such as in Alzheimer or Parkinson diseases in a Loder implanted in the vicinity of the spine in the case of back pain. Such a system may be used and/or adapted to deliver the CRI SPR Cas system of the present invention .
[00280] For example, for specific applications such as prevention of growth or regrowth of smooth muscle cells (that are injured during a stenting procedure and as a result tend to proliferate), the drug may optionally be siRNA that silence smooth muscle cells, including HI 9 silencing, or a drug selected from the group consisting of taxoi, rapamycin and rapamyein- analogs. In such cases the Loder is preferably either a Drug Eluting Stent (DES), with prolonged release at constant rate, or a dedicated device that is implanted separately, in association to the stent. Al l of this may be used/and or adapted to the CRISPR Cas system of the present invention.
[00281] As another example of a specific application, neuro and muscular degenerative diseases develop due to abnormal gene expression. Local delivery of silencing R As may have therapeutic properties for interfering with such abnormal gene expression. Local delivery of anti apoptotic, anti inflammatory and anti degenerative drugs including smal l drugs and macromolecuies may also optionally be therapeutic. In such cases the Loder is applied for prolonged release at constant rate and/or through a dedicated device that is implanted separately. All of this may be used and/or adapted to the CRISPR Cas system of the present invention.
[00282] As yet another example of a specific application, psychiatric and cognitive disorders are treated with gene modifiers. Gene knockdown with silencing R A is a treatment option. Loders locally delivering nucleotide based agents to central nervous system sites are therapeutic options for psychiatric and cognitive disorders including but not limited to psychosis, bi -polar diseases, neurotic disorders and behavioral maladies. The Loders could also deliver locally drags including small drugs and macromolecules upon implantation at specific brain sites. All of this may be used and/or adapted to the CRISPR Cas system of the present invention.
[00283] As another example of a specific application, silencing of innate and/or adaptive immune mediators at local sites enables the prevention of organ transplant rejection. Local delivery of silencing R As and immunomodulating reagents with the Loder implanted into the transplanted organ and/or the implanted site renders local immune suppression by repelling immune ceils such as CDS activated against the transplanted organ. Ail of this may be used/and or adapted to the CRISPR Cas system of the present invention.
[00284] As another example of a specific application, vascular growth factors including VEGFs and angiogenin and others are essential for neovascularization . Local delivery of the factors, peptides, peptidomimetics, or suppressing their repressors is an important therapeutic modality; silencing the repressors and local delivery of the factors, peptides, macromolecules and small drugs stimulating angiogenesis with the Loder is therapeutic for peripheral, systemic and cardiac vascular disease.
[CI0285] The method of insertion, such as implantation, may optionally already be used for other types of tissue implantation and/or for insertions and/or for sampling tissues, optionally without modifications, or alternatively optionally only with non-major modifications in such methods. Such methods optionally include but are not limited to hrachymerapy methods, biopsy, endoscopy with and/or without ultrasound, such as ERCP, stereotactic methods into the brain tissue, Laparoscopy, including implantation with a laparoscope into joints, abdominal organs, the bladder wall and body cavities.
RISj^R e z me m
[00286] CRISPR enzyme rnRNA and guide RNA might also be delivered separately. CRISPR enzyme mRNA can be delivered prior to the guide RNA. to give time for CRISPR enzyme to be expressed, CRISPR enzyme mRNA might be administered 1 -12 hours (preferably around 2-6 hours) prior to the administration of guide RNA.
[00287] Alternatively, CRISPR enzyme mRNA and guide RNA can be administered together. Advantageously, a second booster dose of guide RNA can be administered 1 -12 hours (preferably around 2-6 hours) after the initial administration of CRISPR enzyme mRNA + guide RNA.
[00288] Additional administrations of CRISPR enzyme mRNA and/or guide RNA might be useful to achieve the most efficient levels of genome modification.
[00289] For minimization of toxicity and off-target effect, it will be important to control the concentration of CRISPR. enzyme mRNA and guide RNA delivered. Optimal concentrations of CRISPR enzyme mRNA and guide RNA can be determined by testing different concentrations in a cellular or animal model and using deep sequencing the analyze the extent of modification at potential off-target genomic loci. For example, for the guide sequence targeting 5'- GAGTCCGAGCAGAAGAAGAA-3' in the EMX1 gene of the human genome, deep sequencing can be used to assess the level of modification at the following two off-target loci, 1 : 5 ' -GAGTCCTAGCAGGAGAAGAA-3 ' and 2: 5' -GAGTCTAAGCAGAAGAAGAA-3 ' . The concentration that gives the highest level of on-target modification while minimizing the level of off-target modification should be chosen for in vivo delivery.
[00290] Alternatively, to minimize the level of toxicity and off-target effect, CRISPR enzyme niekase mRN A (for example S. pyogenes Cas9 with the DIOA mutation) can be delivered with a pair of guide RNAs targeting a site of interest. The two guide RNAs need to be spaced as follows. Guide sequences in red (single underline) and blue (double underline) respectively (these examples are based on the PAM requirement for Streptococcus pyogenes Cas9).
O srhang Guide RNA design (guide sequence and PAM color coded) length (bp)
14 N N NCC >^U^:s;i?;NN>^U^:s;i?;NN>^U^[sN G N
N-3'
3' -
13 NNNNNNNNNNNNNNNNNNNNG^NNN ^
-5'
12 5' -
NNNNNNNNNNNNNNNNNNNNCC^r^
N-3'
11 3' -
NNNNNNNNNNNNNNNNNNNNG^NNNN ^
N-5'
10
5' -
NNNNNNNNNNNNNNNNNNNNCC :>;NG ; ΐί ί ;i;NG N N i ;i;NGNGGNNNNNNNNNNNNNNN
N-3'
3' -
Figure imgf000073_0001
N-5'
5' -
NNNNNNNNNNNNNNNNNNNNCC:>VNGii NN>VSG;i NN>GNGGNNNNNNNNNNNNNNNN
N-3'
3' -
NNNNNNNNNNNNNNNNNNNNG^^
N-5'
Figure imgf000073_0002
N-3'
3' -
NNNNNNNNNNNNNNNNNNNNGGN NNN ¾^
N-5f NN NNNN NN NN^
N-3'
' _
NNNNNNNNNNNNNNNNN^
N-5'
blunt NNNNNNNNNNNNN^
N-3'
3 ' --
NNNNNNNNNNNNNNNNN^
N-5'
NNNNNNNNNNNNNN^
N-3'
3 ' -- NNN NN NNN NN M^
N-5'
NNNN NN NNNNK^
N-3'
3' -
NNNNNNNNNNNNNNNNNNNNGGNNNN^^
N-5'
NNNNNNNNNNNNNNNNNN :i NCCNNNN :ί N?¾NNNNN¾NNNNNNNNNNNNNNNNNNNNNN
N-3'
3' -
NNNNNNNNNNNNNNNNNNNNGGNNN^
N-5' NNNNNNN NNNN!^ :ί :i?;NN>;CC :ί :ί :i?;NGGNNNN NNNNNNN NNNNNNN NN -3'
3 ' -
NNNN NN NNNNN NN^
N-5' NNNNNNN NNN^U^ :i :i?;NN>;CC :ί :i ii GGNNNNN NNNNNNN NNNNNNN NN
N-3'
3 ' -
NNNNNNNNNNNNNNNNNNNNGGNNNNN ^
N-5'
NNNNNNNNNNNNNN :i :ii¾i;NCC :ί :ί?¾ί;ΝΝΝ iNGGNNNNNNNNNNNNNNNNNNNNNNNNN
N-3'
3' -
NNNNNNNNNNNNNNNNNNNNGGNNNJxi^
N-5'
5' - NN ir^ ¾\U ^
N-3'
3' -
NNNNNNNNNNNNNNNNNNNNGjGN^
N-5'
5' -
ΝΝΝΝΝΝΝΝΝΝίϊΝΝ ;i Ni;N( c Ni;NNNGGNNNNNNNNNNNNNNNNNNNNNNNNNNN
N-3'
' _
NNNNNNNNNNNNNNNNNNNNG^^
N-5'
5' -
Ν ΝΝΝΝΝ ΝΝ>νΚ^;¾ ΝΝ>ν;> "0;¾
N-3f
Figure imgf000076_0001
N
N N NNy¾K;\¾?;>;^
N
f N N NNy¾K;\¾?;^
N
NNNNNNNNNNNNNNNNNNNN
N ;χΤ
N
N
NN ^ ^N ^ ^V^
N N-5'
5 ' -
N-3'
3' --
NNNNNNNNNNNNNNNNNNNNGGNCC^
N-5'
5 ' - :i :i :i :i CGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
N-3'
3' -
NNNNNNNNNNNNNNNNNNNNNGGC^
N-5'
5' - :i :i NN>^U^ :i :i NN>;N!^ :i ii NGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
N-3'
3' -
NNNNNNNNNNNNNNNNNNNNNNNCCG^
N-5'
5' - :i :i NN>^U^ :i :i NN>;N!^ :i ii CGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
N-3'
3' -
NNNNNNNNNNNNNNNNNNNNNNNCCNGGNl^^
N-5'
5' -
ΝΝ Ν>;ΝΝ : Ν>;ΝΝ : Οΰ(;ΝΝΝΝΝΝΝΝΝΝΝΝΝΝΝΝΝΝΝΝΝΝΝΝΝΝΝΝΝΝΝΝΝΝ
N-3'
3' -
NNNNNNNNNNNNNNNNNNNNNNNCCNNGjSN^
N-5' 5' - Ν>^Ν; Ν ΝΝ>^Ν^
N-3'
3' -
NNNN NNNNNNN NNNNNNN NNCCNNNGGNNNNN NNNN NNNNN NNNNNN
N-5'
5' - Ν>^Ν; Ν ΝΝ>^Ν^
N-3'
' _
NNNNNNNNNNNNNNNNNNNNNNNCCNNNNGGNN N N NN N N NN NNNNNNNN
N-5'
5' -
Ν >ν^;¾ ΝΝ>ν^ί¾
N-3'
' _
NNNNNNNNNNNNNNNNNNNNNNNCCNNNNNGGN N NNNN N NNNN N NNNNNN
N-5'
[00291] Further interrogation of the system have given Applicants evidence of the 5' overhang (see, e.g., Ran et al, Cell.2013 Sep 12; 154(6): 1380-9 and US Provisional Patent Application Serial No.61/871,301 filed August 28, 2013). Applicants have further identified parameters that relate to efficient cleavage by the Cas9 nickase mutant when combined with two guide RNAs and these parameters include but are not limited to the length of the 5' overhang. In embodiments of the invention the 5' overhang is at most 200 base pairs, preferably at most 100 base pairs, or more preferably at most 50 base pairs. In embodiments of the invention the 5' overhang is at least 26 base pairs, preferably at least 30 base pairs or more preferably 34-50 base pairs or 1 -34 base pairs. In other preferred methods of the invention the first guide sequence directing cleavage of one strand of the DNA duplex near the first target sequence and the second guide sequence directing cleavage of other strand near the second target sequence results in a blunt cut or a 3' overhang. In embodiments of the invention the 3' overhang is at most 150, 100 or 25 base pairs or at least 15, 10 or 1 base pairs. In preferred embodiments the 3' overhang is 1- 100 basepairs. [00292] Aspects of the invention relate to the expression of the gene product being decreased or a template polynucleotide being further introduced into the DNA molecule encoding the gene product or an intervening sequence being excised precisely by allowing the two 5' overhangs to reannea! and ligate or the activity or function of the gene product being al tered or the expression of the gene product being increased. In an embodiment of the invention, the gene product is a protein.
[002931 Only sgRNA pairs creating 5' overhangs with less than 8 bp overlap between the guide sequences (offset greater than -8 bp) were able to mediate delectable indel formation. Importantly, each guide used in these assays is able to efficiently induce indels when paired with wildtype Cas9, indicating that the relative positions of the guide pairs are the most important parameters in predicting double nicking activity.
[00294] Since Cas9n and Cas9H840A nick opposite strands of DNA, substitution of Cas9n with Cas9H840A with a given sgRNA pair should result in the inversion of the overhang type. For example, a pair of sgRNAs that will generate a 5' overhang with Cas9n should in principle generate the corresponding 3' overhang instead. Therefore, sgRNA pairs that lead to the generation of a 3' overhang with Cas9n might be used with Cas9H840A to generate a 5' overhang. Unexpectedly, Applicants tested Cas9H840A with a set of sgRNA pairs designed to generate both 5' and 3' overhangs (offset range from -278 to +58 bp), but were unable to observe indel formation. Further work may be needed to identify the necessary design rules for sgRNA pairing to allow double nicking by Cas9H840A.
Liver, proprotein convertase subtiiisin kexin 9 (PCSK9)
[CI 295] Proprotein convertase subtiiisin kexin 9 (PCSK9) is a member of the subtiiisin serine protease family. PCSK9 is primarily expressed by the liver and is critical for the down regulation of hepatocyte LDL receptor expression. LDL-C levels in plasma are highly elevated in humans with gain of function mutations in PCSK9, classifying them as having severe hypercholesterolemia. Therefore, PCSK9 is an attractive target for CRISPR. PCS9K-targeted CRISPR may be formulated in a lipid particle and for example administered at about 15, 45, 90, 150, 250 and 400 .ug/kg intraveneously (see, e.g., http://www.ataylam.com/capella/wp~ coriteot mioad /'iO 13/08/ AI ."N~PCS0?.~001 -Proto ol-l .ancet odf)
[002961 Bailey et al. (J Mol Med (Berl). 1999 Jan;77(l):244-9) discloses insulin delivery by ex-vivo somatic cell gene therapy involves the removal of non-B-ce l somatic cells (e.g. fibroblasts) from a diabetic patient, and genetically altering them in vitro to produce and secrete insulin. The cells can be grown in culture and returned to the donor as a source of insulin replacement. Cells modified in this way could be evaluated before implantation, and reserve stocks could be eryopreserved. By using the patient's own cells, the procedure should obviate the need for immunosuppression and overcome the problem of tissue supply, while avoiding a recurrence of ceil destruction. Ex-vivo somatic cell gene therapy requires an accessible and robust cell type that is amenable to multiple transfections and subject to controlled proliferation. Special problems associated with the use of non-B-cell somatic cells include the processing of proinsulin to insulin, and the conferment of sensitivity to glucose-stimulated proinsulin biosynthesis and regulated insulin release. Preliminary studies using fibroblasts, pituitary cells, kidney (COS) cells and ovarian (CHO) cells suggest that these challenges could be met, and that ex-vivo somatic cell gene therapy offers a feasible approach to insulin replacement therapy. The system of Bailey et al. may be used/and or adapted to the CRISPR Cas system of the present invention for delivery to the liver.
[00297] The methods of Sato et al . (Nature Biotechnology Volume 26 Number 4 April 2008, Pages 431-442) may be applied to the CRISPR Cas system of the present invention for delivery to the liver. Sato et al. found that treatments with the siRNA-bearing vitamin A-coupled liposomes almost completely resolved liver fibrosis and prolonged survival in rats with otherwise lethal dimethyinitrosamine-induced liver cirrhosis in a dose- and duration-dependent manner. Cationic liposomes (Li otrust) containing 0,0'-ditetradecanoyl-N-(a rimethylammonioacetyl) diethanoianiine chloride (DC-6-14) as a cationic lipid, cholesterol and dioleoylphosphatidyiethanolamine at a molar ratio of 4:3:3 (which has shown high transfection efficiency under semmcontaining conditions for in vitro and in vivo gene delivery) were purchased from Hokkaido System Science. The liposomes were manufactured using a freeze- dried empty liposomes method and prepared at a concentration of 1 ratvi (DC -16-4) by addition of double-distilled, water (DDW) to the lyophilized lipid mixture under vortexing before use. To prepare V A-coupled liposomes, 200 nmoi of vitamin A (retinoi, Sigma) dissolved in DMSO was mixed with the liposome suspensions (100 nmol as DC- 16-4) by vortexing in a 1.5 ml tube at 25 1 C. To prepare V A-coupled liposomes carrying siRNAgp46 (VA-lip~siRNAgp46), a solution of siRNAgp46 (580 pmol/ml in DDW) was added to the retinoi-coupled liposome solution with stirring at 25 C. The ratio of siRNA to DC- 16-4 was .1 : 1 .1.5 (mol/mol) and the siRNA to liposome ratio (w†/ t) was 1 :1. Any free vitamin A or siRNA that was not taken up by liposomes were separated from liposomal preparations using a mieropartition system (VIVASPIN 2 concentrator 30,000 MWCO PES, VIVASCIENCE). The liposomal suspension was added to the filters and centrifuged at 1 ,500g for 5 mm 3 times at 25 1 C. Fractions were collected and the material trapped in the filter was reconstituted with PBS to achieve the desired dose for in vitro or in -vivo use. Three injections of 0.75 mg/kg si RNA were given every other day to rats. The system of Sato et al. may be used/and or adapted to the CRISPR Cas system of the present invention for delivery to the liver by delivering about 0.5 to 1 mg/kg of CRISPR Cas RNA in the liposomes as described by Sato et al. to humans.
[00298] The methods of Rozema et al. (PNAS, August 7, 2007, vol. 104, no. 32) for a vehicle for the delivery of siRNA to hepatocytes both in vitro and in vivo, which Rozema et al. have named siRNA Dynamic PoiyConjugates may also be applied to the present invention. Key features of the Dynamic Poly-Conjugate technology include a membrane-active polymer, the ability to reversibiy mask the activity of this polymer until it reaches the acidic environment of endosomes, and the ability to target this modified polymer and its siRNA cargo specifically to hepatocytes in vivo after simple, low-pressure i.v. injection. SATA-modified siRNAs are synthesized by reaction of 5' ammemodified siRNA with 1 weight equivalents (wt eq) of Nsuccmiinidyi-S-acctylthioacetate (SAT A) reagent (Pierce) and 0.36 wt eq of NaHC03 in water at 4°C for 16 h. The modified siRNAs are then precipitated by the addition of 9 vol of ethanol and incubation at 80°C for 2 h. The precipitate is resuspended in IX siRNA buffer (Dharmacon) and quantified by measuring absorbanee at the 260-nm wavelength. PBAVE (30 mg/ml in 5mMTAPS, pH 9) is modified by addition of 1.5 wt % SMPT (Pierce). After a 1 -h incubation, 0.8 mg of SMPT-PBAVE was added to 400 μΐ of isotonic glucose solution containing 5 mM TAPS (pH 9). To this solution was added 50 ug of SATA-modified siRNA. For the dose-response experiments where [PBAVE] was constant, different amounts of siRNA are added. The mixture is then incubated for 16 h. To the solution is then added 5.6 mg of Hepes free base followed by a mixture of 3.7 mg ofCDM-NAGand L9mg of CDM-PEG. The solution is then incubated for at least 1 h at room temperature before injection. CDM-PEG and CDM- NAG are synthesized from the acid chloride generated by using oxalyl chloride. To the acid chloride is added 1.1 molar equivalents polyethylene glycol monomethyl ether (molecular weight average of 450) to generate CDM-PEG or (aminoethoxy)ethoxy-2-(acetylamino)-2-deoxy-P-D- glucopyranoside to generate CDM-NAG. The final product is purified by using reverse-phase HPLC with a 0.1% TFA water/acetonitrile gradient. About 25 to 50 μ§ of siRNA was delivered to mice. The system of Rozema et al. may be applied to the CRISPR Cas system of the present invention for deiiver to the liver, for example by envisioning a dosage of about 50 to about 200 mg of CRISPR Cas for delivery to a human.
Bong
[002991 Oakes and Lieberman (Clin Orthop Reiat Res. 2000 Oct;(379 Suppi):S101 -12) discusses delivery of genes to the bone. By transferring genes into cells at a specific anatomic site, the osteoinductive properties of growth factors can be used at physiologic doses for a sustained period to facilitate a more significant healing response. The specific anatomic site, the quality of the bone, and the soft-tissue envelope, influences the selection of the target cells for regional gene therapy. Gene therapy vectors delivered to a treatment site in osteoinductive carriers have yielded promising results. Several investigators have shown exciting results using ex vivo and in vivo regional gene therapy in animal models. Such a system may be used/and or adapted to the CRISPR Cas system for delivery to the bone.
Brain
[00300] Delivery options for the brain include encapsulation of CRISPR enzyme and guide RNA in the form of either D'NA or RNA into liposomes and conjugating to molecular Trojan horses for trans-blood brain barrier (BBB) deliver}7. Molecular Trojan horses have been shown to be effective for delivery of B-gal expression vectors into the brain of non-human primates. The same approach can be used to delivery vectors containing CRISPR enzyme and guide RNA. For instance, Xia CF and Boado RJ, Pardridge WM ("Antibody-mediated targeting of siRNA. via the human insulin receptor using avidin-biotin technology." Mol Pharm, 2009 May- Jun;6(3):747-51. doi: 10.1021/mp800194) describes how delivery of short interfering RNA (siRNA) to cells in culture, and in vivo, is possible with combined use of a receptor-specific monoclonal antibody (mAb) and avidin-biotin technology. The authors also report that because the bond between the targeting mAb and the siRNA is stable with avidin-biotin technology, and RNAi effects at distant sites such as brain are observed in vivo following an intravenous administration of the targeted siRNA.
[00301] Zhang et al. (Mol Ther. 2003 Jan;7(l):l l-8.)) describe how expression piasmids encoding reporters such as luciferase were encapsulated in the interior of an "artificial virus" comprised of an 85 ran pegylated immunoiiposome, which was targeted to the rhesus monkey brain in vivo with a monoclonal antibody (MAb) to the human insulin receptor (HIR). The HIRMAb enables the liposome carrying the exogenous gene to undergo transeytosis across the blood-brain barrier and endocyiosis across the neuronal plasma membrane following intravenous injection. The level of luciferase gene expression in the brain was 50-fold higher in the rhesus monkey as compared to the rat. Widespread neuronal expression of the beta-galactosidase gene in primate brain was demonstrated by both histochemistiy and confocal microscopy. The authors indicate that this approach makes feasible reversible adult transgenics in 24 hours. Accordingly, the use of immunoiiposome is preferred. These may be used in conjunction with antibodies to target specific tissues or cell surface proteins.
[00302 J Other means of deliver}' or RNA are also preferred, such as via nanoparticles (Cho, S., Goldberg, M., Son, S., Xu, Q., Yang, F., Mei, Y., Bogatyrev, S., Langer, R. and Anderson, D., Lipid-! ike nanoparticles for small interfering RNA delivery to endothelial cells, Advanced Functional Materials, 19: 3112-3118, 2010) or exosomes (Schroeder, A., Levins, C, Cortez, C, Langer, R., and Anderson, D., Lipid-based nanotherapeutics for siRNA delivery, Journal of Internal Medicine, 267: 9-21, 2010, PM1D: 20059641).
[00303] Indeed, exosomes have been shown to be particularly useful in delivery siRNA, a system with some parallels to the CRISPR system. For instance, Ei-Andaloussi S, et al. ("Exosome-mediated delivery of siRNA in vitro and in vivo." Nat Protoc. 2012 Dec;7(12):2112- 26. doi: 10.1()38/nprot.2012.131. Epub 2012 Nov 15.) describe how exosomes are promising tools for drug delivery across different biological barriers and can be harnessed for delivery of siRNA in vitro and in vivo. Their approach is to generate targeted exosomes through transfection of an expression vector, comprising an exosomal protein fused with a peptide ligand. The exosomes are then purify and characterized from transfected ceil supernatant, then siRNA is loaded into the exosomes. Delivery or administration according to the invention can be performed with exosomes, in particular but not limited to the brain.
[00304] Vitamin E (a-tocopherol) may be conjugated with CRISPR Cas and delivered to the brain alo g with high density lipoprotein (HDL), for example in a similar ma ner as was do e by Uno et al. (HUMAN GENE THERAPY 22:71 1-719 (June 201 1 )) for delivering short-interfering RNA (siRNA) to the brain. Mice were infused via Osmotic minipumps (model 1007D; Alzet, Cupertino, CA) filled with phosphate -buffered saline (PBS) or free TocsiBACE or Toe- siBA.CE/HDl·, and connected with Brain Infusion Kit 3 (Alzet). A. brain-infusion cannula was placed about 0.5mm posterior to the bregma at midline for infusion into the dorsal third ventricle. Uno et al. found that as little as 3 nmol of Toc-siRNA with HDL could induce a target reduction in comparable degree by the same ICV infusion method. A similar dosage of CRISPR Cas conjugated to a-tocopheroi and co-administered with HDL targeted to the brain may be contemplated for humans in the present invention, for example, about 3 nmol to about 3 μηιοΐ of CRISPR Cas targeted to the brain may becontempiated.
[00305] Zou et al. ({HUMAN GENE THERAPY 22:465-475 (April 2011}) describes a method of lentiviral-mediated delivery of short-hairpin RNAs targeting PKCy for in vivo gene silencing in the spinal cord of rats. Zou et al. administered about 10 μΐ of a recombinant lentivirus having a titer of 1 x 109 transducing units (TU)/ml by an intrathecal catheter. A similar dosage of CRISPR Cas expressed in a lenti iral vector targeted to the brain may be contemplated for humans in the present invention, for example, about 10-50 ml of CRISPR Cas targeted to the brain in a lentivirus having a titer of 1 x 109 transducing units (TU)/ml may becontempiated.
Targeted deletion, therapeutic applications
[003061 Targeted deletion of genes is preferred. Examples are exemplified in Example 18. Preferred are, therefore, genes involved in cholesterol biosynthesis, fatty acid biosynthesis, and other metabolic disorders, genes encoding mis-folded proteins involved in amyloid and other diseases, oncogenes leading to cellular transformation, latent viral genes, and genes leading to dominant-negative disorders, amongst other disorders. As exemplified here, Applicants prefer gene delivery of a CRISPR-Cas system to the liver, brain, ocular, epithelial, hematopoetic, or another tissue of a subject or a patient in need thereof, suffering from metabolic disorders, amyloidosis and protein-aggregation related diseases, cellular transformation arising from genetic mutations and translocations, dominant negative effects of gene mutations, latent viral infections, and other related symptoms, using either viral or nanoparticle delivery system.
[00307] Therapeutic applications of the CRISPR-Cas system include Glaucoma, Amyloidosis, and Huntington's disease. These are exemplified in Example 20 and the features described therein are preferred alone or in combination.
[00308] Another example of a polyglutamine expansion disease that may be treated by the present invention includes spinocerebellar ataxia type 1 (SCAl). Upon intracerebellar injection, recombinant adenoassociated virus (AAV) vectors expressing short hairpin RNAs profoundly improve motor coordination., restored cerebellar morphology and resolved characteristic ataxin-1 inclusions in Purkinje cells of SCA1 mice (see, e.g., Xia et al., Nature Medicine, Vol. 10, No. 8, Aug. 2004). In particular, AAV1 and AAV5 vectors are preferred a d AAV titers of about 1 x 10" vector genomes/ml are desirable.
[00309] As an example, chronic infectio by HIV-1 may be treated or prevented. In order to accomplish this, one may generate CRISPR-Cas guide R'NAs that target the vast majority of the HIV-1 genome while taking into account HIV- 1 strain variants for maximal coverage and effectiveness. One may accomplish delivery of the CRISPR-Cas system by conventional adenoviral or lentiviral-mediated infection of the host immune system. Depending on approach, host immune cells could be a) isolated, transduced with CRISPR-Cas, selected, and reintroduced in to the host or b) transduced in vivo by systemic delivery of the CRISPR-Cas system. The first approach allows for generation of a resistant immune population whereas the second is more likely to target latent viral reservoirs within the host. This is discussed in more detail in the Examples section.
[00310] In another example, US Patent Publication No. 20130171732 assigned to Sangamo Biosciences, Inc. relates to insertion of an anti-HJV transgene into the genome, methods of which may be applied to the CRISPR Cas system of the present invention. In another embodiment, the CXCR4 gene may be targeted and the TALE system of US Patent Publication No. 20100291048 assig ed to Sangamo Biosciences, Inc. may be modified to the CRISPR Cas system of the present invention. The method of US Patent Publication Nos. 20130137104 and 20130122591 assigned to Sangamo Biosciences, Inc. and US Patent Publication No. 20100146651 assigned to Cel Sectis may be more generally applicable for transgene expression as it involves modifying a hypoxanthine-guanine phosphoribosyltransferase (HPRT) locus for increasing the frequency of gene modification.
[00311] It is also envisaged that the present invention generates a gene knockout cell library. Each cel l may have a single gene knocked out. This is exemplified in Example 23.
[00312] One may make a library of ES cells where each cell has a single gene knocked out, and the entire library of ES ceils will have every single gene knocked out. This library is useful for the screening of gene function in cellular processes as well as diseases. To make this cell library, one may integrate Cas9 driven by an inducible promoter (e.g. doxycycline inducible promoter) into the ES cell. In addition, one .may integrate a single guide RNA targeting a specific gene in the ES cell. To make the ES cell library, one may simply mix ES cells with a library of genes encoding guide NAs targeting each gene in the human genome. One may first introduce a single BxBl attB site into the AAVS1 locus of the human ES cell. Then one may use the BxBl mtegrase to facilitate the integration of individual guide RNA genes into the BxBl attB site in AAVS1 locus. To facilitate integration, each guide RNA gene may be contained on a plasmid that carries of a single attP site. This way BxBl will recombine the attB site in the genome with the attP site on the guide RN A containing plasmid. To generate the ceil library, one may take the library of cells thai have single guide RNAs integrated and induce Cas9 expression. After induction, Cas9 mediates double strand break at sites specified by the guide RNA.
[00313] Chronic administration of protein therapeutics may elicit unacceptable immune responses to the specific protein. The immunogenic! ty of protein drugs can be ascribed to a few immunodominant helper T lymphocyte (HTL) epitopes. Reducing the MHC binding affinity of these HTL epitopes contained within these proteins can generate drugs with lower immunogenicity (Tangri S, et al. ("Rationally engineered therapeutic proteins with reduced immunogenicity" J Immunol, 2005 Mar i 5; 174(6):3187-96.) In the present invention, the immunogenicity of the CRISPR enzyme in particular may be reduced following the approach first set out in Tangri et al with respect to erythropoietin and subsequently developed. Accordingly, directed evolution or rational design may be used to reduce the immunogenicity of the CRISPR enzyme (for instance a Cas9) in the host species (human or other species).
[00314] In Example 28, Applicants used 3 guideR As of interest and able to visualize efficient DNA cleavage in vivo occurring only in a small subset of cells. Essentially, what Applicants have shown here is targeted in vivo cleavage. In particular, this provides proof of concept that specific targeting in higher organisms such as mammals can also be achieved. It also highlights multiple aspect in that multiple guide sequences (i.e. separate targets) can be used simultaneously (in the sense of co-delivery). In other words, Applicants used a multiple approach, with several different sequences targeted at the same time, but independently.
[00315] A suitable example of a protocol for producing AAV, a preferred vector of the invention is provided in Example 34.
[00316] Trinucleotide repeat disorders are preferred conditions to be treated. These are also exemplified herein. [00317] For example, US Patent Publication No. 20110016540, describes use of zinc finger nucleases to genetically modify ceils, animals and proteins associated with trinucleotide repeat expansion disorders. Trinucleotide repeat expansion disorders are complex, progressive disorders that involve developmental neurobiology and often affect cognition as well as sensori-motor functions.
[00318] Trinucleotide repeat expansion proteins are a diverse set of proteins associated with susceptibility for developing a trinucleotide repeat expansion disorder, the presence of a trinucleotide repeat expansion disorder, the severity of a trinucleotide repeat expansion disorder or any combination thereof. Trinucleotide repeat expansion disorders are divided into two categories determined by the type of repeat. The most common repeat is the triplet CAG, which, when present in the coding region of a gene, codes for the amino acid gfutamine (Q). Therefore, these disorders are referred to as the polyglutamine (polyQ) disorders and comprise the following diseases: Huntington Disease (HD); Spinobulbar Muscular Atrophy (SBMA); Spinocerebellar Ataxias (SCA types 1, 2, 3, 6, 7, and 17); and Dentatorubro-Pallidoluysian Atrophy (DRPLA). The remaining trinucleotide repeat expansion disorders either do not involve the CAG triplet or the CAG triplet is not in the coding region of the gene and are, therefore, referred to as the non-polyglutamine disorders. The non-polyglutarmne disorders comprise Fragile X Syndrome (FRAXA); Fragile XE Mental Retardation (FRAXE); Friedreich Ataxia (FRDA); Myotonic Dystrophy (DM); and Spinocerebellar Ataxias (SCA types 8, and 12).
[00319] The proteins associated with trinucleotide repeat expansion disorders are typical ly selected based on an experimental association of the protein associated with a trinucleotide repeat expansion disorder to a trinucleotide repeat expansion disorder. For example, the production rate or circulating concentration of a protein associated with a trinucleotide repeat expansion disorder may be elevated or depressed in a population having a trinucleotide repeat- expansion disorder relative to a population lacking the trinucleotide repeat expansion disorder. Differences in protein levels may be assessed using proteomic techniques including but not limited to Western blot, immunohistochemicaf staining, enzyme linked immunosorbent assay (ELISA), and mass spectrometry. Alternatively, the proteins associated with trinucleotide repeat expansion disorders may be identified by obtaining gene expression profiles of the genes encoding the proteins using genomic techniques including but not limited to DNA microarray analysis, serial analysis of gene expression (S AGE), and quantitative real-time polymerase chai reaction (Q-PCR).
[00320] Non-limiti g examples of proteins associated with trinucleotide repeat expansion disorders include AR (androgen receptor), FMR1 (fragile X mental retardation 1), HTT (huntmgtin). DMPK (dystrophia myotonica-protein kinase), FXN (frataxin), ATXN2 (ataxin 2), ATN1 (atrophin 1), FEN1 (flap structure-specific endonuc lease 1), TNRC6A (trinucleotide repeat containing 6 A), PABPN 1 (poly(A) binding protein, nuclear 1), JPH3 (junctophilin 3), MED 15 (mediator complex subunit 15), ATXNl (ataxin 1), ATXN3 (ataxin 3), TBP (TATA box binding protein), CACNA 1A (calcium channel, voltage-dependent, P/Q type, alpha 1A subunit), ATXN8QS (ATXN8 opposite strand (non-protein coding)), PPP2R2B (protein phosphatase 2, regulatory subunit B, beta), ATXN7 (ataxin 7), TNRC6B (trinucleotide repeat containing 6B), TNRC6C (trinucleotide repeat containing 6C), CELF3 (CUGBP, Elav-like family member 3), MAB21 L1 (mab-21 -like I (C. elegans)), MSH2 (mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coii)), TMEM185A (transmembrane protein 185 A), SIX5 (SIX homeobox 5), CNPY3 (canopy 3 homolog (zebrafish)), FRAXE (fragile site, folic acid type, rare, fra(X)(q28) E), GNB2 (guanine nucleotide binding protein (G protein), beta polypeptide 2), RPL14 (ribosomal protein L14), ATXN8 (ataxin 8), INSR (insulin receptor), TTR (transthyretin), EP400 (El A binding protein p400), GIGYF2 (GRB10 interacting GYF protein 2), OGG1 (8-oxoguanine DNA glycosylase), STCl (stanniocalcin 1), CNDPl (carnosine dipeptidase 1 (metallopeptidase M20 family)), ClOorfZ (chromosome 10 open reading frame 2), MAML3 mastermind -like 3 (Drosophiia), D C1 (dyskeratosis congenita 1, dyskerin), PAXIP1 (PAX interacting (with transcription-activation domain) protein 1 ), CAS (calcium/calmodulin-dependent serine protein kinase (MAGUK family)), MAPT (microtubule-associated protein tau), S l (S l transcription factor), POLG (polymerase (DNA directed), gamma), AFF2 (AF4/FMR2 family, member 2), THBS1 (thrombospondin 1 ), TP53 (tumor protein p53), ESR l (estrogen receptor 1 ), CGGBP1 (CGG triplet repeat binding protein 1), ABT1 (activator of basal transcription 1), KLK3 (kailikrein-reiated peptidase 3), PRNP (prion protein), JUN (jun oncogene), KCXN (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 3), BAX (BCL2-associated X protein), FRAXA (fragile site, folic acid type, rare, fra(X)(q27.3) A (macroorchidism, mental retardation)), KBTBDIQ (kelch repeat and BTB (POZ) domain containing 10), MBNLi (muscleblind-iike (Drosophiia)), RAD51 (RAD51 homolog (RecA homolog, E, coli) (S. cerevisiae)), NCOA3 (nuclear receptor coactivator 3), ERDA1 (expanded repeat domain, CAG/CTG 1), TSC1 (tuberous sclerosis 1), COMP (cartilage oligomeric matrix protein), GCLC (glutamate-cysteine ligase, catalytic subunit), RRAD (Ras-related associated with diabetes), SH3 (mutS homolog 3 (E. coli)), DRD2 (dopamine receptor D2), CD44 (CD44 molecule (Indian blood group)), CTCF (CCCTC-binding factor (zinc finger protein)), CCND1 (eye fin Dl ), CLSPN (claspin homolog (Xenopus laevis)), MEF2A (myocyte enhancer factor 2A), PTPRU (protein tyrosine phosphatase, receptor type, U), GAPDH (glyceraidchyde-3- phosphate dehydrogenase), TRXM22 (tripartite motif-containing 22), WT1 (Wilms tumor 1). AHR (aryl hydrocarbon receptor), GPX1 (glutathione peroxidase 1), TPMT (thiopurine S- methyltransferase), NDP (Norrie disease (pseudogiioma)), ARX (aristaless related homeobox), M l S I (MUS81 endonuclease homolog (S. cerevisiae)), TYR (tyrosinase (oculocutaneous albinism IA)), EGR1 (early growth response 1), UNG (uracil-DNA glycosylate), NUMBL (numb homolog (Drosophila)-like), FABP2 (fatty acid binding protein 2, intestinal), EN2 (engrailed homeobox 2), CRYGC (crystaliin, gamma C), SR 14 (signal recognition particle 14 kDa (homologous Alu RNA binding protein)), CRYGB (crystaliin, gamma B), PDCD1 (programmed cell death 1), eOXAl (homeobox Al ), ATXN2L (ataxin 2-like), PMS2 (PMS2 postmeiotie segregation increased 2 (S. cerevisiae)), GLA (galactosidase, alpha), CBL (Cas-Br- M (murine) ecotropic retroviral transforming sequence), FT H I (ferritin, heavy polypeptide 1), IL12RB2 (interleukin 12 receptor, beta 2), OTX2 (orthodenticle homeobox 2), HOXA5 (homeobox A5), POLG2 (polymerase (D A directed), gamma 2, accessory subunit), DLX2 (distal-less homeobox 2), SIRPA (signal-regulatory protem alpha), OTXI (orthodenticle homeobox 1 ), AHRR (aryl -hydrocarbon receptor repressor), MANF (mesencephalic astrocyte- derived neurotrophic factor), TMEM 158 (transmembrane protein 158 (gene/pseudogene)), and ENSG00000078687.
[00321 ] Preferred proteins associated with trinucleotide repeat expansion disorders include HTT (Huntingtin), AR (androgen receptor), FXN (frataxin), Atxn3 (ataxin), Atxnl (ataxin), Atxn2 (ataxin), Atxn7 (ataxin), AtxnlO (ataxin), DM (dystrophia myotonica-protein kinase), Atnl (atrophin 1), CBP (creb binding protein), VLDLR (very low density lipoprotein receptor), and any combination thereof.
[00322] According to another aspect, a method of gene therapy for the treatment of a subject having a mutation in the CFTR gene is provided and comprises administering a therapeutically effective amount of a CRISPR-Cas gene therapy particle, optionally via a biocompatible pharmaceutical carrier, to the cells of a subject. Preferably, the target DNA comprises the mutation cIeltaF5G8. In general, it is of preferred that the mutation is repaired to the wildtype. In this case, the mutation is a deletion of the three nucleotides that comprise the codon for phenylalanine (F) at position 508. Accordi gly, repair in this instance requires reiiitroduction of the missing codon into the mutant.
0Θ323] To implement this Gene Repair Strategy, it is preferred that an adenovirus/AAV vector system is introduced into the host cell, cells or patient. Preferably, the system comprises a Cas9 (or Cas9 nickase) and the guide RNA along with a adenovirus/AAV vector system comprising the homology repair template containing the F5Q8 residue. This may be introduced into the subject via one of the methods of deliver}' discussed earlier. The CRISPR-Cas system may be guided by the CFTRdelta 508 chimeric guide RNA. It targets a specific site of the CFTR genomic locus to be nicked or cleaved. After cleavage, the repair template is inserted into the cleavage site via homologous recombination correcting the deletion that results in cystic fibrosis or causes cystic fibrosis related symptoms. This strategy to direct delivery and provide systemic introduction of CRISPR systems with appropriate guide RNAs can be employed to target genetic mutations to edit or otherwise manipulate genes that cause metabolic, liver, kidney and protein diseases and disorders such as those in 1 able B.
Genome editing
[00324] The CR ISPR/Cas9 sy.si.cnr··> of the present invention can be used to correct genetic mutations that were previously attempted with limited success using TALEN and ZFN, For example, WQ2013163628 A2, Genetic Correction of Mutated Genes, published application of Duke University describes efforts to correct, for example, a frameshift mutation which causes a premature stop codon and a truncated gene product that can be corrected via nuclease .mediated non-homologous end joining such as those responsible for Duchenne Muscular Dystrophy, ("DMD") a recessive, fatal, X-linked disorder that results in .muscle degeneration due to mutations in the dystrophin gene. The majority of dystrophin mutations that cause DMD are deletions of exons that disrupt the reading frame and cause premature translation termination in the dystrophin gene. Dystrophin is a cytoplasmic protein that provides structural stability to the dystroglycan complex of the cell membrane that is responsible for regulating muscle cell integrity and function. The dystrophin gene or "DMD gene" as used interchangeably herein is 2.2 megabases at locus Xp21. The primary transcription measures about 2,400 kb with the mature mR'NA being about 14 kb. 79 exons code for the protein which is over 3500 amino acids. Exon 51 is frequently adjacent to frame-disrupting deletions in DMD patients and has been targeted in clinical trials for oligonucSeotide-based exon skipping. A clinical trial for the exon 51 skipping compound eteplirsen recently reported a significa t functional benefit across 48 weeks, with an average of 47% dystrophin positive fibers compared to baseline. Mutations in exon 51 are ideal ly suited for permanent correction by NHEJ-based genome editing.
[00325] The methods of US Patent Publication No. 20130145487 assigned to Ceilectis, which relates to meganuclease variants to cleave a target sequence from the human dystrophin gene (DMD), may also be modified to for the CRISPR Cas system of the present invention.
Blood
[00326] The present invention also contemplates delivering the CRISPR-Cas system to the blood.
[00327] The plasma exosomes of Wahlgren et ai, (Nucleic Acids Research, 2012, Vol. 40, No. 17 el30) were previously described and may be utilized to deliver the CRISPR Cas system to the blood.
[00328] The CRISPR Cas system of the present invention is also contemplated to treat hemoglobinopathies, such as thalassemias and sickle cell disease. See, e.g., International Patent Publication No. WO 2013/126794 for potential targets that may be targeted by the CRISPR Cas system of the present invention.
[00329] US Patent Publication Nos. 20110225664, 20110091441, 20100229252, 20090271881 and 20090222937 assigned to Ceilectis, relates to CREI variants , wherein at least one of the two I-Crel monomers has at least two substitutions, one in each of the two functional subdomains of the LAGLIDADG core domain situated respectively from positions 26 to 40 and 44 to 77 of I-Crel, said variant being able to cleave a DNA target sequence from the human interleukin-2 receptor gamma chain (IL2RG) gene also named common cytokine receptor gamma chain gene or gamma C gene. The target sequences identified in US Patent Publication Nos. 20110225664, 20110091441, 20100229252, 20090271881 and 20090222937 may be utilized for the CRJSPR Cas system of the present invention.
[00330] Severe Combined Immune Deficiency (SCID) results from a defect in lymphocytes T maturation, always associated with a functional defect in lymphocytes B (Cavazzana-Calvo et al, Annu. Rev. Med., 2005, 56, 585-602; Fischer et al., Immunol. Rev., 2005, 203, 98-109). Overall incidence is estimated to 1 in 75 000 births. Patients with untreated SCID are subject to multiple opportunist micro-organism infections, and do generally not live beyond one year, SCID can be treated by al logenic hematopoietic stem cell transfer, from a fami lial donor. Histocompatibility with the donor can vary widely. In the case of Adenosine Deaminase (ADA) deficiency, one of the SCID forms, patients can be treated by injection of recombinant Adenosine Deaminase enzyme.
[00331 ] Since the ADA gene has been shown to be mutated in SCID patients (Giblett et al, Lancet, 1972, 2, 1067-1069), several other genes involved in SCID have been identified (Cavazzana-Calvo et al., Annu. Rev. Med., 2005, 56, 585-602; Fischer et al., Immunol. Rev., 2005, 203, 98-109). There are four major causes for SCID: (i) the most frequent form of SCID, SCID-X1 (X-linked SCID or X-SCID), is caused by mutation in the IL2RG gene, resulting in the absence of mature T lymphocytes and NK. cells. IL2RG encodes the gamma C protein (Noguchi, et al., Cell, 1993, 73, 147-157), a common component of at least five interleukiii receptor complexes. These receptors activate several targets through the J AO kinase (Macchi et al., Nature, 1995, 377, 65-68), which inactivation results in the same syndrome as gamma C inactivation; (ii) mutation in the ADA gene results in a defect in purine metabolism that is lethal for lymphocyte precursors, which in turn results in the quasi absence of B, T and NK cells; (iii) V(D)J recombination is an essential step in the maturation of immunoglobulins and T lymphocytes receptors (TCl s). Mutations in Recombination Activating Gene 1 and 2 (RAG 1 and RAG2) and Artemis, three genes involved in this process, result in the absence of mature T and B lymphocytes; and (iv) Mutations in other genes such as CD45, involved in T cell specific signaling have also been reported, although they represent a minority of cases (Cavazzana-Calvo et al., Annu. Rev. Med., 2005, 56, 585-602; Fischer et al, Immunol . Rev., 2005, 203, 98-109).
[003321 Since when their genetic bases have been identified, the different SCID forms have become a paradigm for gene therapy approaches (Fischer et al., Immunol. Rev., 2005, 203, 98- 109) for two major reasons. First, as in all blood diseases, an ex vivo treatment can be envisioned. Hematopoietic Stem Ceils (HSCs) can be recovered from bone marrow, and keep their piuripotent properties for a few cell divisions. Therefore, they can be treated in vitro, and then reinjected into the patient, where they repopulate the bone marrow. Second, since the maturation of lymphocytes is impaired in SCID patients, corrected cells have a selective advantage. Therefore, a small number of corrected cells can restore a functional immune system. This hypothesis was validated several times by (i) the partial restoration of immune functions associated with the reversion of mutations in SCID patients (Hirschhorn et al., Nat. Genet., 1996, 13, 290-295; Stephan et al, N, Engl. J. Med., 1996, 335, 1563-1567; Bousso et al, Proc. Natl, Acad. Sci. USA, 2000, 97, 274-278; Wada et al., Proc. Natl Acad. Sci. USA, 2001, 98, 8697- 8702; Nishikomori et al., Blood, 2004, 103, 4565-4572), (ii) the correction of SCID-X 1 deficiencies in vitro in hematopoietic ceils (Candotti et al, Blood, 1996, 87, 3097-3102; Cavazzana-Caivo et al, Blood, 1996, Blood, 88, 3901-3909; Taylor et al, Blood, 1996, 87, 3103-3 107; Hacein-Bey et al, Blood, 1998, 92, 4090-4097), (iii) the correction of SCID-X1 (Soudais et al., Blood, 2000, 95, 3071-3077; Tsai et al., Blood, 2002, 100, 72-79), JA -3 (Bunting et al, Nat. Med., 1998, 4, 58-64; Bunting et al., Hum. Gene Ther., 2000, 1 1 , 2353- 2364) and RAG2 (Yates et al., Blood, 2002, 100, 3942-3949) deficiencies in vivo in animal models and (iv) by the result of gene therapy clinical trials (Cavazzana-Caivo et al., Science, 2000, 288, 669-672; Aiuti et al., Nat. Med., 2002; 8, 423-425; Gaspar et al, Lancet, 2004, 364, 2181-2187).
[00333 S US Patent Publication No. 20110182867 assigned to the Children's Medical Center Corporation and the President and Fellows of Harvard College relates to methods and uses of modulating fetal hemoglobin expression (HbF) in a hematopoietic progenitor cells via inhibitors of BCL11A expression or activity, such as R Ai and a tibodies. The targets disclosed in US Patent Publication No. 201 101 82867, such as BCL11A, may be targeted by the CRJSPR Cas system of the present invention for modulating fetal hemoglobin expression. See also Bauer et al (Science 11 October 2013: Vol 342 no. 6155 pp. 253-257) and Xu et al. (Science 18 November 2011 : Vol. 334 no. 6058 pp. 993-996) for additional BCL11A targets.
Ears
[00334] The present invention also contemplates delivering the CRISPR-Cas system to one or both ears.
[00335] Researchers are looking into whether gene therapy could be used to aid current deafness treatments— namely, cochlear implants. Deafness is often caused by lost or damaged hair cells that cannot relay signals to auditor}' neurons. In such cases, cochlear implants may be used to respond to sound and transmit electrical signals to the nerve cells. But these neurons often degenerate and retract from the cochlea as fewer growth factors are released by impaired hair cells.
[00336] US patent application 20120328580 describes injection of a pharmaceutical composition into the ear (e.g., auricular administration), such as into the luminae of the cochlea (e.g., the Scala media, Sc vestibulae, and Sc tympani), e.g., using a syringe, e.g., a single-dose syringe. For example, one or more of the compounds described herein can be administered by intratympanic injection (e.g., into the middle ear), and/or injections into the outer, middle, and/or inner ear. Such methods are routinely used in the art, for example, for the administration of steroids and antibiotics into human ears. Injection can be, for example, through the round window of the ear or through the cochlear capsule. Other inner ear administration methods are known in the art (see, e.g., Salt and Plontke, Drug Discovery Today, 10: 1299-1306, 2005).
[00337] In another mode of administratio , the pharmaceutical composition can be administered in situ, "via a catheter or pump. A catheter or pump can, for example, direct a pharmaceutical composition into the cochlear luminae or the round window of the ear and/or the lumen of the colon. Exemplary drug delivery apparatus and methods suitable for administering one or more of the compounds described herein into an ear, e.g., a human ear, are described by McKenna et al., (U.S. Publication No. 2006/0030837) and Jacobsen et al., (U.S. Pat. No. 7,206,639). In some embodiments, a catheter or pump can be positioned, e.g., in the ear (e.g., the outer, middle, and/or i ner ear) of a patient during a surgical procedure. In some embodiments, a catheter or pump can be positioned, e.g., in the ear (e.g., the outer, middle, and/or inner ear) of a patient without the need for a surgical procedure.
[00338] Alternatively or in addition, one or more of the compounds described herein can be administered in combination with a mechanical device such as a cochlear implant or a hearing aid, which is worn in the outer ear. An exemplary cochlear implant that is suitable for use with the present invention is described by Edge et al., (U.S. Publication No. 2007/0093878).
[00339] In some embodiments, the modes of administration described above may be combined in any order and can be simultaneous or interspersed.
[00340] Alternatively or in addition, the present invention may be administered according to any of the Food and Drug Administration approved methods, for example, as described in CDER Data Standards Manual, version number 004 (which is available at fda.give/cder/dsm DRG/drg00301.htm). [00341] In general, the cell therapy methods described in US patent application 20120328580 can be used to promote complete or partial d fferentiation of a cell to or towards a mature cell type of the inner ear (e.g., a hair cell) in vitro. Cells resulting from such methods can then be transplanted or implanted into a patient in need of such treatment. The cell culture methods required to practice these methods, including methods for identifying and selecting suitable cell types, methods for promoting complete or partial differentiation of selected cel ls, methods for identifying complete or partially differentiated cell types, and methods for implanting complete or partially differentiated cells are described below.
[00342] Cells suitable for use in the present invention include, but are not limited to, cells that are capable of differentiating completely or partially into a mature cell of the inner ear, e.g., a hair cel l (e.g., an inner and/or outer hair cel l), when contacted, e.g., in vitro, with one or more of the compounds described herein. Exemplary cells that are capable of differentiating into a hair cel l include, but are not limited to stem cells (e.g., inner ear stem cells, adult stem cells, bone marrow derived stem cells, embryonic stem cells, mesenchymal stem cells, skin stem cells, iPS cells, and fat derived stem cells), progenitor cells (e.g., inner ear progenitor cells), support cells (e.g., Deiters' cells, pillar ceils, inner phalangeal cells, tectal cells and Hansen's cells), and/or germ cells. The use of stem cells for the replacement of inner ear sensory cells is described in Li et al, (U.S. Publication No. 2005/0287127) and Li et al, (U.S. patent Ser. No. 11/953,797). The use of bone marrow derived stem cells for the replacement of inner ear sensor}.' cells is described in Edge et al, PCT/US2007/084654. IPS cells are described, e.g., at Takahashi et al., Ceil, Volume 131, Issue 5, Pages 861-872 (2007); Takahashi and Yamanaka, Cell 126, 663-76 (2006); Okita et al, Nature 448, 260-262 (2007); Yu, J. et al, Science 318(5858):! 917-1920 (2007); Nakagawa et al, Nat. Biotechnol. 26:101-106 (2008); and Zaehres and Scholer, Cell 131(5):834- 835 (2007).
[003431 Such suitable cells can be identified by analyzing (e.g., qualitatively or quantitatively) the presence of one or more tissue specific genes. For example, gene expression can be detected by detecting the protein product of one or more tissue-specific genes. Protein detection techniques involve staining proteins (e.g., using cell extracts or whole cells) using antibodies against the appropriate antigen. In this case, the appropriate antigen is the protein product of the tissue-specific gene expression. Although, in principle, a first antibody (i.e., the antibody that binds the antigen) can be labeled, it is more common (and improves the visualization) to use a second antibody directed against the first (e.g., an anti-IgG). This second antibody is conjugated either with fluorochromes, or appropriate enzymes for coiorimetric reactions, or gold beads (for electron microscopy), or with the biotin-avidin system, so that the location of the primary antibody, and thus the antigen, can be recognized.
[00344] The CR1SPR Cas molecules of the present invention may be delivered to the ear by direct application of pharmaceutical composition to the outer ear, with compositions modified from US Published application, 201 10142917. In some embodiments the pharmaceutical composition is applied to the ear canal. Delivery to the ear may also be refered to as aural or otic delivery.
[00345] In some embodiments the RNA molecules of the invention are delivered in liposome or !ipofectirs formulations and the like and can be prepared by methods well known to those skilled in the art. Such methods are described, for example, in U.S. Pat. Nos. 5,593,972, 5,589,466, and 5,580,859, which are herein incorporated by reference.
[00346] Delivery systems aimed specifically at the enhanced and improved delivery of siRNA into mammalian cells have been developed, (see, for example, Shen et al FEBS Let. 2003, 539: 1 1 1-114; Xia et al, Nat. Biotech. 2002, 20: 1006- 1010; Reich et al., Mol. Vision. 2003, 9: 210-216; Sorensen et al., J. Mol. Biol. 2003, 327: 761-766; Lewis et al, Nat. Gen. 2002, 32; 107- 108 and Simeoni et al, NAR 2003, 3 1 , 11 : 2717-2724) and may be applied to the present invention, siRNA has recently been successfully used for inhibition of gene expression in primates (see for example. Tolentino et al,, Retina 24(4) :660 which may also be applied to the present invention.
[00347] Qi et al. discloses methods for efficient siRNA transfeetion to the inner ear through the intact round window by a novel proteidic delivery technology which may be applied to the CRISPR Cas system of the present invention (see, e.g., Qi et al, Gene Therapy (2013), 1-9). In particular, a TAT double stranded RNA-binding domains (TAT-DRBDs), which can transfect Cy3-!abeled siRNA. into cells of the inner ear, including the inner and outer hair cells, crista ampullaris, macula utriculi and macula saeculi, through intact round-window permeation was successful for delivering double stranded siRNAs in vivo for treating various inner ear ailments and preservation of hearing function. About 40 μΐ of lOmM RNA may be contemplated as the dosage for administration to the ear. [00348] According to Rejaii et al. (Hear Res, 2007 Jun;228(l -2): 180-7), cochlear implant function can be improved by good preservation of the spiral ganglion neurons, which are the target of electrical stimulation by the implant and brain derived neurotrophic factor (BDNF) has previously been shown to enhance spiral ganglion survival in experimentally deafened ears. Rejaii et al. tested a modified design of the cochlear implant electrode that includes a coating of "fi broblast cel ls transduced by a viral vector with a BDNF gene insert. To accomplish this type of ex vivo gene transfer, Rejaii et al. transduced guinea pig fibroblasts with an adenovirus with a BDNF gene cassette insert, and determined that these cells secreted BDNF and then attached BDNF-secreting cells to the cochlear implant electrode via an agarose gel, and implanted the electrode in the scala tympani. Rejaii et al. determined that the BDNF expressing electrodes were able to preserve significantl more spiral ganglion neurons in the basal turns of the cochlea after 48 days of implantation when compared to control electrodes and demonstrated the feasibility of combining cochlear implant therapy with ex vivo gene transfer for enhancing spiral ganglion neuron survival. Such a system may be applied to the CRISPR Cas system of the present invention for delivery to the ear.
[003491 Mukherjea et al. (Antioxidants & Redox Signaling, Volume 13, Number 5, 2010) document that knockdown of NQX3 using short interfering (si) RNA abrogated cisplatin ototoxicity, as evidenced by protection of OHCs from damage and reduced threshold shifts in auditory brainstem responses (ABRs). Different doses of siNOX3 (0.3, 0.6, and 0.9 fig) were administered to rats and NOX3 expression was evaluated by real time RT-PCR, The lowest dose of NOX3 siRNA used (0.3 iig) did not show any inhibition of NOX3 mRNA when compared to transtympanic administration of scrambled siRNA or untreated cochleae. However, administration of the higher doses of NOX3 siRNA (0.6 and 0.9 μg) reduced NOX3 expression compared to control scrambled siRNA. Such a system may be applied to the CRISPR Cas system of the present invention for transtympanic administration with a dosage of about 2 mg to about 4 mg of CRISPR Cas for administratio to a human.
[00350] Jung et al. ( Molecular Therapy, vol 21 no. 4, 834-841 apr. 2013) demonstrate that Hes5 levels in the utricle decreased after the application of siRNA and that the number of hair cells in these utricles was significantly larger than following control treatment. The data suggest that siRNA technology may be useful for inducing repair and regeneration in the inner ear and that the Notch signaling pathway is a potentially useful target for specific gene expression inhibition. Jung et al. injected 8 μ§ of Hes5 siRNA in 2 μ! volume, prepared by adding sterile normal saline to the lyophilized siRNA to a vestibular epithelium of the ear. Such a system may be applied to the CRISPR Cas system of the present invention for administration to the vestibular epithelium of the ear with a dosage of about 1 to about 30 mg of CRISPR Cas for administration to a human.
Eyes
[003511 The present invention also contemplates delivering the CRISPR-Cas system to one or both eyes.
[00352] In yet another aspect of the invention, the CRISPR-Cas system may be used to correct ocular defects that arise from several genetic mutations further described in Genetic Diseases of the Eye, Second Edition, edited by Elias I. Traboulsi, Oxford University Press, 2012.
[00353] For administration to the eye, lentiviral vectors, in particular equine infectious anemia viruses ( EJAV) are particularly preferred.
[00354] In another embodiment, minimal non-primate lentiviral vectors based on the equine infectious anemia virus (E1AV) are also contemplated, especially for ocular gene therapy (see, e.g., Balagaan, J Gene Med 2006; 8: 275 - 285, Published online 21 November 2005 in Wiley InterScience (www.interscience.wiley.com). DOI: 10.1002/jgm.845). The vectors are contemplated to have cytomegalovirus (CMV) promoter driving expression of the target gene. Intracameral, subretinal, intraocular and intravitreal injections are all contemplated (see, e.g., Balagaan, .1 Gene Med 2006; 8: 275 - 285, Published online 21 November 2005 in Wiley InterScience (www.interscience.wiley.com). DOI: 10.1002/jgm.845). Intraocular injections may be performed with the aid of an operating microscope. For subretinal and intravitreal injections, eyes may be prolapsed by gentle digital pressure and fundi visualised using a contact lens system consisting of a drop of a coupling medium solution on the cornea covered with a glass microscope slide coverslip. For subretinal injections, the tip of a I Q-mm 34-gauge needle, mounted on a 5-μ1 Hamilton syringe may be advanced under direct visualisation through the superior equatorial sclera tangential ly towards the posterior pole until the aperture of the needle was visible in the subretinal space. Then, 2 μΐ of vector suspension may be injected to produce a superior bullous retinal detachment, thus confirming subretinal vector admin stration. This approach creates a self-sealing sclerotomy allowing the vector suspension to be retained in the subretinal space until it is absorbed by the RPE, usually within 48 h of the procedure. This procedure may be repeated in the interior hemisphere to produce an inferior retinal detachment. This technique results in the exposure of approximately 70% of neurosensory retina and RPE to the vector suspension. For intr vitreal injections, the needle tip may be advanced through the sclera 1 mm posterior to the corneoscleral limbus and 2 μΐ of vector suspension injected into the vitreous cavity. For intracameral injections, the needle tip may be advanced through a corneoscleral limbal paracentesis, directed towards the central cornea, and 2 μΐ of vector suspension may be injected. For intracameral injections, the needle tip may be advanced through a corneoscleral limbal paracentesis, directed towards the central cornea, and 2 μΐ of vector suspension may be injected. These vectors may be injected at titres of either 1.0-1.4 x 10'° or 1.0-1.4 x 109 transducing units (TU)/ml.
[00355] In another embodiment, RetinoStat®, an equine infectious anemia virus-based lentiviral gene therapy vector that expresses angiostatic proteins endostain and angiostatin that is delivered via a subretinal injection for the treatment of the web form of age-related macular degeneration is also contemplated (see, e.g., Binley et al, HUMAN GENE THERAPY 23:980- 991 (September 2012)). Such a vector may be modified for the C ISPR-Cas system of the present invention. Each eye may be treated with either RctinoStat® at a dose of 1.1 x 103 transducing units per eye (TU/eye) in a total volume of 100 μΐ.
[00356] In another embodiment, an E 1 -, partial E3-, E4-deIeted adenoviral vector may be contemplated for delivery to the eye. Twenty-eight patients with advanced neovaseular age- related macular degeneration (AMD) were given a single intravitreous injection of an E1 -, partial E3-, E4-deleted adenoviral vector expressing human pigment ep- itheiium-derived factor (AdPEDF.ll) (see, e.g., Campochiaro et al,, Human Gene Therapy 17: 167-176 (Februan' 2006)). Doses ranging from 106 to 109'5 particle units (PU) were investigated and there were no serious adverse events related to AdPEDF.ll and no dose-limiting toxicities (see, e.g., Campochiaro et al., Human Gene Therapy 17: 167-176 (February 2006)). Adenoviral vector- mediated ocular gene transfer appears to be a viable approach for the treatment of ocular disorders and could be applied to the CRISPR Cas system.
[00357] In another embodiment, the sd-rxRNA® system of RXi Pharmaceuticals may be used/and or adapted for delivering CRISPR Cas to the eye. in this system, a single intravitreal administration of 3 μg of sd-rxRNA results in sequence-specific reduction of PPIB mRNA levels for 14 days. The the sd-rxRNA® system may be applied to the CRISPR. Cas system of the present invention, contemplating a dose of about 3 to 20 mg of CRISPR administered to a human.
[00358] Miilington-Ward et al. (Molecular Therapy, vol. 19 no. 4, 642-649 apr. 2011) describes adeno-associated vims (AAV) vectors to deliver an RNA interference (RNAi)-based riiodopsin suppressor a d a codon-modified rhodopsin replacement gene resista t to suppression due to nucleotide alterations at degenerate positions over the RNAi target site. An injection of either 6.0 x 106 vp or 1.8 x 10'° vp AAV were subretinaliy injected into the eyes by Millington- Ward et al. The AAV vectors of Miilington-Ward et al. may be applied to the CRISPR Cas system of the present invention, contemplating a dose of about 2 x 10f 1 to about 6 x 10L' vp administered to a human.
[00359] Dalkara et al. (Sci Transl Med 5, 189ra76 (2013)) also relates to in vivo directed evolutio to fashion an AAV vector that delivers wild-type versio s of defective genes throughout the retina after noninjurious injection into the eyes' vitreous humor. Dalkara describes a a 7mer peptide display library and an AAV library constmcted by DNA shuffling of cap genes from AAVl, 2, 4, 5, 6, 8, and 9. The rcAAV libraries and r.AAV vectors expressing GFP under a CAG or Rho promoter were packaged and and deoxyribomiclease-resistant genomic titers were obtained through quantitative PGR. The libraries were pooled, and two rounds of evolution were performed, each consisting of initial library diversification followed by three in vivo selection steps. In each such step, P30 rho-GFP mice were intravitrealiy injected with 2 ml of iodixanol-purified, phosphate-buffered saline (PBS)-dialyzed library with a genomic titer of about 1 x 101" vg/ml. The AAV vectors of Dalkara et al. may be applied to the CRI SPR Cas system of the present invention, contemplating a dose of about 1 x 10° to about 1 x 10i6 vg/ml administered to a human.
[00360] In another embodiment, the rhodopsin gene may be targeted for the treatment of retinitis pigmentosa (RP), wherein the system of US Patent Publication No. 20120204282 assigned to Sangamo Biosciences, Inc. may be modified in accordance of the CRISPR Cas system of the present invention.
[00361] In a other embodiment, the methods of US Patent Publication No. 20130183282 assigned to Cellectis, which is directed to methods of cleaving a target sequence from the human rhodopsin gene, may also be modified to the CRISPR Cas system of the present invention. [00362] US Patent Publication No. 20130202678 assigned to Academia Sinica relates to methods for treating retinopathies and sight-threatening ophthalmologic disorders relating to delivering of the Puf-A gene (which is expressed in retinal ganglion and pigmented cells of eye tissues and displays a unique anti-apoptotic activity) to the sub-retinal or intravitreal space in the eye. In particular, desirable targets are zgc: 193933, prdmla, spata2, texlO, rbb4, ddx3, zp2.2, Blimp- 1 and HtrA2, all of which may be targeted by the CRISPR Cas system of the present invention.
[00363] Wu (Cell Stem Cell, 13 :659-62, 2013) designed a guide RNA that led Cas9 to a single base pair mutation that causes cataracts in mice, where it induced DNA cleavage. Then using either the other wild-type allele or oligos given to the zygotes repair mechanisms corrected the sequence of the broken al lele and corrected the cataract-causing genetic defect in mutant mouse.
[00364] US Patent Publication No. 20120159653, describes use of zinc finger nucleases to genetically modify cel ls, animals and proteins associated with macular degeration (MD). Macular degeneration (MD) is the primary cause of visual impairment in the elderly, but is also a hallmark symptom of childhood diseases such as Stargardt disease, Sorsby fundus, and fatal childhood neurodegenerative diseases, with an age of onset as young as infancy. Macular degeneration results in a loss of vision in the center of the visual field (the macula) because of damage to the retina. Currently existing animal models do not recapitulate major hallmarks of the disease as it is observed in humans. The available animal models comprising mutant genes encoding proteins associated with MD also produce highly variable phenotypes, making translations to human disease and therapy development problematic.
[CI0365] One aspect of US Patent Publication No. 20120159653 relates to editing of any chromosomal sequences that encode proteins associated with MD which may be applied to the CRISPR Cas system of the present invention. The proteins associated with MD are typically selected based on an experimental association of the protein associated with MD to an MD disorder. For example, the production rate or circulating concentration of a protein associated with D may be elevated or depressed in a population having an MD disorder relative to a population lacking the MD disorder. Differences in protein levels may be assessed using proteomic techniques including but not limited to Western blot, immunohistochemical staining, enzyme linked immunosorbent assay (ELISA), and mass spectrometry. Alternatively, the proteins associated with MD may be identified by obtaining gene expression profiles of the genes encoding the proteins using genomic techniques including but not limited to DNA microarray analysis, serial analysis of gene expression (SAGE), and quantitative real-time polymerase chain reaction (Q-PCR).
[00366] By way of non-limiting example, proteins associated with MD include but are not limited to the following proteins: (ABCA4) ATP-binding cassette, sub-family A (ABC1), member 4 ACH 1 achromatopsia (rod monochromacy) 1 ApoE Apolipoprotein E (ApoE) C1 QTNF5 (CTRP5) Clq and tumor necrosis factor related protein 5 (C 1QTNF5) C2 Complement component 2 (C2) C3 Complement components (C3) CCL2 Chemokine (C-C motif) Ligand 2 (CCL2) CCR2 Chemokine (C-C motif) receptor 2 (CCR2) CD36 Cluster of Differentiation 36 CFB Complement factor B CFH Complement factor CFH H CFHR1 complement factor H-related 1 CFHR3 complement factor H -related 3 C GB3 cyclic nucleotide gated channel beta 3 CP cemioplasmin (CP) CRP C reactive protein (CRP) CST3 cystatin C or cystatin 3 (CST3) CTSD Cathepsin D (CTSD) CX3CR1 chemoldne (C-X3-C motif) receptor 1 ELOVL4 Elongation of very long chain fatty acids 4 ERCC6 excision repair cross- complementing rodent repair deficiency, complementation group 6 FBLN5 Fibulin-5 FBLN5 Fibuiin 5 FBLN6 Fibulm 6 FSCN2 fascin (FSCN2) HMCNl Hemicentrin 1 HMCNl hemicentin I HTRA1 FItrA serine peptidase 1 (HTRA1 ) FITRA! HtrA serine peptidase 1 I F -6 Interleukin 6 IL-8 Interleukin 8 LOC387715 Hypothetical protein PLEKHA l Pleckstrin homology domain- containing family A member 1 (PLEKHAl) PROMl Prominin 1 (PROMl or CD133) PRPH2 Peripheri.n-2 RPGR retinitis pigmentosa GTPase regulator SERPINOl serpin peptidase inhibitor, clade G, member 1 (CI- inhibitor) TCOF1 Treacle TIMP3 Metalloproteinase inhibitor 3 (TTMP3) TLR3 Toil-like receptor 3
[00367] The identity of the protein associated with MD whose chromosomal sequence is edited can and will vary. In preferred embodiments, the proteins associated with MD whose chromosomal sequence is edited may be the ATP-binding cassette, sub-family A (ABC1) member 4 protein (ABCA4) encoded by the ABCR gene, the apolipoprotein E protein (APOE) encoded by the APOE gene, the chemokine (C-C motif) Ligand 2 protei (CCL2) encoded by the CCL2 gene, the chemokine (C-C motif) receptor 2 protein (CCR2) encoded by the CCR2 gene, the cemioplasmin protein (CP) encoded by the CP gene, the cathepsin D protein (CTSD) encoded by the CTSD gene, or the metalloproteinase inhibitor 3 protein (TIMP3) encoded by the T MP3 gene. In an exemplary embodiment, the genetically modified animal is a rat, and the edited chromosomal sequence encoding the protein associated with MD may be: (ABCA4) ATP- binding cassette, NM_000350 sub-family A (ABCl ), member 4 APOE Apoiipoprotein E NM 138828 (APOE) CCL2 Chemokine (C-C NM 031530 motif) Ligand 2 (CCL2) CCR2 Chemokine (C-C NM_021 S66 motif} receptor 2 (CCR2) CP ceruiopiasmin (CP) NMJ312532 CTSD Cathepsin D (CTSD) NM 134334 TIMP3 Metalloprotemase NM 012886 inhibitor 3 (TIMP3) The animal or cell may comprise 1, 2, 3, 4, 5, 6, 7 or more disrupted chromosomal sequences encoding a protein associated with MD and zero, 1 , 2, 3, 4, 5, 6, 7 or more chromosomally integrated sequences encoding the disrupted protein associated with MD.
[00368] The edited or integrated chromosomal sequence may be modified to encode an altered protein associated with MD. Several mutations in MD-related chromosomal sequences have been associated with MD. Non-limiting examples of mutations in chromosomal sequences associated with MD include those that may cause MD i cluding in the ABCR protein, E471 (i.e. glutamate at position 471 is changed to lysine), Rl 129L (i.e. arginine at position 1129 is changed to leucine), T1428M (i.e. threonine at position 1428 is changed to methionine), R1517S (i.e. arginine at position 1517 is changed to serine), I1562T (i.e. isoleucine at position 1562 is changed to threonine), and G1578R (i.e. glycine at position 1578 is changed to arginine); in the CCR2 protein, V64I (i.e. valine at position 192 is changed to isoleucine); in CP protein, G969B (i.e. glycine at position 969 is changed to asparagine or aspartate); in ΊΊΜΡ3 protein, S156C (i.e. serine at position 156 is changed to cysteine), G166C (i.e. glycine at position 166 is changed to cysteine), G167C (i.e. glycine at position 167 is changed to cysteine), Y168C (i.e. tyrosine at position 168 is cha ged to cysteine), S170C (i.e. serine at position 170 is changed to cysteine), YT72C (i.e. tyrosine at position 172 is changed to cysteine) and S1 81C (i.e. serine at position 181 is changed to cysteine). Other associations of genetic variants in MD-associated genes and disease are known in the art.
Heart
[00369] The present invention also contemplates delivering the CRISPR-Cas system to the heart. For the heart, a myocardium tropic adena-assoeiated vims (AAVM) is preferred, in particular AAVM41 which showed preferential gene transfer in the heart (see, e.g., Lin-Yanga et ai., PNAS, March 10, 2009, vol. 106, no. 10). Administration may be systemic or local. A dosage of about 1-10 x 10' ' vector genomes are contemplated for systemic administration. See also, e.g., Eulalio et al. (2012) Nature 492: 376 and Somasuntharam et al. (2013) Biomaterials 34: 7790. [00370] For example, US Patent Publication No. 20110023139, describes use of zinc finger nucleases to genetically modify cells, animals and proteins associated with cardiovascular disease. Cardiovascular diseases generally include high blood pressure, heart attacks, heart failure, and stroke and TLA.. Any chromosomal sequence involved in cardiovascular disease or the protein encoded by any chromosomal sequence involved in cardiovascular disease may be utilized in the methods described in this disclosure. The cardiovascular-re Sated proteins are typically selected based on an experimental association of the cardiovascular-related protein to the development of cardiovascular disease. For example, the production rate or circulating concentration of a cardiovascular-related protein may be elevated or depressed in a population having a cardiovascular disorder relative to a population lacking the cardiovascular disorder. Differences in protein levels may be assessed using proteomic techniques including but not limited to Western blot, immunohistochemical staining, enzyme linked immunosorbent assay (ELISA), and mass spectrometry. Alternatively, the cardiovascular-related proteins may be identified by obtaining gene expression profiles of the genes encoding the proteins using genomic techniques including but not limited to DNA microarray analysis, serial analysis of gene expression (SAGE), and quantitative real-time polymerase chain reaction (Q-PCR).
[00371] By way of example, the chromosomal sequence may comprise, but is not limited to, IL1B (interieukin 1, beta), XDH (xanthine dehydrogenase), TP53 (tumor protein p53), PTG1S (prostaglandin 12 (prostacyclin) synthase), MB (myoglobin), IL4 (interieukin 4), ANGPT1 (angiopoietin 1 ), ABCG8 (ATP-bindmg cassette, sub-family G (WHITE), member 8), CTSK (cathepsiii K), PTGIR (prostaglandin 12 (prostacyclin) receptor (IP)), CNJ11 (potassium inwardly-rectifying channel, subfamily J, member 1 1), INS (insulin), CRP (C -reactive protein, pentraxm-related), PDGFRB (platelet-derived growth factor receptor, beta polypeptide), CCNA2 (cyclin A2), PDGFB (platelet -derived growth factor beta polypeptide (simian sarcoma viral (v- sis) oncogene homolog)), CNJ5 (potassium inwardly-rectifying channel, subfamily J, member 5), KCNN3 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 3), CAPN1 Q (calpam 10), PTGES (prostaglandin E synthase), ADRA2B (adrenergic, alpha-2B-, receptor), ABCG5 (ATP-binding cassette, sub-family G (WHITE), member 5), PRDX2 (peroxiredoxin 2), CAP 5 (calpain 5), PARP14 (poly (ADP-ribose) polymerase family, member 14), MEX3C (mex-3 homolog C (C. elegans)), ACE angiotensin I converting enzyme (peptidyl-dipeptidase A) I), TNF (tumor necrosis factor (TNF superfamily, member 2)), IL6 (interleukin 6 (interferon, beta 2)), STN (statin), SERPINEl (serpin peptidase inhibitor, clade E (nexin, plasminogen activator mhibitor type 1), member 1), ALB (albumin), ADIPOQ (adiponectin, C1Q and collagen domain containing), APOB (apolipoprotein B (including Ag(x) antigen)), APOE (apo lipoprotein E), LEP (leptin), MTHFR (5,10-methy!enetetrahydrofolate reductase (NADPH)), APOAl (apolipoprotein A-I), EDN1 (endothelin 1), NPPB (natriuretic peptide precursor B), NOS3 (nitric oxide synthase 3 (endothelial cell)), PPARG (peroxisome proliferator-activated receptor gamma), PLAT (plasminogen activator, tissue), PTGS2 (prostagiandin-endoperoxide synthase 2 (prostaglandin G/B synthase and cyclooxygenase)), CETP (eholesteryi ester transfer protein, plasma), AGTR1 (angiotensin 11 receptor, type 1), HMGCR (3-hydroxy-3-methylglutaryl-Coenzyme A. reductase), IGF1 (insulin-like growth factor 1 (somatomedin C)), SELE (selectin E), REN (renin), PPARA (peroxisome proliferator-activated receptor alpha), PON1 (paraoxoiiase 1), KNG1 (kininogen 1), CCL2 (chemokine (C-C motif) ligand 2), LPL (lipoprotein lipase), VWF (von Willebrand factor), F2 (coagulation factor II (thrombin)), ICAM1 (intercellular adhesion molecule 1), TGFB1 (transforming growth factor, beta 1), NPPA (natriuretic peptide precursor A), ILIO (interleukin 10), EPO (erythropoietin), SOD1 (superoxide dismutase 1, soluble), VCAM 1 (vascular cell adhesion molecule 1), IFNG (interferon, gamma), LPA (lipoprotein, Lp(a)), MPO (myeloperoxidase), ESR1 (estrogen receptor 1 ), MAP 1 (mitogen-activated protein kinase 1 ), HP (haptoglobin), F3 (coagulation factor III (thromboplastin, tissue factor)), CST3 (cystatin C), COG2 (component of oligomeric golgi complex 2), MMP9 (matrix metailopeptidase 9 (gelatinase B, 92 kDa gelatinase, 92 kDa type IV eollagenase)), SERPINC1 (serpin peptidase inhibitor, clade C (antithrombin), member 1), F8 (coagulation factor VI 11, procoagulant component), HMOX1 (heme oxygenase (decycling) 1 ), APOC3 (apolipoprotein C-III), 1L8 (interleukin 8), PROK1 (prokinetiem 1), CBS (cystathionine-beta-synthase), NOS2 (nitric oxide synthase 2, inducible), TLR4 (toll-like receptor 4), SELF (selectin P (granule membrane protein 140 kDa, antigen ( 1)62 ;· ). ABCA l (ATP -binding cassette, sub-family A (ABC!), member 1), AGT (angiotensinogen (serpin peptidase inhibitor, clade A, member 8)), LDLR (low density lipoprotein receptor), GPT (glutamic-pyruvate transaminase (alanine aminotransferase)), VEGFA (vascular endothelial growth factor A), R3C2 (nuclear receptor subfamily 3, group C, member 2), IL1 8 (inter!eukirs 18 (interferon-gamma-inducing factor)), NOS1 (nitric oxide synthase 1 (neuronal)), NR3C1 (nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)), FGB (fibrinogen beta chain), GF (hepatocyte growth factor (hepapoietin A; scatter factor)), ILIA (interleukin 1, alpha), RETN (resistin), Λ ΊΊ (v-akt murine thymoma viral oncogene homo log 1 ), LIPC (lipase, hepatic), HSPD1 (heat shock 60 kDa protein 1 (chaperoiiin)), MAPK14 (mitogen- activated protein kinase 14), SPP1 (secreted phosphoprotein 1), ITGB3 (integrin, beta 3 (pi ate let glycoprotein 111a, antigen CD6I)), CAT (catalase), UTS2 (urotensin 2), THBD (thrombomodulin), F1.0 (coagulation factor X), CP (ceruloplasmiti (ferroxidase)), TNFRSF1 IB (tumor necrosis factor receptor superfamily, member 1 lb), EDNRA (endothelin receptor type A), EGFR (epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homo log, avian)), MMP2 (matrix metailopeptidase 2 (gclatinasc A, 72 kDa geiatinase, 72 kDa type IV coilagenase)), PLG (plasminogen), NPY (neuropeptide Y), RHOD (ras homolog gene family, member D), AP 8 (mitogen-activated protein kinase 8), MYC (v-myc myelocytomatosis viral oncogene homolog (avian)), FNl (fibronectiii I), CMAl (chymase 1, mast cell), PLAU (plasminogen activator, urokinase), GNB3 (guanine nucleotide binding protein (G protein), beta polypeptide 3), ADRB2 (adrenergic, beta-2-, receptor, surface), APGA5 (apolipoprotem A-V), SOD2 (superoxide dismutase 2, mitochondrial), F5 (coagulation factor V (proacceierin, labile factor)), VDR (vitamin D (1 ,25-dihydroxyvitamin D3) receptor), ALOX5 (arachidonate 5 -lipoxygenase), HLA-D B1 (major histocompatibility complex, class II, DR beta 1), PARP1 (poly (ADP-ribose) polymerase 1 ), CD40LG (CD40 ligand), POX (paraoxonase 2), AGER (advanced glycosylation end product-specific receptor), IRS I (insulin receptor substrate 1), PTGS1 (prostaglandm-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)), ECEl (endothelin converting enzyme 1), F7 (coagulation factor VII (semm prothrombin conversion accelerator)), URN (interleukin 1 receptor antagonist), EPHX2 (epoxide hydrolase 2, cytoplasmic), IGFBP1 (insulin-like growth factor binding protein 1 ), MAP 10 (mitogen-activated protein kinase 10), FAS (Fas (TNF receptor superfamily, member 6)), ABCB1 (ATP-binding cassette, sub-family B (MDR TAP), member 1), JUN (jun oncogene), IGFBP3 (insulin-like growth factor binding protein 3), CD 14 (CD 14 molecule), PDE5A (phosphodiesterase 5A, cGMP-specific), AGTR2 (angiotensin II receptor, type 2), CD40 (CD40 molecule, TNF receptor superfamily member 5), LCAT (lecithin-cholesterol acyitransferase), CCR5 (chemokine (C-C motif) receptor 5), MMP1 (matrix metailopeptidase 1 (interstitial coilagenase)), TIMP1 (TIMP metailopeptidase inhibitor I), ADM (adrenomedulliii), DYT10 (dystonia 10), STAT3 (signal transducer and activator of transcription 3 (acute-phase response factor)), MMP3 (matrix metallopeptidase 3 (stromelysin 1, progelatmase)), ELN (elastin), USF1 (upstream transcription factor 1), C'f 'l 1 (complement factor H), HSPA4 (heat shock 70 kDa protein 4), MMP12 (matrix metallopeptidase 12 (macrophage elastase)), MME (membrane metallo-endopeptidase), F2R (coagulation factor ]] (thrombin) receptor), SELL (selectin L), CTSB (cathepsiii B), ANXA5 (annexin A5), ADRB1 (adrenergic, beta-1-, receptor), CYBA (cytochrome b-245, alpha polypeptide), EGA (fibrinogen alpha chain), GGT1 (gamma- glutamyitransferase 1 ), LIPG (lipase, endothelial), HIF1A (hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)), CXCR4 (chemokine (C-X-C motif) receptor 4), PROC (protem C (mactivator of coagulation factors Va and Villa)), SCARBl (scavenger receptor class B, member 1), CD79A (CD79a molecule, immunoglobulin-associated alpha), PLTP (phospholipid transfer protein), ADD! (adducin 1 (alpha)), FGG (fibrinogen gamma chain), SAA1 (serum amyloid Al), K.CNH2 (potassium voltage-gated channel, subfamily H (eag-related), member 2), DPP4 (dipeptidyl-peptidase 4), G6PD (glucose-6- phosphate dehydrogenase), NPR1 (natriuretic peptide receptor A/guanylate cyclase A (atrionatriuretic peptide receptor A)), VTN (vitronectin), KIAAOIOI (KIAAOiOl), FOS (FBJ murine osteosarcoma viral oncogene homolog), TLR2 (toll-like receptor 2), PPIG (peptidylprolyl isom erase G (cyclophilin G)), IL1R1 (mterleukin 1 receptor, type I), AR (androgen receptor), CYP1A 1 (cytochrome P450, family 1, subfamily A, polypeptide 1), SERP1NA1 (serpin peptidase inhibitor, clade A (alpha- 1 antiproteinase, antitrypsin), member 1), MTR (5- methyltetrahydrofolate-homocysteine methyltransferase), RBP4 (retmol binding protein 4, plasma), APOA4 (apolipoprotein A-IV), CDKN2A (cyclin-dependent kinase inhibitor 2A (melanoma, pi 6, inhibits CDK4)), FGF2 (fibroblast growth factor 2 (basic)), EDNRB (endothelin receptor type B), ITGA2 (integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor)), CABIN i (calcineurin binding protein 1), SHBG (sex hormone-binding globulin), HMGBl (high-mobility group box 1 ), HSP90B2P (heat shock protein 90 kDa beta (Grp94), member 2 (pseudogene)), CYP3A4 (cytochrome P450, family 3, subfamily A, polypeptide 4), GJAl (gap junction protein, alpha 1, 43 kDa), ( V I (caveolin 1, caveolae protein, 22 kDa), ESR2 (estrogen receptor 2 (ER beta)), LTA (lymphotoxin alpha (TNF superfamily, member 1)), GDF15 (growth differentiation factor 15), BDNF (brain-derived neurotrophic factor), CYP2D6 (cytochrome P450, family 2, subfamily D, polypeptide 6), NGF (nerve growth factor (beta polypeptide)), SPl (Spl transcription factor), TGIFl (TGFB-induced factor homeobox i), SRC (v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homoiog (avian)), EGF (epidermal growth factor (beta-urogastrone)), PIK3CG (phosphoinositide-3-kinase, catalytic, gamma polypeptide), HLA-A (major histocompatibiKty complex, class I, A), CNQ1 (potassium voltage-gated channel, QT-Hke subfamily, member 1), CNR1 (cannabinoid receptor 1 (brain)), FBN1 (fibrilli 1), CHELA (choline kinase alpha), BEST1 (bestrophin 1), APP (amyloid beta (A4) precursor protein), CTNNB1 (eaten in (cadherin-assoeiated protein), beta 1, 88 kDa), 1 L2 (interleukin 2), CD36 (CD36 molecule (thrombospondin receptor)), PRKAB1 (protein kinase, AMP-activated, beta 1 non-catalytic subunit), TPO (thyroid peroxidase), ALDH7A1 (aldehyde dehydrogenase 7 family, member Al), CX3CR 1 (ehemokine (C-X3-C motif) receptor 1 ), TH (tyrosine hydroxylase), F9 (coagulation factor IX), GB1 (growth hormone 1), TF (transferrin), FIFE (hemochromatosis), 1 L17A (interfeukin 17 A), PTEN (phosphatase and tensin homoiog), GSTM1 (glutathione S-transferase mu 1), DMD (dystrophin), GATA4 (GATA binding protein 4), F13A1 (coagulation factor X l f f. Al polypeptide), TTR (transthyretin), FABP4 (fatty acid binding protein 4, adipocyte), PON3 (paraoxonase 3), APOC1 (apolipoprotein C-I), INSR (insulin receptor), TNFRSF1B (tumor necrosis factor receptor superfamily, member IB), HTR2A (5-hydroxyrxyptamine (serotonin) receptor 2A), CSF3 (colony stimulating factor 3 (granulocyte)), CYP2C9 (cytochrome P450, family 2, subfamily C, polypeptide 9), TXN (thiorcdo in), CYP11 B2 (cytochrome P450, family 1 1, subfamily B, polypeptide 2), PTH (parathyroid hormone), CSF2 (colony stimulating factor 2 (granulocyte-macrophage)), KDR (kinase insert domain receptor (a type If f receptor tyrosine kinase)), PLA2G2A (phospholipase A2, group IIA (platelets, synovial fluid)), B2M (beta-2-microglobulin), THBS1 (thrombospondin 1), GCX) (glucagon), R OA (ras homoiog gene family, member A), A LDFI2 (aldehyde dehydrogenase 2 family (mitochondrial)), TCF7L2 (transcription factor 7 -like 2 (T-cell specific, HMG-box)), BDKRB2 (bradykinin receptor B2), NFE2L2 (nuclear factor (erythroid-derived 2)- like 2), NOTCH ! (Notch homoiog 1 , transiocation-associated (Drosophila)), UGTIA I (UDP giucuronosyltransferase 1 family, polypeptide Al), IFNAl (interferon, alpha 1), PPARD (peroxisome pro iiferator-activated receptor delta), SIRTl (sirtuin (silent mating type information regulation 2 homoiog) 1 (S. cerevisiae)), GNRH1 (gonadotrop in-releasing hormone 1 (luteinizing-reieasing hormone)), PAPPA (pregnancy-associated plasma protein A, pappalysin 1), ARR3 (arrestin 3, retinal (X-arrestin)), NPPC (natriuretic peptide precursor C), AHSP (alpha hemoglobin stabilizing protein), PTK2 (PTK2 protein tyrosine kinase 2), IL13 (interleukin 13), MTOR (mechanistic target of rapamycin (serine/threonine kinase)), ITGB2 (integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)), GSTTl (glutathione S-transferase theta 1 ), IL6ST (interleukin 6 signal transducer (gpl30, oncostatin M receptor)), CPB2 (earboxypeptidase B2 (plasma)), CYP1A2 (cytochrome P450, family 1, subfamily A, polypeptide 2), HNF4A (hepatocyte nuclear factor 4, alpha), SLC6A4 (solute carrier family 6 (neurotransmitter transporter, serotonin), member 4), PLA2G6 (phospholipase A2, group VI (cytosoSic, calcium- independent)}, TNFSF1 1 (tumor necrosis factor (ligand) superfamily, member 11), SLC8A1 (solute carrier family 8 (sodium/calcium exchanger), member 1), F2RL3 (coagulation factor II (thrombin) receptor-like 1 ), A R1A 1 (aido-keto reductase family 1, member A l (aldehyde reductase)), ALDH9A1 (aldehyde dehydrogenase 9 family, member Al), BGLAP (bone gamma- carboxyglutamate (gla) protein), MTTP (microsomal triglyceride transfer protein), MTRR (5- methyltetrahydrofolate-homocysteine metliyltraiisferase reductase), SULT1A3 (sulfotransferase family, cytosolic, 1 A, phenol -preferring, member 3), RAG E (renal tumor antigen), C4B (complement component 4B (Chido blood group), P2RY12 (purinergic receptor P2Y, G-protein coupled, 12), RNLS (renalase, FAD-dependent amine oxidase), CREBl (cAMP responsive element binding protein 1 ), POMC (proopiomelanocortin), RAC 1 (ras-related C3 botulinum toxin substrate 1 (rho tamily, small GTP binding protein Raci)), LMNA (lamin NCj, CD59 (CD59 molecule, complement regulatory protein}, SCN5A (sodium channel, voltage-gated, type V, alpha subunit), CYP1B1 (cytochrome P450, family I, subfamily B, polypeptide 1), MIF (macrophage migration inhibitory factor (glycosylation -inhibiting factor)), MM 13 (matrix metallopeptidase 13 (collagenase 3)), TIMP2 (ΊΊΜΡ metallopeptidase inhibitor 2), CYP19A1 (cytochrome P450, family 19, subfamily A, polypeptide 1 ), CYP21 A2 (cytochrome P450, family 21, subfamily A, polypeptide 2), PTPN22 (protein tyrosine phosphatase, non-receptor type 22 (lymphoid)), MYH14 (myosin, heavy chain 14, non-muscle), MBL2 (mannose-binding lectin (protein C) 2, soluble (opsonic defect)), SELPLG (selectin P ligand), AOC3 (amine oxidase, copper containing 3 (vascular adhesion protein !)), CTSL1 (cathepsin LI), PCNA (proliferating cel l nuclear antigen), IGF2 (insulin -like growth factor 2 (somatomedin A)), ITGB1 (integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MS 12)), CAST (calpastatin), CXCL12 (chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1)), IGHE (immunoglobulin heavy constant epsilon), CNE 1 (potassium voltage-gated channel, Isk- related family, member 1), TFRC (transfemn receptor (p90. CD71)), COLIAI (collagen, type I, alpha 1), COL1A2 (collagen, type I, alpha 2), IL2RB (interleukin 2 receptor, beta), PLA2G10 (phospholipase A2, group X), ANGPT2 (angiopoietin 2), PROCR (protein C receptor, endothelial (EPCR)), NOX4 (NADPH oxidase 4), HAMP (hepcidin antimicrobial peptide), PTP 11 (protein tyrosine phosphatase, non-receptor type 1 1 ), SLC2A1 (solute carrier family 2 (facilitated glucose transporter), member 1), IL2RA (interleuki 2 receptor, alpha), CCL5 (chemokine (C-C motif) ligand 5), IRF1 (interferon regulatory factor 1), CFLAR (CASP8 and FADD-like apoptosis regulator), CALCA (caicitonin-reiated polypeptide alpha), EIF4E (eukaryotic translation initiation factor 4E), GSTP1 (glutathione S~transferase pi I), JAK2 (Janus kinase 2), CYP3A5 (cytochrome P450, family 3, subfamily A, polypeptide 5), HSPG2 (heparan sulfate proteoglycan 2), CCL3 (chemokine (C-C motif) ligand 3), MYD88 (myeloid differentiation primary response gene (88)), VIP (vasoactive intestinal peptide), SOAT1 (sterol O-acyltransferase 1), ADRB 1 (adrenergic, beta, receptor kinase 1), NR4A2 (nuclear receptor subfamily 4, group A, member 2), MMP8 (matrix metai!opeptidase 8 (neutrophil collagenase)), NPR2 (natriuretic peptide receptor B/guanylate cyclase B (atrionatriuretic peptide receptor B)), GCH3 (GTP cyclohydrolase 1), EPRS (glutamyl-prolyl-tRNA synthetase), PPARGC1A (peroxisome proliferator-activated receptor gamma, coactivator 1 alpha), F12 (coagulation factor XII (Hageman factor)), PEC AMI (platelet/endothelial cell adhesion molecule), CCL4 (chemokine (C-C motif) ligand 4), SERPINA3 (serpin peptidase inhibitor, clade A (alpha- 1 antiproteinase, antitrypsin), member 3), CASR (calcium-sensing receptor), GJA5 (gap junction protein, alpha 5, 40 kDa), FABP2 (fatty acid binding protein 2, intestinal), TTF2 (transcription termination factor, RNA polymerase II), PRGSI (protein S (alpha)), CTFl (cardiotrophm 1), SGCB (sarcoglycan, beta (43 kDa dystrophin -associated glycoprotein)), YMEI LI (YMEl-like 1 (S. ccrevisiae}}, CAMP (cathelicidin antimicrobial peptide), ZC3H 12A (zinc finger CCCH-type containing 12 A), A R1B3 (a do-keto reductase family 1 , member Bl (aldose reductase)), DBS (desmin), MMP7 (matrix metal lopeptidasc 7 (matrilysin, uterine)}, AFJR (aryl hydrocarbon receptor), CSF3 (colony stimulating factor 1 (macrophage)), HDAC9 (histone deacetylase 9), CTGF (connective tissue growth factor), KCNMA1 (potassium large conductance calcium- activated channel, subfamily M, alpha member 1), UGT1A (UDP glucuronosyltransferase I family, polypeptide A complex locus), PRKCA (protein kinase C, alpha), COMT (catechol- .beta.-methyltransferase), S100B (SI 00 calcium binding protein B), EGR1 (early growth response 1), PRL (prolactin), IL15 (interleukin 15), DRD4 (dopamine receptor D4), CAMK2G (calcium/calrnodulin-dependent protein kinase II gamma), SLC22A2 (solute carrier family 22 (organic cation transporter), member 2), CCL1 1 (ehemokine (C-C motif) Hgand 1 1), PGF (B321 placental growth factor), THPO (thrombopoietin), GP6 (glycoprotein VI (platelet)), TACR1 (tachykinin receptor 1), NTS (neurotensin), HNF A (H F.1 homeobox A), SST (somatostatin), KCND1 (potassium voltage-gated channel, Shal-reiated subfamily, member I), LOC646627 (phosphobpase inhibitor), TBXASl (thromboxane A synthase 1 (platelet)), CYP2J2 (cytochrome P450, family 2, subfamily J, polypeptide 2), TBXA2R (thromboxane A2 receptor), ADH I C (alcohol dehydrogenase 1C (class I), gamma polypeptide), ALOX12 (arachidonate 12- iipoxygenase), AHSG (alpha-2-HS-giycoprotein), BHMT (betaine- omocysteine rnethyltransferase), GJA4 (gap junction protein, alpha 4, 37 kDa), SLC25A4 (solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4), ACLY (ATP citrate lyase), ALOX5AP (arachidonate 5 -lipoxygenase-activating protein), NUMA1 (nuclear mitotic apparatus protein 1), CYP27B1 (cytochrome P450, family 27, subfamily B, polypeptide 1), CYSLTR2 (cysteinyl leukotriene receptor 2), SODS (superoxide dismutase 3, extracellular), LTC4S (leukotriene C4 synthase), UCN (urocortin), GFIRL (ghrelm/obestatin prepropeptide), APOC2 (apolipoprotein C-II), CLEC4A (C-type lectin domain family 4, member A), KBTBDIO (kelch repeat and BTB (POZ) domain containing 10), TNC (tenascin C), TYMS (thymidylate synthetase), SHCl (SHC (Src homology 2 domain containing) transforming protein 1 ), LRPl (low density lipoprotein receptor-related protein 1), SOCS3 (suppressor of cytokine signaling 3), ADFIIB (alcohol dehydrogenase I B (class I), beta polypeptide), KLK3 (kaliikrein -related peptidase 3), HSD11B1 (hydroxysteroid (11 -beta) dehydrogenase 1), VKORC1 (vitamin K epoxide reductase complex, subunit 1 ), SERP1NB2 (serpin peptidase inhibitor, clade B (ovalbumin), member 2), TNS1 (tensin 1 ), R F19A (ring finger protein 19A), EPOR (erythropoietin receptor), ITGAM (integrin, alpha M (complement component 3 receptor 3 subunit)), ΡΓΓΧ2 (paired-like homeodomain 2), MAPK7 (mitogen-activated protein kinase 7), FCGR3A (Fc fragment of IgG, low affinity H I a, receptor (CD 16a)), LEPR (leptin receptor), ENG (endoglin), GPXl (glutathione peroxidase 1), GOT2 (glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2)), HRH1 (histamine receptor HI), NRI 12 (nuclear receptor subfamily 1, group I, member 2), CRH (corticotropin releasing hormone), HTR A (5- hydroxytryptamine (serotonin) receptor IA), VDAC1 (voltage-dependent anion channel 1), FIPSE (heparanase), SFTPD (surfactant protein D), TAP2 (transporter 2, ATP-binding cassette, sub-family B (MDR/TAP)), RNF123 (ring finger protein 123), PTK2B (PTK2B protein tyrosine kinase 2 beta), NTRK2 (neurotrophic tyrosine kinase, receptor, type 2), IL6R (interleukin 6 receptor), ACHE (acetylcholinesterase (Yt blood group)), GLP1R (glucagon-like peptide 1 receptor), GHR (growth hormone receptor), GSR (glutathione reductase), NQOl (NAD(P)H dehydrogenase, quinone 1), NR5A1 (nuclear receptor subfamily 5, group A, member 1), GJB2 (gap junction protein, beta 2, 26 kDa), SLC9A 1 (solute carrier family 9 (sodium/hydrogen exchanger), member 1), MAOA (monoamine oxidase A), PCSK.9 (proprotein convertase subtilisin/kexm type 9), FCGR2A (Fc fragment of IgG, low affinity Ila, receptor (CD32)), SERPINFl (serpin peptidase inhibitor, ciade F (alpha -2 antiplasmin, pigment epithelium derived factor), member 1), EDN3 (endothelin 3), DHFR (dihydro folate reductase), GAS6 (growth arrest-specific 6), SMPD1 (sphingomyeSin phosphodiesterase 1, acid lysosomal), UCP2 (uncoupling protein 2 (mitochondrial, proton carrier)), TFAP2A (transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha)), C4BPA (complement component 4 binding protein, alpha), SERPINF2 (serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2), TYMP (thymidine phosphorylase), ALPP (alkaline phosphatase, placental (Regan isozyme)}, CXC 2 (ehemokinc (C-X-C motif) receptor 2), SLC39A3 (solute carrier family 39 (zinc transporter), member 3), ABCG2 (ATP-binding cassette, sub-family G ( WHITE), member 2), ADA (adenosine deaminase), JAK3 (Janus kinase 3), HSPA1A (heat shock 70 kDa protein 1A), FASN (fatty acid synthase), FGF1 (fibroblast growth factor 1 (acidic)), Fl ! (coagulation factor XI), ATP7A (AT ase, Cu++ transporting, alpha polypeptide), CR1 (complement component (3b/4b) receptor 1 (Kiiops blood group)), GFAP (glial fibrillary acidic protein), ROCK1 (Rho-associated, coiled-coil containing protein kinase 1 ), MECP2 (methyl CpG binding protein 2 (Rett syndrome)), MYLK (myosin light chain kinase), BCHE (butyrylcholinesterase), LIPE (lipase, hormone-sensitive), PRDX5 (peroxiredoxin 5), ADORA1 (adenosine Al receptor), WRN (Werner syndrome, RecQ helicase- iike), CXCR3 (chemokine (C-X-C motif) receptor 3), CD81 (CD81 molecule), SMAD7 (SMAD family member 7), LAMC2 (laminin, gamma 2), MAP3K5 (mitogen -activated protein kinase kinase kinase 5), CHGA (chromogranin A (parathyroid secretory protein 1)), LAPP (islet amyloid polypeptide), RHO (rhodopsin), ENPP1 (ectonucleotide pyrophosphatase/phosphodiesterase 1 ), PTHLH
Figure imgf000112_0001
hormone-like hormone), RG1 (neuregulin 1), VEGFC (vascular endothelial growth factor C), ENPEP (glutamyl aminopeptidase (aminopeptidase A)), CEBPB (CCAAT/enhancer binding protein (C/EBP), beta), NAGLU (N-acetylglucosaminidase, alpha-), F2RL3 (coagulation factor ]] (thrombin) receptor-like 3), CX3CL1 (chemokme (C-X3-C motif) ligand 1), BDKRB1 (bradykinin receptor Bl), ADAMTS13 (ADAM metaliopeptidase with thrombospondin type 1 motif, 13), ELA'NE (elastase, neutrophil expressed), ENPP2 (ectonucleotide pyrophosphatase/phosphodiesterase 2), CISH (cytokine inducible SH2- containing protein), GAST (gastrin), MYOC (myocilin, trabecular meshwork inducible glucocorticoid response), ATP1A2 (ATPase, Na+/K+ transporting, alpha 2 polypeptide), NF1 (neurofibromin 1 ), GJB1 (gap junction protein, beta 1, 32 kDa), MEF2A (myocyte enhancer factor 2A), VCL (vinculin), BMPR2 (bone morphogenetic protein receptor, type II (serine/threonine kinase)), TUBB (tubulin, beta), CDC42 (cell division cycle 42 (GTP binding protein, 25 kDa)), KRT1 8 (keratin 18), HSFl (heat shock transcription factor 1 ), MYB (v-myb myeloblastosis viral oncogene homolog (avian)), PRKAA2 (protein kinase, AMP-activated, alpha 2 catalytic subu t), ROCK2 (Rho-associated, coiled-coil containing protein kinase 2), TFPI (tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor)), PRKGl (protein kinase, cGMP-dependent, type I), BMP2 (bone morphogenetic protein 2), CTNND1 (catenin (cadherin-associated protein), delta 1), CTH (cystathionase (cystathionine gamma- lyase)), CTSS (cathepsin S), VAV2 (vav 2 guanine nucleotide exchange factor), NPY2R (neuropeptide Y receptor Y2), 1GFBP2 (insulin-like growth factor binding protein 2, 36 kDa), CD28 (CD28 molecule), GSTA1 (glutathione S-transferase alpha 1), PPIA (peptidylprolyl isomerase A (cyclophilin A)), APOH (apolipoprotein H (beta-2-glycoprotein 1)), S100A8 (SI.00 calcium binding protein A8), IL11 (interleukin 11), ALOX15 (arachidonate 15 -lipoxygenase), FBLNl (fibulin 1 ), NR1H3 (nuclear receptor subfamily 1 , group H, member 3), SCD (stearoyl- CoA desaturase (delta-9-desaturase)), GIP (gastric inhibitory polypeptide), CHGB (chromogranin B (secretogranin 1)), PRKCB (protein kinase C, beta), SRD5A1 (sterotd-5-alpha- reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1)), HSD11B2 (hydroxysteroid (3 1-beta) dehydrogenase 2), CALCRL (calcitonin receptor-like), GALNT2 (UDP-N-acetyl-afpha-D-ga!actosamine:pofypeptide N-acetylgalactosaminyltransferase 2 (GalNAc-T2)), ANGPTL4 (angiopoietin-like 4), KC N4 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 4), PIK3C2A (phosphoinositide- 3-kinase, class 2, alpha polypeptide), HBEGF (heparin-binding EGF-like growth factor), CYP7A1 (cytochrome P450, family 7, subfamily A, polypeptide 1), HLA-DRB5 (major histocompatibility complex, class II, DR beta 5), BNIP3 (BCL2/adeno virus E1B 19 kDa interacting protein 3), GCKR (glueokinase (hexokinase 4) regulator), S100A12 (SI 00 calcium binding protein AI2), PADI4 (peptidyl arginine deiminase, type IV), HSPAI4 (heat shock 70 kDa protein 14), CXCR l (chemokine (C-X-C motif) receptor 1 ), HI 9 (HI 9, imprinted maternally expressed transcript (non-protein coding)), KRTAP19-3 (keratin associated protem 19-3), IDDM2 (insulin-dependent diabetes mellitus 2), RAC2 (ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)), RYR 1 (ryanodine receptor 1 (skeletal)), CLOCK (clock homolog (mouse)), NGFR (nerve growth factor receptor (TNFR superfamiiv, member 16)), DBH (dopamine beta-hydroxylase (dopamine beta-monooxygenase)), CHRNA4 (cholinergic receptor, nicotinic, alpha 4), CACNA1C (calcium channel, voltage- dependent, L type, alpha 1C subunit), PR AG2 (protein kinase, AMP-aetivated, gamma 2 non- catalytic subuiiit), CHAT (choline acetyltransferase), PTGDS (prostaglandin D2 synthase 21 kDa (brain)), NR1H2 (nuclear receptor subfamily 1, group H, member 2), TEK (TEK tyrosine kinase, endothelial), VEGFB (vascular endothelial growth factor B), MEF2C (myocyte enhancer factor 2C), MAPKAPK2 (mitogen-activated protein kinase-activated protein kinase 2), TNFRSF11A (tumor necrosis factor receptor superfamiiv, member 11a, NFKB activator), HSPA9 (heat shock 70 kDa protem 9 (mortalin)), CYSLTR3 (cysteinyl leukotriene receptor 1 ), MAT1A (methionine adenosyl transferase I, alpha), OPRL1 (opiate receptor-like 1), IMPA1 (inositol(myo)-l(or 4)- moiiophosphatase 1), CLCN2 (chloride channel 2), DLD (dihydrolipoamide dehydrogenase), PSMA6 (proteasome (prosome, macropain) subunit, alpha type, 6), PS B8 (proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7)), CHI3L1 (chitinase 3-like 1 (cartilage gSycoprotein-39)), ALDH1 B1 (aldehyde dehydrogenase 1 family, member Bl), PARP2 (poly (ADP-ribose) polymerase 2), STAR (steroidogenic acute regulatory protein), LBP (lipopolysaccharide binding protein), ABCC6 (ATP-binding cassette, sub-family C(CFTR/MRP), member 6), RGS2 (regulator of G-protein signaling 2, 24 kDa), EFNB2 (ephrin- B2), GJB6 (gap junction protein, beta 6, 30 kDa), APOA2 (apo lipoprotein A-II), AMPD1 (adenosine monophosphate deaminase 1), DYSF (dysferiin, limb girdle muscular dystrophy 2B (autosomal recessive)), FDFT1 (farnesyl-diphosphate famesyitransferase 1), EDN2 (endothelin 2), CCR6 (chemokine (C-C motif) receptor 6), GJB3 (gap junction protein, beta 3, 31 kDa), IL1RLI (interleukiii I receptor-like 1), ENTPD1 (ectonucleoside triphosphate diphosphohydrola.se 1), BBS4 (Bardet-Biedl syndrome 4), CELSR2 (eadherin, EGF LAG seven- pass G-type receptor 2 (flamingo homolog, Drosophiia)), FUR (Fl l receptor), RAPGEF3 (Rap guanine nucleotide exchange factor (GEF) 3), HYAL1 (hyaiuronoglucosaminidase 1), ZNF259 (zinc finger protein 259), ATOXI (ATX1 antioxidant protein 1 homolog (yeast)), ATF6 (activating transcription factor 6), H (ketobe okinase (fructokinase)), SAT1 (spermidine/spermine Nl-acetyltraiisferase I), GGH (gamma-glutamyl hydrolase (conjugase, folylpolygarnmaghitarnyi hydrolase)), ΊΊΜΡ4 (TIMP metallopeptidase inhibitor 4), SLC4A4 (solute carrier family 4, sodium bicarbonate cotransporter, member 4), PDE2A (phosphodiesterase 2A, cGMP-stim lated), PDE3B (phosphodiesterase 3B, cGMP-inhibited), FADS1 (fatty acid desaturase 1), FADS2 (fatty acid desaturase 2), TMSB4X (thymosin beta 4, X-linked), TXNIP (thioredoxin mteracting protein), LIMS1 (LIM and senescent cell antigen-like domains I), R OB (ras homolog gene family, member B), LY96 ( lymphocyte antigen 96), FOXOl (forkhead box 01), P PLA2 (patatin-like phospholipase domai containing 2), TRH (thyrotropin-reieasing hormone), GJC1 (gap junction protein, gamma 1 , 45 kDa), SLC1 7A5 (solute carrier family 17 (anion/sugar transporter), member 5), FTO (fat mass and obesity associated), GJD2 (gap junction protein, delta 2, 36 kDa), PSRC (proline/serine-rich coiled-coil 1), CASP12 (caspase 12 (gcne/pscudogene)), GPBAR1 (G protein-coupled bile acid receptor 1), PXK (PX domain containing serine/threonine kinase), IL33 (interleukin 33), TRIB1 (tribbles homolog 1 (Drosophiia)}, PBX4 (pre-B-cell leukemia homeobox 4), NUPR l (nuclear protein, transcriptional regulator, 1), 15-Sep(15 kDa selenoprotein), CILP2 (cartilage intermediate layer protein 2), TERC (telom erase R A component), GGT2 (gamma-glutamyltransferase 2), MT- CG1 (mitochondrialiy encoded cytochrome c oxidase I), and UOX (urate oxidase, pseudogene), [00372] in an additional embodiment, the chromosomal sequence may further be selected from Ponl (paraoxonase 1 ), LDLR (LDL receptor), ApoE (Apolipoprotein E), Apo B-100 (Apoiipoprotein B-100), ApoA (Apolipoprotein(a)), ApoA l (Apolipoprotein Al), CBS (Cystathione B-synthase), Glycoprotein Ilb/l lb, MTHRF (5, 10-methyienetetrahydrofolate reductase (NADPH), and combinations thereof. In one iteration, the chromosomal sequences and proteins encoded by chromosomal sequences involved in cardiovascular disease may be chosen from CacnalC, Sodl, Pten, Ppar(alpha), Apo E, Leptin, and combinations thereof.
Kidneys
[00373] The present invention also contemplates delivering the CRISPR-Cas system to the kidney. Delivery strategies to induce cellular uptake of the therapeutic nucleic acid include physical force or vector systems such as viral-, lipid- or complex- based delivery, or nanocarriers. From the initial applications with less possible clinical relevance, when nucleic acids were addressed to renal ceils with hydrodynamic high pressure injection systemicaily, a wide range of gene therapeutic "viral, and non-viral carriers have been applied already to target posttraiiscriptional events in different animal kidney disease models in vivo (Csaba Revesz and Peter Hamar (201 1). Delivery Methods to Target RNAs in the Kidney, Gene Therapy Applications, Prof. Chtinsheng Kang (Ed.), ISBN: 978-953-307-541 -9, InTech, Available from: p:// .nHecbope^
the-kidney). Delivery methods to the kidney are summarized as follows:
Figure imgf000116_0001
Delivery
Carrier Target RNA Disease Model Functional assays Author method
blood pressure,
serum albumin,
HyperWang et al, Gene
Mineral serum urea
Adeno-associated tension Cold-induced Therapy, (Jul
Viral cortieoid nitrogen, serum
virus -2 caused renal hypertension 2006), Vol 13, No.
receptor creatinine, kidney
damage 14, pp. (1097-1 103) weight, urinary
sodium
obayashi et al.
Journal of Pharmacology and
Hydrodynamic Experimental pU6 vector Lucif erase n.a. n.a. uptake
/Viral Therapeutics, (Feb
2004), Vol. 308, No. 2, pp. (688- 693)
Wolfram et al,.
Uptake, binding Nature
Lipoproteins, affinity to Biotechnology,
Lipid apoB 1 , apoM ii.a. n.a.
albumin lipoproteins and (Sep 2007), Vol.
albumin 25, No. 10, pp.
(1 149-1 157)
Molitoris et al., J ischemic and
Am Soc Nephrol,
Acute renal cisplatin- Histological
Lipid Lipo lecianiine2000 p53 (Aug 2009), Vol.
injury induced acute scoring, apoptosis
20, No. 8, injury
pp. (1754-1764)
MDA-MB-
DOTAP/DOPE, 231 breast Mikhaylova el al., DOTAP/DO Breast adenocancer Cell viability, dancer Gene Therapy
Lipid COX-2
PE/DOPE- carcinoma xenograft- uptake (Mar 201 i ), Vol. 16, PEG2000 bearing No. 3, pp. (217-226) mouse
Albuminuria,
urinary creatinine,
histology, type Ϊ Yuan et ai.. Am J
Streptozotoci and IV collagen, Physiol Renal
12/ 15- Diabetic
Lipid Choieslerol n -induced TGF-β, " Physiol, (Jun lipoxygenase ncpkro- pathy
diabetes iibronectin, 2008), Vol. 295, plasminogen pp. (F605-F617) activator inhibitor
1
Cell proliferation
and apoptosis,
histology, ROS,
Y. Zhang et al., i mitochondrial
Mitochondrial Streptozotoci Arts Soc Nephrol,
Lipotectamme Diabetic import of Mn-
Lipid membrane 44 n -induced (Apr 2006 Vol.
2000 nephro- patby SOD and
(ΤΪΜ44) diabetes 17, No. 4, pp.
glutathione
(1090-1101) peroxidase,
cellular membrane
polarization
Caki-2 kidney
Singhal et al,. cancer
Hydrodynamic Renal Cancer Res, (May
Proteolipe-some RLIP76 xenograft- uptake
/ Lipid carcinoina 2009), Vol. 69, No.
bearing
10, pp. (4244-4251) mouse DeKvery
Carrier Target RNA Disease Model Functional assays Author method
Malek eJ al., Toxicology and
Uptake,
Applied
Luciferase biodistribution,
Polymer PEGylated PEI n.a. n.a. Pharmacology, pGL3 erythrocyte
(Apr 2009), Vol. aggregation
236, No. 1 , pp. (97- 108)
Proteinuria,
glomerulosclerosis Shimizu et al., J
Lupus , TGF- β, Am Soc
PEGylated Glomerulo¬
Polymer MAPK.1 glomerulo fibronectin, Nephrology, (Apr poly-L-lysine nephritis
nephritis plasminogen 2010), Vol 21, No.
activator inhibitor 4, pp. (622-633) 1
Jiang et al ,,
B16F1
Biodistribution, Molecular
Kidney melanoma
Polymer/Nano Hyaluronic acid/ citotoxicity, tumor Pharmaceutics,
VEGF cancer/ tumor- particle Quantum dot/ PEI volume, (May-Jun 2009), melanoma bearing
endocytosis Vol, 6, No. 3, pp. mouse
(727-737)
Cao et al, J
PEGylated Controlled Release,
Polymer/Nano cell viability,
polycapro- lactone GAPDH n.a. n.a. (Jun 2010), Vol. particle uptake
nanofiber 144, No. 2, pp.
(203-212) urinary albumin,
urinary creatinine,
Ninichuk et al.. Am histopathology,
Uninephreeto J Pathol, (Mar
Spiegelmer CC chetnokine Glomerulo glomerular
Aptamer - mized 2008), Vol. 172, mNOX-E36 iigand 2 sclerosis filtration rate,
mouse No, 3, pp. (628- macrophage count,
6.37) serum Ccl2, Mac- 2+, i-67+
Binding affinity to
Purschke et al., D-AVP, inhibition
Proc Natl Acad Sci, vasopressin Congestive of AVP Signaling,
Aptamer Aptamer OX-F37 n.a. (Mar 2006), Vol.
(AVP) heart: failure Urine osmolality
103, No. 13, pp. and sodium
(5173-5178) concentration,
[00374] Yuan et al. (Am J Physiol Renal Physiol 295: F605--F617, 2008) investigated whether in vivo delivery of small interfering RNAs (siRNAs) targeting the 12/ 15 -lipoxygenase (12/15- LO) pathway of arachidonate acid metabolism can ameliorate renal injury and diabetic nephropathy (DN) in a streptozotocininjecied mouse model of type 1 diabetes. To achieve greater in vivo access and siRNA expression in the kidney, Yuan et al. used double-stranded 12/15-LO siRNA oligonucleotides conjugated with cholesterol. About 400 μg of siRNA was injected subcutaneouslv into mice. The method of Yuang et. al. may be applied to the CRISPR Cas system of the present invention contemplating a 1-2 g subcutaneous injection of CRISPR Cas conjugated with cholesterol to a human for delivery to the kidneys. [00375] Molitoris et al. (J Am Soc Nephrol 20: 1754-1764, 2009) exploited proximal tubule cells (PTCs), as the site of oligonucleotide reabsorption within the kidney to test the efficacy of siRNA targeted to p53, a pivotal protein in the apoptotic pathway, to prevent kid ey injury. Naked synthetic siRNA to p53 injected intravenously 4 h after ischemic injur}' maximally protected both PTCs a d kidney functio . Molitoris et al.'s data indicates that rapid delivery of siRN A to proximal tubule cells follows intravenous administration. For dose-response analysis, rats were injected with doses of siP53, 0.33; 1, 3, or 5mg/kg, given at the same four time points, resulting in cumulative doses of 1.32; 4, 12, and 20 mg/kg, respectively. All siRNA doses tested produced a SCr reducing effect on day one with higher doses being effective over approximately five days compared with PBS-treated ischemic control rats. The 12 and 20 mg kg cumulative doses provided the best protective effect. The method of Molitoris et al. may be applied to the CRISPR Cas system of the present invention contemplating 12 a d 20 mg kg cumulative doses to a human for deliver}' to the kidneys.
[00376] Thompson et al. (Nucleic Acid Therapeutics, Volume 22, Number 4, 2012) reports the toxicoiogicai and pharmacokinetic properties of the synthetic, small interfering RNA I5NP following intravenous administration in rodents and nonhuman primates. Ϊ5ΝΡ is designed to act via the RNA interference (RNAi) pathway to temporarily inhibit expression of the pro-apoptotic protein p53 and is being developed to protect cells from acute ischemia/reperfusion injuries such as acute kid ey injury that can occur during major cardiac surgery and delayed graft function that can occur fol lowing renal transplantation. Doses of 800mg/kg 15 NP in rodents, and 1,000 mg/kg I5NP in nonhuman primates, were required to elicit adverse effects, which in the monkey were isolated to direct effects on the blood that included a sub-clinical activation of complement and slightly increased clotting times. In the rat, no additional adverse effects were observed with a rat analogue of I5NP, indicating that the effects likely represent class effects of synthetic RNA duplexes rather than toxicity related to the intended pharmacologic activity of Ϊ5ΝΡ. Taken together, these data support clinical testing of intravenous administration of I5NP for the preservation of renal function following acute isehemia/reperftision injury. The no observed adverse effect level (NOAEL) in the monkey was 500 mg/kg. No effects on cardiovascular, respirator}', and neurologic parameters were observed in monkeys following i.v. administration at dose levels up to 25 mg kg. Therefore, a similar dosage may be contemplated for i travenous administration of CRISPR Cas to the kidneys of a human. [00377] Shimizu et al. (J Am Soc Nephrol 21 : 622-633, 2010) developed a system to target delivery of siR As to glomeruli via polyiethylene glycol)-poly(L-lysine)-based vehicles. The siRNA/nanocarrier complex was approximately 10 to 20 nm in diameter, a size that would allow it to move across the fenestrated endothelium to access to the mesangium. After intraperitoneal injection of fluorescence-labeled siRNA'naiio carrier complexes, Shimizu et al. detected siRNAs in the blood circulation for a prolonged time. Repeated intraperitoneal administration of a mitogen-activated protein kinase 1 (MAPKl) siRNA/nanocarrier complex suppressed glomerular MAPKl mRNA and protein expression in a mouse model of glomerulonephritis. For the investigation of siRNA accumulation, Cy5 -labeled siRNAs complexed with PIC nanocarriers (0.5 ml, 5 nmol of siRNA content), naked Cy5-labeled siRNAs (0.5 ml, 5 nmol), or Cy5-labeled siRN As encapsulated in HVJ-E (0.5 ml, 5 nmol of siRN A content) were administrated to BALB- c mice. The method of Shimizu et al. may be applied to the CRISPR Cas system of the present invention contemplating a dose of about of 10-20 μ/mo! CRISPR Cas complexed with nanocarriers in about 1-2 liters to a human for intraperitoneal administration and delivery to the kidneys.
Lungs
[00378] The present invention also contemplates delivering the CRISPR -Cas system to oneor both lungs.
[00379] Although AAV-2-based vectors were originally proposed for CFTR delivery to CF airways, other serotypes such as AAV-1 , AAV -5, AAV-6, and AAV-9 exhibit improved gene transfer efficiency in a variety of models of the lung epithelium (see, e.g., Li et al., Molecular Therapy, vol. 17 no. 12, 2067-2077 Dec 2009). AAV-1 was demonstrated to be -100-fold more efficient than AAV -2 and AAV-5 at transducing human airway epithelial cells in vitro, 5 although AAV- 3 transduced murine tracheal airway epithelia in vivo with an efficiency equal to that of AAV-5. Other studies have shown that AAV-5 is 50-fold more efficient than AAV-2 at gene delivery to human airway epithelium (HAE) in vitro and significantly more efficient in the mouse lung airway epithelium in vivo. AAV-6 has also been shown to be more efficient than AAV-2 in human airway epithelial cells in vitro and murine airways in vivo.8 The more recent isolate, AAV-9, was shown to display greater gene transfer efficiency than AAV-5 in murine nasal and alveolar epithelia in vivo with gene expression detected for over 9 months suggesting AAV may enable long-term gene expression in vivo, a desirable property for a CFTR gene delivery vector. Furthermore, it was demonstrated that AAV-9 could be readmimstered to the murine lung with no loss of CFTR expression and minimal immune consequences. CF and non- CF HAE cultures may be inoculated on the apical surface with 100 μΐ of AAV vectors for hours (see, e.g., Li et al., Molecular Therapy, vol. 17 no. 12, 2067-2077 Dec 2009). The MOI may vary from 1 x 103 to 4 x 105 vector genomes/cell, depending on virus concentration and purposes of the experiments. The above cited vectors are contemplated for the deliver}' and/or admin stration of the invention .
[00380] Zamora et ai. (Am J Respir Grit Care Med Vol 183. pp 531-538, 201 1) reported an example of the application of an RNA interference therapeutic to the treatment of human infectious disease and also a randomized trial of an antiviral drug in respiratory syncytial virus (RSV)-infected lung transplant recipients. Zamora et al, performed a randomized, double-blind, placebocontrolled trial in LTX recipients with RSV respiratory tract infection. Patients were permitted to receive standard of care for RSV. Aerosolized ALN-RS V01 (0.6 mg kg) or placebo was administered daily for 3 days. This study demonstrates that an RNAi therapeutic targeting RSV can be safely administered to LTX recipients with RSV infection. Three daily doses of ALN-RSVG 1 did not result in any exacerbation of respiratory tract symptoms or impairment of lung function and did not exhibit any systemic proinflammatory effects, such as induction of cytokines or GRP. Pharmacokinetics showed only low, transient systemic exposure after inhalation, consistent with preclinical animal data showing that ALN-RSV01, administered intravenous])' or by inhalation, is rapidly cleared from the circulation through exonucleasemediated digestion a d renal excretion. The method of Zamora et al. may be applied to the CR ISPR Cas system of the present invention and an aerosolized CRISPR Cas, for example with a dosage of 0.6 mg/kg, may be contemplated for the present invention.
[00381] For an example of CFTRdelta508 chimeric guide RNA, see Example 22 which demonstrates gene transfer or gene delivery of a CRISPR-Cas system in airways of subject or a patient in need thereof, suffering from cystic fibrosis or from cystic fibrosis (CF) related symptoms, using adeno-associated virus (AAV) particles. In particular, they exemplify a repair strategy for Cystic Fibrosis delta F508 mutation. This type of strategy should apply across ail organisms. With particular reference to CF, suitable patients may include: Human, non-primate human, canine, feline, bovine, equine and other domestic animals. I this instance, Applica ts utilized a CRISPR-Cas system comprising a Cas9 enzyme to target deltaF508 or other CFTR- inducing mutations.
[00382] The treated subjects in this instance receive pharmaceutically effective amount of aerosolized AAV vector system per lung endobronchial^ delivered while spontaneously breathing. As such, aerosolized delivery is preferred for AAV delivery in general. An adenovirus or an AAV particle may be used for delivery. Suitable gene constructs, each operably linked to one or more regulatory sequences, may be cloned into the delivery vector. In this instance, the following constructs are provided as examples: Cbh or EFla promoter for Cas9, U6 or HI promoter for chimeric guide RNA),: A preferred arrangement is to use a CFTRdelta508 targeting chimeric guide, a repair template for deltaF508 mutation and a codon optimized Cas9 enzyme (preferred Cas9s are those with nuclease or nickase activity) with optionally one or more nuclear localization signal or sequence(s) (NLS(s)), e.g., two (2) NLSs. Constructs without NLS are also envisaged.
[00383] In order to identify the Cas9 target site, Applicants analyzed the human CFTR genomic locus and identified the Cas9 target site. Preferably, in general and in this CF case, the PAM may contain a GG or a NNAGAAW motif.
[00384] Accordingly, in the case of CF, the present method comprises manipulation of a target sequence in a genomic locus of interest comprising
delivering a non-naturally occurring or engineered composition comprising a viral vector system comprising one or more viral vectors operably encoding a composition for expression thereof, wherein the composition comprises:
a non-natural ly occurring or engineered composition comprising a vector system comprising one or more vectors comprising
I. a first regulator}' element operably linked to a CRISPR-Cas system chimeric RNA (chiRNA) polynucleotide sequence, wherein the polynucleotide sequence comprises
(a) a guide sequence capable of hybridizing to the CF target sequence in a suitable mammalian cel l,
(b) a tracr mate seque ce, and
(c) a tracr sequence, and
II. a second regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme comprising at least one or more nuclear localization sequences, wherein (a), (b) and (c) are arranged in a 5' to 3' orientation,
wherein components I and II are located on the same or different vectors of the system, wherein when tra scribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence. In respect of CF, preferred target DNA sequences comprise the CFTRdelta508 mutation. A preferred PAM is described above. A preferred CRISPR enzyme is any Cas (described herein, but particularly that described in Example 22).
[00385] Alternatives to CF include any genetic disorder and examples of these are well kno wn. Another preferred method or use of the in vention is for correcting defects in the E P2A and EMP2B genes that have been identified to be associated with Lafora disease.
[00386] hi some embodiments, a "guide sequence" may be distinct from "guide RNA". A guide sequence may refer to an approx. 20bp sequence, within the guide RNA, that specifies the target site.
[00387] In some embodiments, the Cas9 is (or is derived from) SpCas9. In such embodiments, preferred mutations are at any or all or positions 10, 762, 840, 854, 863 and/or 986 of SpCas9 or corresponding positions in other Cas9s (which may be ascertained for instance by standard sequence comparison tools. In particular, any or ail of the following mutations are preferred in SpCas9: D10A, E762A, H840A, N854A, N863A and/or D986A; as well as conservative substitution for any of the replacement amino acids is also envisaged. The same (or conservative substitutions of these mutations) at corresponding positions in other Cas9s are also preferred. Particularly preferred are D10 and H840 in SpCas9. However, in other Cas9s, residues corresponding to SpCas9 D10 and H840 are also preferred. These are advantageous as they provide nickase activity. Such mutations may be applied to all aspects of the present invention, not only treat ment of CF.
[00388] Schwank et al. (Ceil Stem Cell, 13:653-58, 2013) used CRISPR/Cas9 to correct a defect associated with cystic fibrosis in human stem ceils. The team's target was the gene for an ion channel, cystic "fibrosis transmembrane conductor receptor (CFTR). A deletion in CFTR causes the protein to misfold in cystic fibrosis patients. Using cultured intestinal stem cells developed from cell samples from two children with cystic fibrosis, Schwank et al. were able to correct the defect using CR1SPR along with a donor plasmid containing the reparative sequence to be inserted. The researchers then grew the cells into intestinal "organoids," or miniature guts, and showed that they functio ed normally. In this case, about half of clonal organoids underwent the proper genet c correction.
Muscles
[00389] The present invention also contemplates delivering the CRISPR-Cas system to muscle(s).
[00390] Bortolanza et al. (Molecular Therapy vol. 19 no. 11, 2055-2064 Nov. 201 1 ) shows that systemic delivery of RNA interference expression cassettes in the FRG1 mouse, after the onset of facioscapulohumeral muscular dystrophy (FSHD), led to a dose-dependent long-term FR.G1 knockdown without signs of toxicity. Bortolanza et al, found that a single intravenous injection of 5 x 10 " vg of rAAV6-shlFRGl rescues muscle histopathology and muscle function of FRG1 mice, hi detail, 200 μΐ containing 2 x 101" or 5 x 10f vg of vector in physiological solution were injected into the tail vein using a 25 -gauge Terumo syringe. The method of Bortolanza et al. may be applied to an AAV expressing CRJSPR Cas and injected into humans at a dosage of about 2 χ lO13 or 2 x 10i 6 vg of vector.
[00391] Dumonceaux et al. (Molecular Therapy vol. 18 no. 5, 881-887 May 2010) inhibit the myostatin pathway using the technique of RNA interference directed against the myostatin receptor AcvRIIb mRNA (sh-AcvRIIb). The restoration of a quasi-dystrophin was mediated by the vectorized U7 exon-skippirsg technique (U7-DYS). Adeno-associated vectors carrying either the sh-Acvrllb construct alone, the U7-DYS construct alone, or a combination of both constructs were injected in the tibialis anterior (TA) muscle of dystrophic mdx mice. The injections were performed with 10n AAV viral genomes. The method of Dumonceaux et al. may be applied to an AAV expressing CRJSPR Cas and injected into humans, for example, at a dosage of about 10 l" to about 10f 5 vg of vector.
[00392] inouchi et al. (Gene Therapy (2008) 15, 1 126-1130) report the effectiveness of in vivo siRNA deliver)? into skeletal muscles of normal or diseased mice through nanoparticfe formation of chemically unmodified siRNAs with atelocoUagen (ATCOL), ATCOL-mediated local application of siRNA targeting myostatin, a negative regulator of skeletal muscle growth, in mouse skeletal muscles or intravenously, caused a marked increase in the muscle mass within a few weeks after application. These results imply that ATCOL-mediated application of siRNAs is a powerful tool for future therapeutic use for diseases including muscular atrophy. Mst- siRNAs (final concentration, 10 niM) were mixed with ATCOL (final concentration for local administration, 0.5%) (AteioGene, Kohken, Tokyo, Japan) according to the manufacturer's instructions. After anesthesia of mice (20-week-old male C57BL/6) by Nembutal (25 mg/kg, i.p.), the Mst-siRNA/ATCOL complex was injected into the masseter and biceps femoris muscles. The method of Kinouchi et ai. may be applied to CRISPR Cas and injected into a human, for example, at a dosage of about 500 to 1000 ml of a 40 μΜ solution into the muscle.
[00393] Hagstrom et al. (Molecular Therapy Vol. 10, No. 2, August 2004) describe an intravascular, nonviral methodology that enables efficient and repeatabie delivery of nucleic acids to muscle cells (myofibers) throughout the limb muscles of mammals. The procedure involves the injection of naked plasmid DNA or siRNA into a distal vein of a limb that is transiently isolated by a tourniquet or blood pressure cuff. Nucleic acid deliver}.' to myofibers is facilitated by its rapid injection in sufficient volume to enable extravasation of the nucleic acid solution into muscle tissue. High levels of transgene expression in skeletal muscle were achieved in both small and large animals with minimal toxicity. Evidence of siRNA delivery to limb muscle was also obtained. For plasmid DNA intravenous injection into a rhesus monkey, a threeway stopcock was connected to two syringe pumps (Model PHD 2000; Harvard Instruments), each loaded with a single swinge. Five minutes after a papaverine injection, pDNA (15.5 to 25.7 mg in 40 -100 ml saline) was injected at a rate of 1.7 or 2.0 mi/s. This could be scaled up for plasmid DNA expressing CRISPR Cas of the present invention with an injection of about 300 to 500 mg in 800 to 2000 ml saline for a human. For adenoviral vector injections into a rat, 2 x 109 infectious particles were injected in 3 ml of normal saline solution (NSS). This could be scaled up for an adenoviral vector expressing CRJSPR Cas of the present invention with an injection of about 1 10 " infectious particles were injected in 10 liters of NSS for a human. For siRNA, a rat was injected into the great saphenous vein with 12.5 μ of a siRNA and a primate was injected injected into the great saphenous vein with 750 ug of a siRNA. This could be scaled up for a CR ISPR Cas of the present invention, for example, with an injection of about 15 to about 50 mg into the great saphenous vein of a human.
Skin
[00394] The present invention also contemplates delivering the CRISPR-Cas system to the skin. [00395] Hickerso et al. (Molecular Therapy— Nucleic Acids (2013) 2, el 29) relates to a motorized microneedle array skin delivery device for delivering self-delivery (sd)-siRNA to human and murine skin. The primary challenge to translating siRNA-based skin therapeutics to the clinic is the development of effective delivery systems. Substantial effort has been invested in a variety of skin delivery technologies with limited success. In a clinical study in which skin was treated with siR A, the exquisite pain associated with the hypodermic needle injection precluded enrollment of additional patients in the trial, highlighting the need for improved, more "patient-friendly" (i.e., little or no pain) delivery approaches. Microneedles represent an efficient way to deliver large charged cargos including siRNAs across the primary barrier, the stratum corneum, and are generally regarded as less painful than conventional hypodermic needles. Motorized "stamp type" microneedle devices, including the motorized microneedle array (MMNA) device used by Hickerson et al., have been shown to be safe in hairless mice studies and cause little or no pain as evidenced by (i) widespread use in the cosmetic industry and (ii) limited testing in which nearly all volunteers found use of the device to be much less painful than a flushot, suggesting siRNA delivery using this device will result in .much less pain than was experienced in the previous clinical trial using hypodermic needle injections. The MMNA device (marketed as Triple-M or Tri-M by Bomtech Electronic Co, Seoul, South Korea) was adapted for delivery of siRNA to mouse and human skin. sd-siRNA solution (up to 300 μ! of 0.1 mg ml RNA) was introduced into the chamber of the disposable Tri-M needle cartridge (Bomtech), which was set to a depth of 0.1 mm. For treating human skin, deidentified skin (obtained immediately following surgical procedures) was manually stretched and pinned to a cork platform before treatment. Al l intradermal injections were performed using an insulin syringe with a 28-gauge 0.5-inch needle. The MMNA device and method of Hickerson et al. could be used and/or adapted to deliver the CRISPR Cas of the present invention, for example, a a dosage of up to 300 μΐ of 0.1 mg/ml CRISPR Cas to the skin.
[00396] Leachman et al. (Molecular Therapy, vol. 18 no. 2, 442-446 Feb. 2010) relates to a phase lb clinical trial for treatment of a rare skin disorder pachyonychia congenita (PC), an autosomal dominant syndrome that includes a disabling plantar keratoderma, utilizing the first short-interfering RNA (siRNA)-based therapeutic for skin. This siRNA, called TD101 , specifically and potently targets the keratin 6a (K6a) N171K mutant mRNA without affecting wild-type K6a mRNA. The dose-escalation schedule is presented below: Week EH5iii fs¾ Days VoSsiros TD!isi iifstf..¾¾ TD18 (sag)
■ Ϊ--
5Ϊ-2! SJ X> S
Figure imgf000127_0001
v IS 5..*
f> ΐ.!
:> ■}.:) S.i:
. ½ i
[00397] Initially, 0.1 ml of a 1.0 mg ml solution of TD101 or vehicle alone (Dulbeeeo's phosphate-buffered saline without calcium or magnesium) was administered to symmetric calluses. Six rising dose-volumes were completed without an adverse reaction to the increases: 0.1, 0.25, 0.5, 1.0, 1.5, and 2.0 ml of a 1.0 mg/ml solution of TD101 solution per injection. As the highest planned volume (2.0 ml) was well tolerated, the concentration of TD101 was then increased each week from 1 mg/ml up to a final concentration of 8.5 mg/ml. Similar dosages are contemplated for the administration of a CRISPR Cas that specifically and potently targets the keratin 6a ( 6a) 17 I K mutant mR A.
[00398] Zheng et al. (PNAS, July 24, 2012, vol. 109, no. 30, 11975-11980) show that spherical nucleic acid nanoparticle conjugates (SNA-NCs), gold cores surrounded by a dense shell of highly oriented, covalently immobilized siRNA, freely penetrate almost 100% of keratinocytes in vitro, mouse skin, and human epidermis within hours after application. Zheng et al. demonstrated that a single application of 25 nM epidermal growth factor receptor (EGFR) SNA-NCs for 60 h demonstrate effective gene knockdown in human skin. A similar dosage may be contemplated for CRISPR Cas immobilized in SNA-NCs for administration to the skin.
Hepatitis viruses
[00399] The present invention may also be applied to treat hepatitis B virus (HBV). However, the CRISPR Cas system must be adapted to avoid the shortcomings of NAi, such as the risk of oversaving endogenous small RNA pathways, by for example, optimizing dose and sequence (see, e.g., Grimm et al., Nature vol. 441, 26 May 2006). For example, low doses, such as about 1 -10 x 1014 particles per humane are contemplated.
[00400] In another embodiment, the CRISPR Cas system directed against HBV may be administered in liposomes, such as a stable nucleic-acid-lipid particle (SNALP) (see, e.g., Morrissey et al.. Nature Biotechnology, Vol. 23, No. 8, August 2005). Daily intravenous injections of about 1 , 3 or 5 rag/kg/day of CRISPR Cas targeted to HBV RNA in a SNALP are contemplated. The daily treatment may be over about three days and then weekly for about five weeks.
[00401] In another embodiment, the system of Chen et al. (Gene Therapy (2007) 14, 11-19) may be used/and or adapted for the CR ISPR. Cas system of the present invention. Chen et al. use a double-stranded adenoassociated virus 8-pseudotyped vector (dsAAV2/8) to deliver shRNA. A single administration of dsAAV2/8 vector (1 x 10l vector genomes per mouse), carrying HBV- speeific shRNA, effectively suppressed the steady level of HBV protein, mRNA and re ficative DNA in liver of HBV transgenic mice, leading to up to 2-3 logio decrease in HBV load in the circulation. Significant HBV suppression sustained for at least 120 days after vector administration. The therapeutic effect of shRNA was target sequence dependent and did not involve activation of interferon. For the present invention, a CRISPR Cas system directed to HBV may be cloned into an AAA'" vector, such as a dsAAV2/8 vector and administered to a human, for example, at a dosage of about I x 101 s vector genomes to about 1 x 10i6 vector genomes per human.
[00402] In another embodiment, the method of Wooddeil et al. (Molecular Therapy vol. 21 no. 5, 973-985 May 2013) may be used/and or adapted to the CRISPR Cas system of the present invention. Woodell et al. showr that simple coinjection of a hepatocyte-targeted, N- acetylgaiactosamine-conj ugated melittin-like peptide (NAG-MLP) with a liver-tropic cholesterol-conjugated siRNA (choi-siR A) targeting coagulation factor VII (F7) results in efficient F7 knockdown i mice and nonhuman primates without changes in clinical chemistry or induction of cytokines. Using transient and transgenic mouse models of HBV infection, Wooddeil et al show that a single coinjection of NAG-MLP with potent chol-siRNAs targeting conserved HBV sequences resulted in multilog repression of viral RNA, proteins, and viral DNA with long duration of effect. Intraveinous coinjections, for example, of about 6 mg kg of NAG- MLP and 6 mg/kg of HBV specific CRISPR Cas may be envisioned for the present invention. In the alternative, about 3 mg kg of NAG-MLP and 3 mg kg of HBV specific CRISPR Cas may be delivered on day one, followed by administration of about about 2-3 mg/kg of NAG-MLP and 2- 3 mg/kg of HBV specific CRISPR Cas two weeks later.
[00403] The present invention may also be applied to treat hepatitis C virus (HCV). The methods of Roelvinki et al. (Molecular Therapy vol. 20 no, 9, 1737-1749 Sep 2012) may be applied to the CRISPR Cas system. For example, an AAV vector such as AAV8 may be a contemplated vector and for example a dosage of about 1.25 x 10n to 1.25 lGfJ vector genomes per kilogram body weight (vg/kg) may be contemplated.
[00404] It will be readily apparent that a host of other diseases can be treated in a similar fashion. Some examples of genetic diseases caused by mutations are provided herein, but many more are known. The above strategy can be applied to these diseases.
Huntington's Disease (HP)
[00405] RNA interference (RNAi) offers therapeutic potential for this disorder by reducing the expression of HTT, the disease-causing gene of Huntington's disease (see, e.g., McBride et al., Molecular Therapy vol. 19 no. 12 Dec. 201 1, pp. 2152-2162), therefore Applicant postulates that it may be used/and or adapted to the CRISPR-Cas system. The CRISPR-Cas system may be generated using an algorithm to reduce the off-targeting potential of antisense sequences. The CRISPR-Cas sequences may target either a sequence in exon 52 of mouse, rhesus or human huntingtin and expressed in a viral vector, such as AAV. Animals, including humans, may be injected with about three microinjections per hemisphere (six injections total): the first 1 mm rostral to the anterior commissure (12 μΐ) and the two remaining injections (12 μΐ and 10 μΐ, respectively) spaced 3 and 6 mm caudal to the first injection with le!2 vg ml of AAV at a rate of about 1 μΐ/minute, and the needle was left in place for an additional 5 minutes to allow the injectate to diffuse from the needle tip.
[004061 DiFiglia et al. (PNAS, October 23, 2007, vol. 104, no. 43, 17204-17209) observed that single administration into the adult striatum of an siRNA targeting Hit can silence nun an! Htt, attenuate neuronal pathology, and delay the abnormal behavioral phenotype observed in a rapid-onset, viral transgenic mouse model of HD. DiFiglia injected mice intrastriatally with 2 μΐ of Cy3-labeled cc-siRNA-Htt or unconjugated siRNA-Htt at 10 μΜ. A similar dosage of CRISPR Cas targeted to Htt may be contemplated for humans in the present invention, for example, about 5-10 ml of 10 μΜ CRISPR Cas targeted to Htt may be injected intrastriatally. [00407] In another example, Boudreau et al. (Molecular Therapy vol, 17 no. 6 June 2009) injects 5 μΐ of recombinant AAV serotype 2/ 1 vectors expressing htt-specific R Ai virus (at 4 x ΙΟ1" viral genomes/ml) into the straiatum. A similar dosage of CRISPR Cas targeted to Htt may be contemplated for humans in the present invention, for example, about 10-20 ml of 4 x 10f viral genomes/ml) CRISPR Cas targeted to Htt may be injected intrastriatally.
[00408] In another example, a CRISPR Cas targetd to HTT may be administered continuously (see, e.g., Yu et al., Cell 150, 895-908, August 31, 2012). Yu et al. utilizes osmotic pumps delivering 0.25 ml hr (Model 2004) to deliver 300 mg/day of ss-siRNA or phosphate-buffered saline (PBS) (Sigma Aldrich) for 28 days, and pumps designed to deliver 0.5 μΐ/hr (Model 2002) were used to deliver 75 rng/day of the positive control MOE ASQ for 14 days. Pumps (Durect Corporation) were filled with ss-siRNA or MOE diluted in sterile PBS and then incubated at 37 C for 24 or 48 (Model 2004) hours prior to implantatio . Mice were a esthetized with 2.5% isofluorane, and a midline incision was made at the base of the skull. Using stereotaxic guides, a cannula was implanted into the right lateral ventricle and secured with Loctite adhesive, A catheter attached to an Alzet osmotic mini, pump was attached to the cannula, and the pump was placed subcutaneously in the midscapular area. The incision was closed with 5.0 nylon sutures. A similar dosage of CRISPR Cas targeted to Htt may be contemplated for humans in the present invention, for example, about 500 to 1000 g/day CRISPR Cas targeted to Htt may be administered.
[00409] In another example of continuous infusion, Stiles et. al . (Experimental Neurology 233 (2012) 463-471) implanted an intraparenchymal catheter with a titanium needle tip into the right putamen. The catheter was connected to a SynchroMed® II Pump (Medtronic Neurological, Minneapolis, MN) subcutaneously implanted in the abdomen. After a 7 day infusion of phosphate buffered saline at 6 μΙ.Λ¼ν, pumps were re-filled with test article and programmed for continuous delivery for 7 days. About 2,3 to 1 1.52 mg/d of siRNA were infused at varying infusion rates of about 0.1 to 0.5 μΙ.,½.ίη. A similar dosage of CRISPR Cas targeted to Htt may be contemplated for humans in the present invention, for example, about 20 to 200 rng/day CRISPR Cas targeted to Htt may be administered,
[00410] In another example, the methods of US Patent. Publication No. 20130253040 assigned to Sangamo may also be also be adapted from TALES to the CRISPR Cas system of the present invention for treating Huntington's Disease. Nuclejc_acid^
[0Θ411] The invention uses nucleic acids to bind target DNA sequences. This is advantageous as nucleic acids are much easier and cheaper to produce than proteins, and the specificity can be varied according to the length of the stretch where homology is sought. Complex 3-D positioning of multiple fingers, for example is not required.
[00412 J The terms "polynucleotide", "nucleotide", "nucleotide sequence", "nucleic acid" and "Oligonucleotide" are used interchangeably. They refer to a polymeric form of nucleotides of any length, either deoxyribonueleotides or ribonucleotides, or analogs thereof. Polynucleotides may have any three dimensional structure, and may perform any function, known or unknown. The following are non-limiting examples of polynucleotides: coding or non-coding regions of a gene or gene fragment, loc (locus) defined from linkage analysis, exons, nitrons, messenger RNA (niRNA), transfer RNA, ribosomal RNA, short interfering RNA (siRNA), short-hairpin RNA (sh A), micro-RNA (miRNA), ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers. The term also encompasses nucleic-acid-like structures with synthetic backbones, see, e.g., Eckstein, 1991; Baserga et ai., 1992; Milligan, 1993; WO 97/0321 1; WO 96/39154; Mata, 1997; Strauss-Soukup, 1997; and Samstag, 1996. A polynucleotide may comprise one or more modified nucleotides, such as methylated nucleotides and nucleotide analogs. If present, modifications to the nucleotide structure may be imparted before or after assembly of the polymer. The sequence of nucleotides may be interrupted by non-nucleotide components. A polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component,
[00413] As used herein the term "wild type" is a term of the art understood by skilled persons and means the typical form of an organism, strain, gene or characteristic as it occurs in nature as distinguished from mutant or variant forms.
[00414] As used herein the term "variant" should be taken to mean the exhibition of qualities that have a pattern that deviates from what occurs in nature.
[00415] The terms "non-naturally occurring" or "engineered" are used interchangeably and indicate the involvement of the hand of man. The terms, when referring to nucleic acid molecules or polypeptides mean that the nucleic acid molecule or the polypeptide is at least substantially free from at least one other component with which they are naturally associated in nature and as found in nature.
[00416] "Complementarity" refers to the ability of a nucleic acid to form hydrogen bond(s) with another nucleic acid sequence by either traditional Watson-Crick base pairing or other non- traditional types. A percent complementarity indicates the percentage of residues in a nucleic acid molecule which can form hydrogen bonds (e.g., Watson-Crick base pairing) with a second nucleic acid sequence (e.g., 5, 6, 7, 8, 9, 10 out of 10 being 50%, 60%, 70%, 80%, 90%, and 100% complementary). "Perfectly complementary'' means that all the contiguous residues of a nucleic acid sequence will hydrogen bond with the same number of contiguous residues in a second nucleic acid sequence. "Substantially complementary" as used herein refers to a degree of complementarity that is at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 100%, over a region of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, or more nucleotides, or refers to two nucleic acids that hybridize under stringent conditions.
[00417] As used herein, "stringent conditions" for hybridization refer to conditions under which a nucleic acid having complementarity to a target sequence predominantly hybridizes with the target sequence, and substantially does not hybridize to non-target sequences. Stringent conditions are generally sequence-dependent, and vary depending on a number of factors. In general, the longer the sequence, the higher the temperature at which the sequence specifically hybridizes to its target sequence. Non-limiting examples of stringent conditions are described in detail in Tijssen (1993), Laboratory Techniques In Biochemistry And Molecular Biology- Hybridization With Nucleic Acid Probes Part I, Second Chapter "Overview of principles of hybridization and the strategy of nucleic acid probe assay", Elsevier, N.Y. Where reference is made to a polynucleotide sequence, then complementary or partially complementary sequences are also envisaged. These are preferably capable of hybridising to the reference sequence under highly stringent conditions. Generally, in order to maximize the hybridization rate, relatively low-stringency hybridization conditions are selected: about 20 to 25° C lower than the thermal melting point (Tm ). The Tm is the temperature at which 50% of specific target sequence hybridizes to a perfectly complementary probe in solution at a defined ionic strength and pH. Generally, in order to require at least about 85% nucleotide complementarity of hybridized sequences, highly stringent washing conditions are selected to be about 5 to 15° C lower than the Tm . In order to require at least about 70% nucleotide complementarity of hybridized sequences, moderately-stringent washing conditions are selected to be about 15 to 30° C lower than the Tm . Highly permissive (very low stringency) washing co ditions may be as low as 50° C below the Tm , allowing a high level of mis-matching between hybridized sequences. Those skil led in the art will recognize that other physical and chemical parameters in the hybridization a d wash stages can also be altered to affect the outcome of a detectable hybridization signal from a specific level of homology between target and probe sequences. Preferred highly stringent conditions comprise incubation in 50% formamide, 5 - SSC, and 1% SDS at 42° C, or incubation in 5xSSC and 1% SDS at 65° C, with wash in 0.2xSSC and 0.1% SDS at 65° C.
[00418] "Hybridization" refers to a reaction in which one or more polynucleotides react to form a complex that is stabilized via hydrogen bonding between the bases of the nucleotide residues. The hydrogen bonding may occur by Watson Crick base pairing, Hoogstehi binding, or in any other sequence specific manner. The comple may comprise two strands forming a duplex structure, three or more strands forming a multi stranded complex, a single self- hybridizing strand, or any combination of these. A hybridization reaction may constitute a step in a more extensive process, such as the initiation of PGR, or the cleavage of a polynucleotide by an enzyme. A sequence capable of hybridizing with a given sequence is referred to as the "complement" of the given sequence.
[00419] As used herein, the term "genomic locus" or "locus" (plural loci) is the specific location of a gene or D A sequence on a chromosome. A "gene" refers to stretches of DNA or RNA that encode a polypeptide or an RNA chain that has functional role to play in an organism and hence is the molecular unit of heredity in living organisms. For the purpose of this invention it may be considered that genes include regions which regulate the production of the gene product, whether or not such regulatory sequences are adjacent to coding and/or transcribed sequences. Accordingly, a gene includes, but is not necessarily limited to, promoter sequences, terminators, translational regulatory sequences such as ribosome binding sites and internal ribosome entry sites, enhancers, silencers, insulators, boundary elements, replication origins, matrix attachment sites and locus control regions.
[0042(1] As used herein, "expression of a genomic locus" or "gene expression" is the process by which information from a gene is used in the synthesis of a functional gene product. The products of gene expression are often proteins, but in non-protein coding genes such as rRNA genes or tRNA genes, the product is functional RNA. The process of gene expression is used by all known life - eukaryotes (including multicellular organisms), prokaryotes (bacteria and archaea) and viruses to generate functional products to survive. As used herein "expression" of a gene or nucleic acid encompasses not only cellular gene expression, but also the transcription and translation of nucleic acid(s) in cloning systems and in any other context. As used herein, "expression" also refers to the process by which a polynucleotide is transcribed from a DNA template (such as into and mRNA or other RNA transcript) and/or the process by which a transcribed mRNA is subsequently translated into peptides, polypeptides, or proteins. Transcripts and encoded polypeptides may be collectively referred to as "gene product." If the polynucleotide is derived from genomic DN A, expression may include splicing of the mRNA. in a eukaryotie cell.
[00421] The terms "polypeptide", "peptide" and "protein" are used interchangeably herein to refer to polymers of amino acids of any length. The polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non amino acids. The terms also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component. As used herein the term "amino acid" includes natural and/or unnatural or synthetic amino acids, including glycine and both the D or L optical isomers, and amino acid analogs and peptidomimetics.
[00422] As used herein, the term "domain" or "protein domain" refers to a part of a protein sequence that may exist and function independently of the rest of the protein chain.
[00423] As described in aspects of the invention, sequence identity is related to sequence homology. Homology comparisons may be conducted by eye, or more usually, with the aid of readily available sequence comparison programs. These commercially available computer programs may calculate percent (%) homology between two or more sequences and may also calculate the sequence identity shared by two or more amino acid or nucleic acid sequences. In some preferred embodiments, the capping region of the dTALEs described herein have sequences that are at least 95% identical or share identity to the capping region amino acid sequences provided herein.
[00424] Sequence homologies may be generated by any of a number of computer programs known in the art, for example BLAST or FASTA, etc. A suitable computer program for carrying out such an alignment is the GCG Wisconsin Bestfit package (University of Wisconsin, U.S.A; Devereux et ah, 1984, Nucleic Acids Research 12:387). Examples of other software than may perform sequence comparisons include, but are not limited to, the BLAST package (see Ausubei et a!., 1999 ibid - Chapter 18), FASTA (Atschui et ai., 1990, J. Mol. Biol., 403-410) and the GENEWORKS suite of comparison tools. Both BLAST and FASTA are available for offline and online searching (see Ausubei et a!.., 1999 ibid, pages 7-58 to 7-60). However it is preferred to use the GCG Bestfit program.
[00425] Percentage (%) sequence homology may be calculated over contiguous sequences, i.e., one sequence is aligned with the other sequence and each amino acid or nucleotide in one sequence is directly compared with the corresponding amino acid or nucleotide in the other sequence, one residue at a time. This is called an "ungapped" alignment. Typically, such ungapped alignments are performed only over a relatively short number of residues.
[00426] Although this is a very simple and consistent method, it fails to take into consideration that, for example, in an otherwise identical pair of sequences, one insertion or deletion may cause the following amino acid residues to be put out of alignment, thus potential ly resulting in a large reduction in % homology when a global alignment is performed. Consequently, most sequence comparison methods are designed to produce optimal alignments that take into consideration possible insertions and deletions without unduly penalizing the overall homology or identity score. This is achieved by inserting "gaps" in the sequence alignment to try to maximize local homology or identity,
[00427] However, these more complex methods assign "gap pe alties" to each gap that occurs in the alignment so that, for the same number of identical amino acids, a sequence alignment with as few gaps as possible - reflecting higher relatedness between the two compared sequences - may achieve a higher score than one with many gaps. "Affinity gap costs" are typically used that charge a relatively high cost for the existence of a gap and a smaller penalty for each subsequent residue in the gap. This is the most commonly used gap scoring system. High gap penalties may, of course, produce optimized alignments with fewer gaps. Most alignment programs allow the gap penalties to be modified. However, it is preferred to use the default values when using such software for sequence comparisons. For example, when using the GCG Wisconsin Bestfit package the default gap penalty for amino acid sequences is -12 for a gap a d -4 for each extension. [00428] Calculation of maximum % homology therefore first requires the production of an optimal alignment, taking into consideration gap penalties. A suitable computer program for carrying out such an alignment is the GCG Wisconsin Bestflt package (Devereux et al, 1984 Nuc. Acids Research 12 p387). Examples of other software than may perform sequence comparisons include, but are not limited to, the BLAST package (see Ausubel et al,, 1999 Short Protocols in Molecular Biology, 4th Ed, - Chapter 1 8), FA ST A (Altschul et al, 1990 J. Mol. Biol. 403-410) and the GENE WORKS suite of comparison tools. Both BLAST and FASTA are available for offline and online searching (see Ausubel et al., 1999, Short Protocols in Molecular Biology, pages 7-58 to 7-60). However, for some applications, it is preferred to use the GCG Bestfit program. A new tool, called BLAST 2 Sequences is also available for comparing protein and nucleotide sequences (see FEMS Microbiol Lett. 1999 174(2): 247-50; FEMS Microbiol Lett. 1999 177(1): 187-8 and the website of the National Center for Biotechnology information at the website of the National Institutes for Health).
[00429] Although the final % homology may be measured in terms of identity, the alignment process itself is typically not based on an all-or-nothing pair comparison. Instead, a scaled similarity score matrix is generally used that assigns scores to each pair-wise comparison based on chemical similarity or evolutionary distance. An example of such a matrix commonly used is the BLOSUM62 matrix - the default matrix for the BLAST suite of programs. GCG Wisconsin programs generally use either the public default values or a custom symbol comparison table, if supplied (see user manual for further details). For some applications, it is preferred to use the public default values for the GCG package, or in the case of other software, the default matrix, such as BLOSUM62.
[00430] Alternatively, percentage homologies may be calculated using the multiple alignment feature in DNASlSl (Hitachi Software), based on an algorithm, analogous to CLUSTAL (Higgins DG & Sharp PM (1988), Gene 73(1), 237-244). Once the software has produced an optimal alignment, it is possible to calculate % homology, preferably % sequence identity. The software typically does this as part of the sequence comparison and generates a numerical result.
[00431] The sequences may also have deletions, insertions or substitutions of amino acid residues which produce a silent change and result in a functionally equivalent substance. Deliberate amino acid substitutions may be made on the basis of similarity in amino acid properties (such as polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues) and it is therefore useful to group amino acids together in functional groups. Amino acids may be grouped together based on the properties of their side chains alone. However, it is more useful to include mutation data as well. The sets of amino acids thus derived are likely to be conserved for structural reasons. These sets may be described in the form of a Venn diagram (Livingstone CD. and Barton G.J. (1993) ''Protein sequence alignments: a strategy for the hierarchical analysis of residue conservation" Co put. Appl. Biosci. 9: 745-756} (Taylor W.R. ( 1986) "The classification of amino acid conservation" J. Theor. Biol. ] 19; 205-218). Conservative substitutions may be .made, for example according to the table below which describes a generally accepted Venn diagram grouping of amino acids.
Figure imgf000137_0001
0Θ432] Embodiments of the invention include sequences (both polynucleotide or polypeptide) which may comprise homologous substitution (substitution and replacement are both used herein to mean the interchange of an existing amino acid residue or nucleotide, with an alternative residue or nucleotide) that may occur i.e., like-for-like substitution in the case of amino acids such as basic for basic, acidic for acidic, polar for polar, etc. Non-homologous substitution may also occur i.e., from one class of residue to another or alternatively involving the inclusion of unnatural amino acids such as ornithine (hereinafter referred to as Z), diaminobutyric acid ornithine (hereinafter referred to as B), norleucine ornithine (hereinafter referred to as O), pyriylalanine, thienylalanine, naphthyl alanine and phenyl-glycine. [00433] Variant amino acid sequences may include suitable spacer groups that .may be inserted between any two amino acid residues of the sequence including alkyl groups such as methyl, ethyl or propyl groups in addition to amino acid spacers such as glycine or β-alanine residues. A further form of variation, which involves the presence of one or more amino acid residues in peptoid form, may be well understood by those skilled in the art. For the avoidance of doubt, "the peptoid form" is used to refer to variant amino acid residues wherein the a-carbon substituent group is on the residue's nitrogen atom rather than the a-carbon. Processes for preparing peptides in the peptoid form are known in the art, for example Simon RJ et al., PNAS (1992) 89(20), 9367-9371 and Horwell DC, Trends Biotechnol (1995) 13(4), 132-134.
[00434] The practice of the present invention employs, unless otherwise indicated, conventional techniques of immunology, biochemistry, chemistry, molecular biology, microbiology, cell biology, genomics and recombinant DNA, which are within the skill of the art. See Sambrook, Fritsch and Maniatis, MOLECULAR CLONING: A LABORATORY MANUAL, 2nd edition ( 1989); CURRENT PROTOCOLS IN MOLECULAR BIOLOGY (F. M. Ausubel, et al. eds., (1987)); the series METHODS IN ENZYMOLOGY (Academic Press, Inc.): PGR 2: A PRACTICAL APPROACH (M.J. MacPherson, B.D. Hames and G.R. Taylor eds. (1995)), Harlow and Lane, eds. (1988) ANTIBODIES, A LABORATORY MANUAL, and ANIMAL CELL CU LTURE (R.I. Freshney, ed. (1987)).
V ectors
[00435] In one aspect, the invention provides for vectors that are used in the engineering and optimization of CRISPR-Cas systems.
[00436] A used herein, a ''vector" is a tool that allows or facilitates the transfer of an entity from one environment to another. It is a repiicon, such as a plasmid, phage, or cosmid, into which another DNA segment may be inserted so as to bring about the replication of the inserted segment. Generally, a vector is capable of replication when associated with the proper control elements. In general, the term "vector" refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. Vectors include, but are not limited to, nucleic acid molecules that are single-stranded, double-stranded, or partially double-stranded; nucleic acid molecules that comprise one or more free ends, no free ends (e.g. circular); nucleic acid molecules that comprise DNA, RNA, or both; and other varieties of polynucleotides known in the art. One type of vector is a ''plasmid," which refers to a circular double stranded DNA loop into which additional DNA segments can be inserted, such as by standard molecular cloning techniques. Another type of vector is a viral vector, wherein viral ly-derived DNA or RNA sequences are present in the vector for packaging into a virus (e.g. retroviruses, replicatio defective retroviruses, adenoviruses, replication detective adenoviruses, and adeno-associated viruses (AAVs)). Viral vectors also include polynucleotides carried by a vims for transfection into a host cell. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g. bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) are integrated into the genome of a host ceil upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively-1 inked. Such vectors are refen'ed to herein as "expression vectors." Common expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
[00437] Recombinant expression vectors can comprise a nucleic acid of the invention in a form suitable for expression of the nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory elements, which may be selected on the basis of the host cells to be used for expression, that is operatively-linked to the nucleic acid sequence to be expressed. Within a recombinant expression vector, "operably linked" is intended to mean that the nucleotide sequence of interest is linked to the regulatory elements) in a manner that allows for expression of the nucleotide sequence (e.g. in an in vitro transcription/translation system or in a host ceil when the vector is introduced into the host ceil). With regards to recombination and cloning methods, mention is made of U.S. patent application 10/815,730, published September 2, 2004 as US 2004-0171156 Al , the contents of which are herein incorporated by reference in their entirety.
[004381 Aspects of the invention relate to bicistronic vectors for chimeric RNA and Cas9. Bicistronic expression vectors for chimeric RNA and Cas9 are preferred. In general and particularly in this embodiment Cas9 is preferably driven by the CBh promoter. The chimeric RNA may preferably be driven by a U6 promoter. Ideally the two are combined. The chimeric guide RNA typically consists of a 20bp guide sequence (Ns) and this may be joined to the tracr sequence (running from the first "U" of the lower strand to the end of the transcript). The tracr sequence may be truncated at various positions as indicated. The guide and tracr sequences are separated by the tracr-mate sequence, which may be GUUUUAGAGCUA, This may be followed by the loop sequence GAAA as shown. Both of these are preferred examples. Applicants have demonstrated Cas9-mediated indeis at the human EMXl and PVALB loci by SURVEYOR assays. ChiRNAs are indicated by their "+n" designation, and crRNA refers to a hybrid RNA where guide and tracr sequences are expressed as separate transcripts. Throughout this application, chimeric RNA may also be called single guide, or synthetic guide RNA (sgRNA). 'The loop is preferably GAAA, but it is not limited to this sequence or indeed to being only 4bp in length. Indeed, preferred loop forming sequences for use in hairpin structures are four nucleotides in length, and most preferably have the sequence GAAA. However, longer or shorter loop sequences may be used, as may alternative sequences. The sequences preferably include a nucleotide triplet (for example, AAA), and an additional nucleotide (for example C or G). Examples of loop forming sequences include CAAA and AAAG.
[00439] The terrn "'regulatory element" is intended to include promoters, enhancers, internal ribosomal entry sites (IRES), and other expression control elements (e.g. transcription termination signals, such as polyadenylation signals and poiy-U sequences). Such regulatory- elements are described, for example, in Goeddel, GENE EXPRESSION TECHNOLOGY : METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Caiif. (1990). Regulatory elements include those that direct constitutive expression of a nucleotide sequence in many types of host ceil and those that direct expression of the nucleotide sequence only in certain host ceils (e.g., tissue-specific regulator}' sequences). A tissue-specific promoter may direct expression primarily in a desired tissue of interest, such as muscle, neuron, bone, skin, blood, specific organs (e.g. liver, pancreas), or particular cell types (e.g. lymphocytes). Regulatory elements may also direct expression in a temporal-dependent manner, such as in a cell-cycle dependent or developmental stage-dependent manner, which may or may not also be tissue or cell-type specific. In some embodiments, a vector comprises one or more pol III promoter (e.g. 1, 2, 3, 4, 5, or more pol III promoters), one or more pol II promoters (e.g. 1 , 2, 3, 4, 5, or more pol II promoters), one or more pol I promoters (e.g. 1, 2, 3, 4, 5, or more pol I promoters), or combinations thereof. Examples of pol III promoters include, but are not limited to, U6 and HI promoters. Examples of pol II promoters include, but are not limited to, the retroviral Rous sarcoma virus (RSV) LTR promoter (optionally with the RSV enhancer), the cytomegalovirus (CMV) promoter (optionally with the CMV enhancer) [see, e.g., Boshart et al, Cell, 41 :521 -530 (1985)], the SV40 promoter, the dihydrofolate reductase promoter, the β-aethi promoter, the phosphoglycerol kinase (PGK) promoter, and the EE l a promoter. Also encompassed by the term "regulatory element" are enhancer elements, such as WPRE; CMV enhancers; the R-U5' segment in LTR of HTLV-I (Moi. Cell. Biol, Vol. 8(1 ), p. 466-472, 1988); SV40 enhancer; and the intron sequence between exons 2 and 3 of rabbit β-globin (Proe. Natl. Acad. Sci. USA., Vol. 78(3), p. 1527-31 , 1981 ). It will be appreciated by those skilled in the art that the design of the expression vector can depend on such factors as the choice of the host ceil to be transformed, the level of expression desired, etc. A vector can be introduced into host cells to thereby produce transcripts, proteins, or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein (e.g., clustered regularly interspersed short palindromic repeats (CRISPR) transcripts, proteins, enzymes, mutant forms thereof, fusion proteins thereof, etc.). With regards to regulatory sequences, mention is made of U.S. patent application 10/491,026, the contents of which are incorporated by reference herein in their entirety. With regards to promoters, mention is made of PCT publication WO 2011/028929 and U.S. application 12/511,940, the contents of which are incorporated by reference herein in their entirely.
[00440] Vectors can be designed for expression of CRISPR transcripts (e.g. nucleic acid transcripts, proteins, or enzymes) in prokaryotic or eukaryotic cells. For example, CRISPR transcripts can be expressed in bacterial cells such as Escherichia coli, insect cells (using baculovirus expression vectors), yeast cells, or mammalian cells. Suitable host cells are discussed further in Goeddel, GENE EXPRESSION TECHNOLOGY : METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990). Alternatively, the recombinant expression vector can be transcribed and translated in vitro, for example using T7 promoter regulatory sequences and T7 polymerase.
[00441] Vectors may be introduced and propagated in a prokaryote or prokaryotic cell, in some embodiments, a prokaryote is used to amplify copies of a vector to be introduced into a eukaryotic cell or as an intermediate vector in the production of a vector to be introduced into a eukaryotic cell (e.g. amplifying a piasmid as part of a viral vector packaging system). In some embodiments, a prokaryote is used to amplify copies of a vector and express one or more nucleic acids, such as to provide a source of one or more proteins for deliver}' to a host cell or host organism. Expression of proteins in prokaryotes is most often carried out in Escherichia coli with vectors containing constitutive or inducible promoters directing the expression of either fusion or non-fusion proteins. Fusion vectors add a number of amino acids to a protein encoded therein, such as to the amino terminus of the recombinant protein. Such fusion vectors may serve one or more purposes, such as: (i) to increase expression of recombinant protein; (ii) to increase the solubility of the recombinant protein; and (iii) to aid in the purification of the recombinant protein by acting as a ligand in affinity purification. Often, in fusion expression vectors, a proteolytic cleavage site is introduced at the junction of the fusion moiety and the recombinant protein to enable separation of the recombinant protein from the fusion moiety subsequent to purification of the fusion protem. Such enzymes, and their cognate recognition sequences, include Factor Xa, thrombin and enterokinase. Example fusion expression vectors include pGEX (Phannacia Biotech Ine; Smith and Johnson, 1988. Gene 67: 31-40), pMAL (New England Biolabs, Beverly, Mass.) and pPJT5 (Pharmacia, Piscataway, N.J.) that fuse glutathione S-transferase (GST), maltose E binding protein, or protein A, respectively, to the target recombinant protein.
[00442] Examples of suitable inducible non-fusion E. coii expression vectors include pTrc (Amrann et al., (1988) Gene 69:301 -315) and pET l i d (Studier et al, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990) 60-89).
[00443] In some embodiments, a vector is a yeast expression vector. Examples of vectors for expression in yeast Saceharomyces cerivisae include pYepSecl (Baldari, et al., 1987. EMBO J. 6: 229-234), pMFa (Kuijan and Herskowitz, 1982, Cell 30: 933-943), pJRY88 (Schultz et al., 1987. Gene 54: 113-123), pYES2 (Invitrogen Corporation, San Diego, Calif.), and picZ (InVitrogen Corp, San Diego, Calif.),
[00444] In some embodiments, a vector drives protein expression in insect cells using baculovirus expression vectors. Baculovirus vectors available for expression of proteins in cultured insect cells (e.g., SF9 cells) include the pAc series (Smith, et al., 1983. Mol. Cell. Biol. 3: 2156-2165) and the pVL series (Lucklow and Summers, 1989. Virology 170: 31-39).
[00445] In some embodiments, a vector is capable of driving expression of one or more sequences in mammalian cells using a mammalian expression vector. Examples of mammalian expression vectors include pCDMS (Seed, 1987. Nature 329: 840) and pMT2PC (Kaufman, et al., 1987. EMBO J. 6: 187-195). When used in mammalian cells, the expression vector's control functions are typically provided by one or more regulatory elements. For example, commonly used promoters are derived from polyoma, adenovirus 2, cytomegalovirus, simian virus 40, and others disclosed herein and known in the art. For other suitable expression systems for both prokaryotic and eukaryotic ceils see, e.g.. Chapters 16 and 17 of Sambrook, et al., MOLECULAR CLONING: A LABORATORY MANUAL. 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989.
[00446] In some embodiments, the recombinant mammalian expression vector is capable of directing expression of the nucleic acid preferentially in a particular cell type (e.g., tissue- specific regulatory elements are used to express the nucleic acid). Tissue-specific regulatory elements are known in the art. Non-limiting examples of suitable tissue-specific promoters include the albumin promoter (liver-specific; Pinkert, et al, 1987. Genes Dev. 1 : 268-277), lymphoid-speci ic promoters (Calame and Eaton, 1988. Adv. Immunol. 43: 235-275), in. particular promoters of T cell receptors (Winoto and Baltimore, 1989. EMBO J. 8: 729-733) and immunoglobulins (Baneiji, et al, 1983. Cell 33: 729-740; Queen and Baltimore, 1983. Cell 33: 741-748), neuron-specific promoters (e.g., the neurofilament promoter; Byrne and Ruddle, 1989. Proc. Natl Acad. Sci. USA 86: 5473-5477), pancreas-specific promoters (Edlund, et al., 1985. Science 230: 912-916), and mammary gland-specific promoters (e.g., milk whey promoter; U.S. Pat. No. 4,873,316 and European Application Publication No. 264,166). Developmentally- regulated promoters are also encompassed, e.g., the murine hox promoters ( essel and Grass, 1990. Science 249: 374-379) and the a-fetoprotein promoter (Campes and Tilghman, 1989. Genes Dev. 3: 537-546). With regards to these prokaryotic and eukaryotic vectors, mention is made of U.S. Patent 6,750,059, the contents of which are incorporated by reference herein in their entirety. Other embodiments of the invention may relate to the use of viral vectors, with regards to which mention is made of U.S. Patent application 13/092,085, the contents of which are incorporated by reference herein in their entirety. Tissue-specific regulatory elements are known in the art and in this regard, mention is made of U.S. Patent 7,776,321, the contents of which are incorporated by reference herein in their entirety.
Regulator}' elements
[00447] In some embodiments, a regulatory element is operably linked to one or more elements of a CRISPR system so as to drive expression of the one or more elements of the CRISPR system. In general, CRISPRs (Clustered Regularly Interspaced Short Palindromic Repeats), also known as SPBDRs (SPacer Interspersed Direct Repeats), constitute a family of DNA loci that are usually specific to a particular bacterial species. The CRISPR locus comprises a distinct class of interspersed short sequence repeats (SSRs) that were recognized in E. coli (Ishino et al, J. Bacterid., 169:5429-5433 [1987]; and Nakata et al., J. Bacterid., 171 :3553- 3556 [1989]), and associated genes. Similar interspersed SSRs have been identified in Haloferax mediterranei, Streptococcus pyogenes, Anabaena, and Mycobacterium tuberculosis (See, Groenen et al, Mol. Microbiol., 10: 1057-1065 [1993]; Hoe et al, Emerg. Infect. Dis., 5:254-263 [1999]; Masepohl et al., Biochim. Biophys. Acta 1307:26-30 [1996]; and Mojica et al, Mol. Microbiol, 17:85-93 [1995]). The CRISPR loci typically differ from other SSRs by the structure of the repeats, which have been termed short regularly spaced repeats (SRSRs) (Janssen et al., OMICS J. lnteg. Biol., 6:23-33 [2002]; and Mojica et al., Mol. Microbiol, 36:244-246 [2000]). In general, the repeats are short elements that occur in clusters that are regular!)? spaced by unique intervening sequences with a substantially constant length (Mojica et al., [2000], supra). Although the repeat sequences are highly conserved between strains, the number of interspersed repeats and the sequences of the spacer regions typically differ from strain to strain (van Embden et al, J. Bacteriol., 182:2393-2403 [2000]). CRISPR loci have been identified in more than 40 prokaryotes (See e.g., Jansen et al, Mol. Microbiol., 43: 1565-1575 [2002]; and Mojica et al., [2005]) including, but not limited to Aeropyrum, Pyrobaculum, Sulfolobus, Archaeoglobus, Halocarcula, Methanobacterium, Methanococcus, Methanosarcina, Methanopyrus, Pyrococcus, Picrophilus, Thermoplasma, Corynebacterium, Mycobacterium, Streptomyces, Aquifex, Porphyromonas, Chiorobium, Tbermus, Bacillus, Listeria, Staphylococcus, Clostridium, Thermoanaerobacter, Mycoplasma, Fusobacterium, Azarcus, Chromobacterium, Neisseria, Nitrosomonas, Desulfovihrio, Geobacter, Myxococcus, Campylobacter, Wolinella, Acinetobacter, Erwinia, Escherichia, Legionella, Methylococcus, Pasteurella, Photobacterium, Salmonella, Xanthomonas, Yersinia, Treponema, and Thermotoga.
[00448] In general, "CRISPR system" refers collectively to transcripts and other elements involved in the expression of or directing the activity of CR1 SPR-associated ("Cas") genes, including sequences encoding a Cas gene, a tracr (trans-activating CRISPR) sequence (e.g. tracrRNA or an active partial tracrRNA), a tracr-mate sequence (encompassing a "direct repeat" and a tracrRNA -processed partial direct repeat in the context of an endogenous CRISPR system), a guide sequence (also referred to as a "spacer" in the context of an endogenous CRISPR system), or other sequences and transcripts from a CRISPR locus. In embodiments of the invention the terms guide sequence and guide RNA are used interchangeably. In some embodiments, one or more elements of a CRISPR system is derived from a type I, type II, or type III CRISPR system. In some embodiments, one or more elements of a CRISPR system is derived from a particular organism comprising an endogenous CRISPR system, such as Streptococcus pyogenes. I general, a CRISPR system is characterized by elements that promote the formation of a CRISPR complex at the site of a target sequence (also referred to as a protospacer in the context of an endogenous CRISPR system). In the context of formation of a CRISPR complex, "target sequence" refers to a sequence to which a guide sequence is designed to have complementarity, where hybridization between a target sequence and a guide sequence promotes the formation of a CRISPR complex. A target sequence may comprise any polynucleotide, such as DNA or RNA polynucleotides. In some embodiments, a target sequence is located in the nucleus or cytoplasm of a cell.
[00449] in some embodiments, direct repeats may be identified in silico by searching for repetitive motifs that fulfill any or all of the following criteria:
1. found in a 2Kb window of genomic sequence flanking the type I I CR ISPR locus;
2. span from 20 to 50 bp; and
3. interspaced by 20 to 50 bp.
[00450] In some embodiments, 2 of these criteria may be used, for instance 1 and 2, 2 and 3, or 1 and 3. In some embodiments, ail 3 criteria may be used.
[00451 J In some embodiments, candidate tracrRNA may be subsequently predicted b - sequences that fulfill any or all of the following criteria:
1. sequence homology to direct repeats (motif search in Geneious with up to 18-bp mismatches);
2. presence of a predicted Rho-independent transcriptional terminator in direction of transcription; and
3. stable hairpin secondary stmcture between tracrRNA and direct repeat.
[00452] In some embodiments, 2 of these criteria may be used, for instance I and 2, 2 and 3, or 1 and 3. In some embodiments, ail 3 criteria may be used.
[00453 J In some embodiments, chimeric synthetic guide RNAs (sgRNAs) designs may incorporate at least 12 bp of duplex structure between the direct repeat a d tracrRNA. [00454] In preferred embodiments of the invention, the CRISPR system is a type II CRISPR system and the Cas enzyme is Cas9, which catalyzes DNA cleavage. Enzymatic action by Cas9 derived from Streptococcus pyogenes or any closely related Cas9 generates double stranded breaks at target site sequences which hybridize to 20 nucleotides of the guide sequence and that have a protospacer-adjacent motif (PAM) sequence (examples include NGG NRG or a PAM that can be determined as described herein) following the 20 nucleotides of the target sequence. CRISPR activity through Cas9 for site-specific DNA recognition and cleavage is defined by the guide sequence, the traer sequence thai hybridizes in part to the guide sequence and the PAM sequence. More aspects of the CRISPR system are described in arginov and Hannon, The CRISPR system: small RNA-guided defence in bacteria and archaea, Mole Cell 2010, January 15; 37(1): 7.
[00455] The type II CRISPR locus from Streptococcus pyogenes SF370, which contains a cluster of four genes Cas9, Casl , Cas2, and Csnl, as well as two non-coding RNA elements, tracrRNA and a characteristic array of repetitive sequences (direct repeats) interspaced by short stretches of non-repetitive sequences (spacers, about 30bp each). In this system, targeted DNA double-strand break (DSB) is generated in four sequential steps (Fig. 2A). First, two non-coding RNAs, the pre-crRNA array and tracrRNA, are transcribed from the CRISPR locus. Second, tracrRNA hybridizes to the direct repeats of pre-crRNA, which is then processed into mature crRNAs containing individual spacer sequences. Third, the mature crRNA:tracrRNA complex directs Cas9 to the DNA target consisting of the protospacer and the corresponding PAM via heteroduplex formation between the spacer region of the crRNA and the protospacer DNA. Finally, Cas9 mediates cleavage of target DNA upstream of PAM to create a DSB within the protospacer (Fig. 2 A). Fig. 2B demonstrates the nuclear localization of the codon optimized Cas9. To promote precise transcriptional initiation, the RNA polymerase Il l-based U6 promoter was selected to drive the expression of tracrRNA (Fig. 2C). Similarly, a U6 promoter-based construct was developed to express a pre-crRNA array consisting of a single spacer flanked by two direct repeats (DRs, also encompassed by the term "tracr-mate sequences"; Fig, 2C). The initial spacer was designed to target a 33 -base-pair (bp) target site (30-bp protospacer plus a 3 -bp CRISPR motif (PA M) sequence satisfying the NGG recognition motif of Cas9) in the human EMX1 locus (Fig. 2C), a key gene in the d evelopment of the cerebral cortex. [00456] Typically, in the context of an endogenous CRISPR system, formation of a CRISPR complex (comprising a guide sequence hybridized to a target sequence and complexed with one or more Cas proteins) results in cleavage of one or both strands in or near (e.g. within 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 50, or more base pairs from) the target sequence. Without wishing to be bound by theory, the traer sequence, which may comprise or consist of all or a portion of a wild- type tracr sequence (e.g. about or more than about 20, 26, 32, 45, 48, 54, 63, 67, 85, or more nucleotides of a wild-type tracr sequence), may also form part of a CRISPR complex, such as by hybridization along at least a portion of the tracr sequence to all or a portion of a tracr mate sequence that is operably linked to the guide sequence. In some embodiments, one or more vectors driving expression of one or more elements of a CRISPR system are introduced into a host cell such that expression of the elements of the CRISPR system direct formation of a CRISPR complex at one or more target sites. For example, a Cas enzyme, a guide sequence linked to a tracr-mate sequence, and a tracr sequence could each be operably linked to separate regulatory elements on separate vectors. Alternatively, two or more of the elements expressed from the same or different regulatory elements, may be combined in a single vector, with one or more additional vectors providing any components of the CRISPR system not included in the first vector. CRISPR system elements that are combined in a single vector may be arranged in any suitable orientation, such as one element located 5 ' with respect to ("upstream" of) or 3' with respect to ("downstream" of) a second element. The coding sequence of one element may¬ be located on the same or opposite strand of the coding sequence of a second element, and oriented in the same or opposite direction. In some embodiments, a single promoter drives expression of a transcript encoding a CRISPR enzyme and one or more of the guide sequence, tracr mate sequence (optionally operably linked to the guide sequence), and a tracr sequence embedded within one or more intron sequences (e.g. each in a different intron, two or more in at least one intron, or all in a single intron). In some embodiments, the CRISPR enzyme, guide sequence, tracr mate sequence, and tracr sequence are operably linked to and expressed from the same promoter.
[00457] In some embodiments, a vector comprises one or more insertion sites, such as a restriction endonuclease recognition sequence (also referred to as a "cloning site"). In some embodiments, one or more msertion sites (e.g. about or more than about I, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more insertion sites) are located upstream and/or downstream of one or more sequence elements of one or more vectors. In some embodiments, a vector comprises an insertion site upstream of a tracr mate sequence, and optionally downstream of a regulatory element operably linked to the tracr mate sequence, such that following insertion of a guide sequence into the insertion site and upon expression the guide sequence directs sequence-specific binding of a CRISPR complex to a target sequence in a eukaryotic cell. In some embodiments, a vector comprises two or more insertion sites, each insertion site being located between two tracr mate sequences so as to allow insertion of a guide sequence at each site. In such an arrangement, the two or more guide sequences may comprise two or more copies of a single guide sequence, two or more different guide sequences, or combinations of these. When multiple different guide sequences are used, a single expression construct may be used to target CRISPR activity to multiple different, corresponding target sequences within a cell. For example, a single vector may comprise about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or more guide sequences. In some embodiments, about or more than about 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, or more such guide-sequence-containing vectors may be provided, and optionally delivered to a cell.
[00458] In some embodiments, a vector comprises a regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme, such as a Cas protein. Non-limiting examples of Cas proteins include Casl, Casl B, Cas2, Cas3, Cas4, Cas5, Cas6, Cas7, Cas8, Cas9 (also known as Csn l and Csxl2), Cas 10, Csyl, Csy2, Csy3, Csel, Csc2, Cscl, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmrl, Cmr3, Cmr4, Cmr5, Cmr6, Csbl, Csb2, Csb3, Csxl7, Csx l4, CsxlO, Csx16, CsaX, Csx3, Csxl, Csx15, Csfl , Csf2, Csf3, Csf4, homologies thereof, or modified versions thereof. In some embodiments, the unmodified CRISPR enzyme has DNA cleavage activity, such as Cas9. In some embodiments, the CRISPR. enzyme directs cleavage of one or both strands at the location of a target sequence, such as within the target sequence and/or within the complement of the target sequence. In some embodiments, the CRISPR enzyme directs cleavage of one or both strands within about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 50, 100, 200, 500, or more base pairs from the first or last nucleotide of a target sequence. In some embodiments, a vector encodes a CRISPR enzyme that is mutated to with respect to a corresponding wild-type enzyme such that the mutated CRISPR enzyme lacks the ability to cleave one or both strands of a target polynucleotide containing a target sequence. For example, an aspartate-to-alanine substitution (D10A) in the RuvC I catalytic domain of Cas9 from S. pyogenes converts Cas9 from a nuclease that cleaves both strands to a nickase (cleaves a single strand). Other examples of mutations that render Cas9 a nickase include, without limitation, H840A, N854A, and N863A. As a further example, two or more catalytic domains of Cas9 (RuvC I, RuvC II, and RuvC III or the HNH domain) may be mutated to produce a mutated Cas9 substantially lacking all DNA cleavage activity. In some embodiments, a D10A mutation is combined with one or more of H840A, N854A, or N863A mutations to produce a Cas9 enzyme substantially lacking all DNA cleavage activity. In some embodiments, a CR iSPR enzyme is considered to substantially lack all DNA cleavage activity when the DNA cleavage activity of the mutated enzyme is less than about 25%, 10%, 5%, 1 %, 0.1 %, 0.01 %, or lower with respect to its non-mutated form. Where the enzyme is not SpCas9, mutations may be made at any or all residues corresponding to positions 10, 762, 840, 854, 863 and/or 986 of SpCas9 (which may be ascertained for instance by standard sequence comparison tools . In particular, any or all of the following mutations are preferred in SpCas9: D10A, E762A, H840A, N854A, N863A and/or D986A; as well as conservative substitution for any of the replacement amino acids is also envisaged. The same (or conservative substitutions of these mutations) at corresponding positions in other Cas9s are also preferred. Particularly preferred are D10 and H840 in SpCas9 . However, in other Cas9s, residues corresponding to SpCas9 D10 and H840 are also preferred.
[00459] An aspartate-to-alanine substitution (D10A) in the RuvC I catalytic domain of SpCas9 was engineered to convert the nuclease into a nickase (SpCas9n) (see e.g. Sapranauskas et a!., 2011 , Nucleic Acis Research, 39: 9275; Gasiunas et a!,, 2012, Proc. Natl. Acad. Sci. USA, 109:E2579), such that nicked genomic DNA undergoes the high-fidelity homoiogy-directed repair (HDR), Surveyor assay confirmed that SpCas9n does not generate indels at the EMX! protospacer target. Co-expression of EMX 1 -targeting chimeric crRNA (having the tracrRNA component as well) with SpCas9 produced indels in the target site, whereas co-expression with SpCas9n did not (n=3). Moreover, sequencing of 327 amplicons did not detect any indels induced by SpCas9n. The same locus was selected to test CRISPR-mediated HR by co- transfecting HE 293FT cells with the chimeric RNA targeting EMX1 , hSpCas9 or hSpCas9n, as well as a HR template to introduce a pair of restriction sites (Hindlll and Nhel) near the protospacer.
[00460] Preferred ortiioiogs are described herein. A Cas enzyme may be identified Cas9 as this can refer to the general class of enzymes that share homology to the biggest nuclease with multiple nuclease domains from the type II CRISPR system. Most preferably, the Cas9 enzyme is from, or is derived from, spCas9 or saCas9. By derived, Applicants mean that the derived enzyme is largely based, in the sense of having a high degree of sequence homology with, a wifdtype enzyme, but that it has been mutated (modified) in some way as described herein.
[00461] It will be appreciated that the terms Cas and CRISPR enzyme are generally used herein interchangeably, unless otherwise apparent. As mentioned above, many of the residue numberings used herein refer to the Cas9 enzyme from the type II CRISPR locus in Streptococcus pyogenes. However, it will be appreciated that this invention includes many more Cas9s from other species of microbes, such as SpCas9, SaCa9, Stl Cas9 and so forth.
Codon opJijniz jon
[004-62] An example of a codon optimized sequence, in this instance optimized for humans (i.e. being optimized for expression in humans) is provided herein, see the SaCas9 human codon optimized sequence. Whilst this is preferred, it wil l be appreciated that other examples are possible and codon optimization for a host species is known.
[00463] In some embodiments, an enzyme coding sequence encoding a CRISPR enzyme is codon optimized for expression in particular ceils, such as eukaryotic cells. The eukaryotic cells may be those of or derived from a particular organism, such as a mammal, including but not limited to human, mouse, rat, rabbit, dog, or non-human mammal or primate. In some embodiments, processes for modifying the germ line genetic identity of human beings and/or processes for modifying the genetic identity of animals which are likely to cause them suffering without any substantial medical benefit to man or animal, and also animals resulting from such processes, may be excluded.
[00464] In general, codon optimization refers to a process of modifying a nucleic acid sequence for enhanced expression in the host cells of interest by replacing at least one codon (e.g. about or more than about 1 , 2, 3, 4, 5, 10, 15, 20, 25, 50, or more codons) of the native sequence with codons that are more frequently or most frequently used in the genes of that host cel l while maintaining the native amino acid sequence. Various species exhibit particular bias for certain codons of a particular amino acid. Codon bias (differences In codon usage between organisms) often correlates with the efficiency of translation of messenger RJN A (mRNA), which is in turn believed to be dependent on, among other things, the properties of the codons being translated and the availability of particular transfer RNA (tRNA) molecules. The predominance of selected tRNAs in a cell is generally a reflection of the codons used most frequently in peptide synthesis. Accordingly, genes can be tailored for optimal gene expression in a given organism based on codon optimization. Codon usage tables are readily available, for example, at the "Codon Usage Database" available at www.kazusa.orjp/codoii/ (visited Jul. 9, 2002), and these tables can be adapted in a number of ways. See Nakamura, Y., et al. "Codon usage tabulated from the international DNA sequence databases: status for the year 2000" Nucl. Acids Res. 28:292 (2000). Computer algorithms for codon optimizing a particular sequence for expression in a particular host cell are also available, such as Gene Forge (Aptagen; Jacobus, PA), are also available. In some embodiments, one or more codons (e.g. 1 , 2, 3, 4, 5, 10, 15, 20, 25, 50, or more, or all codons) in a sequence encoding a CRISPR enzyme correspond to the most frequently used codon for a particular amino acid.
Nuclear localization sequences (NLSs)
[CI 465] in some embodiments, a vector encodes a CRISPR enzyme comprising one or more nuclear localization sequences (NLSs), such as about or more than about I, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs. In some embodiments, the CRISPR enzyme comprises about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs at or near the amino-terminus, about or more than about 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs at or near the carboxy-terminus, or a combination of these (e.g. one or more N LS at the amino-terminus and one or more NLS at the earboxy terminus). When more than one NLS is present, each may be selected independently of the others, such that a single NLS may be present in more than one copy and/or in combination with one or more other NLSs present in one or more copies. In a preferred embodiment of the invention, the CRISPR enzyme comprises at most 6 NLSs. In some embodiments, an NLS is considered near the N- or C-terminus when the nearest amino acid of the NLS is within about 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 40, 50, or more amino acids along the polypeptide chain from the N~ or C-terminus. Non-limiting examples of NLSs include an NLS sequence derived from: the NLS of the SV40 virus large T-antigen, having the amino acid sequence PKKKJRKV; the NLS from rsueieoplasmin (e.g. the nuc!eop!asmin bipartite NLS with the sequence KRPAATKKAGQAKKKK); the c-myc NLS having the amino acid sequence PAAKRVKLD or RQRRNELKRSP; the hRNPAl 9 NLS having the sequence NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY; the sequence
RMRIZFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV of the IBB domain from importin-alpha; the sequences VSRKRPRP and PPKKARED of the myoma T protein; the sequence PGPKK PL of human p53; the sequence S/\ ! . I .V1 ,\P of mouse c-abl IV; the sequences DRLRR and P QKKR of the influenza virus NS 1 ; the sequence RKLKKKIKKL of the Hepatitis vims delta antigen; the sequence RE K FL R . of the mouse Mx l protein; the sequence KLR GDEVDG\7DEVAKI SK of the human poly(ADP-ribose) polymerase; and the sequence R CLQAGM LEARKTKK of the steroid hormone receptors (human) glucocorticoid.
[00466] In general, the one or more NLSs are of sufficient strength to drive accumulation of the CRISPR enzyme in a detectable amount in the nucleus of a eukaryotic cell. In general, strength of nuclear localization activity may derive from the number of NLSs in the CRISPR. enzyme, the particular NLS(s) used, or a combination of these factors. Detection of accumulation in the nucleus may be performed by any suitable technique. For example, a detectable marker may be fused to the CR ISPR enzyme, such that location within a cell may be visualized, such as in combination with a means for detecting the location of the nucleus (e.g. a stain specific for the nucleus such as DAPI). Cell nuclei may also be isolated from cells, the contents of which may then be analyzed by any suitable process for detecting protein, such as immunohistochemistry, Western blot, or enzyme activity assay. Accumulation in the nucleus may also be determined indirectly, such as by an assay for the effect of CRISPR complex formation (e.g. assay for DNA cleavage or mutation at the target sequence, or assay for altered gene expression activity affected by CR ISPR complex formation and/or CRISPR enzyme activity), as compared to a control no exposed to the CRISPR enzyme or complex, or exposed to a CRISPR enzyme lacking the one or more NLSs.
Guide sequence
[00467] In general, a guide sequence is any polynucleotide sequence having sufficient complementarity with a target polynucleotide sequence to hybridize with the target sequence and direct sequence-specific binding of a CRISPR complex to the target sequence. In some embodiments, the degree of complementarity between a guide sequence and its corresponding target sequence, when optimally aligned using a suitable alignment algorithm, is about or more than about 50%, 60%, 75%, 80%, 85%, 90%, 95%, 97.5%, 99%, or more. Optimal alignment may be determined with the use of any suitable algorithm for aligning sequences, non-limiting example of which include the Smith -Waterman algorithm, the Needleman-Wunsch al gorithm. algorithms based on the Burrows- Wheeler Transform (e.g. the Burrows Wheeler Aligner), ClustalW, Chistai X, BEAT, Novoalign (Novocraft Technologies; available at www.novocraft.com), ELAND (Alumina, San Diego, CA), SOAP (available at soap.genomics.org.cn), and Maq (available at maq.sourceforge.net). In some embodiments, a guide sequence is about or more than about 5, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 75, or more nucleotides in length, hi some embodiments, a guide sequence is less than about 75, 50, 45, 40, 35, 30, 25, 20, 15, 12, or fewer nucleotides in length. The ability of a guide sequence to direct sequence-specific binding of a CRISPR complex to a target sequence may be assessed by any suitable assay. For example, the components of a CRISPR system sufficient to form a CRISPR complex, including the guide sequence to be tested, may be provided to a host cell having the corresponding target sequence, such as by transfection with vectors encoding the components of the CRISPR sequence, followed by an assessment of preferential cleavage within the target sequence, such as by Surveyor assay as described herein. Similarly, cleavage of a target polynucleotide sequence may be evaluated in a test tube by providing the target sequence, components of a CRISPR complex, including the guide sequence to be tested and a control guide sequence different from the test guide sequence, and comparing binding or rate of cleavage at the target sequence between the test and control guide sequence reactions. Other assays are possible, and will occur to those skilled in the art.
[00468] A guide sequence may be selected to target any target sequence. In some embodiments, the target sequence is a sequence within a genome of a cel l. Exemplar}' target sequences include those that are unique in the target genome. For example, for the S. pyogenes Cas9, a unique target sequence in a genome may include a Cas9 target site of the form MMMMMMMMNNNNNNNNNNNNXGG where NNNNNNNNNNNNXGG (N is A, G, T, or C; and X can be anything) has a single occurrence in the genome. A unique target sequence in a genome may include an S. pyogenes Cas9 target site of the form MMMMMMMMMNNNNNNNNNNNXGG where NNNNNNNNNNNXGG (N is A, G, T, or C; and X can be anything) has a single occurrence in the genome. For the S. thermophilics CRISPRl Cas9, a unique target sequence in a genome may include a Cas9 target site of the form MMMMM MMMNNNNNNNNNNNNXXAGAAW where NNNNN NN NNNNNXX AG A A W (N is A, G, T, or C; X can be anything; and W is A or T) has a single occurrence in the genome, A unique target sequence in a genome may include an S. thermophilus CRISPRl Cas9 target site of the form MMMM MMMMNNNNNNNNNNNXXAGAAW where
NNNNNNNNNNNXXAGAAW (N is A, G, T, or C; X can be anything; and W is A or T) has a single occurrence in the genome. For the S. pyogenes Cas9, a uiiiqiie target sequence in a genome may include a Cas9 target site of the form MMMMN1MMM NMN NNN NNXGGXG where NNNNNNNNNNNNXGGXG (N is A, G, T, or C; and X can be anything) has a single occurrence in the genome. A unique target sequence in a genome may include an S. pyogenes Cas9 target site of the form MMMMMMMMMNNNNNNNNNNNXGGXG where NNNNNNNNNNNXGGXG (N is A, G, T, or C; and X can be anything) has a single occurrence in the genome. In each of these sequences "M" may be A, G, T, or C, and need not be considered in identifying a sequence as unique.
[00469] In some embodiments, a guide sequence is selected to reduce the degree secondary structure within the guide sequence. In some embodiments, about or less than about 75%, 50%, 40%, 30%), 25%,, 20%, 15%, 10%, 5%», 1%,, or fewer of the nucleotides of the guide sequence participate in self-complementary base pairing when optimally folded. Optimal folding may be determined by any suitable polynucleotide folding algorithm. Some programs are based on calculating the minimal Gibbs tree energy. An example of one such algorithm is mFokl, as described by Zuker and Stiegier (Nucleic Acids Res. 9 ( 1981 ), 133- 148). Another example folding algorithm is the online webserver RNAfoid, developed at Institute for Theoretical Chemistry at the University of Vienna, using the centroid structure prediction algorithm (see e.g. A.R. Gruber et al, 2008, Cell 106(1): 23-24; and PA Carr and GM Church, 2009, Nature Biotechnology 27(12): 1 151-62).
Tracr mate sequence
[00470] In general, a tracr mate sequence includes any sequence that has sufficient complementarity with a tracr sequence to promote one or more of: ( 1 ) excision of a guide sequence flanked by tracr mate sequences in a cell containing the corresponding tracr sequence; and (2) formation of a CRISPR complex at a target sequence, wherein the CRISPR complex comprises the tracr mate sequence hybridized to the tracr sequence. In general, degree of com lementarity is with reference to the optimal alignment of the tracr mate sequence and tracr sequence, along the length of the shorter of the two sequences. Optimal alignment may be determined by any suitable alignment algorithm, and may further account for secondary structures, such as self-complementarity within either the tracr sequence or tracr mate sequence. In some embodiments, the degree of complementarity between the tracr sequence and tracr mate sequence along the length of the shorter of the two when optimally aligned is about or more than about 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97.5%, 99%, or higher. In some embodiments, the tracr sequence is about or more than about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 40, 50, or more nucleotides in length. In some embodiments, the tracr sequence and tracr mate sequence are contained within a single transcript, such that hybridization between the two produces a transcript having a secondary structure, such as a hairpin. In an embodiment of the invention, the transcript or transcribed polynucleotide sequence has at least two or more hairpins. In preferred embodiments, the transcript has two, three, four or five hairpins. In a further embodiment of the invention, the transcript has at most five hairpins. In a hairpin structure the portion of the sequence 5' of the final "N" and upstream of the loop corresponds to the tracr mate sequence, and the portion of the sequence 3' of the loop corresponds to the tracr sequence Further non-limiting examples of single polynucleotides comprising a guide sequence, a tracr mate sequence, and a tracr sequence are as follows (listed 5' to 3'), where "N" represents a base of a guide sequence, the first block of lower case letters represent the tracr mate sequence, and the second block of lower case letters represent the tracr sequence, and the final poly-T sequence represents the transcription terminator: (1) isnsnsnsnsnsnsnsnsn^
ggcttcatgccgaaatcaacaccctgtcattttatggcagggtgttttcgttatttaa rTTTTT; (2) \\\\\\\\\\\\\\N NN NN NuiU!igu ;icf ai5AAAigcagn uciaci!aaga!i!a ucUcaiucce aaatcaacaccctgtcattttatggcagggtgttttcgttatttaaTTTTTT; (3) N N N NNNNNNNNNNNNNgtmtgtactctcaGAAAtgcagaagctacaaagataaggcttcatgccg aaatcaacaccctgtcattttatggcagggtgtTTTTTT; (4) N N N NNNNNNNNNNNNNNgttttagagctaGA^ tagcaagttaaaataaggctagtccgttatcaactt gaaaaagtggcaccgagtcggtgcTTTTTT; (5) N N N N NN gttttagagctaGAAATAGcaagttaaaataaggctagtccgttatcaac ttgaaaaagtgTTTTTTT; and (6)
'N N NN NNNNNNgttttagagctagAAATAGcaagttaaaataaggctagtccgttatcaTT TTTTTT. In some embodiments, sequences (I) to (3) are used in combination with Cas9 from S. thermophilus CRISPRl. In some embodiments, sequences (4) to (6) are used in combination with Cas9 from S. pyogenes. In some embodiments, the tracr sequence is a separate transcript from a transcript comprising the tracr mate sequence.
Recombination template
[00471] in some embodiments, a recombination template is also provided. A recombination template may be a component of another vector as described herein, contained in a separate vector, or provided as a separate polynucleotide. In some embodiments, a recombination template is designed to serve as a template in homologous recombination, such as within or near a target sequence nicked or cleaved by a CRISPR enzyme as a part of a CRISP complex. A template polynucleotide may be of any suitable length, such as about or more than about 10, 15, 20, 25, 50, 75, 100, 150, 200, 500, 1000, or more nucleotides in length. In some embodiments, the template polynucleotide is complementary to a portion of a polynucleotide comprising the target sequence. When optimally aligned, a template polynucleotide might overlap with one or more nucleotides of a target sequences (e.g. about or more than about 1 , 5, 10, 15, 20, or more nucleotides). In some embodiments, when a template sequence and a polynucleotide comprising a target sequence are optimally aligned, the nearest nucleotide of the template polynucleotide is within about 1 , 5, 10, 15, 20, 25, 50, 75, 100, 200, 300, 400, 500, 1000, 5000, 10000, or more nucleotides from the target sequence.
Fusion protein
[00472] In some embodiments, the CRISPR enzyme is part of a fusion protein comprising one or more heterologous protein domains (e.g. about or more than about 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, or more domains i addition to the CRISPR enzyme). A CRISPR enzyme fusion protein may comprise any additional protein sequence, and optionally a linker sequence between any two domains. Examples of protein domains that may be fused to a CR ISPR enzyme include, without limitation, epitope tags, reporter gene sequences, and protein domains having one or more of the following activities: methylase activity, demethylase activity, transcription activation activity, transcription repressio activity, transcription release factor activity, histone modification activity, RNA cleavage activity and nucleic acid binding activity. Non-limiting examples of epitope tags include histidine (His) tags, V5 tags, FLAG tags, influenza hemagglutinin (HA) tags, Myc tags, VSV-G tags, and thioredoxin (Trx) tags. Examples of reporter genes include, but are not limited to, glutathione-S-transferase (GST), horseradish peroxidase (HRP), chloramphenicol acetyltransferase (CAT) beta-galactosidase, beta-glucuronidase, luciferase, green fluorescent protein (GFP), HcRed, DsRed, cyan fluorescent protein (CFP), yellow fluorescent protein (YFP), and autofluorescent proteins including blue fluorescent protein (BFP). A CRISPR enzyme may be fused to a gene sequence encoding a protein or a fragment of a protein that bind DNA molecules or bind other cellular molecules, including but not limited to maltose binding protein (MBP), S-tag, Lex A DNA binding domain (DBD) fusions, GAL4 DNA binding domain fusions, and herpes simplex virus (F1SV) BP 16 protein fusions. Additional domains that may form part of a fusion protein comprising a CRISPR enzyme are described in US20110059502, incorporated herein by reference. In some embodiments, a tagged CRISPR enzyme is used to identify the location of a target sequence.
Inducible sysi
[00473 J In some embodiments, a CRISPR enzyme may form a component of an inducible system. The inducible nature of the system would allow for spatiotemporai control of gene editing or gene expression using a form of energy. The form of energy may include but is not limited to electromagnetic radiation, sound energy, chemical energy and thermal energy. Examples of inducible system include tetracycline inducible promoters (Tet-On or Tet-Off), small molecule two-hybrid transcription activations systems (FKBP, ABA, etc), or light inducible systems (Phytochrome, LOV domains, or cryptochrome).Ln one embodiment, the CRISPR enzyme may be a part of a Light Inducible Transcriptional Effector (LITE) to direct changes in transcriptional activity in a sequence-specific manner. The components of a light may include a CRISPR enzyme, a light-responsive cytochrome heterodimer (e.g. from Arabidopsis thaliana), and a transcriptional activation/repression domain. Further examples of inducible DNA binding proteins and methods for their use are provided in US 61/736465 and US 61/721,283, which is hereby incorporated by reference in its entirety.
Delive y
[00474] In some aspects, the invention provides methods comprising delivering one or more polynucleotides, such as or one or more vectors as described herein, one or more transcripts thereof, and/or one or proteins transcribed therefrom, to a host cell. In some aspects, the invention further provides ceils produced by such methods, and animals comprising or produced from such cells. In some embodiments, a CRISPR enzyme in combination with (and optionally complexed with) a guide sequence is delivered to a cell Conventional viral and non-viral based gene transfer methods can be used to introduce nucleic acids in mammalian cells or target tissues. Such methods can be used to administer nucleic acids encoding components of a CRISPR system to ceils in culture, or in a host organism. Non-viral vector delivery systems include DNA plasniids, RNA (e.g. a transcript of a vector described herein), naked nucleic acid, and nucleic acid complexed with a delivery vehicle, such as a liposome. Viral vector delivery systems include DNA and RNA viruses, which have either episomai or integrated genomes after delivery to the cell. For a review of gene therapy procedures, see Anderson, Science 256:808- 8 13 (1992); Nabcl & Feigner, T1BTECH 1 1 :2 1 1-217 ( 1993); Mitani & Caskey, TIBTECH 11 : 162-166 (1993); Dillon, TIBTECH 11 : 167-175 (1993); Miller, Nature 357:455-460 (1992); Van Brant, Biotechnology 6(10): 1 149-1 154 (1988); Vigne, Restorative Neurology and Neuroscience 8:35-36 (1995); Kremer & Petri caudet, British Medical Bulletin 51(1):31 ~44 (1995); Haddada et al, in Current Topics in Microbiology and Immunology Doerfler and Bohm (eds) (1995); and Yu et al., Gene Therapy 1 : 13-26 (1994).
[00475] Methods of non-viral deliver)? of nucleic acids include lipofection, microinjection, biolisties, virosomes, liposomes, immunoliposomes, polycation or lipid:nucleic acid conjugates, naked DNA, artificial virions, and agent-enhanced uptake of DNA. Lipofection is described in e.g., U.S. Pat. Nos. 5,049,386, 4,946,787; and 4,897,355) and lipofection reagents are sold commercially (e.g., Transfectam™ and Lipofectin™). Cationic and neutral lipids thai are suitable for efficient receptor-recognition lipofection of polynucleotides include those of Feigner, WO 91/17424; WO 91/16024, Delivery can be to cells (e.g. in vitro or ex vivo administration) or target tissues (e.g. in vivo administration).
[00476] The preparation of lipid:nucleic acid complexes, including targeted liposomes such, as immunolipid complexes, is well known to one of skill in the art (see, e.g., Crystal, Science 270:404-410 ( 1995); Blaese et al., Cancer Gene Ther. 2:291-297 ( 1995); Behr et al, Bioconjugate Chem. 5:382-389 (1994); Remy et al., Bioconjugate Chem. 5:647-654 (1994); Gao et al., Gene Therapy 2:710-722 (1995); Ahmad et al, Cancer Res. 52:4817-4820 ( 1992); U.S. Pat. Nos, 4,186,183, 4,217,344, 4,235,871 , 4,261 ,975, 4,485,054, 4,501,728, 4,774,085, 4,837,028, and 4,946,787).
[00477] The use of RNA or DNA viral based systems for the delivery of nucleic acids take advantage of highly evolved processes for targeting a virus to specific cells in the body and trafficking the viral payload to the nucleus. Viral vectors can be administered directly to patients (in vivo) or they can be used to treat cells in vitro, and the modified cells may optionally be administered to patients (ex vivo). Conventional viral based systems could include retroviral, lentivirtis, adenoviral, adeno-associated and herpes simplex virus vectors for gene transfer. Integration in the host genome is possible with the retrovirus, lentivirus, and adeno-associated virus gene transfer methods, often resulting in long term expression of the inserted transgene. Additionally, high transduction efficiencies have been observed in many different cell types and target tissues.
[004781 The tropism of a retrovirus can be altered by incorporating foreign envelope proteins, expanding the potential target population of target cells. Lenti iral vectors are retroviral vectors that are able to transduce or infect non-dividing cells and typically produce high viral titers. Selection of a retroviral gene transfer system would therefore depend on the target tissue. Retroviral vectors are comprised of cis-acting long terminal repeats with packaging capacity for up to 6-10 kb of foreign sequence. The minimum cis-acting LT s are sufficient for replication and packaging of the vectors, which are then used to integrate the therapeutic gene into the target cell to provide permanent transgene expression. Widely used retroviral vectors include those based upon murine leukemia virus (MuLV), gibbon ape leukemia virus (GaLV), Simian Immuno deficiency virus (SIV), human immuno deficiency virus (HIV), and combinations thereof (see, e.g., Buchscher et al, J. Virol. 66:2731-2739 (1992); Johann et al., J. Virol. 66:1635-1640 (1992): Sommnerfelt et al, Virol. 176:58-59 ( 1990); Wilson et al., J. Virol. 63:2374-2378 (1989): Miller et ai„ J. Virol. 65:2220-2224 (1991): PCT/US94/05700).
[0047 J In another embodiment, Coca! vesiculovirus envelope pseudotyped retroviral, vector particles are contemplated (see, e.g., US Patent Publication No. 20120164118 assigned to the Fred Hutchinson Cancer Research Center). Coca! virus is in the Vesiculovirus genus, and is a causative agent of vesicular stomatitis in mammals. Coca virus was originally isolated from mites in Trinidad (Jonkers et al, Am. J. Vet. Res. 25:236-242 (1964)), and infections have been identified in Trinidad, Brazil, and Argentina from insects, cattle, and horses. Many of the vesiculoviruses that infect mammals have been isolated from naturally infected arthropods, suggesting that they are vector-borne. Antibodies to vesiculoviruses are common among people living in rural areas where the viruses are endemic and laboratory-acquired; infections in humans usuall result in influenza-like symptoms. The Cocal virus envelope glycoprotein shares 71.5% identity at the amino acid level with VSV-G Indiana, and phyiogenetic comparison of the envelope gene of vesiculoviruses shows that Cocal virus is serologically distinct from, but most closely related to, VSV-G Indiana strains among the vesiculoviruses. Jonkers et al, Am. J. Vet. Res. 25:236-242 (1964) and Travassos da Rosa et al., Am. J. Tropical Med. & Hygiene 33:999- 1006 (1984). The Cocal vesiculovirus envelope pseudotyped retroviral vector particles may include for example, lenti viral, alpharetroviral, betaretroviral, gammaretroviral, deltaretro viral, and epsilonretro iral vector particles that may comprise retroviral Gag, Pol, and/or one or more accessory protein(s) and a Coca! vesiculovirus envelope protein. Within certain aspects of these embodiments, the Gag, Pol, and accessory proteins are lentiviral and/or gammaretroviral .
[00480] In applications where transient expression is preferred, adenoviral based systems may be used. Adenoviral based vectors are capable of very high transduction efficiency in many cell types and do not require cell division. With such vectors, high titer and levels of expression have been obtained. This vector can be produced in large quantities in a re!ativeiy simple system..
[00481] Adeno-associated virus ("AAV") vectors may also be used to transduce cells with target nucleic acids, e.g., in the in vitro production of nucleic acids and peptides, and for in vivo and ex vivo gene therapy procedures (see, e.g., West et al., Virology 160:38-47 (1987); U.S. Pat. No. 4,797,368; WO 93/24641; Kotin, Human Gene Therapy 5:793-801 (1994); Muzyczka, J. Clin. Invest. 94: 1351 (1994). Construction of recombinant AAV vectors are described in a number of publications, including U.S. Pat. No. 5,173,414; Tratschin et al., Mol. Cell. Biol. 5:3251-3260 (1985); Tratschin, et a!., Mol. Cell. Biol. 4:2072-2081 (1984); Hermonat & Muzyczka, PNAS 81 :6466-6470 (1984); and Samulski et a!.. J. Virol. 63:03822-3828 (1989).
[00482] Packaging cells are typically used to form virus particles that are capable of infecting a host cell. Such cells include 293 cells, which package adenovirus, and ψ2 cells or PA317 cells, which package retrovirus. Viral vectors used in gene therapy are usually generated by producer a cell !ine that packages a nucleic acid vector into a viral particle. The vectors typically contain the minimal viral sequences required for packaging and subsequent integration into a host, other viral sequences being replaced by an expression cassette for the polynuc! eotide(s) to be expressed. The missing viral functions are typically supplied in trans by the packaging cell line. For example, AAV vectors used in gene therapy typically only possess ITR sequences from the AAV genome which are required for packaging and integration into the host genome. Viral DNA is packaged in a cell line, which contains a helper plasmid encoding the other AAV genes, namely rep and cap, but lacking ITR sequences. The cell line may also infected with adenovirus as a helper. The helper virus promotes replication of the AAV vector and expression of AAV genes from the helper plasmid. The helper plasmid is not packaged in significant amounts due to a lack of IT R sequences. Contamination with adenovirus can be reduced by, e.g., heat treatment to which adenovirus is more sensitive than AAV.
[00483] Accordingly, AAV is considered an ideal candidate for use as a transducing vector. Such AAV transducing vectors can comprise sufficient cis-acting functions to replicate in the presence of adenovirus or herpesvirus or pox virus (e.g., vaccinia vims) helper functions provided in trans. Recombinant AAV (rAAV) can be used to carry exogenous genes into cells of a variety of lineages. In these vectors, the AAV cap and/or rep genes are deleted from the viral genome and replaced with a DNA segment of choice. Current AAV vectors may accommodate up to 4300 bases of inserted DNA.
[00484 J There are a number of ways to produce rAAV, and the invention provides rAAV and methods for preparing rAAV. For example, plasmid(s) containing or consisting essentially of the desired viral construct are transfected into AAV-infected cells. In addition, a second or additional helper plasmid is cotransfected into these ceils to provide the AAV rep and/or cap genes which are obligatory for replication and packaging of the recombinant viral construct. Under these conditions, the rep and/or cap proteins of AAV act in trans to stimulate replication and packaging of the rAAV construct. Two to Three days after transfection, rAAV is harvested. Traditionally rAAV is harvested from the ceils along with adenovirus. The contaminating adenovirus is then inactivated by heat treatment. In the instant invention, rAAV is advantageousl harvested not from the cells themselves, but from cell supernatant. According!)?, in an initial aspect the invention provides for preparing rAAV, and in addition to the foregoing, rAAV can be prepared by a method that comprises or consists essentially of: infecting susceptible cells with a rAAV containing exogenous DNA including DNA for expression, and helper virus (e.g., adenovirus, herpesvirus, poxvirus such as vaccinia virus) wherein the rAAV lacks functioning cap and/or rep (and the helper vims (e.g., adenovirus, herpesvirus, poxvirus such as vaccinia virus) provides the cap and/or rev function that the rAAV lacks); or infecting susceptible cel ls with a rAAV containing exogenous DNA including DNA for expression, wherein the recombinant lacks functioning cap and/or rep, and transfecting said cells with a plasmid supplying cap and/or rep function that the rAAV lacks; or infecting susceptible cells with a rAAV containing exogenous DNA including DNA for expression, wherein the recombinant lacks functioning cap and/or rep, wherein said cells supply cap and/or rep function thai the recombinant lacks; or transiecting the susceptible cells with an AAV lacking funct ioning cap and/or rep and piasmids for inserting exogenous DNA into the recombmant so that the exogenous DNA is expressed by the recombinant and for supplying rep and/or cap functions whereby transteetion results in an rAAV containing the exogenous DNA including DNA for expression that lacks functioning cap a d/or rep,
[00485] The rAAV can be from an AAV as herein described, and advantageousl can be an rAAVl, rAAV2, AAV5 or rAAV having hybrid or capsid which may comprise AAVl, AAV2, AAV5 or any combination thereof. One can select the AAV of the rAAV with regard to the cells to be targeted by the rAAV; e.g., one can select AAV serotypes 1 , 2, 5 or a hybrid or capsid AAVl, AAV2, AAV5 or any combination thereof for targeting brain or neuronal cells; and one can select AAV4 for targeting cardiac tissue.
[00486] In addition to 293 cells, other cells that can be used in the practice of the invention and the relative infectivity of certain AAV serotypes in vitro as to these cells (see Grimm, D. et al, J. Virol. 82: 5887-5911 (2008)) are as follows:
Figure imgf000162_0001
[00487] The invention provides rAAV that contains or consists essentially of an exogenous nucleic acid molecule encoding a CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) system, e.g., a plurality of cassettes comprising or consisting a first cassette comprising or consisting essentially of a promoter, a nucleic acid molecule encoding a CRISPR-associated (Cas) protein (putative nuclease or helicase proteins), e.g., Cas9 and a terminator, and a two, or more, advantageously up to the packaging size limit of the vector, e.g., in total (including the first cassette) five, cassettes comprising or consisting essentially of a promoter, nucleic acid molecule encoding guide RNA (gRNA) and a terminator (e.g., each cassette schematically represented as Promoter-gRNAl -terminator, Promoter-gRNA2 -terminator ... Promoter- gRNA(N)-terminator (where N is a number that can be inserted that is at an upper limit of the packaging size limit of the vector), or two or more individual rAAVs, each containing one or more tha one cassette of a CRISPR system, e.g., a first rAAV containing the first cassette comprising or consisting essentially of a promoter, a nucleic acid molecule encoding Cas, e.g., Cas9 and a terminator, and a second rAAV containing a plurality, four, cassettes comprising or consisting essential ly of a promoter, nucleic acid molecule encoding guide RNA (gRNA) and a terminator (e.g., each cassette schematically represented as Promoter-gRNAl -terminator, Promoter-gRNA2 -terminator ... Promoter-gRNA(N)-termmator (where N is a number that can be inserted that is at an upper limit of the packaging size limit of the vector). As rAAV is a DNA virus, the nucleic acid molecules in the herein discussion concerning AAV or rAAV are advantageously DNA. The promoter is in some embodiments advantageously human Synapsin 1 promoter (hSyn).
[00488] Additional methods for the delivery of nucleic acids to cells are known to those skilled in the art. See, for example, US20030087817. incorporated herein by reference.
[00489] In some embodiments, a host cel l is transient])? or non -transiently transfected with one or more vectors described herein. In some embodiments, a cell is transfected as it naturally occurs in a subject. In some embodiments, a cell that is transfected is taken from a subject. In some embodiments, the cell is derived from cells taken from a subject, such as a cell line. A wide variety of cell lines for tissue culture are known in the art. Examples of cell lines include, but are not limited to, C8161 , CCRF-CEM, MOLT, mI CD-3, NHDF, HeLa-S3, Huh l, Huh4, Huh7, HUVEC, HASMC, HEKn, HEKa, MiaPaCell, Panel , PC-3, TFI, CTLL-2, CiR, Rat6, CV1 , RPTE, A10, T24, .182, A375, ARH-77, Calul, SW480, SW620, S OV3, SK-UT, CaCo2, P388D1, SEM-K2, WEHI-231, HB56, TIB55, Jurkat, J45.0L LRMB, Bcl-1, BC-3, IC21, DLD2, Raw264.7, NRK, NRK-52E, MRC5, MEF, Hep G2, HeLa B, HeLa T4, COS, COS-1 , COS-6, COS-M6A, BS-C-1 monkey kidney epithelial, BALB/ 3T3 mouse embryo fibroblast, 3T3 Swiss, 3T3-L1, 132-d5 human fetal fibroblasts; 10.1 mouse fibroblasts, 293-T, 3T3, 721 , 9L, A2780, A2780ADR, A2780eis, A172, A20, A253, A431 , A-549, ALC, B16, B35, BCP-1 cells, BEAS- 2B, bEnd.3, ! ! -2 1 . BR 293, BxPC3, C3H-10T1/2, C6/36, Cal-27, CHO, CHO-7, CeO-IR, CHO-K1, CHO-K2, CHQ-T, CHO Dhfr -/-, COR-L23, COR-L23/CPR, COR-L23/5010, CGR- L23/R23, COS-7, COV-434, CM L Tl, CMT, CT26, D17, DH82, DU145, DuCaP, EL4, EM2, EM3, EMT6/AR1, EMT6/AR10.0, FM3, H1299, H69, HB54, HB55, HCA2, HEK-293, HeLa, Flepal cl c7, HL-60, HMEC, HT-29, Jurkat, JY ceils, 562 cells, Ku812, KCL22, KG l , ΚΛΌ1 , LNCap, Ma-Mel 1-48, MC-38, MCF-7, MCF-IOA, MDA-MB-231, MDA-MB-468, MDA-MB- 435, MDCK II, MDCK II, MOR/0.2R, MONO-MAC 6, MTD-1A, My End, NCI-H69/CPR, NCI-H69/LX10, NCI-H69/LX20, NCI-H69/LX4, \ H i-3T3. N ALM- 1 , NW-145, OPCN / OPCT cell lines, Peer, PNT-1A / PNT 2, RenCa, RIN-5F, RMA/RMAS, Saos-2 cells, Sf-9, SkBr3, T2, T-47D, T84, TI-IPl cell line, U373, U87, U937, VCaP, Vero cells, WM39, WT-49, X63, YAC-1 , YAR, and transgenic varieties thereof. Cell lines are available from a variety of sources known to those wit skill in the art (see, e.g., the American Type Culture Collection (ATCC) (Manassus, Va.)). In some embodiments, a cell transfected with one or more vectors described herein is used to establish a new cell line comprising one or more vector-derived sequences. In some embodiments, a ceil transiently transfected with the components of a CRISP R system as described herein (such as by transient transfection of one or more vectors, or transfection with RNA), and modified through the activity of a CRISPR complex, is used to establish a new ceil line comprising cells containing the modification but lacking any other exogenous sequence. In some embodiments, cells transiently or non-trarssiently transfected with one or more vectors described herein, or cell lines derived from such ceils are used in assessing one or more test compounds.
[00490] In some embodiments, one or more vectors described herein are used to produce a non-human transgenic animal or transgenic plant. In some embodiments, the transgenic animal is a mammal, such as a mouse, rat, or rabbit. Methods for producing transgenic animals and plants are known in the art, and generally begin with a method of cell trans fection, such as described herein.
[00491] In another embodiment, a fluid delivery device with an array of needles (see, e.g., US Patent Publication No. 20110230839 assigned to the Fred Hutchinson Cancer Research Center) may be contemplated for delivery of CRISPR Cas to solid tissue. A device of US Patent Publication No. 20110230839 for delivery of a fluid to a solid tissue may comprise a plurality of needles arranged in an array; a plurality of reservoirs, each in fluid communication with a respective one of the plurality of needles; and a plurality of actuators operatively coupled to respective ones of the plurality of reservoirs and configured to control a fluid pressure within the reservoir. In certain embodiments each of the plurality of actuators may comprise one of a plurality of plungers, a first end of each of the plurality of plungers being received in a respective one of the plurality of reservoirs, and in certain further embodiments the plungers of the plurality of plungers are operatively coupled together at respective second ends so as to be simultaneously depressable. Certain still further embodiments may comprise a plunger driver configured to depress all of the plurality of plungers at a selectively variable rate. In other embodiments each of the plurality of actuators .may comprise one of a plurality of fluid transmission lines having first and second ends, a first end of each of the plurality of fluid transmission lines being coupled to a respective one of the plurality of reservoirs. In other embodiments the device may comprise a fluid pressure source, and each of the plurality of actuators comprises a fluid coupling between the fluid pressure source and a respective one of the plurality of reservoirs. In further embodiments the fluid pressure source may comprise at least one of a compressor, a vacuum accumulator, a peristaltic pump, a master cylinder, a microfluidie pump, and a valve. In another embodiment, each of the plurality of needles may comprise a plural ity of ports distributed along its length.
Modifying a target
[00492 J In one aspect, the invention provides for methods of modifying a target polynucleotide in a eukaryotic cell, which may be in vivo, ex vivo or in vitro. In some embodiments, the method comprises sampling a cell or population of cells from a human or non- human animal, or a plant, and modifying the cell or ceils. Culturing may occur at any stage ex vivo. The cell or cells .may even be re-introduced into the non-human animal or plant. For reintroduced cells it is particularly preferred that the ceils are stem cells.
[00493] In some embodiments, the method comprises allowing a CRISPR complex to bind to the target polynucleotide to effect cleavage of said target polynucleotide thereby modifying the target polynucleotide, wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said target polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tract sequence. [00494] In one aspect, the invention provides a method of modifying expression of a polynucleotide in a eukaryotic ceil. In some embodiments, the method comprises allowing a CRJSPR complex to bind to the poly ucleotide such that said binding results in increased or decreased expression of said polynucleotide; wherein the CRJSPR complex comprises a CRJSPR enzyme compiexed with a guide seque ce hybridized to a target sequence within said polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence. Similar considerations and conditions apply as above for methods of modifying a target polynucleotide. In fact, these sampling, culturing and re-introduction options apply across the aspects of the present invention.
[00495] Indeed, in any aspect of the invention, the CRISPR complex may comprise a CRISPR enzyme compiexed with a guide sequence hybridized to a target sequence, wherein said guide sequence may be linked to a tracr mate sequence which in turn may hybridize to a tracr sequence. Similar considerations and conditions apply as above for methods of modifying a target polynucleotide.
Kits
[004961 In one aspect, the invention provides kits containing any one or more of the elements disclosed in the above methods and compositions. Elements may be provided individually or in combinations, and may be provided in any suitable container, such as a vial, a bottle, or a tube. In some embodiments, the kit includes instructions in one or more languages, for example in more than one language.
[00497] In some embodiments, a kit comprises one or more reagents for use in a process utilizing one or more of the elements described herein. Reagents may be provided in any suitable container. For example, a kit may provide one or more reaction or storage buffers. Reagents .may be provided in a form that is usable in a particular assay, or in a form that requires addition of one or more other components before use (e.g. in concentrate or lyopiiilized form). A buffer can be any buffer, including but not limited to a sodium carbonate buffer, a sodium bicarbonate buffer, a borate buffer, a Iris buffer, a MOPS buffer, a I IEPES buffer, and combinations thereof. In some embodiments, the buffer is alkaline. In some embodiments, the buffer has a pH from about 7 to about 10. In some embodiments, the kit comprises one or more oligonucleotides corresponding to a guide sequence for insertion into a vector so as to operably link the guide sequence and a regulatory element. In some embodiments, the kit comprises a homologous recombination template polynucleotide. In some embodiments, the kit comprises one or more of the vectors and/or one or more of the polynucleotides described herein. The kit may advantageously allows to provide ail elements of the systems of the invention,
CR ISPR complex
[00498] In one aspect, the invention provides methods for using one or more elements of a CRISPR system. The CRISPR complex of the invention provides an effective means for modifying a target polynucleotide. The CRISPR complex of the invention has a wide variety of utility including modifying (e.g., deleting, inserting, translocating, inactivating, activating) a target polynucleotide in a multiplicity of cell types. As such the CRISPR complex of the invention has a broad spectrum of applications in, e.g., gene therapy, drug screening, disease diagnosis, and prognosis. An exemplar}? CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within the target polynucleotide. The guide sequence is linked to a tracr mate sequence, which in turn hybridizes to a tracr sequence.
[00499] In one embodiment, this invention provides a method of cleaving a target polynucleotide. The method comprises modifying a target polynucleotide using a CRISPR complex that binds to the target polynucleotide and effect cleavage of said target polynucleotide. Typically, the CRISPR complex of the invention, when introduced into a cell, creates a break (e.g., a single or a double strand break) in the genome sequence. For example, the method can be used to cleave a disease gene in a cell.
[00500] The break created by the CRISPR complex can be repaired by a repair processes such as the error prone non-homologous end joining (NHEJ) pathway or the high fidelity homology- directed repair (HDR) (Fig. 29). During these repair process, an exogenous polynucleotide template can be introduced into the genome sequence. In some methods, the HDR process is used modify genome sequence. For example, an exogenous polynucleotide template comprising a sequence to be integrated flanked by an upstream sequence and a downstream sequence is introduced into a cel l. The upstream and downstream sequences share sequence similarity with either side of the site of integration in the chromosome.
[00501] Where desired, a donor polynucleotide can be DNA, e.g., a DNA plasmid, a bacterial artificial chromosome (BAC), a yeast artificial chromosome (YAC), a viral vector, a linear piece of DNA, a PGR fragment, a naked nucleic acid, or a nucleic acid complexed with a delivery- vehicle such as a liposome or poloxamer.
[00502] The exogenous polynucleotide template comprises a seque ce to be integrated (e.g., a mutated gene). The sequence for integration may be a sequence endogenous or exogenous to the cell. Examples of a sequence to be integrated include polynucleotides encoding a protein or a non-coding R A (e.g., a micro R A). Thus, the sequence for integration may be operably linked to an appropriate control sequence or sequences. Alternatively, the sequence to be integrated may provide a regulatory function.
[00503] The upstream and downstream sequences in the exogenous polynucleotide template are selected to promote recombination between the chromosomal sequence of interest and the donor polynucleotide. The upstream sequence is a nucleic acid sequence that shares sequence similarity with the genome sequence upstream of the targeted site for integration. Similarly, the downstream sequence is a nucleic acid sequence that shares sequence similarity with the chromosomal sequence downstream of the targeted site of i tegration. The upstream and downstream sequences in the exogenous polynucleotide template can have 75%, 80%, 85%, 90%, 95%, or 100% sequence identity with the targeted genome sequence. Preferably, the upstream and downstream sequences in the exogenous polynucleotide template have about 95%, 96%, 97%, 98%, 99%, or 100% sequence identity with the targeted genome sequence. In some methods, the upstream and downstream sequences in the exogenous polynucleotide template have about 99% or 100% sequence identity with the targeted genome sequence.
[00504] An upstream or downstream sequence may comprise from about 20 bp to about 2500 bp, for example, about 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2100, 2200, 2300, 2400, or 2500 bp. In some methods, the exemplary upstream or downstream sequence have about 200 bp to about 2000 bp, about 600 bp to about 1000 bp, or more particularly about 700 bp to about 1000 bp.
[00505] In some methods, the exogenous polynucleotide template may further comprise a marker. Such a marker may make it easy to screen for targeted integrations. Examples of suitable markers include restriction sites, fluorescent proteins, or selectable markers. The exogenous polynucleotide template of the invention can be constructed using recombinant techniques (see, for example, Sambrook et al., 2001 and Ausubel et al., 1996). [00506] In an exemplary method for modifying a target polynucleotide by integrating an exogenous polynucleotide template, a double stranded break is introduced into the genome sequence by the CRISPR complex, the break is repaired via homologous recombination an exogenous polynucleotide template such that the template is integrated into the genome. The presence of a double-stranded break facilitates integration of the template,
[00507] In other embodiments, this invention provides a method of modifying expression of a polynucleotide in a eukaryotic cell. The method comprises increasing or decreasing expression of a target polynucleotide by using a CR ISPR. comple that binds to the polynucleotide.
[00508] In some methods, a target polynucleotide can be inactivated to effect the modification of the expression in a cell. For example, upon the binding of a CRISPR. complex to a target sequence in a cell, the target polynucleotide is inactivated such that the sequence is not transcribed, the coded protein is not produced, or the sequence does not function as the wild-type sequence does. For example, a protein or micro RN A coding sequence may be inactivated such that the protein is not produced.
[00509] In some methods, a control sequence can be inactivated such that it no longer functions as a control sequence. As used herein, "control sequence" refers to any nucleic acid sequence that effects the transcription, translation, or accessibility of a nucleic acid sequence. Examples of a control sequence include, a promoter, a transcription terminator, and an enhancer are control sequences.
[0051(1] The inactivated target sequence may include a deletion mutation (i.e., deletion of one or more nucleotides), an insertion mutation (i.e., insertion of one or more nucleotides), or a nonsense mutation (i.e., substitution of a single nucleotide for another nucleotide such that a stop codon is introduced). In some methods, the inactivation of a target sequence results in "knockout" of the target sequence.
Disease models
[0051 1 ] A method of the invention may be used to create a plant, an animal or cell that may be used as a disease model. As used herein, "disease" refers to a disease, disorder, or indication in a subject. For example, a method of the invention may be used to create an animal or ceil that comprises a modification in one or more nucleic acid sequences associated with a disease, or a plant, animal or cell in which the expression of one or more nucleic acid sequences associated with a disease are altered. Such a nucleic acid sequence may encode a disease associated protein sequence or may be a disease associated control sequence. Accordingly, it is understood that in embodiments of the invention, a plant, subject, patient, organism or cell can be a non-human subject, patient, organism or cell. Thus, the invention provides a plant, animal or ceil, produced by the present methods, or a progeny thereof. The progeny may be a clone of the produced plant or animal, or may result from sexual reproduction by crossing with other individuals of the same species to introgress further desirable traits into their offspring. The cell may be in vivo or ex vivo in the cases of multicellular organisms, particularly animals or plants. In the instance where the cell is in cultured, a cell line .may be established if appropriate culturing conditions are met and preferably if the cell is suitably adapted for this purpose (for instance a stem cell). Bacterial cell lines produced by the invention are also envisaged. Hence, cell lines are also envisaged.
[00512J In some methods, the disease model can be used to study the effects of mutations on the animal or cell and development and/or progression of the disease using measures commonly used in the study of the disease. Alternatively, such a disease model is useful for studying the effect of a pharmaceutically active compound on the disease.
[00513] In some methods, the disease model can be used to assess the efficacy of a potential gene therapy strategy. That is, a disease-associated gene or polynucleotide can be modified such that the disease development and/or progression is inhibited or reduced. In particular, the method comprises modifying a disease-associated gene or polynucleotide such that an altered protein is produced and, as a result, the animal or cell has an altered response. Accordingly, in some methods, a genetically modified animal may be compared with an animal predisposed to development of the disease such that the effect of the gene therapy event may be assessed.
[005 J 4] in another embodiment, this invention pro vides a method of developing a biologically active agent that modulates a cell signaling event associated with a disease gene. The method comprises contacting a test compound with a cell comprising one or more vectors that drive expression of one or more of a CRISPR enzyme, a guide sequence linked to a tracr mate sequence, and a tracr sequence; and detecting a change in a readout that is indicative of a reduction or an augmentation of a cell signaling event associated with, e.g., a mutation in a disease gene contained in the ceil.
[00515J A cel l model or animal model can be constructed in combination with the method of the invention for screening a cellular function change. Such a model may be used to study the effects of a genome sequence modified by the CRISPR comple of the invention on a cellular function of interest. For example, a cellular function model may be used to study the effect of a modified genome sequence on intracellular signaling or extracellular signaling. Alternatively, a cellular function model may be used to study the effects of a modified genome sequence on sensory perception. In some such models, one or more genome sequences associated with a signaling biochemical pathway in the model are modified.
|00516| Several disease models have been specifically investigated. These include de novo autism risk genes CHD8, KATNAL2, and SCN2A; and the syndromic autism (Angelman Syndrome) gene UBE3A. These genes and resulting autism models are of course preferred, but serve to show the broad applicability of the invention across genes and corresponding models.
[00517] An altered expression of one or more genome sequences associated with a signaling biochemical pathway can be determined by assaying for a difference in the mRNA levels of the corresponding genes between the test model cell and a control ceil, when they are contacted with a candidate agent. Alternatively, the differential expression of the sequences associated with a signaling biochemical pathway is determined by detecting a difference in the level of the encoded polypeptide or gene product.
[00518] To assay for an agent-induced alteration in the level of mRNA transcripts or corresponding polynucleotides, nucleic acid contained in a sample is first extracted according to standard methods in the art. For instance, mRNA can be isolated using various lytic enzymes or chemical solutions according to the procedures set forth in Sambrook et al. (1989), or extracted by nucleic-acid-binding resins following the accompanying instructions provided by the manufacturers. The mRNA contained in the extracted nucleic acid sample is then detected by amplification procedures or conventional hybridization assays (e.g. Northern blot analysis) according to methods widely known in the art or based on the methods exemplified herein.
[00519] For purpose of this invention, amplification means any method employing a primer and a polymerase capable of replicating a target sequence with reasonable fidelity. Amplification may be earned out by natural or recombinant DNA polymerases such as TaqGo!d™, T7 DNA polymerase, Klenow fragment of E.eoli DNA polymerase, and reverse transcriptase, A preferred amplification method is PGR. In particular, the isolated RNA can be subjected to a reverse transcription assay that is coupled with a quantitative polymerase chain reaction (RT-PCR) in order to quantify the expression level of a sequence associated with a signaling biochemical pathway. [00520] Detection of the gene expression level can be conducted in real time in an amplification assay. In one aspect, the amplified products can be directly visualized with fluorescent DNA-binding agents including but not limited to DNA intercalators and DNA groove binders. Because the amount of the intercalators incorporated into the double-stranded DN A molecules is typically proportional to the amount of the amplified DNA products, one can conveniently determine the amount of the amplified products by quantifying the fluorescence of the intercalated dye using conventional optical systems in the art. DNA-binding dye suitable for this application include SYBR green, SYBR blue, DAPI, propidium iodine, Hoeste, SYBR gold, ethidium bromide, acridities, proflavine, acridine orange, acriflavine, fluorcoumanin, ellipticine, daunomycin, chloroquine, distamycin D, chromomycin, homidium, mithramycm, ruthenium polypyridyls, anthramycin, and the like.
[00521] In another aspect, other fluorescent labels such as sequence specific probes can be employed in the amplification reaction to facilitate the detection and quantification of the amplified products. Probe-based quantitative amplification relies on the sequence-specific detection of a desired amplified product. It utilizes fluorescent, target-specific probes (e.g., TaqMan® probes) resulting in increased specificity and sensitivity. Methods for performing probe-based quantitative amplification are well established in the art and are taught in U.S. Patent No. 5,2 10,015.
[00522] In yet another aspect, conventional hybridization assays using hybridization probes that share sequence homology with sequences associated with a signaling biochemical pathway can be performed. Typically, probes are allowed to form stable complexes with the sequences associated with a signaling biochemical pathway contained within the biological sample derived from the test subject in a hybridization reaction. It will be appreciated by one of skill in the art that where antisense is used as the probe nucleic acid, the target polynucleotides provided in the sample are chosen to be complementary to sequences of the antisense nucleic acids. Conversely, where the nucleotide probe is a sense nucleic acid, the target polynucleotide is selected to be complementary to sequences of the sense nucleic acid.
[00523] Hybridization can be performed under conditions of various stringency. Suitable hybridization conditions for the practice of the present invention are such that the recognition interaction between the probe and sequences associated with a signaling biochemical pathway is both sufficiently specific and sufficiently stable. Conditions that increase the stringency of a hybridization reaction are widely known and published in the art. See, for example, (Sambrook, et al., ( 1989); Nonradioactive In Situ Hybridization Application Manual, Boehringer Mannheim, second edition). The hybridization assay can be formed using probes immobilized on any solid support, including but are not limited to nitrocellulose, glass, silicon, and a variety of gene arrays. A preferred hybridizatio assay is conducted o high-density gene chips as described in U.S. Patent No. 5,445,934,
[00524] For a convenient detection of the probe-target complexes formed during the hybridization assay, the nucleotide probes are conjugated to a detectable label. Detectable labels suitable for use in the present invention include any composition detectable by photochemical, biochemical, spectroscopic, immunochemical, electrical, optical or chemical means. A. wide variety of appropriate detectable labels are known in the art, which include fluorescent or chemiluminescent labels, radioactive isotope labels, enzymatic or other ligaiids. In preferred embodiments, one wil l likely desire to employ a fluorescent label or an enzyme tag, such as digoxigenin, β-galactosidase, urease, alkaline phosphatase or peroxidase, avidin/biotin complex.
[00525] The detection methods used to detect or quantify the hybridization intensity will typically depend upon the label selected above. For example, radiolabeis may be detected using photographic film or a phosphoimager. Fluorescent markers may be detected and quantified using a photodetector to detect emitted light. Enzymatic labels are typically detected by providing the enzyme with a substrate and measuring the reaction product produced by the action of the enzyme on the substrate; and finally colorimetric labels are detected by simply visualizing the colored label.
[00526] An agent-induced change in expression of sequences associated with a signaling biochemical pathway can also be determined by examining the corresponding gene products. Determining the protein level typically involves a) contacting the protein contained in a biological sample with an agent that specifically bind to a protein associated with a signaling biochemical pathway; and (b) identifying any agentrprotein complex so formed. In one aspect of this embodiment, the agent that specifically binds a protein associated wit a signaling biochemical pathway is an antibody, preferably a monoclonal antibody.
[00527] The reaction is performed by contacting the agent with a sample of the proteins associated with a signaling biochemical pathway derived from the test samples under conditions that will allow a complex to form between the agent and the proteins associated with a signaling biochemical pathway. The formation of the complex can be detected directly or indirectly according to standard procedures in the art. In the direct detection method, the agents are supplied with a detectable label and unreacted agents may be removed from the complex; the amount of remaining label thereby indicating the amount of complex formed. For such method, it is preferable to select labels that remain attached to the agents even during stringent washing conditions. It is preferable that the label does not interfere with the binding reaction. In the alternative, an indirect detection procedure may use an agent that contains a label introduced either chemically or enzymatica!Iy. A. desirable label generally does not interfere with binding or the stability of the resulting agen polypeptide complex. However, the label is typically designed to be accessible to an antibody for an effective binding and hence generating a detectable signal.
[00528] A wide variety of labels suitable for detecting protein levels are known in the art. Non-limiting examples include radioisotopes, enzymes, colloidal metals, fluorescent compounds, bioluminescent compounds, and chemilumiiiescent compounds.
[00529] The amount of agent ^polypeptide complexes formed during the binding reaction can be quantified by standard quantitative assays. As illustrated above, the formation of agentpolypeptide complex can be measured directly by the amount of label remained at the site of binding. In an alternative, the protein associated with a signaling biochemical pathway is tested for its ability to compete with a labeled analog for binding sites on the specific agent. In this competitive assay, the amount of label captured is inversely proportional to the amount of protein sequences associated with a signaling biochemical pathway present in a test sample.
[00530] A number of techniques for protein analysis based on the general principles outlined above are available in the art. They include but are not limited to radioimmunoassays, ELISA (enzyme linked immunoradiometric assays), '"sandwich" immunoassays, immunoradiometric assays, in situ immunoassays (using e.g., colloidal gold, enzyme or radioisotope labels), western blot analysis, immunoprecipitation assays, immunofluorescent assays, and SDS-PAGE.
[00531] Antibodies that specifically recognize or bind to proteins associated with a signaling biochemical pathway are preferable for conducting the aforementioned protein analyses. Where desired, antibodies that recognize a specific type of post-translational modifications (e.g., signaling biochemical pathway inducible modifications) can be used. Post-translational modifications include but are not limited to glycosylation, lipidation, acetylation, and phosphorylation. These antibodies may be purchased from commercial vendors. For example, anti-phosphotyrosine antibodies that specifically recognize tyrosine-phosphor lated proteins are available from a number of vendors including Invitrogen and Perkin Elmer. Anti- phosphotyrosine antibodies are particularly useful in detecting proteins that are differentially phosphorylated on their tyrosine residues in response to an ER stress. Such proteins include but are not limited to eukaryotie translation initiation factor 2 alpha (eIF~2a). Alternatively, these antibodies can be generated using conventional polyclonal or monoclonal antibody technologies by immunizing a host animal or an antibody-producing cell with a target protein that exhibits the desired post-translational modification.
[00532] In practicing the subject method, it may be desirable to discern the expression pattern of an protein associated with a signaling biochemical pathway in different bodily tissue, in different ceil types, and/or in different subcellular structures. These studies can be performed with the use of tissue-specific, cell-specific or subcellular structure specific antibodies capable of binding to protein markers that are preferentially expressed in certain tissues, ceil types, or s ubcell ular structures.
[005331 An altered expression of a gene associated with a signaling biochemical pathway can also be determined by examining a change in activity of the gene product relative to a control cell. The assay for an agent-induced change in the activity of a protein associated with a signaling biochemical pathway will dependent on the biological activity and/or the signal transduction pathway that is under nvest gation. For example, where the protein is a kinase, a change in its ability to phosphorylate the downstream substrate(s) can be determined by a variety of assays known in the art. Representative assays include but are not limited to immunoblotting and immunoprecipitation with antibodies such as anti-phosphotyrosine antibodies that recognize phosphorylated proteins. In addition, kinase activity can be delected by high throughput chemiluminescent assays such as AlphaScreen™ (available from Perkin Elmer) and e'Tag™ assay (Chan-Bui, et al. (2003) Clinical Immunology H I : 162-174).
[00534] Where the protein associated with a signaling biochemical pathway is part of a signaling cascade leading to a fluctuation of intracellular pH condition, pH sensitive molecules such as fluorescent pFI dyes can be used as the reporter molecules. In another example where the protein associated with a signaling biochemical pathway is an ion channel, fluctuations in membrane potential and/or intracellular ion concentration can be monitored. A number of commercial kits and high-throughput devices are particularly suited for a rapid and robust screening for modulators of ion channels. Representative instruments include FLIPRTM (Molecular Devices, Inc.) and VIPR (Aurora Biosciences). These instruments are capable of detecting reactions in over 1000 sample wells of a microplate simultaneous!)', and providing real-time measurement and functional data within a second or even a millisecond.
[00535] In practicing any of the methods disclosed herein, a suitable "vector can be introduced to a cell or an embryo via one or more methods known in the art, including without limitation, microinjection, electroporation, sonoporation, biolistics, calcium phosphate-mediated transfection, cationic transfection, liposome transfection, dendnmer transfection, heat shock transfection, nucleofeetion iransfection, rnagneio lection, l no loci ion. impal election, optical transfection, proprietary agent-enhanced uptake of nucleic acids, and delivery "via liposomes, immunoliposomes, virosomes, or artificial virions. In some methods, the vector is introduced into an embryo by microinjection. The vector or vectors may be microinjected into the nucleus or the cytoplasm of the embryo. In some methods, the vector or vectors may be introduced into a cell by nucleofeetion.
[00536] The target polynucleotide of a CPJSPR complex can be any polynucleotide endogenous or exogenous to the eukaryotic cell. For example, the target polynucleotide can be a polynucleotide residing in the nucleus of the eukaryotic cell. The target polynucleotide can be a sequence coding a gene product (e.g., a protein) or a non-coding sequence (e.g., a regulatory polynucleotide or a junk DNA).
[00537] Examples of target polynucleotides include a sequence associated with a signaling biochemical pathway, e.g., a signaling biochemical pathway-associated gene or polynucleotide. Examples of target polynucleotides include a disease associated gene or polynucleotide. A "disease-associated" gene or polynucleotide refers to any gene or polynucleotide which is yielding transcription or translation products at an abnormal level or in an abnormal form in cells derived from a disease-affected tissues compared with tissues or cells of a non disease control. It may be a gene that becomes expressed at an abnormally high level; it may be a gene that becomes expressed at an abnormally low level, where the altered expression correlates with the occurrence and/or progression of the disease. A disease-associated gene also refers to a gene possessing mutation(s) or genetic variation that is directly responsible or is in linkage disequilibrium with a gene(s) that is responsible for the etiology of a disease. The transcribed or translated products may be known or unknown, and may be at a normal or abnormal level.
[00538] The target polynucleotide of a CRISPR complex can be any polynucleotide endogenous or exogenous to the eukaryotie cell. For example, the target pol nucleotide can be a polynucleotide residing in the nucleus of the eukaryotie cell. The target polynucleotide can be a sequence coding a gene product (e.g., a protein) or a non-coding sequence (e.g., a regulatory polynucleotide or a junk DNA). Without wishing to be bound by theory, it is believed that the target sequence should be associated with a PAM (protospacer adjacent motif); that is, a short sequence recognized by the CRISPR complex. The precise sequence and length requirements for the PAM differ depending on the CR ISPR. enzyme used, but PAMs are typically 2-5 base pair sequences adjacent the protospacer (that is, the target sequence) Examples of PAM sequences are given in the examples section below, and the skilled person will be able to identify further PAM sequences for use with a given CRJSPR enzyme.
[00539] The target polynucleotide of a CRISPR complex may include a number of disease- associated genes and polynucleotides as well as signaling biochemical pathway-associated genes and polynucleotides as listed in US provisional patent applications 61/736,527 and 61/748,427 having Broad reference BI-201 1/008 AVSGR Docket No. 44063-701.101 and BI- 201 1/008/WSGR Docket No. 44063-701.102 respectively, both entitled SYSTEM S M ETHODS AND COMPOSITIONS FOR SEQUENCE MANIPULATION filed on December 12, 2012 and January 2, 2013, respectively, the contents of all of which are herein incorporated by reference in their entirety.
[G0540] Examples of target polynucleotides include a sequence associated with a signaling biochemical pathway, e.g., a signaling biochemical pathway-associated gene or polynucleotide. Examples of target polynucleotides include a disease associated gene or polynucleotide. A "disease-associated" gene or polynucleotide refers to any gene or polynucleotide which is yielding transcription or translation products at an abnormal level or in an abnormal form in cells derived from a disease-affected tissues compared with tissues or cells of a non disease control. It may be a gene that becomes expressed at an abnormally high level; it may be a gene that becomes expressed at an abnormally low level, where the altered expression correlates with the occurrence and/or progression of the disease. A disease-associated gene also refers to a gene possessing mutation(s) or genetic variation that is directly responsible or is in linkage disequilibrium with a gene(s) that is responsible for the etiology of a disease. The transcribed or translated products may be known or unknown, and may be at a normal or abnormal level.
[00541] Examples of disease-associated genes and polynucleotides are listed in Tables A and B, Disease specific information is available from McK.usick~Nath.aas Institute of Genetic Medicine, Johns Hopki s University (Baltimore, Md.) and National Center for Biotechnology Information, National Library of Medicine (Befhesda, Md.), available on the World Wide Web. Examples of signaling biochemical pathway-associated genes and polynucleotides are listed in Table C.
[00542] Mutations in these genes and pathways can result in production of improper proteins or proteins in improper amounts which affect function. Further examples of genes, diseases and proteins are hereby incorporated by reference from US Provisional application 61/736,527 filed December 12, 2012. Such genes, proteins and pathways may be the target polynucleotide of a CRISPR complex.
Table A
Figure imgf000178_0001
Figure imgf000179_0001
Parkinson's Disease x-Synuelcin: DJ-1; 1.RR 2: Parkin; PIN l
Table B:
Figure imgf000179_0002
and oncology TCL5, SCL, TAL2, FLT3, BS1, NBS, ZNFN 1AL ΪΚ1 , LYF1 , diseases and disorders HOXD4, HOX4B, BCR, CML, PHL, ALL, ARNT, KRAS2, RASK2,
GMPS, AF1G, ARHGEF12, LARG, KIAA0382, CALM, CLTH, CEBPA, CEBP, CHIC2, BTL, FLT3, IT. PBT, LPP, NPM 1, NUP214, D9S46E, CAN, ( A. IN, RUNX1, CBFA2, AMLl , WHSC1L1 , NSD3, FLT3, AF1Q, NPM1, NUMAL ZNF145, PLZF, PML, MY !.. STAT5B, AF10, CALM, CLTH, ARL11, ARLTS1, P2RX7, P2X7, BCR, CML, PHL, ALL, GRAF, NF1 , VRNF, WSS, NFNS, PTPNl i, PTP2C, SHP2, NS1, BCL2, CCND1, PRAD1, BCL1 , TCRA, GAT A 1 , GF1, ERYF1, NFEl, ABL1 , NQOl , DIA4, NMOR1 , NUP214, D9S46E, CAN, CAIN).
Inflammation and AIDS (KTR3DL1 , NKAT3, NKB1 , AMB11, KIR3DS1, IFNG, CXCL12, immune related SDF1); Autoimmune lymphoproliferative syndrome (TNFR.SF6, APT!, diseases and disorders FAS, CD95, ALPS1A); Combined immunodeficiency, (IL2RG,
SCIDX1 , SCIDX, IMD4); HIV-1 (( '('1 ,5. SCYA.5, D17S136E, TCP228), HIV susceptibility or infection (IL10, CSIF, CM BR2, CCR2,
CMKBR5, CCCKR5 (CCR5)); immunodeficiencies (CD3E, CD3G, AICDA, AID, HIGM2, TNFRSF5, CD40, UNG, DGU, HIGM4, TNFSF5, CD40LG, HIGML IGM, FOXP3, IPEX, AIID, XPID, PIDX, TNFRSF14B, TACI); Inflammation (IL- 10, f I - 1 ( I I.· l a. l l.- l IL-13, IL-17 (IL-17a (CTLA8), IL-17b, IL-17c, IL-17d, IL.- 170, H-23, Cx3crl, ptpn22, TNFa, NOD2/CARD15 for IBD, IL~6, Ι !.· ! 2 (IL 2a, IL 2b), L i LA4, Cx3cI1 ); Severe combined immunodeficiencies SCIDs)(j AK3, JA L, DCLRE1C, ARTEMIS, SCIDA, RAG1, RAG2, ADA, PTPRC, CD45, LCA, IL7R CD3D, T3D, IL2RG, SCIDX L SCIDX, IMD4).
Metabolic, liver, Amyloid neuropathy (TTR, PALB); Amyloidosis (APOA1, APP, AAA, kidney and protein CVAP, ADl , GSN, FGA, LYZ, TTR, PALB); Cirrhosis (KRT18, RT8, diseases and disorders CIRHl A, NAIC, TEX292, KIAA1988); Cystic fibrosis (CFTR, ABCC7,
CF, MRP7); Glycogen storage diseases (SLC2 A2, GLIJT2, G6PC, G6PT, G6PT1, GAA, LAMP2, LAMPB, AGL, GDE, GBEl, GYS2, PYGL, PFKM); Hepatic adenoma, 142330 (TCF1, HNF1A, MODY3), Hepatic failure, early onset, and neurologic disorder (SCOD1, SCOl), Hepatic lipase deficiency (L1PC), Hepatoblastoma, cancer and carcinomas (CTNNB1, PDGFRL, PDGRL, PRLTS, AXIN1, ΑΧΓΝ, CTNNB1, TP53, P53, LFS l , 1GF2R, VI R!. MET, CASP8, MCH5; Medullary cystic kidney disease (UMOD, HNFJ, FJHN, MC D2, ADMCKD2); Phenylketo uria (PAH, PKUL QDPR, DHPR, PTS); Polycystic kidney and hepatic disease (FCYT, P HD1 , ARP D, PK.D1, P D2, PK.D4, PKDTS, PRKCSH, G19P1 , PCLD, SEC63).
Muscular / Skeletal Becker muscular dystrophy (DMD, BMD, MYF6), Duchemie Muscular diseases and disorders Dystrophy (DMD, BMD); Emery-Dreifuss muscular dystrophy (LMNA,
LMN1, EMD2, FPLD, CMDIA -IGPS, LGMDI B, LMNA, LM 1, EMD2, FPLD, CMD1A); Facioscapulohumeral muscular dystrophy (FSHMD1A, FSHD1A); Muscular dystrophy (FKRP, MDC 1C, LGMD2I, 1.ΛΜΛ2. LAMM, LARGE, KJAA0609, MDC1D, FCMD,
T i ll). MYOT, CAP 3, CA P3, DYSF, LGMD2B, SGCG, LGMD2C, DMDA1, SCG3, SGCA, ADL, DAG2, LGMD2D, DMDA2, SGCB, LGMD2E, SGCD, SGD, LGMD2F, CMD1 L, TCAP, LGMD2G, CMDIN, TRJM32, HT2A, LGMD2H, FKRP, MDCIC, LGMD2L TTN, CMD1G, TMD, LGMD2J, POMT1, CAV3, LGMD1C, SEPN1, SELN, RSMD1 , PLEC1 , PLTN, EBSl ); Osteopetrosis (LRP5, BMND1, LRP7, LR3, OPPG, V B( 1 12. CLCN7, CLC7, OPTA2, OSTM1 , GL, TCIRG 1, TIRC7, OC116, OPTB1 ); Muscular atrophy (VAPB, VAPC, ALS8, SMN1 , SMA1 , SMA.2, SMA3, SMA4, BSCL2, SPG 17, GARS, SMAD1 , CMT2D, HEXB, IGHMBP2, SMUBP2, CATF1, SMARDl).
Neurological and ALS (SODL ALS2, STEX, FUS, TARDBP, VEGF (VEGF-a, VEGF-b, neuronal diseases and VEGF-c); Alzheimer disease (APP, AAA, CVAP, AD1, APOE, AD2, disorders PSE 2, AD4, STM2, APBB2, FE65L1 , NOS3, PLAU, URK, ACE,
DCP1 , ACEl , MPO, PACIPL PAXIPi L, PTIP, A2M, BLMFI, BMH, PSEN1 , AD3); Autism ( Mecp2. BZRAP l , MDGA2, SemaSA, Neurexin 1, GLOl, MECP2, RTT, PPMX, MRX16, MRX79, NLGN3, NLGN4, KIAA1260, AUTSX2); Fragile X Syndrome (FMR2, FXR1, FXR2, mGLURS); Huntington's disease and disease like disorders (HD, IT 15, PRNP, PR IP. JPH3, JP3, ! !Dl 2. TBP, SCA17); Parkinson disease (NR4A2, NURR1, NOT, TINUR, SNCAIP, TBP, SCA17, SNCA, NACP, PAR l , PARK4, DJ1 , PARK7, LRRK2, PARKS, P1N 1, PARK6, UCHL1, PARKS, SNCA, NACP, PARKl, PARK 4, PRKN, PARK2, PDJ, DBH, NDUFV2); Rett syndrome (MECP2, RTT, PPMX, MRX 16, MRX79, ( OK 1.5. STK9, MECP2, RTT, PPMX, MRX16, MRX79, x-Synuclein, DJ-1); Schizophrenia (Neuregulinl (Nrgl), Erb4 (receptor for Neuregulin), Complexinl (Cplxl ), Tphl Tryptophan hydroxylase, Tph2, Tryptophan hydroxylase 2, Neurexin 1 , GSK3, GSK3a", GSK3b, 5-HTT (Slc6a4), COMT, DRD (Drdla), SLC6A3, DAOA, DTNBP1, Dao (Daol)); Secretase Related Disorders (APH-1 (alpha and beta), Presenilin (Psenl), nicastrin, (Ncstn), PEN-2, Nosl , Parpl , Natl, Nat2); Trinucleotide Repeat Disorders (HIT (Huntington's Dx), SBMA/SMAXl/AR (Kennedy's Dx), FXN/X25 (Friedrich's " Ataxia), ATX3 (Maehado- Joseph's Dx), ATXN1 and ATXN2
(spinocerebellar ataxias), DMP (myotonic dystrophy), Atrophin-1 and Atnl (DRPLA Dx), CBP (Creb-BP - global instability), VLDLR
(Alzheimer's), Atxn7, AtxnlO).
Occular diseases and Age-related macular degeneration (Abcr, Ccl2, Cc2, cp (ceruiopiasmin), disorders Timp3, cathepsinD, Vldlr, Ccr2); Cataract (CRY A A, CRYA1, CRYBB2,
CRYB2, PITX3, BFSP2, CP49, CP47, CRYAA, CRYA1 , PAX6, AN2, MGDA, CRYBA1, CRYB1, CRYGC, CRYG3, CCL, LIM2, MP19, CRYGD, CRYG4, BFSP2, CP49, CP47, HSF4, CTM, HSF4, CTM, MIP, AQPO, CRYAB, CRYA2, CTPP2, CRYBB1, CRYGD, CRYG4, CRYBB2, CRYB2, CRYGC, CRYG3, CCL, CRYAA, CRYAL GJA8, |CX50, GAEL GJA3, CX46, CZP3, CAE3, CCM1 , CAM, KRITl );
jCorrseal clouding and dystrophy (APOA1 , TGFBI, CSD2, CDGG1, jCSD, BIGH3, CDG2, TACSTD2, TROP2, MlSl, VSXl, RINX, PPCD, |PPD, TCN, COL8A2, FECD, PPCD2, PIP5 3, CFD); Cornea plana lcongenital (KERA, CNA2); Glaucoma (MYOC, TIGR, GLCIA, JO AG, !GPOA, OPTN, GLCIE, FIP2, HYPL, NRP, CYPIBI, GLC3A, OPAl, INTO, NPG, CYPI BI , GLC3A); Leber congenital amaurosis (C 'RB L !RP12, CRX, CORD2, CRD, RPGRIP1, LCA6, CORD9, RPE65, RP20, klPLl, LCA4, GUCY2D, GUC2D, LCA 1, CORD6, RDH 12, LCA3); iMacuiar dystrophy (ELO VL4, ADMD, STGD2, STGD3, RDS, RP7, JPRPH2, PRPH, AVMD, AOFMD, VMD2).
Tabie CT"
Figure imgf000182_0001
Figure imgf000183_0001
Figure imgf000184_0001
Figure imgf000185_0001
Figure imgf000186_0001
Hepatic Cholestasis PRKCE; IRAKI; INS; MYD88; PRKCZ; TRAF6; PPARA;
Figure imgf000187_0001
Figure imgf000188_0001
Figure imgf000189_0001
Figure imgf000190_0001
Figure imgf000191_0001
Arachidonic Acid PRDX6; GRN; YWHAZ; CYP1 B1
Metabolism
Orcadian Rhythm CSNKIE; CREB1; ATI 4: NR1D1
Signaling
Coagulation System BD RB1; F2R; SERPINE 1; F3
Dopamine Receptor PPP2R1A; PPP2CA; PPP f CC; PPP2R5C
Signaling
Glutathione Metabolism IDH2; GSTP1; ANPEP; IDH1
Glycerolipid Metabolism ALDHlAl; GPAM; SPH ! ; SPH 2
Linoleic Acid PRDX6; GRN; YW AZ; CYPI B I
Metabolism
Methionine Metabolism DNMT 1 ; DNMT3B; AHCY; DNMT3 A
Pyruvate Metabolism GLOl; ALDHlAl; PKM2; LDHA
Arginine and Proline ALDHlAl; NOS3; NOS2A
Metabolism
Eicosanoid Signaling PRDX6; GRN; YWHAZ
Fructose and Mannose H 2; GCK; ! ! !
Metabolism
Galactose Metabolism H&2; GCK; HK1
Stiibene, Conmarine and PRDX6; PRDXl; TYR
Ligniii Biosynthesis
Antigen Presentation CALR; B2M
Pathway
Biosynthesis of Steroids NQO l : DHCR7
Butanoate Metabolism ALDH l Al; NLGN1
Citrate Cycle IDH2; IDH1
Fatty Acid Metabolism ALDHl Al; CYPI BI
Giycerophospholipid PRDX6; CHKA
Metabolism
Histidme Metabolism PRMT5; ALDHlAl
Inositol Metabolism EROIL; APEX1
Metabolism of GSTP1; CYPIBI
Xenobiotics
by Cytochrome p450
Methane Metabolism PRDX6; PRDXl
Phenylalanine PRDX6; PRDXl
Metabolism
Propanoate Metabolism ALDH lAl ; LDHA
Selenoamino Acid PRMT5; AHCY
Metabolism
Sphingolipid Metabolism SPHKl; SPHK2
Aminophosphonate PRMT5
Metabolism
Androgen and Estrogen PRMT5
Metabolism Ascorbate and Aldarate ALDH1A 1
Metabolism
Bile Acid Biosynthesis ALDH1A1
Cysteine Metabolism LDHA
Fatty Acid Biosynthesis FASN
G 1 utamate Reeep tor GNB2L1
Signaling
NRF2-mediated P DX1
Oxidative
Stress Response
Pentose Phosphate GPI
Pathway
Pentose and Ghicurorsate UCFIL1
Interconversions
Retinol Metabolism ALDH1A 1
Riboflavin Metabolism TYR
Tyrosine Metabolism PRMT5, TYR
Ubiquinone Biosynthesis PRMT5
Valine, Leucine and ALDH1A1
Isoleueine Degradation
Glycine, Serine and CHKA
Threonine Metabolism
Lysine Degradation ALDH 1A1
Pain/Taste TRPM5; TRPA1
Pain TRPM7; TRPC5; TRPC6; TRPC1 ; Cnrl ; cnr2; Grk2;
Trpal; Pome; Cgrp; Crf; Pka; Era; Nr2b; TRPM5; Prkaca;
Prkacb; Prkarla; Prkar2a
Mitochondrial Function AIF; CytC; SMAC (Diablo); Aifm-i ; Aiftn-2
Developmental BMP-4; Chordin (Chrd); Noggin (Nog); WNT (Wnt2;
Neurology
Wnt2b; Wnt3a; Wnt4; WiitSa; Wiit6; Wnt7b; WntSb;
Wnr9a; Wiit9b; WntiOa; WntiOb; Wntl6); beta-eateiiin;
Dkk-1; Frizzled related proteins; Otx-2; Gbx2; FGF-8;
Reelin; Dabl; unc-86 (Pou4fl or Brn3a); Numb; Rein
[00543] Embodiments of the invention also relate to methods and compositions related to knocking out genes, amplifying genes and repairing particular mutations associated with DNA repeat instability and neurological disorders (Robert D. Wells, Tetsuo Ashizawa, Genetic Instabilities and Neurological Diseases, Second Edition, Academic Press, Oct 13, 201 1 - Medical). Specific aspects of tandem repeat sequences have been found to be responsible for more than twenty human diseases (New insights into repeat instability: role of RNA»DNA hybrids, .Vic! s or EI, Polak U, Napieraia M. RNA Biol 2010 Sep-Oct;7(5):551-8). The CRISPR- Cas system may be harnessed to correct these defects of genomic instability.
[00544] A further aspect of the invention relates to utilizing the CRISPR-Cas system for correcting defects in the EMP2A and EMP2B genes that have been identified to be associated with Lafora disease. Lafora disease is an autosomal recessive condition which is characterized by progressive myoclonus epilepsy which may start as epileptic seizures in adolescence. A few cases of the disease may be caused by mutations in genes yet to be identified. The disease causes seizures, muscle spasms, difficulty walking, dementia, and eventually death. There is currently no therapy that has proven effective against disease progression. Other genetic abnormalities associated with epilepsy may also be targeted by the CRISPR-Cas system and the underlying genetics is further described in Genetics of Epilepsy and Genetic Epilepsies, edited by GiuHano Avanzini, Jeffrey L. Noebels, Mariani Foundation Paediatric Neurology:20; 2009).
[CI0545] The methods of US Patent Publication No. 201 10158957 assigned to Sangamo Biosciences, Inc. involved in inactivating T cell receptor (TCR) genes may also be modified to the CRISPR Cas system of the present invention. In another example, the methods of US Patent Publication No. 2010031 1 124 assigned to Sangamo Biosciences, Inc. and US Patent Publication No. 201 10225664 assigned to Cellectis, which are both involved in inactivating glutamine synthetase gene expression genes may also be modified to the CRISPR Cas system of the present invention,
[00546] Several further aspects of the invention relate to correcting defects associated with a wide range of genetic diseases which are further described on the website of the National Institutes of Health under the topic subsection Genetic Disorders (website at health.nih.gov/topic/GeneticDisorders). The genetic brain diseases may include but are not limited to Adrenoleukodystrophy, Agenesis of the Corpus Callosum, Aicardi Syndrome, Alpers' Disease, Alzheimer's Disease, Barth Syndrome, Batten Disease, CADASIL, Cerebellar Degeneration, Fabry's Disease, Gerstmann-Straussier-Scheinker Disease, Huntington's Disease and other Triplet Repeat Disorders, Leigh's Disease, Lesch-Nyhan Syndrome, Menkes Disease, Mitochondrial Myopathies and NINDS Colpocephaly. These diseases are further described on the website of the National Institutes of Healt under the subsection Genetic Brain Disorders.
[00547] In some embodiments, the condition may be neoplasia. In some embodiments, where the condition is neoplasia, the genes to be targeted are any of those listed in Table A (in this case PTEN and so forth). In some embodiments, the condition may be Age-related Macular Degeneration. In some embodiments, the condition may be a Schizophrenic Disorder. In some embodiments, the condition may be a Trinucleotide Repeat Disorder. In some embodiments, the condition may be Fragile X Syndrome. In some embodiments, the condition may be a Secretase Related Disorder. In some embodiments, the condition may be a Prion - related disorder. In some embodiments, the condition may be ALS. In some embodiments, the condition may be a drug addiction. In some embodiments, the condition may be Autism. In some embodiments, the condition may be Alzheimer's Disease. In some embodiments, the condition may be inflammation. In some embodiments, the condition may be Parkinson's Disease.
[00548] For example, US Patent Publication No. 20110023145, describes use of zinc finger nucleases to genetically modify cells, animals and proteins associated with autism spectrum disorders (ASD). Autism spectrum disorders (ASDs) are a group of disorders characterized by qualitative impairment in social interaction and communication, and restricted repetitive and stereotyped patterns of behavior, interests, and activities. The three disorders, autism, Asperger syndrome (AS) and pervasive developmental disorder-not otherwise specified (PDD-NOS) are a continuum of the same disorder with varying degrees of severity, associated intellectual functioning and medical conditions. ASDs are predominantly genetically determined disorders with a heritability of around 90%.
[00549] US Patent Publication No. 20110023145 comprises editing of any chromosomal sequences that encode proteins associated with ASD which may be applied to the CRISP Cas system of the present invention. The proteins associated with ASD are typically selected based on. an experimental association, of the protein associated with ASD to an incidence or indication of an ASD. For example, the production rate or circulating concentration of a protein associated with ASD may be elevated or depressed in a population having an ASD relative to a population lacking the ASD. Differences in protein levels may be assessed using proteomic techniques including but not limited to Western blot, immunohistochemical staining, enzyme linked immunosorbent assay (ELISA), and mass spectrometry. Alternatively, the proteins associated with ASD may be identified by obtaining gene expression profiles of the genes encoding the proteins using genomic techniques including but not limited to D A microarray analysis, serial analysis of gene expression (SAGE), and quantitative real-time polymerase chain reaction (Q- PCR). [00550] Non limiting examples of disease states or disorders that may be associated with proteins associated with ASD include autism, Asperger syndrome (AS), pervasive developmental disorder-not otherwise specified (PDD-NOS), Rett's syndrome, tuberous sclerosis, phenylketonuria, Smith-Lemli-Opitz syndrome and fragile X syndrome. By way of non-limiting example, proteins associated with ASD include but are not limited to the following proteins: ATP IOC aminophospho lipid- MET MET receptor transporting ATPase tyrosine kinase (ATP IOC) BZRAP1 MGLUR5 (GRM5) Metabotropic glutamate receptor 5 (MGLUR5) CDHIO Cadherin-10 MGLUR6 (GRM6) Metabotropic glutamate receptor 6 (MGLUR6) CD! 19 Cadherin-9 NLGN 1 Neuroligin-1 C TN4 Contaetin-4 NLGN2 Neuroligin-2 CNTNAP2 Contactin-associated SEMA5A Neuroligin-3 protein-like 2 (C TNAP2) DHCR7 7- dehydrocholesterol NLGN4X Neuroligin-4 X- reductase (DHCR7) linked DOC2A Double ( 2- like domain- NLGN4Y Neuroligin-4 Y- containing protein alpha linked DPP6 Dipeptidyl NLGN5 Neuroligi.n-5 aminopeptidase-like protein 6 EN2 engrailed 2 (EN2) NRCAM Neuronal cell adhesion molecule (NRCAM) MDGA2 fragile X mental retardation NRXNl Neurexin-1 1 (MDGA2) FMR2 (AFF2) AF4/FMR2 family member 2 OR4M2 Olfactory receptor (AFF2) 4M2 FOXP2 Forkhead box protein P2 OR4N4 Olfactory receptor (FOXP2) 4N4 FXR1 Fragile X mental QXTR oxytocin receptor retardation, autosomal (OX I k ) homolog 1 (FXR1) FXR2 Fragile X mental PAH phenylalanine retardation, autosomal hydroxylase (PAH ) homolog 2 (FXR2) GABRA1 Gamma-aminobutyric acid PTEN Phosphatase and receptor subunit alpha- 1 ten sin homologue (GABRA l) (PTEN) GABRA5 GABAA (.gamma.-aminobutyric PTPRZ1 Receptor-type acid) receptor alpha 5 tyrosine-protein subunit (GABRA5) phosphatase zeta (PTPRZ1 ) GABRB! Gamma-aminobutyric acid RELN Reelin receptor subunit beta-1 (GABRBl) GABRB3 GABAA (.gamma.-aminobutyric RPL10 60S ribosomal acid) receptor .beta.3 subunit protein 1,10 (GABRB3) GABRG1 Gamma-aminobutyric acid SEMA5A Semaphorin-5A receptor subunit gamma-1 (SEMA5A) (GABRG1) HIRIP3 HIRA-interacting protein 3 SEZ6L2 seizure related 6 homolog (mouse)- like 2 HOXAl Homeobox protein Flox- Λ I SHANK.3 SH3 and multiple (HOXAl) ankyrin repeat domains 3 (SHANK3) 11,6 mterleukin- 6 SHBZRAP1 SH3 and multiple ankyrin repeat domains 3 (SHBZRAP1) LAMB1 Laminin subunit beta-1 SLC6A4 Serotonin (LAMBi) transporter (SERT) MAPK3 Mitogen-activated protein TAS2R1 Taste receptor kinase 3 type 2 member 1 TAS2R1 MAZ Myc-associated zinc finger TSC1 Tuberous sclerosis protein protein 1 MDGA2 MAM domain containing TSC2 Tuberous sclerosis giycosylphosphatidylinositol protein 2 anchor 2 (MDGA2) MECP2 Methyl CpG binding UBE3A Ubiquitin protein protein 2 (MECP2) ligase E3A (UBE3A) MECP2 methyl CpG binding WNT2 Wingless-type protein 2 (MECP2) MMTV i tegration site family, member 2 (WNT2)
[00551] The identity of the protein associated with ASD whose chromosomal sequence is edited can and will vary. In preferred embodiments, the proteins associated with ASD whose chromosomal sequence is edited may be the benzodiazapine receptor (peripheral) associated protein 1 (BZRAPl) encoded by the BZRAPl gene, the AF4/FMR2 family member 2 protein (AFF2) encoded by the AFF2 gene (also termed MFR2), the fragile X mental retardation autosomal homolog I protein (FXR1 ) encoded by the F.XR.1 gene, the fragile X mental retardation autosomal homolog 2 protein (FXR2) encoded by the FXR2 gene, the MAM domain containing giycosylphosphatidylinositol anchor 2 protein (MDGA2) encoded by the MDGA2 gene, the methyl CpG binding protein 2 (M ECP2) encoded by the MECP2 gene, the metabotropic glutamate receptor 5 (MGLUR5) encoded by the MGLUR5-1 gene (also termed GRM5), the neurexin 1 protein encoded by the NRXNl gene, or the semaphorin~5A protein (SEMA5A) encoded by the SEMA5A gene. In an exemplary embodiment, the genetically modified animal is a rat, and the edited chromosomal sequence encoding the protein associated with ASD is as listed below: BZRAP l benzodiazapine receptor XM_002727789, (peripheral) associated XM 213427, protein 1 (BZRAPl) XM 002724533, XM 001081125 AFF2 (FMR2) AF4/FMR2 family member 2 XM_219832, (AFF2) XM_001054673 FXR1 Fragile X mental NM 001012179 retardation, autosomal homolog 1 (FXR1) FXR2 Fragile X mental NM_()01 100647 retardation, autosomal homolog 2 (FXR2) MDGA2 MAM domain containing NM_199269 giycosylphosphatidylinositol anchor 2 (MDGA2) MECP2 Methyl CpG binding NM 022673 protein 2 (MECP2) MGLUR5 Metabotropic glutamate NM 017012 (GRM5) receptor 5 (MGLUR5) NRXNl Neurexin- 1 NM_021767 SEMA5A Semaphorin-SA (SEMA5A NM 001 107659
[00552] Exemplar}? animals or cel ls may comprise one, two, three, four, five, six, seven, eight, or nine or more inactivated chromosomal seque ces encoding a protein associated with ASD, and zero, one, two, three, four, five, six, seven, eight, nine or more chromosoma!ly integrated sequences encoding proteins associated with ASD, The edited or integrated chromosomal sequence may be modified to encode an altered protein associated with ASD. Non-limiting examples of mutations in proteins associated with ASD include the 1.18Q mutation in neurexin 1 where the leucine at position 18 is replaced with a giutamine, the R451 C mutation in neuroligin
3 where the arginine at position 451 is replaced with a cysteine, the R87W mutation i neuroligin
4 where the arginine at position 87 is replaced with a tryptophan, and the I425V mutation in serotonin transporter where the isoleucine at position 425 is replaced with a valine. A number of other mutations and chromosomal rearrangements in ASD-reSated chromosomal sequences have been associated with ASD and are known in the art. See, for example, Freitag et al. (2010) Eur. Child. Adolesc. Psychiatry 19:169-178, and Bucan et al. (2009) PLoS Genetics 5: el000536, the disclosure of which is incorporated by reference herein in its entirety.
[00553] Examples of proteins associated with Parkinson's disease include but are not limited to α-synuclein, DJ-1 , LRRK2, P1 K.1, Parkin, UCHL1 , Synphilin-1 , and URRl .
[00554] Examples of addiction-related proteins may include ABAT for example.
[00555] Examples of mflammation-reiated proteins may include the monocyte chemoattractant protei - 1 (MCP1) encoded by the Ccr2 ge e, the C-C chemokine receptor type 5 (CCR5) encoded by the Ccr5 gene, the IgG receptor ]]B (FCGR2b, also termed CD32) encoded by the Fcgr2b gene, or the Fc epsilon Rig (FCERlg) protein encoded by the Fcerlg gene, for example.
[00556] Examples of cardiovascular diseases associated proteins may include IL1 B (interleukin 1, beta), XDH (xa thine dehydrogenase), TP53 (tumor protein p53), PTGIS (prostaglandin 12 (prostacyclin) synthase), MB (myoglobin), IL4 (interleukm 4), ANGPT1 (angiopoietin 1), ABCG8 (ATP-binding cassette, sub-family G (WHITE), member 8), or CTSK (cathepsin ), for example.
[00557] For example, US Patent Publication No. 201 10023153, describes use of zinc finger nucleases to genetically modify cells, animals and proteins associated with Alzheimer's Disease. Once modified cells and animals may be further tested using known methods to study the effects of the targeted mutations on the development and/or progression of AD using measures commonly used in the study of AD - such as, without limitation, learning and memory, anxiety, depression, addiction, and sensory motor functions as well as assays that measure behavioral, functional, pathological, metaboloic and biochemical function.
[00558] The present disclosure comprises editing of any chromosomal sequences that encode proteins associated with AD. The AD-related proteins are typically selected based on an experimental association of the AD-related protem to an AD disorder. For example, the production rate or circulating concentration of an AD-related protein may be elevated or depressed in a population having an AD disorder relative to a population lacking the AD disorder. Differences in protein levels may be assessed using proteomic techniques including but not limited to Western blot, immunohistochemical staining, enzyme linked immunosorbent assay (EL1SA), and mass spectrometry. Alternatively, the AD-related proteins may be identified by obtaining gene expression profiles of the genes encoding the proteins using genomic techniques including but not limited to DNA microarray analysis, serial analysis of gene expression (SAGE), and quantitative real-time polymerase chain reaction (Q-PCR).
[00559] Examples of Alzheimer's disease associated proteins may include the very low density lipoprotein receptor protein (VLDLR) encoded by the VLDLR gene, the ubiquitin-like modifier activating enzyme 1 (UBA1) encoded by the UBA1 gene, or the NEDD8-activating enzyme El catalytic subunit protein (UBEIC) encoded by the UBA3 gene, for example.
[00560] By way of non-limiting example, proteins associated with AD include but are not limited to the proteins listed as follows: Chromosomal Sequence Encoded Protein ALAS2 Delta- aminolevulinate synthase 2 (ALAS2) ABCA1 ATP-binding cassette transporter (ABCA1) ACE Angiotensin I -converting enzyme (ACE) APOE Apolipoprotein E precursor (APOE) APP amyloid precursor protein (APP) AQP1 aquaporin 1 protein (AQP1) BIN l Myc box-dependent- interacting protein 1 or bridging integrator 1 protein (BINl) BDNF brain-derived neurotrophic factor (BDNF) BTNLS Butyrophilin-like protein 8 (BTNL8) C10RF49 chromosome 1 open reading frame 49 CDH4 Cadiierin-4 CHRNB2 Neuronal acetylcholine receptor subunit beta-2 C LFSF2 CKLF-like MARVEL transmembrane domain- containing protein 2 (C LFSF2) CLEC4E C-type lectin domain family 4, member e (CLEC4E) CLU ciusterin protein (also known as apoplipoprotein J) CR3 Erythrocyte complement receptor 1 (CR1 , also known as CD35, C3b/C4b receptor and immune adherence receptor) CRIL Erythrocyte complement receptor 1 (CRIL) CSF3R granulocyte colony-stimulating factor 3 receptor (CSF3R) CST3 Cystatin C or cystatin 3 CYP2C Cytochrome P450 2C DAPK1 Death-associated protein kinase 1 (DAPK1) ESRI Estrogen receptor 1 FCAR Fc fragment of IgA receptor (FCAR, also known as CD89) FCGR3B Fc fragment of IgG, low affinity Illb, receptor (FCGR3B or CD 16b) FFA2 Free fatty acid receptor 2 (FFA2) FGA Fibrinogen (Factor I) GAB2 GRB2-associated-binding protein 2 (GAB2) GAB2 GRB2-associated-binding protein 2 (GAB2) GALP Galanin-like peptide GAPDHS Glyceraldehyde-3~phosphate dehydrogenase, spermatogenic (GAPDHS) GMPB GMBP HP Haptoglobin (HP) HTR7 5 -hydroxytryptamine (serotonin) receptor 7 (adenylate cyclase-coupled) IDE Insulin degrading enzyme IF 127 IF 127 IFI6 Interfero , alpha-inducible protein 6 (IF16) 1FIT2 Interferon-induced protein with tetratricopeptide repeats 2 (IFIT2) L1RN interleukin-l receptor antagonist (IL-1RA) IL8RA Iiiterleukin 8 receptor, alpha (IL8RA or (1) 181 ! 1L8RB mterleukm 8 receptor, beta (I L8RB) JAG1 Jagged I (JAG1) KCNJ15 Potassium inwardly-rectifying channel, subfamily J, member 15 (KCNJ15) LRP6 Low-density lipoprotein receptor-related protein 6 (LRP6) MAPT microtubule-associated protem tan (MAPT) MARK4 MAP/microtubule affinity-regulating kinase 4 (MARK.4) MPHOSPH l M-phase phosphoprotem 1 MTHFR 5,10-methy!enetetrahydrofolate reductase MX2 Interferon-induced GTP-binding protein Mx2 NB'N Nibrin, also known as NBN NCSTN Nicastrin NIACR2 Niacin receptor 2 (NIACR2, also known as GPR109B) NMNAT3 nicotinamide nucleotide adenylyltransferase 3 NTM Neurotrimin (or HNT) ORM1 Orosmucoid 1 (ORM 1 ) or Alpha-] -acid glycoprotein 1 P2RY13 P2Y purinoceptor 13 (P2RY13) PBEFI Nicotinamide phospiioiibosyitransferase (NAmPRTase or Nampt) also known as pre-B-cell colony-enhancing factor I (PBEFl) or visfatin PCK1 Phosphoenolpyruvate carboxykinase PICALM phosphatidylinositol binding clathrin assembly protem (PICA LM) PLAU Urokinase-type plasminogen activator (PLAU) PLXNC1 Plexin CI (PLXNC1 ) PRNP Prion protein PSENl preseniim 1 protein (PSEN l) PSEN2 presenilin 2 protein (PSEN2) PTPRA protein tyrosine phosphatase receptor type A protein (PTPRA) RALGPS2 Ral GEF with PH domain and SFI3 binding motif 2 (RALGPS2) RGSL2 regulator of G-protein signaling like 2 (RGSL2) SELENBP1 Selenium binding protein 1 (SELNBPl ) SLC25A37 Mitoferrin-1 SORLl sortil i -related receptor L(DLR class) A repeats- containing protem (SORLl ) TF Transferrin TFAM Mitochondrial transcription factor A TNF Tumor necrosis factor TNFRSF10C Tumor necrosis factor receptor superfamily member I OC (TNFRSF10C) TNFSF10 Tumor necrosis factor receptor superfamily, (TRAIL) member 10a (TNFSF10) UBA1 ubiquitin-like modifier activating enzyme I (UBA1) UB.A3 NEDD8- activating enzyme El catalytic subunit protein (UBE1C) UBB ubiquitin B protein (UBB) UBQL I Ubiquilin-1 UCHL1 ubiquitin carboxyi-termmai esterase LI protein (UCHLI) UCHL3 ubiquitin carboxyf-terminal hydrolase isozyme L3 protein (UCHL3) V LDLR very low density lipoprotein receptor protein (VLDLR) [00561] In exemplary embodiments, the proteins associated with AD whose chromosomal sequence is edited may be the very low density lipoprotein receptor protein (VLDLR) encoded by the VLDLR gene, the ubiquitin- like modifier activating enzyme 1 (UBA1) encoded by the UBA1 gene, the NEDDS-aetivating enzyme El catalytic subunit protein (UBE1 C) encoded by the UBA3 gene, the aquaporin 1 protein (AQP1) encoded by the AQP1 gene, the ubiquitin carboxy] -terminal esterase LI protein (UCHLl) encoded by the UCHL1 gene, the ubiquitin carboxyl-terminal hydrolase isozyme L3 protein (UCHL3) encoded by the UCHL3 gene, the ubiquitin B protein (UBB) encoded by the UBB gene, the microtubule-associated protem tau (MAPT) encoded by the MAPT gene, the protein tyrosine phosphatase receptor type A protem (PTPRA) encoded by the PTP A gene, the phosphatidylinositol binding clathrin assembly protein (PICALM) encoded by the PICALM gene, the elusterin protein (also known as apop lipoprotein J) encoded by the CLU gene, the presenil i I protein encoded by the PSEN1 gene, the presenilin 2 protein encoded by the PSEN2 gene, the sortilm-related receptor L(DLR class) A repeats-containing protein (SORLl) protein encoded by the SORLl ge e, the amyloid precursor protem (APP) encoded by the APP gene, the A po lipoprotein E precursor (APOE) encoded by the APOE gene, or the brain-derived neurotrophic factor (BDNF) encoded by the BDNF gene. In an exemplary embodiment, the genetically modified animal is a rat, and the edited chromosomal sequence encoding the protein associated with AD is as as follows: APP amyloid precursor protei (APP) NM 019288 AQP1 aquaporin 1 protein (AQP1) NM 012778 BDNF Brain-derived neurotrophic factor NM__012513 CLU clusterin protem (also known as NM 053021 apoplipoprotein J) MAPT microtubule-associated protei NM 017212 tau (MAPT) PICA LM phosphatidylinositol binding NM__053554 clathrin assembly protein (PICALM) PSENl presenilin 1 protein (PSEN l ) NM_019163 PSEN2 presenilin 2 protein (PSEN2) NM 031087 PTPRA protein tyrosine phosphatase NM 012763 receptor type A protein (PTPRA) SORLl sortiiin-related receptor L(DLR NMJ353519, class) A repeats-containing XM 001065506, protein (SORLl) XM 2171 15 UBAl ubiquitin-like modifier activating NM_001014080 enzyme 1 (UBAl) UBA3 NEDDS-aetivating enzyme El NM_057205 catalytic subunit protein (UBE1C) UBB ubiquitin B protein (UBB) NM 138895 UCHLl ubiquitin carboxyl-terminal NM_017237 esterase LI protem (UCHLl) UCHL3 ubiquitin carboxyl- terminal NM 001110165 hydrolase isozyme L3 protem (UCHL3) VLDLR very low density lipoprotein NM 013155 receptor protein (VLDLR) [00562] The animal or cell may comprise 1, 2, 3, 4, 5, 6, 7, 8, 9,10, 1 1 , 12, 13, 14, 15 or more disrupted chromosomal sequences encoding a protein associated with AD and zero, L 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or more chromosomaily integrated sequences encoding a protei associated with AD.
[00563] The edited or integrated chromosomal sequence may be modified to encode a altered protein associated with AD. A number of mutations in AD-re!ated chromosomal sequences have been associated with AD. For instance, the V 7171 (i.e. valine at position 717 is changed to isoieucme) missense mutation in APP causes familial AD. Multiple mutations in the preseniiin-1 protein, such as H163R (i.e. histidine at position 163 is changed to arginine), A246E (i.e. alanine at position 246 is changed to gluiamate), L286V (i.e. leucine at position 286 is changed to valine) and C410Y (i.e. cysteine at position 410 is changed to tyrosine) cause familial Alzheimer's type 3, Mutations in the presenilin-2 protein, such as N141 I (i.e. asparagine at position 141 is changed to isoleueirse), VI 9V (i.e. methionine at position 239 is changed to valine), and D439A (i.e. aspartate at position 439 is changed to alanine) cause familial Alzheimer's type 4. Other associations of genetic variants in AD-associated genes and disease are known in the art. See, for example, Waring et ai. (2008) Arch. Neurol. 65:329-334, the disclosure of which is incorporated by reference herein in its entirety.
[00564] Examples of proteins associated Autism Spectrum Disorder may include the benzodiazepine receptor (peripheral) associated protein 1 (BZRAPl) encoded by the BZRAP1 gene, the AF4/F R2 family member 2 protein (AFF2) encoded by the AFF2 gene (also termed MFR2), the fragile X mental retardation autosomal homolog 1 protein (FXRl) encoded by the FXR 1 gene, or the fragile X mental retardation autosomal homolog 2 protein (FXR2) encoded by the FXR2 gene, for example.
[00565] Examples of proteins associated Macular Degeneration may include the ATP-binding cassette, sub-family A (ABCl) member 4 protein (ABCA4) encoded by the ABCR gene, the apolipoprotein E protein (APQE) encoded by the APOE gene, or the chemokine (C-C motif) Ligand 2 protein (CCL2) encoded by the CCL2 gene, for example.
[00566] Examples of proteins associated Schizophrenia may include NRG1, ErbB4, CPLX1, 1 Pi l l . TP! 12. NRX l , GSK3A, BDNF, DISCI , GSK3B, and combinations thereof
[00567] Examples of proteins involved in tumor suppression may include ATM (ataxia telangiectasia mutated), ATR (ataxia telangiectasia and Rad3 related), EGFR (epidermal growth factor receptor), ERBB2 (v~erb-b2 erythroblastic leukemia viral oncogene homolog 2), ERBB3 (v-erb-b2 erythroblastic leukemia viral oncogene homolog 3), ERBB4 (v-erb-b2 erythroblastic leukemia viral oncogene homolog 4), Notch 1, Notch2, Notch 3, or Notch 4, for example.
[00568] Examples of proteins associated with a secretase disorder may include PSENEN (presenilin enhancer 2 homolog (C. elegans)), CTSB (cathepsin B), PSENl (presenilin 1), APP (amyloid beta (A4) precursor protein), APH1B (anterior pharynx detective 1 homolog B (C. elegans)), PSEN2 (presenilin 2 (Alzheimer disease 4)), or BACE1 (beta-site APP-cleaving enzyme 1), for example.
[00569] For example, US Patent Publication No. 201 10023146, describes use of zinc finger nucleases to genetically modify cells, animals and proteins associated with secretase-assoeiate disorders. Secretases are essential for processing pre-proteins into their biologically active forms. Defects in various components of the secretase pathways contribute to many disorders, particularly those with hallmark amyioidogenesis or amyloid plaques, such as Alzheimer's disease (AD).
[00570] A secretase disorder and the proteins associated with these disorders are a diverse set of proteins that effect susceptibility for numerous disorders, the presence of the disorder, the severity of the disorder, or any combination thereof. The present disclosure comprises editing of any chromosomal sequences that encode proteins associated with a secretase disorder. The proteins associated with a secretase disorder are typically selected based on an experimental association of the secretase—elated proteins wit the development of a secretase disorder. For example, the production rate or circulating concentration of a protein associated with a secretase disorder may be elevated or depressed in a population with a secretase disorder relative to a population without a secretase disorder. Differences in protein levels may be assessed using proteomic techniques including but not limited to Western blot, immimohistochemical staining, enzyme linked immunosorbent assay (ELISA), and mass spectrometry. Alternatively, the protein associated with a secretase disorder may be identified by obtaining gene expression profiles of the genes encoding the proteins using genomic techniques including but not limited to D A microarray analysis, serial analysis of gene expression (SAGE), and quantitative real-time polymerase chain reaction (Q-PCR .).
[00571] By way of non- limiting example, proteins associated with a secretase disorder include PSENEN (presenilin enhancer 2 homolog (C. elegans)), CTSB (cathepsin B), PSENl (presenilin 1), APP (amyloid beta (A4) precursor protem), APHI B (anterior pharynx defective 1 hornolog B (C. elegans)), PSEN2 (presenilin 2 (Alzheimer disease 4)), BACE1 (beta-site APP-cleaving enzyme 1), ITM2B (integral membrane protein 2B), CTSD (cathepsm D), NOTCH 1 (Notch homo fog 1 , translocation -associated (Drosophila)), TNF (tumor necrosis factor (TNF superfamiiy, member 2)), INS (insulin), DYT10 (dystonia 10), ADAM 17 (ADAM metal lopeptidase domain 17), APOE (apolipoprotem E), ACE (angiotensin ] converting enzyme (peptidyl-dipeptidasc A) 1 ), STN (statin), TP53 (tumor protein p53), IL6 (interleukin 6 (interferon, beta 2)), NGFR (nerve growth factor receptor (TNFR superfamiiy, member 16)), ILIB (interleukin 1 , beta), ACHE (acetylcholinesterase (Yt blood group)), CTNNB l (catenin (cadherin-associated protem), beta 1, 88kDa), IGFl (insulin-like growth factor 1 (somatomedin C)), IFNG (interferon, gamma), NRG1 (neuregulin 1), CASP3 (caspase 3, apoptosis-related cysteine peptidase), MAP 1 (mitogen-activated protein kinase 1), CDHI (cadherin 1, type 1, E- cadherin (epithelial )), APBB1 (amyloid beta (A4) precursor protein -bin ding, family B, member 1 (Fe65)), HMGCR (3-hydroxy-3-methylglutaryl-Coenzyme A reductase), CREB1 (cAMP responsive element binding protein 1). PTGS2 (prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase)), HES1 (hairy and enhancer of split 1 , (Drosophila)), CAT (catalase), TGFB1 (transforming growth factor, beta 1), EN 02 (enolase 2 (gamma, neuronal)), ERBB4 (v-erb-a erythroblastic leukemia viral oncogene hornolog 4 (avian)), TRAPPC10 (trafficking protein particle complex 10), MAOB (monoamine oxidase B), NGF (nerve gro wth factor (beta polypeptide)), MM 12 (matri metal lopeptidase 12 (macrophage elastase)), JAG1 (jagged I (Aiagiile syndrome)), CD40LG (CD40 ligand), PPARG (peroxisome proliferator-activated receptor gamma), FGF2 (fibroblast growth factor 2 (basic)), IL3 (interleukin 3 (colony-stimulating factor, multiple)), LRP1 (low density lipoprotein receptor- related protein 1), NOTCH4 (Notch hornolog 4 (Drosophila)), MAPK8 (mitogen-activated protein kinase 8), PREP (prolyl endopeptidase), NOTCH3 (Notch hornolog 3 (Drosophila)), PRNP (prion protein), CTSG (cathepsin G), EGF (epidermal growth factor (beta-urogastrone)), REN (renin), CD44 (CD44 molecule (Indian blood group)), SELP (selectin P (granule membrane protem 140 kDa, antigen CD62)), GHR (growth hormone receptor), ADC YAP 1 (adenylate cyclase activating polypeptide 1 (pituitary)), JNSR (insulin receptor), GFAP (glial fibrillary acidic protein), MMP3 (matrix metallopeptidase 3 (stromelysin 1, progelatinase)), MAP 10 (mitogen-activated protein kinase 10), SP1 (Spl transcription factor), MYC (v-myc myelocytomatosis viral oncogene homolog (avian)), CTSE (eathepsin E), PPARA (peroxisome proliferator-activated receptor alpha), JUN (jun oncogene), ΊΊΜΡ1 (ΊΊΜΡ metallopeptidase inhibitor 1), IL5 (interleukin 5 (colony-stimulating factor, eosinophil)), ILIA (interleukin I, alpha), MMP9 (matrix metal Sopeptidase 9 (gelatinase B, 92 kDa geSatinase, 92 kDa type IV coilageiiase)), HTR4 (5-hydroxytryptamine (serotonin) receptor 4), HSPG2 (heparan sulfate proteoglycan 2), KRAS (v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog), CYCS (cytochrome c, somatic), SMG1 (SMG1 homolog, phosphatidylinositol 3-kinase-related kinase (C, elegans)), ILl R] (interleiikm 1 receptor, type I), PROKl (prokineticin 1 ), MAPK3 (mitogen- activated protein kinase 3), NTR 1 (neurotrophic tyrosine kinase, receptor, type 1), ILl 3 (interleukin 13), MME (membrane metallo-endopeptidase), TKT (transketoiase), CXCR2 (chemokine (C-X-C motif) receptor 2), IGF! R (insulin- like growth factor 1 receptor), RARA (retmoic acid receptor, alpha), CREBBP (CREB binding protein), PTGSl (prostaglandin- endoperoxide synthase I (prostaglandin G/H synthase and cyclooxygenase)), GALT (galactose- 1 -phosphate uridylyltransferase), CHRM1 (cholinergic receptor, muscarinic 1), ATXN1 (ataxin I s. PAWR (PRKC, apoptosis, WT1, regulator), NOTCH2 (Notch homolog 2 (Drosophila)), M6PR (mannose-6-phosphate receptor (cation dependent)), CYP46A 1 (cytochrome P450, family 46, subfamily A, polypeptide 1), CSNK1 D (casein kinase 1, delta), MAPK14 (mitogen- activated protein kinase 14), PRG2 (proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein)), PRKC A (protein kinase C, alpha), LI CAM (LI cell adhesion molecule), CD40 (CD40 molecule, T F receptor superfamily member 5), NR1 I2 (nuclear receptor subfamily 1, group I, member 2), JAG2 (jagged 2), CTNND1 (catenin (cadherin-associated protein), delta 1), CDH2 (cadherin 2, type 1 , -cadherin (neuronal)), CMA1 (chymase 1 , mast cell), SORT ! (sortilin 1), DL&l (delta-like 1 homolog (Drosophila)), THEM4 (thioesterase superfamily member 4), JUP Q unction plakoglobin), CD46 (CD46 molecule, complement regulatory protein), CCL11 (chemokine (C-C motif) ligand 1 1 ), CAV3 (caveolin 3), RNASE3 (ribonuclease, RNase A family, 3 (eosinophil cationic protein)), SPA8 (heat shock 70kDa protein 8), CASP9 (caspase 9, apoptosis-related cysteine peptidase), CYP3A4 (cytochrome P450, family 3, subfamily A, polypeptide 4), CCR3 (chemokine (C-C motif) receptor 3), TFAP2A (transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha)), SCP2 (sterol carrier protein 2), CD 4 (cyciin-depeiident kinase 4), HIF1A (hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)), TCF7L2 (transcription factor 7-like 2 (T-cell specific, HMG-box)), 1LIR2 (interleukin 1 receptor, type II), B3GALTL (beta 1 ,3-galactosyltransferase-likc), MDM2 (Mdm2 p53 binding protein homolog (mouse)), RELA (v-rel reticuloendotheliosis viral oncogene homolog A (avian)), CASP7 (caspase 7, apoptosis-related cysteine peptidase), IDE (insulin-degrading enzyme), FABP4 (fatty acid binding protein 4, adipocyte), CASK (calcium/calmodulin-dependent seri e protein kinase ( AGUK family)), ADCYAPIRI (adenylate cyclase activating polypeptide I (pituitary) receptor type I), ATF4 (activating transcription factor 4 (tax-responsive enhancer element B67)), PDGFA (platelet-derived growth factor alpha polypeptide), C.21 or 133 (chromosome 21 open reading frame 33), SCG5 (secretogranin V (7B2 protein)), R F123 (ring finger protein 123), NFKB1 (nuclear factor of kappa light polypeptide gene enhancer in B-celis I), ERBB2 (v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian)), CAV1 (caveolin 1, eaveoiae protein, 22 kDa), MMP7 (matrix metallopeptidase 7 (matrilysin, uterine)), TGFA (transforming growth factor, alpha), RXRA (retinoid X receptor, alpha), STX1A (syntaxin 1A (brain)), PSMC4 (proteasome (prosome, macropain) 26S subunit, ATPase, 4), P2RY2 (purinergic receptor P2Y, G-protein coupled, 2), TNFRSF21 (tumor necrosis factor receptor superfamily, member 21 ), DLG1 (discs, large homolog I (Drosophiia)), NUMBL (numb homolog (Drosophiia)~Iike), SPN (sialophorin), PLSCRl (phospholipid scramblase 1), UBQLN2 (ubiquilin 2), UBQLN l (ubiquilin 1), PCSK7 (proprotein convertase subtilisin/kexin type 7), SPON1 (spondin 1, extracellular matrix protein), SILV (silver homolog (mouse)), QPCT (glutaminyl-peptide cyclotransferase), HESS (hairy and enhancer of split 5 (Drosophiia)), GCCl (GRIP and coiled-coil domain containing 1), and any combination thereof.
[00572] The genetically modified animal or ceil may comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more disrupted chromosomal sequences encoding a protein associated with a secretase disorder and zero, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more chromosomally integrated sequences encoding a disrupted protein associated with, a secretase disorder.
[00573] Examples of proteins associated with Amyotrophic Lateral Sclerosis may include SOD1 (superoxide dismutase 1), ALS2 (amyotrophic lateral sclerosis 2), FITS (fused in sarcoma), TARDBP (TAR DNA binding protein), VAGFA (vascular endothelial growth factor A), VAGFB (vascular endothelial growth factor B), and VAGFC (vascular endothelial growth factor C), and any combination thereof. [00574] For example, US Patent Publication No. 20110023144, describes use of zinc finger nucleases to genetically modify cells, animals and proteins associated with amyotrophyic lateral sclerosis (ALS) disease. ALS is characterized by the gradual steady degeneration of certain nerve cel ls in the brain cortex, brain stem, and spinal cord involved in voluntary movement.
[00575] Motor neuron disorders and the proteins associated with these disorders are a diverse set of proteins that effect susceptibility for developing a motor neuron disorder, the presence of the motor neuron disorder, the severity of the motor neuron disorder or any combmation thereof. The present disclosure comprises editing of any chromosomal sequences thai encode proteins associated with ALS disease, a specific motor neuron disorder. The proteins associated with ALS are typically selected based on an experimental association of ALS— related proteins to ALS. For example, the production rate or circulating concentration of a protein associated with ALS may be elevated or depressed in a population with ALS relative to a population without ALS. Differences in protein levels may be assessed using proteomic techniques including but not limited to Western blot, immunohistochemical staining, enzyme linked immunosorbent assay (EL1SA), and mass spectrometry. Alternatively, the proteins associated with ALS may be identified by obtaining gene expression profiles of the genes encoding the proteins using genomic techniques including but not limited to DNA. microarray analysis, serial analysis of gene expression (SAGE), and quantitative real-time polymerase chain reaction (Q-PCR).
[00576] By way of non-limiting example, proteins associated with ALS include but are not limited to the following proteins: SOD1 superoxide dismutase 1 , ALS3 amyotrophic lateral soluble sclerosis 3 SETX senataxin ALS 5 amyotrophic lateral sclerosis 5 FLIS fused in sarcoma ALS7 amyotrophic lateral sclerosis 7 ALS2 amyotrophic lateral DPP6 Dipeptidyl-peptidase 6 sclerosis 2 NEFH neurofilament, heavy PTGS1 prostaglandin- polypeptide endoperoxide synthase 1 SLC1A2 solute carrier family 1 TNFRSF10B tumor necrosis factor (glial high affinity receptor superfamiiy, glutamate transporter), member 10b member 2 PRPH peripheral HSP90AA1 heat shock protein 90 kDa alpha (cytosolic), class A .member 1 GRIA2 glutamate receptor, IFNG interferon, gamma ionotropie, AM PA 2 SI Q0B SI 00 calcium binding FGF2 fibroblast growth factor 2 protein B AOX1 aldehyde oxidase 1 CS citrate synthase TARDBP TAR DNA binding protein TXN thioredoxin RAPH1 Ras association MAP3K5 mitogen- activated protein (RaIGDS/AF-6) and kinase 5 pleckstriii homology domains 1 NBEAL1 neurobeachin- ike 1 GPX1 glutathione peroxidase 1 ICAIL islet cell autoantigen RACl ras- related C3 botulmum 1.69 kDa-like toxin substrate I MAPT rmcrotubule-associated ITPR2 inositol 1,4,5- protein tan triphosphate receptor, type 2 ALS2CR4 amyotrophic lateral GLS glutaminase sclerosis 2 (juvenile) chromosome region, candidate 4 ALS2CR8 amyotrophic lateral CNTFR ciliary neurotrophic factor sclerosis 2 (juvenile) receptor chromosome region, candidate 8 ALS2CR11 amyotrophic lateral FOLH1 folate hydrolase 1 sclerosis 2 (juvenile) chromosome region, candidate 11 FAM1 17B family with sequence P4HB prolyl 4-hydroxylase, similarity 1 17, member B beta polypeptide CNTF ciliary neurotrophic factor SQSTM 1 sequestosome 1 STRADB STE20-related kinase NAIP NLR family, apoptosis adaptor beta inhibitory protein YWHAQ tyrosine 3- SLC33A1 solute earner family 33 rnonooxygenase/tiyptoph (acetyl-CoA transporter), an 5-monooxygenase member 1 activation protein, theta polypeptide TRAK2 trafficking protein, FIG. 4 FIG. 4 homo fog, SAC! kinesin binding 2 lipid phosphatase domai containing NIF3L1 NIF3 NGG1 interacting LNA internexin neuronal factor 3-like 1 intermediate fi lament protein, alpha PARD3B par-3 partitioning COX8A cytochrome c oxidase defective 3 homo log B subunit VIIIA CDK15 cyclin-dependent kinase ECW1 HECT, C2 and WW 15 domain containing E3 ubiquitin protein ligase 1 NOS1 nitric oxide synthase 1 MET met proto-oncogene SOD2 superoxide dismutase 2, HSPB1 heat shock 27 kDa mitochondrial protein 1 NEFL neurofilament, light CTSB cathepsin B polypeptide ANG angiogenin, HSPA8 heat shock 70 kDa ribonuciease, RNase A protein 8 family, 5 VAPB VAMP (vesicle- ESRI estrogen receptor 1 associated membrane protein) -associated protem B and C SNCA synuclem, alpha HGF hepatocyte growth factor CAT' catalase ACTS actin, beta NEFM neurofilament, medium TH tyrosine hydroxylase polypeptide BCL2 B-celi CLL/lymphoma 2 FAS Fas (TNF receptor superfamily, member 6) CASP3 caspase 3, apoptosis- CLU clusterin related cysteine peptidase SMN1 survival of motor neuron G6PD glucose-6-phosphate 1, telomeric dehydrogenase BAX BCL2 -associated X HSF1 heat shock transcriptio protein factor 1 RNF 19A ring finger protem 19A JUN jun oncogene ALS2CR12 amyotrophic lateral HSPA5 heat shock 70 kDa sclerosis 2 (juvenile) protei 5 chromosome region, candidate 12 MAPK14 mitogen-activated protein ]L10 interieukin 10 kinase 14 APEX1 APEX nuclease TXNRDl thioredoxin reductase 1 (multifunctional DNA repair enzyme) 1 NGS2 nitric oxide synthase 2, TI M P I TJMP metallopeptidase inducible inhibitor 1 CASP9 caspase 9, apoptosis- XIAP X- linked inhibitor of related cysteine apoptosis peptidase GLG1 golgi glycoprotein 1 EPG erythropoietin VEGFA vascular endothelial ELN elastin growth factor A GDNF glial cell derived NFE2L2 nuclear factor (erythroid- neurotrophic factor derived 2)-like 2 SLC6A3 solute carrier family 6 HSPA4 heat shock 70 kDa (neurotransmitter protein 4 transporter, dopamine), member 3 APOE apolipoprotein E PSMB8 proteasome (prosome, macropain) subunit, beta type, 8 DCTN1 dynactin 1 T1MP3 T1MP metaSlopeptidase inhibitor 3 KJFAP3 kinesin-associated SLC1A1 solute carrier family 1 protein 3 (neuronal/ epithelial high affinity glutamate transporter, system Xag), member 1 SMN2 survival of motor neuron CCNC cyclin C 2, centromeric PP4 membrane protein, STUB1 STIP1 homology and U- palmitoylated 4 box containing protein 1 ALS2 amyloid beta (A4) PRD.X6 peroxiredoxin 6 precursor protein SYP synaptophysin CABIN 1 calcineurin binding protein 1 CASP1 caspase 1, apoptosis- GART phosphoribosylglycinami related cysteine de formyltransferase, peptidase phosphoribosyfglycinami de synthetase, phosphori.bosylamin.oimi dazoie synthetase CDK5 cyclin-dependent kinase 5 ATXN3 ataxin 3 RTN4 reticulon 4 C1QB complement component 1, q subcomponent, B chain VEGFC nerve growth factor HTT huntingtin receptor PARK7 Parkinson disease 7 XDH xanthi e dehydrogenase GFAP glial fibrillary acidic MAP2 micro tubule-associated protein protein 2 CYCS cytochrome c, somatic FCGR3B Fc fragment of IgG, low affinity nib, CCS copper chaperone for UBL5 ubiquitin-like 5 superoxide dismutase MMP9 matrix metallopeptida.se SLC18A3 solute carrier family 18 9 ( (vesicular acetylcholine), member 3 TRPM7 transient receptor HSPB2 heat shock 27 kDa potential cation channel, protein 2 subfamily M, member 7 AKTl v-akt muri e thymoma DERL1 Deri -like domain family, viral oncogene homolog 1 member I CCL2 chemokine (C— C motif) GRN neugrin, neurite ligand 2 outgrowth associated GSR glutathione reductase TPPP3 tubulin polymerization- promoting protein family member 3 APAF1 apoptotic peptidase BTBD! Q BTB (POZ) domain activating factor 1 containing 10 GLUD1 glutamate CXCR4 chemokine (C--X--C motif) dehydrogenase 1 receptor 4 SIX 1 A3 solute carrier family 1 FLT1 fins-related tyrosine (glial high affinity glutamate transporter), member 3 kinase 1 PON l paraoxonase 1 AR androgen receptor LIF leukemia inhibitory factor ERBB3 v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 LGALS1 lectin, galactoside- CD44 CD44 molecule binding, soluble, 1 TPS 3 tumor protein p53 TLR3 toll-like receptor 3 GRIA1 glutamate receptor, GAPDH glyceraldehyde-3- ionotropic, AMPA 1 phosphate dehydrogenase GRIK1 glutamate receptor, DES desmin ionotropic, kainate 1 CHAT choline acetyltransferase FLT4 fins-related tyrosine kinase 4 CHMP2B chromatin modifying BAG1 BCL2-associated protein 2B athanogene MT3 metallothionein 3 CHRNA4 cholinergic receptor, nicotinic, alpha 4 GSS glutathione synthetase BAK1 BCL2- antagonist killer 1 KDR kinase insert domain GSTP1 glutathione S-transferase receptor (a type III pi 1 receptor tyrosine kinase) OGG1 8-oxoguanine DNA IL6 interleukin 6 (interferon, glycosy!ase beta 2).
[00577] The animal or cell may comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more disrupted chromosomal sequences encoding a protein associated with ALS and zero, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more chromosomally integrated sequences encoding the disrupted protein associated with ALS. Preferred proteins associated with ALS include SOD1 (superoxide dismutase 1), ALS2 (amyotrophic lateral sclerosis 2), FUS (fused in sarcoma), TARDBP (TAR DNA binding protein), VAGFA (vascular endothelial growth factor A), VAGFB (vascular endothelial growth factor B), and VAGFC (vascular endothelial growth factor C), and any combination thereof.
[00578] Examples of proteins associated with prion diseases may include SOD1 (superoxide dismutase 1), ALS2 (amyotrophic lateral sclerosis 2), FUS (fused in sarcoma), TARDBP (TAR DNA binding protein), VAGFA (vascular endothelial growth factor A), VAGFB (vascular endothelial growth factor B), and VAGFC (vascular endothelial growth factor C), and any combination thereof.
[00579] Examples of proteins related to neurodegenerative conditions in prion disorders may include A2M (Alpha-2-Maeroglobulin), AATF (Apoptosis antagonizing transcription factor), ACPP (Acid phosphatase prostate), ACTA2 (Actin alpha 2 smooth muscle aorta), ADAM22 (ADAM metallopeptidase domain), ADORA3 (Adenosine A3 receptor), or ADRA1D (Alpha-I D adrenergic receptor for Alpha- ID adrenoreceptor), for example.
[00580] Examples of proteins associated with Immunodeficiency may include A2M [alpha-2- macroglobulin]; AANAT [aryialkylamine N-acetyltransferase] ; ABCAl [ATP-binding cassette, sub-family A (ABC!), member 1]; ABCA2 [ATP-binding cassette, sub-family A (ABC1), member 2]; or ABCA3 [ATP-binding cassette, sub-family A (ABC1), member 3]; for example.
[00581] Examples of proteins associated with Trinucleotide Repeat Disorders include AR (androgen receptor), FMR! (fragile X mental retardation 1 ), HTT (huntingtin), or DMP (dystrophia myotonica-protein kinase), FXN (frataxin), ATXN2 (ataxin 2), for example.
[00582] Examples of proteins associated with Neurotransmission Disorders include SST (somatostatin), NOS1 (nitric oxide synthase 1 (neuronal)), ADRA2A (adrenergic, alpha -2A-, receptor), ADRA2C (adrenergic, alpha-2C~, receptor), TACR1 (tachykinin receptor 1), or HTR2c (5-hydroxytryptamine (serotonin) receptor 2C), for example.
[00583] Examples of neurodevelopmental-associated seque ces include A2BP1 [ataxin 2- binding protein 1 ], AADAT [aminoadipate aminotransferase], AA AT [arylal.kyl.amme N~ acetyltransfera.se], ABAT [4-aminobutyrate aminotransferase], ABCA1 [ATP -binding cassette, sub-family A (ABC.1), member 1], or ABCA 13 [ATP-binding cassette, sub-family A (ABC1), member 13], for example.
[00584] Further examples of preferred conditions treatable with the present system include may be selected from: Aicardi-Goutieres Syndrome; Alexander Disease; Allan-Herndon-Dudiey Syndrome; POLG-Related Disorders; Alpha-Mannosidosis (Type II and III); Alstrom Syndrome; A gelman; Syndrome; Ataxia-Telangiectasia; Neuronal Ceroid-Lipofuscinoses; Beta- Thalassemia; Bilateral Optic Atrophy and (I fantile) Optic Atrophy Type 1; Retinoblastoma (bilateral); Canavan Disease; Cerebrooculofacioskeletal Syndrome 1 [COFS1 ]; Cerebrotendinous Xanthomatosis: Cornelia de Laiige Svndrome; MAPT-Related Disorders; Genetic Prion Diseases; Dravet Syndrome; Early-Onset Familial Alzheimer Disease; Friedreich Ataxia [FRDA]; Fryns Syndrome; Fucosidosis; Fukuyama Congenital Muscular Dystrophy; Galactosialidosis; Gaucher Disease; Organic Acidemias; Hemophagocytic Lymphohistiocytosis; Hutchinson-Gilford Progeria Syndrome; Mucolipidosis II; Infantile Free Sialic Acid Storage Disease; PLA2G6- Associated Neurodegeneration; Jervell a d Lange-Nielsen Syndrome; junctional Epidermolysis Bullosa; Huntington Disease; rabbe Disease (Infantile); Mitochondrial DNA-Associated Leigh Syndrome a d NARP; Lesch-Nyhan Syndrome; LIS1- Associated Lissencephaly; Lowe Syndrome; Maple Syrup Urine Disease; MECP2 Duplication Syndrome; ATP7A-Related Copper Transport Disorders; LAMA2-Reiated Muscular Dystrophy; Arylsuifatase A Deficiency; Mucopolysaccharidosis Types I, II or HI; Peroxisome Biogenesis Disorders, Zellweger Syndrome Spectrum; Neurodegeneration with Brain Iron Accumulation Disorders; Acid Sphingomyelinase Deficiency; Niemann-Pick Disease Type C; Glycine Encephalopathy; ARX-Reiated Disorders; Urea Cycle Disorders; COL 1 A.1/2 -Related Osteogenesis Imperfecta; Mitochondrial DNA Deletion Syndromes; PLPl -Related Disorders; Perry Syndrome; Phe!an-McDermid Syndrome; Glycogen Storage Disease Type II (Pompe Disease) (Infantile); MAPT-Related Disorders; MECP2 -Related Disorders; Rhizomelic Chondrodysplasia Punctata Type 1 ; Roberts Syndrome; Sandhoff Disease; Schindler Disease - Type 1 ; Adenosine Deaminase Deficiency; Smith-Leml.i~Opi.tz Syndrome; Spinal Muscular Atrophy; Infantile-Onset Spinocerebellar Ataxia; Hexosaminidase A Deficiency; Thanatophoric Dysplasia Type 1; Collagen Type VI-Related Disorders; Usher Syndrome Type I; Congenital Muscular Dystrophy; Wolf-Hirschhorn Syndrome; Lysosomal Acid Lipase Deficiency; and Xeroderma Pigmentosum.
[00585] As will be apparent, it is envisaged that the present, system can be used to target, any polynucleotide sequence of interest. Some examples of conditions or diseases that might be usefully treated using the present system are included in the Tables above and examples of genes currently associated with those conditions are also provided there. However, the genes exemplified are not exhaustive.
[00586] For example, "wild type StCas9" refers to wild type Cas9 from S thermophilics, the protein sequence of which is given in the SwissProt database under accession number G3ECR1. Similarly, S pyogenes Cas9 is included in SwissProt under accession number Q99ZW2.
[00587] The ability to use CRISPR-Cas systems to perform efficient and cost effective gene editing and manipulation will allow the rapid selection and comparison of single and and multiplexed genetic manipulations to transform such genomes for improved production and enhanced traits. In this regard reference is made to US patents and publications: US Patent No. 6,603,061 - Agrobacterium-Mediated Plant Transformation Method; US Patent No. 7,868,149 - Pla t Genome Sequences and Uses Thereof and US 2009/0100536 - Transgenic Plants with Enhanced Agronomic Traits, all the contents and disclosure of each of which are herein incorporated by reference in their entirety. In the practice of the invention, the contents and disclosure of Morrell et al "Crop genomics: advances and applications" Nat. Rev Genet. 201 1 Dec 29; 13(2):85-96 are also herein incorporated by reference in their entirety.
EXAMPLES
[00588] The following examples are given for the purpose of illustrating various embodiments of the invention and are not meant to limit the present, invention in any fashion. The present examples, along with the methods described herein are presently representative of preferred embodiments, are exemplar}', and are not intended as limitations on the scope of the invention. Changes therein and other uses which are encompassed within the spirit of the invention as defined by the scope of the claims will occur to those skilled in the art.. Example 1: CRISP R Complex Activity in the Nucleus of a Eukaryotic Cell
[00589] An example type II CRISPR system is the type II CRISPR locus from Streptococcus pyogenes SF370, which contains a cluster of four genes Cas9, Casl, Cas2, and Csnl, as well as two non-coding RNA elements, tracrRNA and a characteristic array of repetitive sequences (direct repeats) interspaced by short stretches of non-repetitive sequences (spacers, about 30bp each). In this system, targeted DNA double-strand break (DSB) is generated in four seque tial steps (Fig. 2A). First, two non-coding RNAs, the pre-crRNA array and tracrRNA, are transcribed from the CRISPR locus. Second, tracrRNA hybridizes to the direct repeats of pre- crRNA, which is then processed into mature crRN As containing individual spacer sequences. Third, the mature crRN A rtracrRN A complex directs Cas9 to the DNA target consisting of the protospacer and the corresponding PAM via heterodupiex formation between the spacer region of the crRNA and the protospacer DNA. Finally, Cas9 mediates cleavage of target DNA upstream of PAM to create a DSB within the protospacer (Fig. 2A). This example describes an example process for adapting this RNA-programmable nuclease system to direct CR ISPR complex activity in the nuclei of eukaryotic cells.
[00590] Cell culture and transfection
[00591] Human embryonic kidney (HEK) ceil line HEK 293FT (Life Technologies) was maintained in Duibecco's modified Eagle's Medium (DMEM) supplemented with 30% fetal bovine serum (HyClone), 2mM GlutaMAX (Life Technologies), lOOU/mL penicillin, and IQQjig mL streptomycin at 37°C with 5% C02 incubation. Mouse neuro2A (N2A) cell line (ATCC) was maintained with DMEM supplemented with 5% fetal bovine serum (HyClone), 2mM GlutaMAX (Life Technologies), lOOU/mL penicillin, and IQC^g'niL streptomycin at 37°C with 5% CiK
[00592] HEK 293FT or N2A cells were seeded into 24-well plates (Corning) one day prior to transfection at a density of 200,000 cells per well. Cells were transfected using Lipofectamine
2000 (Life Technologies) following the manufacturer's recommended protocol. For each well of a 24-well plate a total of 800ng of plasmids were used.
[005931 Surveyor assay and sequencing analysis for genome modification
[00594] HEK 293FT or N2A cells were transfected with plasmid DNA as described above.
After transfection, the cells were incubated at 37°C for 72 hours before genomic DNA extraction.
Genomic DNA was extracted using the QuickExtract DNA extraction kit (Epicentre) following the manufacturer's protocol Briefly, cells were resuspended i QuickExtraei solution and incubated at 65°C for 15 minutes and 98°C for 10 minutes. Extracted genomic DNA was immediately processed or stored at -2G°C,
[CI 595] The genomic region surrounding a CRISPR target site for each gene was PGR amplified, and products were purified using QiaQuick Spin Column (Qiagen) following manufacturer's protocol. A total of 400ng of the purified PCR products were mixed with 2μ1 10X Taq polymerase PCR buffer (Enzymatics) and ultrapure water to a final volume of 20μ1, and subjected to a re-annealing process to enable heteroduplex formation: 95°C for lOmin, 95°C to 85°C ramping at - 2°C/s, 85°C to 25°C at - 0.25°C/s, and 25°C hold for 1 minute. After re- annealing, products were treated with Surveyor nuclease and Surveyor enhancer S (Transgenomics) following the manufacturer's recommended protocol, and analyzed on 4-20% Novex TBE poly-acrylamide gels (Life Technologies). Gels were stained with SYBR Gold DNA stain (Life Technologies) for 30 minutes and imaged with a Gel Doc gel imaging system (Bio-rad). Quantification was based on relative band intensities, as a measure of the fraction of cleaved DNA. Fig. 7 provides a schematic illustration of this Surveyor assay.
[00596] Restriction fragment length polymorphism assay for detection of homologous recombination.
[00597] HE 293FT and N2A cells were transfected with plasmid DNA, and incubated at 37°C for 72 hours before genomic DNA extraction as described above. The target genomic region was PCR amplified using primers outside the homology arms of the homologous recombination (HR) template. PCR products were separated on a 1% agarose gel and extracted with MinElute GelExtraetion Kit (Qiagen). Purified products were digested with Hindlll (Fermentas) and analyzed on a 6% Novex TBE poly-acrylamide gel (Life Technologies).
[00598] RNA secondary structure prediction and analysis
[00599] RNA secondary structure prediction was performed using the online webserver RNAfold developed at Institute for Theoretical Chemistry at the University of Vienna, using the centroid structure prediction algorithm (see e.g. A.R. Gruber et a!., 2008, Cel l 106(1): 23-24; and PA Carr and GM Church, 2009, Nature Biotechnology 27(12): 1151-62).
[0060(1] RNA purification
[00601] HEK 293FT cells were maintained and transfected as stated above. Cells were harvested by trypsinization followed by washing in phosphate buffered saline (PBS). Total cell NA was extracted with TRI reagent (Sigma) following manufacturer's protocol. Extracted total RNA was quantified using Naonodrop (Thermo Scientific) and normalized to same conce tration.
[00602] Northern blot analysis of crRNA and tracrRNA expression in mammalian cells
[00603] RNAs were mixed with equal volumes of 2X loading buffer (Ambion), heated to 95°C for 5 min, chilled on ice for 1 mirs, and then loaded onto 8% denaturing polyacrylamide gels (SequaGei, National Diagnostics) after pre-running the gel for at least 30 minutes. The samples were electrophoresed for 1.5 hours at 40 W limit. Afterwards, the RNA was transferred to Hybond N+ membrane (GE Heallhcare) at 300 mA in a semi-dry transfer apparatus (Bio-rad) at room temperature for 1.5 hours. The RNA was crosslinked to the membrane using autocrosslink button on Siratagene UV Crosslinker the Stratalinker (Stratagene). The membrane was pre- hybridized in ULTRAhyb-OIigo Hybridization Buffer (Ambion) for 30 min with rotation at 42°C, and probes were then added and hybridized overnight. Probes were ordered from IDT and labeled with [gamnia-3/P] ATP (Perkin Elmer) with T4 polynucleotide kinase (New England Biolabs). The membrane was washed once with pre-warmed (42°C) 2xSSC, 0.5% SDS for 1 min followed by two 30 minute washes at 42°C. The membrane was exposed to a phosphor screen for one hour or overnight at room temperature and then scanned with a piiosphorimager (Typhoon).
[00604] Bacterial CRISPR system construction and evaluation
[00605] CRISPR locus elements, i cluding tracrRNA, Cas9, and leader were PCR amplified from Streptococcus pyogenes SF370 genomic DN.A with flanking homology arms for Gibson Assembly. Two Bsal type IIS sites were introduced in between two direct repeats to facilitate easy insertion of spacers (Fig. 8). PCR products were cloned into EcoRV-digested pACYC184 downstream of the tet promoter using Gibson Assembly Master Mix ( EB). Other endogenous CRISPR system elements were omitted, with the exception of the last 50bp of Csn2. Oligos (Integrated DNA Technology) encoding spacers with complimentary overhangs were cloned into the i¾al-digested vector pDCOOO (NEB) and then ligated with T7 ligase (Enzymatics) to generate pCRISPR plasmids. Challenge pfasmids containing spacers with PAM
[ΌΘ606] expression in mammalian ceils (expression constructs illustrated in Fig. 6A, with functionality as determined by results of the Surveyor assay shown in Fig. 6B). Transcription start sites are marked as +1, and transcription terminator and the sequence probed by northern blot are also indicated. Expression of processed tracrRNA was also confirmed by Northern blot. Fig. 6C shows results of a Northern blot analysis of total RN A extracted from 293 FT cells transfected with U6 expression constructs carrying long or short tracrRNA, as well as SpCas9 and DR-EMX1 (l)-DR. Left and right panels are from 293 FT cells transfected without or with SpRNase III, respectively. U6 indicate loading control blotted with a probe targeting human U6 srsRNA. Transfection of the short tracrRNA expression construct led to abundant levels of the processed form of tracrRNA (~75bp). Very low amounts of long tracrRN A are detected on the Northern blot.
[00607] To promote precise transcriptional initiation, the RNA polymerase Hi-based U6 promoter was selected to drive the expression of tracrRNA (Fig. 2C). Similarly, a LI6 promoter- based construct was developed to express a pre-crRNA array consisting of a single spacer flanked by two direct repeats (DRs, also encompassed by the term "traer-mate sequences"; Fig, 2C). The initial spacer was designed to target a 33-base-pair (bp) target site (30-bp protospacer plus a 3-bp CRISPR motif (P AM) sequence satisfying the NGG recognition motif of Cas9) in the human ΕΜΧΪ locus (Fig. 2C), a key gene in the development of the cerebral cortex.
[00608] To test whether heterologous expression of the CRISPR system (SpCas9, SpRNase III, tracrRNA, and pre-crRNA) in mammalian cells can achieve targeted cleavage of mammalian chromosomes, FJE 293FT cells were transfected with combinations of CRISPR components. Since DSBs in mammalian nuclei are partially repaired by the non-homologous end joining (NHEJ) pathway, which leads to the formation of indels, the Surveyor assay was used to detect potential cleavage activity at the target EMX1 locus (Fig. 7) (see e.g. Guschin et al, 2010, Methods Mol Biol 649: 247). Co-transfection of al l four CRISPR components was able to induce up to 5.0% cleavage in the protospacer (see Fig. 2D). Co-transfection of all CRISPR components minus SpRNase I I I also induced up to 4.7% indel in the protospacer, suggesting that there may be endogenous mammalian RNases that are capable of assisting with crRNA maturation, such as for example the related Dicer and Drosha enzymes. Removing any of the remaining three components abolished the genome cleavage activity of the CRISPR system (Fig. 2D). Sanger sequencing of ampiicons containing the target locus verified the cleavage activity: in 43 sequenced clones, 5 mutated al leles (1 1.6%) were found. Similar experiments using a variety of guide sequences produced indel percentages as high as 29% (see Figs. 3-6, 10, and 11). These results define a three-component system for efficient CRISPR -mediated genome modification in mammalian cells. To optimize the cleavage efficiency, Applicants also tested whether different isoforms of tracrRNA affected the cleavage efficiency and found that, in this example system, only the short (89-bp) transcript form was able to mediate cleavage of the human liM.XJ genomic locus (Fig. 6B).
[00609] Fig. 12 provides an additional Northern blot analysis of crRNA processing in mammalian cells. Fig. 12 A illustrates a schematic showing the expression vector for a single spacer flanked by two direct repeats (DR-EMX l(l)-DR). The 30bp spacer targeting the human EMX1 locus protospacer 1 (see Fig. 6) and the direct repeat sequences are shown in the sequence beneath Fig. 12 A. The line indicates the region whose reverse-complement sequence was used to generate Northern blot probes for EMX1(1) crRNA detection. Fig. 12B shows a Northern blot analysis of total. RNA extracted from 293FT cells transfected with U6 expression constructs carrying DR-EMX1(1)-DR. Left and right panels are from 293FT cells transfected without or with SpRNase III respectively. DR-EMX! (1 )~DR was processed into mature crR As onl in the presence of SpCas9 and short tracrRNA and was not dependent on the presence of SpRNase III. The mature crRNA detected from transfected 293FT total RNA is ~33bp and is shorter than the 39-42bp mature crRNA from S. pyogenes. These results demonstrate that a CRISPR system can be transplanted into eukaryotic cells and reprogrammed to facilitate cleavage of endogenous mammalian target polynucleotides.
[00610] Fig. 2 illustrates the bacterial CRISPR system described in this example. Fig. 2A illustrates a schematic showing the CRISPR locus 1 from Streptococcus pyogenes SF370 and a proposed mechanism of CRISPR-mediated DNA cleavage by this system. Mature crRNA processed from the direct repeat-spacer array directs Cas9 to genomic targets consisting of complimentary protospacers and a protospacer-adjacent motif (PAM). Upon target-spacer base pairing, Cas9 mediates a double-strand break in the target DNA. Fig. 2B illustrates engineering of S. pyogenes Cas9 (SpCas9) and RNase III (SpRNase III) with nuclear localization signals (NLSs) to enable import into the mammalian nucleus. Fig. 2C illustrates mammalian expression of SpCas9 and SpRNase III driven by the constitutive EFla promoter and tracrRN A and pre- crRNA array (DR-Spacer-DR) driven by the RNA Pol3 promoter U6 to promote precise transcription initiation and termination. A protospacer from the human EMXl locus with a satisfactory PAM sequence is used as the spacer in the pre-crRNA array. Fig. 2D illustrates surveyor nuclease assay for SpCas9-mediated minor insertions and deletions. SpCas9 was expressed with and without SpRNase III, iracrRNA, and a pre-crRNA array carrying the EMX1- target spacer. Fig. 2E illustrates a schematic representation of base pairing between target locus and EMX1 -targeting crRNA, as well as an example chromatogram showing a micro deletion adjacent to the SpCas9 cleavage site. Fig. 2F illustrates mutated alleles identified from sequencing analysis of 43 clonal amplicons showing a variety of micro insertions and deletions. Dashes indicate deleted bases, and non-aligned or mismatched bases indicate insertions or mutations. Scale bar = 1 Ομηι.
[0061 1 ] To further simplify the three-component system, a chimeric crRNA-tracrRNA hybrid design was adapted, where a mature crRNA (comprising a guide sequence) may be fused to a partial iracrRN A via a stem-loop to mimic the natural crRNArtracrRNA duplex. To increase co- delivery efficiency, a bicistronic expression -vector was created to drive co-expression of a chimeric RNA and SpCas9 in transfected cells. In parallel, the bicistronic vectors were used to express a pre-crRN A (DR-guide sequence-DR) with SpCas9, to induce processing into crRN A with a separately expressed IracrRNA (compare Fig. 11B top and bottom). Fig. 8 provides schematic illustrations of bicistronic expression vectors for pre-crRNA array (Figure 8A) or chimeric crRNA (represented by the short line downstream of the guide sequence insertion site and upstream of the EFla promoter in Fig. 8B) with hSpCas9, showing location of various elements and the point of guide sequence insertion. The expanded sequence around the location of the guide sequence insertion site in Fig. 8B also shows a partial DR sequence (GTTTAGAGCTA) and a partial IracrRNA sequence
(TAGCAAGTTAAAATAAGGCTAGTCCGTTTTT). Guide sequences can be inserted between Bbsl sites using annealed oligonucleotides. Sequence design for the oligonucleotides are shown below the schematic illustrations in Fig. 8, with appropriate ligation adapters indicated. WPRE represents the Woodchuck hepatitis virus post-transcriptional regulatory element. The efficiency of chimeric RNA-mediated cleavage was tested by targeting the same EMX1 locus described above. Using both Surveyor assay and Sanger sequencing of amplicons, Applicants confirmed that the chimeric RNA design facilitates cleavage of human EMX1 locus with approximately a 4.7% modification rate (Fig. 3).
[00612] Generalizability of CRISPR -mediated cleavage in eukaryotic cells was tested by targeting additional genomic loci in both human and mouse cells by designing chimeric RNA targeting multiple sites in the human EMXl and PVALB, as well as the mouse Th loci. Fig. 13 illustrates the selection of some additional targeted protospacers in human PVALB (Fig. 13 A) and mouse Th (Fig. 13B) loci. Schematics of the gene loci and the location of three protospacers within the last exon of each are provided. The underlined sequences include 30bp of protospacer sequence and 3 bp at the 3' end corresponding to the PAM sequences. Protospacers on the sense and anti-sense strands are indicated above and below the DNA sequences, respectively. A modification rate of 6.3% and 0.75% was achieved for the human PVALB and mouse Th loci respectively, demonstrating the broad applicability of the CRISP R system in modifying different loci across multiple organisms (Fig. 5). While cleavage was only detected with one out of three spacers for each locus using the chimeric constructs, all target sequences were cleaved with efficiency of indel production reaching 27% when using the co-expressed pre-crRNA arrangement (Figs. 6 and 13).
[00613] Fig. 11 provides a further illustration that SpCas9 can be reprogrammed to target multiple genomic loci in mammalian cells. Fig. 11A provides a schematic of the human EMX1 locus showing the location of five protospacers, indicated by the underlined sequences. Fig. 1 IB provides a schematic of the pre-crRNA/trcrRNA complex showing hybridization between the direct repeat region of the pre-crRNA and tracrRJMA (top), and a schematic of a chimeric RNA design comprising a 20bp guide sequence, and tracr mate and tracr sequences consisting of partial direct repeat and tracrRNA sequences hybridized in a hairpin structure (bottom). Results of a Surveyor assay comparing the efficacy of Cas9-mediated cleavage at five protospacers in the human ΕΜΧΪ locus is illustrated in Fig. 1 1 C. Each protospacer is targeted using either processed pre-crRNA'fracrRNA complex (crRNA) or chimeric RNA (chiRNA).
[00 J 4] Since the secondary structure of RNA can be crucial for intermolecular interactions, a structure prediction algorithm based on minimum free energy and Boltzmann-weighted structure ensemble was used to compare the putative secondary structure of all guide sequences used in the genome targeting experiment (see e.g. Gruber et al., 2008, Nucleic Acids Research, 36: W70). Analysis revealed thai in most cases, the effective guide sequences in the chimeric crRNA context were substantial ly free of secondary structure motifs, whereas the ineffective guide sequences were more likely to form internal secondary structures that could prevent base pairing with the target protospacer DNA. It is thus possible that variability in the spacer secondary structure might impact the efficiency of CRISPR-mediated interference when using a chimeric crRNA.. [00615] Further vector designs for SpCas9 are shown in Fig. 22, which illustrates single expression vectors incorporating a U6 promoter linked to an insertion site for a guide oligo, and a Cbii promoter linked to SpCas9 coding sequence. The vector shown in Fig. 22b includes a tracrR A coding sequence linked to an HI promoter.
[00616] In the bacterial assay, all spacers facilitated efficient CRISPR interference (Fig. 3C). These results suggest that there may be additional factors affecting the efficiency of CRISPR. activity in mammalian cells.
[00617] To investigate the specificity of CRISPR-mediated cleavage, the effect of single- nucleotide mutations in the guide sequence on protospacer cleavage in the mammalian genome was analyzed using a series of E Y7-targeting chimeric crRNAs with single point mutations (Fig. 3A). Fig. 3B illustrates results of a Surveyor nuclease assay comparing the cleavage efficiency of Cas9 when paired with different mutant chimeric RNAs. Single-base mismatch up to 12-bp 5' of the PAM substantially abrogated genomic cleavage by SpCas9, whereas spacers with mutations at farther upstream positions retained activity against the original protospacer target (Fig. 3B). In addition to the PAM, SpCas9 has single-base specificity within the last 12- bp of the spacer. Furthermore, CRISPR is able to mediate genomic cleavage as efficiently as a pair of TALE nucleases (TALEN) targeting the same EMX1 protospacer. Fig. 3C provides a schematic showing the design of TALENs targeting EM XI, and Fig. 3D shows a Surveyor gel comparing the efficiency of TALEN and Cas9 (n=3).
[00618] Having established a set of components for achieving CRISPR-mediated gene editing in mammalian cells through the error-prone NHEJ mechanism, the ability of CRISPR to stimulate homologous recombination (HR), a high fidelity gene repair pathway for making precise edits in the genome, was tested. The wild type SpCas9 is able to mediate site -specific DSBs, which can be repaired through both NHEJ and HR. In addition, an aspartate-to-alanine substitution (D I OA) in the RuvC I catalytic domain of SpCas9 was engineered to convert the nuclease into a nickase (SpCas9n; illustrated in Fig. 4A) (see e.g. Sapranausaks et a!. , 2011, Nucleic Acids Resch, 39: 9275; Gasiunas et aL, 201.2, Proc. Natl. Acad. Sci. USA, 109:E2579), such that nicked genomic DNA undergoes the high-fidelity homology-directed repair (HDR). Surveyor assay confirmed that SpCas9n does not generate indeis at the EMX1 protospacer target. As illustrated in Fig. 4B, co-expression of EMX1 -targeting chimeric crRNA with SpCas9 produced indeis in the target site, whereas co-expression with SpCas9n did not (n=3). Moreover, sequencing of 327 amplicons did not detect any indels induced by SpCas9n. The same locus was selected to test CRISPR -mediated HR by co-transfecting HEK 293FT cells with the chimeric RNA targeting EMXl, hSpCas9 or IiSpCas9ii, as well as a HR template to introduce a pair of restriction sites (HmdIII and Nhei) near the protospacer. Fig. 4C provides a schematic illustration of the HR strategy, with relative locations of recombination points and primer annealing sequences (arrows). SpCas9 and SpCas9n indeed catalyzed integration of the HR. template into the EMXl locus. PGR amplification of the target region followed by restriction digest with Hindlll revealed cleavage products corresponding to expected fragment sizes (arrows in restriction fragment length polymorphism gel analysis shown in Fig. 4D), with SpCas9 and SpCas9n mediating similar levels of HR efficiencies. Applicants further verified HR using Sanger sequencing of genomic amplicons (Fig. 4E). These results demonstrate the utility of CRISPR for facilitating targeted gene i sertion in the mammalian genome. Given the 14-bp (12- bp from the spacer and 2 -bp from the PA ) target specificity of the wild type SpCas9, the availability of a nickase can significantly reduce the likelihood of off-target modifications, since single strand breaks are not substrates for the error-prone NHEJ pathway.
0Θ619] Expression constructs mimicking the natural architecture of CRISPR loci with arrayed spacers (Fig. 2A) were constructed to test the possibility of multiplexed sequence targeting. Using a single CRIS PR array encoding a pair of EMXl- and F4Li?-targeting spacers, efficient cleavage at both loci was detected (Fig, 4F, showing both a schematic design of the crRNA array and a Surveyor blot showing efficient mediation of cleavage). Targeted deletion of larger genomic regions through concurrent DSBs using spacers against two targets within EMXl spaced by 1 19bp was also tested, and a 1.6% deletion efficacy (3 out of 182 amplicons; Fig. 4G) was detected. This demonstrates that the CRISPR system can mediate multiplexed editing within a single genome.
Example 2: CRISPR system modifications and alternatives
[0Θ620] The ability to use RNA to program sequence-specific DNA cleavage defines a new class of genome engineering tools for a variety of research and industrial applications. Several aspects of the CRISPR system can be further improved to increase the efficiency and versatility of CRISPR targeting. Optimal Cas9 activity may depend on the availability of free Mg2+ at levels higher than that present in the mammalian nucleus (see e.g. Jinek et a!. , 2012, Science, 337:816), and the preference for an NGG motif immediately downstream of the protospacer restricts the ability to target on average every 12-bp in the human genome (Fig. 9, evaluating both plus and minus strands of human chromosomal sequences). Some of these constraints can be overcome by exploring the diversity of CRISPR Soci across the microbial metagenome (see e.g. Makarova et al, 2011, Nat Rev Microbiol 9:467). Other CRISPR loci may be transplanted into the mammalian cellular milieu by a process similar to that described in Example 1. For example, Fig. 10 illustrates adaptation of the Type II CRISPR system from CRISPR 1 of Streptococcus thennophilus LMD-9 for heterologous expression in mammalian cells to achieve CRISPR-mediated genome editing. Fig. 10A provides a Schematic illustration of CRISPR 1 from S. thennophilus LMD-9. Figure 10B illustrates the design of an expression system for the S. thermophilus CRISPR system. Human eodon-optimized hStCasP is expressed using a constitutive EFla promoter. Mature versions of tracrRNA and crRNA are expressed using the U6 promoter to promote precise transcription initiation. Sequences from the mature crRNA and tracrRNA are illustrated. A single base indicated by the lower case "a" in the crRNA sequence is used to remove the polyU sequence, which serves as a RNA polIII transcriptional terminator. Fig. IOC provides a schematic showing guide sequences targeting the human EMXl locus. Fig. 10D shows the results of hStCas9-mediated cleavage in the target locus using the Surveyor assay. RNA guide spacers 1 and 2 induced 14% and 6.4%, respectively. Statistical analysis of cleavage activity across biological replica at these two protospacer sites is also provided in Fig. 5. Fig. 14 provides a schematic of additional protospacer and corresponding PAM sequence targets of the S, thermophilus CRISPR system in the human EMXl locus. Two protospacer sequences are highlighted and their corresponding PAM sequences satisfying NNAGAAW motif are indicated by underlining 3 ' with respect to the corresponding highlighted sequence. Both protospacers target the anti-sense strand.
Example 3: Sample target sequence selection algorithm
[00621] A software program is designed to identify candidate CRISPR target sequences on both strands of an input DNA sequence based on desired guide sequence length and a CRISPR motif sequence (PAM) for a specified CRISPR enzyme. For example, target sites for Cas9 from S. pyogenes, with PAM sequences NGG, may be identified by searching for 5'-Nx-NGG-3' both on the input sequence and on the reverse-complement of the input. Likewise, target sites for Cas9 of S. thennophilus CRISPRl, with PAM sequence NNAGAAW, may be identified by searching for 5 ' -NX-NN AG AA W-3 ' both on the input sequence and on the reverse-complement of the input. Likewise, target sites for Cas9 of S. thennopkilus CRISPR3, with PAM sequence NGGNG, may be identified by searching for 5'-Nx-NGG G-3' both on the input sequence and on the reverse-complement of the input. The value "x" in Nx may be fixed by the program or specified by the user, such as 20.
[006221 Since multiple occurrences in the genome of the DNA target site may lead to nonspecific genome editing, after identifying all potential sites, the program filters out sequences based on the number of times they appear in the relevant reference genome. For those CRISPR enzymes for which sequence specificity is determined by a 'seed' sequence, such as the l l-12bp 5' from the PAM sequence, including the PAM sequence itself, the filtering step may be based on the seed sequence. Thus, to avoid editing at additional genomic loci, results are filtered based on the number of occurrences of the seed: PAM sequence in the relevant genome. The user may be allowed to choose the length of the seed sequence. The user may also be allowed to specify the number of occurrences of the seedrPAM sequence in a genome for purposes of passing the filter. The default is to screen for unique sequences. Filtration level is altered by changing both the lengt of the seed sequence and the number of occurrences of the sequence in the genome. The program may in addition or alternatively provide the sequence of a guide sequence complementary to the reported target sequence(s) by providing the reverse complement of the identified target sequence(s). An example visualization of some target sites in the human genome is provided in Fig. 18.
[00623] Further details of methods and algorithms to optimize sequence selection can be found in U.S. application Serial No. 61/064,798 (Attorney docket 44790.1 1.2022; Broad Reference BI-2012/084); incorporated herein by reference.
Example 4: Evaluation of multiple chimeric crRNA-tracrRNA hybrids
[00624] This example describes results obtained for chimeric RNAs (chiRNAs; comprising a guide sequence, a tracr mate sequence, and a traer sequence in a single transcript) having tracr sequences that incorporate different lengths of wild-type traerRNA sequence. Fig.16a illustrates a schematic of a bicistronic expression vector for chimeric RNA and Cas9. Cas9 is driven by the CBh promoter and the chimeric RNA is driven by a U6 promoter. The chimeric guide RNA consists of a 20bp guide sequence (Ns) joined to the tracr sequence (running from the first "U" of the lower strand to the end of the transcript), which is truncated at various positions as indicated. The guide and tracr sequences are separated by the tracr-mate sequence GUUUUAGAGCUA fol lowed by the loop sequence GAAA. Results of SURVEYOR assays for Cas9-mediated indels at the human EMX1 and PVALB loci are illustrated in Figs. 16b and 16c, respectively. Arrows indicate the expected SURVEYOR fragments. ChiRNAs are indicated by their "+n" designation, and crRNA refers to a hybrid RNA where guide and tracr sequences are expressed as separate transcripts. Quantification of these results, performed in triplicate, are illustrated by histogram in Figs. 17a and 17b, corresponding to Figs. 16b and 16c, respectively ("N.D." indicates no indels detected). Protospacer IDs and their corresponding genomic target, protospacer sequence, RAM sequence, and strand location are provided in Table D. Guide sequences were designed to be complementary to the entire protospacer sequence in the case of se arate transcripts in the hybrid system, or only to the underlined portion in the case of chimeric
Figure imgf000224_0001
Figure imgf000224_0002
[00625] Further details to optimize guide sequences can be found in U.S. application Serial No. 61/836,127 (Attorney docket 44790.08.2022; Broad Reference BI-2013/004G); incorporated herein by reference.
[00626] Initially, three sites within the EMX1 locus in human HEK 293FT cel ls were targeted. Genome modification efficiency of each chiRNA was assessed using the SURVEYOR nuclease assay, whic detects mutations resulting from DNA double-strand breaks (DSBs) and their subsequent repair by the non- homologous end joining (NHEJ) DNA damage repair pathway. Constructs designated chiRNA(+n) indicate that up to the +n nucleotide of wild-type tracrRNA is included in the chimeric RNA construct, with values of 48, 54, 67, and 85 used for n. Chimeric RNAs containing longer fragments of wild-type tracrRNA (chiRNA(+67) and chiRNA(+85)) mediated DNA cleavage at all three EMX1 target sites, with chiRNA(+85) in particular demonstrating significantly higher levels of DNA cleavage than the corresponding crRNA/tracrRNA hybrids that expressed guide and tracr sequences in separate transcripts (Figs, 16b and 17a). Two sites in the PVALB locus that yielded no detectable cleavage using the hybrid system (guide sequence and tracr sequence expressed as separate transcripts) were also targeted using chiRNAs. chiRNA(+67) and chiRNA(+85) were able to mediate significant cleavage at the two PVALB protospacers (Figs. 16c and 17b).
For all five targets in the EMX3 and PVALB loci, a consistent increase in genome modification efficiency with increasing tracr sequence length was observed. Without wishing to be bound by any theory, the secondary structure formed by the 3' end of the tracrRNA may play a role in enhancing the rate of CRISPR comple formation.
Example 5: Cas9 diversity
[00627] The CR ISPR-Cas system is an adaptive immune mechanism against invading exogenous DNA employed by diverse species across bacteria and archaea. The type II CRISPR - Cas9 system consists of a set of genes encoding proteins responsible for the "acquisition" of foreign DNA into the CRISPR locus, as well as a set of genes encoding the "execution" of the DNA cleavage mechanism; these include the DNA nuclease (Cas9), a non -coding transact! va ing cr-RNA (tracrRNA), and an array of foreign DNA-derived spacers flanked by direct repeats (crRNAs). Upon maturation by Cas9, the tracRNA and crRNA duplex guide the Cas9 nuclease to a target DNA sequence specified by the spacer guide sequences, and mediates double-stranded breaks in the DNA near a short sequence motif in the target DNA that is required for cleavage and specific to each CRISPR-Cas system. The type II CR ISPR-Cas systems are found throughout the bacterial kingdom and highly diverse in in Cas9 protein sequence and size, tracrRNA and crRNA direct repeat sequence, genome organization of these elements, and the motif requirement for target cleavage. One species may have multiple distinct CRISPR-Cas systems.
[00628] Applicants evaluated 207 putative Cas9s from bacterial species identified based on sequence homology to known Cas9s and structures orthologous to known subdomains, including the HNH endoiiuclease domain and the RuvC endomiciease domains [information from the Eugene Koonin and Kira Makarova]. Phylogenetic analysis based on the protein sequence conservation, of this set revealed five families of Cas9s, including three groups of large Cas9s (-1400 amino acids) and two of small Cas9s (~1100 amino acids) (see Figs. 19 and 20A-F).
[00629] Further details of Cas9s and mutations of the Cas9 enzyme to convert into a nickase or DMA binding protein and use of same with altered functionality can be found in U.S. application Serial Nos 61/836,101 and 61/835,936 (Attorney docket 44790.09.2022 and 4790.07.2022 and Broad Reference BI-2013/004E and BJ-2013/004F respectively) incorporated herein by reference.
Example 6: Cos9 orthologs
[00630] Applicants analyzed Cas9 orthologs to identify the relevant PAM sequences and the corresponding chimeric guide RNA. Having an expanded set of PAMs provides broader targeting across the genome and also significant!)? increases the number of unique target sites and provides potential for identifying novel Cas9s with increased levels of specificity in the genome.
[00631] The specificity of Cas9 orthologs can be evaluated by testing the ability of each Cas9 to tolerate mismatches between the guide RNA and its DNA target. For example, the specificity of SpCas9 has been characterized by testing the effect of mutations in the guide RNA on cleavage efficiency. Libraries of guide RNAs were made with single or multiple mismatches betwee the guide sequence and the target DNA. Based on these findings, target sites for SpCas9 can be selected based on the following guidelines:
[00632] To maximize SpCas9 specificity for editing a particular gene, one should choose a target site within the locus of interest such that potential Off-target' genomic sequences abide by the following four constraints: First and foremost, they should not be followed by a PAM with either 5'-NGG or NAG sequences. Second, their global sequence similarity to the target sequence should be minimized. Third, a maximal number of mismatches should lie within the PAM-proximal region of the off-target site. Finally, a maximal number of mismatches should be consecutive or spaced less than four bases apart.
[00633] Similar .methods can be used to evaluate the specificity of other Cas9 orthologs and to establish criteria for the selection of specific target sites within the genomes of target species. As mentioned previously phylo genetic analysis based on the protein sequence conservation of this set revealed five families of Cas9s, including three groups of large Cas9s (- 1400 amino acids) and two of small Cas9s (-T 100 amino acids) (see Figs. 19 and 20A-F). Further details on Cas orthologs can be found in U.S. application Serial Nos 61/836,101 and 61/835,936 (Attorney docket 44790.09.2022 and 4790.07.2022 and Broad Reference BI-2013/004E and BI-2013/004F respectively) incorporated herein by reference.
Example 7: Methodological improvement to simplify cloning and delivery.
[00634] Rather than encoding the U6-promoter and guide RNA on a plasmid, Applicants amplified the U6 promoter with a DNA oligo to add on the guide RNA. The resulti g PGR product may be transfected into cel ls to drive expression of the guide RN A.
[0Θ635] Example primer pair that allows the generation a PGR product consisting of U6- promoter: rguideRNA targeting human Emxl locus:
[00636] Forward Primer: AAACTCTAGAgagggectatttcecatgattc
[00637] Reverse Primer (carrying the guide RNA, which is underlined): acctctagAAAAAAAGCACCGACTCGGTGCCACTrTTTCAAGTTGATAACGGACTAGC
CTTATTTTAACTTGCTATGCTGTTTTGTTTCCAAAACAGCATAGCTCTAAAACCCC TAGTCATTGGAGGTGACGGTGTTTCGTCCTTTCCACaag
Example 8: Methodological improvement to improve activity:
[00638] Rather than use poI3 promoters, in particular RNA polymerase III (e.g. U6 or H I promoters), to express guide R As in eukaryotic ceils, Applicants express the T7 polymerase in eukaryotic cells to drive expression of guide RNAs using the T7 promoter.
[00639] One example of this system may involve introduction of three pieces of DNA :
1. expression vector for Cas9
2. expression vector for T7 polymerase
3. expression vector containing guideRNA fused to the T7 promoter
Example 9: Methodological improvement to reduce toxicity of Cas9: Delivery of Cas9 in the form of mRNA,
[00640] Delivery of Cas9 in the form of mRN A enables transient expression of Cas9 in cells, to reduce toxicity. For example, humanized SpCas9 may be amplified using the following primer pair;
[00641] Forward Primer (to add on T7 promoter for in "vitro transcription): TAATACGACTCACTATAGGAAGTGCGCCACCATGGCCCCAAAGAAGAAGCGG
[00642] Reverse Primer (to add on poly A tail):
GGTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTttcttaCTTTTTCTTTTTTGCCTGGCCG [00643] Applicants transfect the Cas9 rnRNA into cells with, either guide RNA in the form of
RNA or DNA cassettes to drive guide RNA expression in eukaryotic cells.
Example 10: Methodological improvement to reduce toxicity of Cas9: Use of an inducible promoter
[00644] Applicants transiently turn on Cas9 expression only when it is needed for carrying out genome modification. Examples of inducible system include tetracycline inducible promoters (Tet-On or Tet-Off), small molecule two-hybrid transcription activations systems (FKBP, ABA, etc), or light inducible systems (Phytochrome, LOV domains, or eryptoehrome).
Example 11: Improvement of the Cas9 system for in vivo application
[00645] Applicants conducted a Metagenomic search for a Cas9 with small molecular weight. Most Cas9 homologs are fairl large. For example the SpCas9 is around 1368aa long, which is too large to be easily packaged into viral vectors for delivery. A graph representing the length distribution of Cas9 homologs is generated from sequences deposited in GenBank (Fig. 23). Some of the sequences may have been mis-annotated and therefore the exact frequency for each length may not necessarily be accurate. Nevertheless it provides a glimpse at distribution of Cas9 proteins and suggest that there are shorter Cas9 homologs.
[00646] Through computational analysis, Applicants found that in the bacterial strain Campylobacter, there are two Cas9 proteins with less than 1000 amino acids. The sequence for one Cas9 from Campylobacter jejuni is presented below. At this length, CjCas9 can be easily packaged into AAV, lentiviruses, Adenoviruses, and other viral s ectors for robust delivery into primary ceils and in vivo in animal models. In a preferred embodiment of the invention, the Cas9 protein from S. aureus is used.
[00647] -'Campylobacter jejuni Cas9 (CjCas9)
[00648] M ARIL AFDI GIS SIGWAFSEND ELKDCG V RiFTKVEN PKTGESL ALP RRLAR SARKJILARRKARLNHLKHLIANEFKLNYEDYQSFDESLAK ^YKGSLISPYELRFRALN
ELLSKQDFARVILHIAKRRGYDDIKNSDDKEKGAJLKAJKQNEEKLANYQSVGEYLYK EYFQKFKENSKEFTNVRNK ESYERCIAQSFLKDELKLIFKKQREFGFSFSKKFEEEVL
SVAFYKR^ALKDFSHL^ONCSFFTDEO APKNSPLAFMFVALTRIRNLLNNLKNTEGIL YTKDDLNALLN EVLKNGTLT YKQTKKLLGLSDDYEFKGEKGTY FIEFKKYKEFI AL
GEFRNLSQDDLNEIAKDITLIKDEIKLKK.ALAKYDLNQNQIDSLSKLEFKDHLNISFKAL KLVTPLMLEG KYDEACNELNL .VA]NEDK DFLPAFNETYYKDEVTNPV\7LRA]KE YRKVLNALL KYGKVHKI 1EIAREVGKNHSQRAK1EKEQNENYKAKKDAELECEK
LGLONSKNILKLRLF EQKEFCAYSGE JKISDLQDEKMLEJDHIYPYSRSFDDSYMN
KVLVFT QNQEK1NQTPFEAFGNDSAKWQKIEVLAKNLPTKXQKRILDKNYKDKEQ
ΚΧ! ί)! Ν!ΛΙ)ΊΊ Υ!ΛΚΙΑΙ XY 1 DY(j)!1 Pi.Si)!)i:\ 1 i.NiyiOKCiS VIfVi-A SCiYl
L SALRHTWGFSAKDR NHLHHAIDAVIIAY^ANNSIVKAFSDFKKEQESNSAELYrAK
KISELDY N RKFFEPFSGFRQ VLD JDEIFVS PER PSGALHEETFRKEEEFYQS
YGGKEGVLKALELGKIRKVNGKIVKNGDMFRVDIFKHKKTNKFYAVP1YTMDFAL
VU»NKAVARSKKGEIKDWILMDENYEFCFSLYKDSL]LIQTKDMQEPEFVYY1SIAFTSS
TVSLIVS HDN FETLS NQ ILFKNANEKEVIAKSIGIQNLKVFEKYIVSALGEYT A
EFRQREDFKK.
[00649] The putative traerRNA element for this CjCas9 is:
[006501 TATAATCTCATAAGAAATTTAAAAAGGGACTAAAATAAAGAGTTTGCG
GGACrCTGCGGGGTTACAATCX CTAAAACCGCTTTTAAAATT
[00651] The Direct Repeat sequence is:
[00652] ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC
[00653] An example of a chimeric guideRNA for CjCas9 is:
[00654] NNNNNNNNNNNNNNNNNNNNGLIULIUAGUCCCGAAAGGGACUAAAAU AAAGAGIJUUGCGGGACUCUGCGGGGUUACAAUCCCCUAAAACCGCUUUU
Example 12: Cas9 optimization
[00655] For enhanced function or to develop new functions, Applicants generate chimeric Cas9 proteins by combining fragments from different Cas9 homologs. For example, two example chimeric Cas9 proteins:
[00656] For example, Applicants fused the N-term of StlCas9 (fragment from this protein is in bold) with C-term of SpCas9 (fragment from this protein is underlined).
[00657] >Stl (N)Sp(C)Cas9
[00658] MSDLVLGLDIGIGSVGVGILNKVTGEDHKNS IFPAAQAENNLVRRTN QGRRLAR K HRRVRLNRLFEESGLITDFTKISINL PYQL V GLTDELSNEE
LF1ALKNMVKHRGISYLDDASDDGNSSVGDYAQIVKENSKQLETKTPGQIQLERY
QTYGQLRGDFTVEKDGKKHRLIrWFPTSAYRSEALRILQTQQEFNPQITDEFI R
YLEILTGKRKYYHGPGNEKSRTDYGRYRTSGETLDNIFGILIG CTFYPDEFRAA
ASYTAQEFNLLNDLNNL PTETIOCLSKEQKNQIINYVKNEKAMGPAKLFKY1AK LLSCDVADIKGYMDKSGKAEIHTFEAY MKTLETLDIEQMDRETLDKLAYVLT LNTEREGIQEALEHEFADGSFSQKQVDELVQFRKANSSIFG GWHNFSV LMME
LIPELYETSEEQMTILTRLGKQKTTSSSNKTKYIDEKLLTEEIYNPWAKSVRQAIK IVNAAIKEYGDFDNIVIE A ENQTTQKGO NSRERMKRIEEGJKELGSOIL EHPVE TQLONEKLYLYYLONGRDMYVDOELDINRLSDYDVDHIVPQSFLKDDSID VLT R S [ ) N R C i S j ) N V P i .l: V V X- 1 X V W K 01. ( . N Λ i , Γ f '(.) R K Π ) Λ I T A H P. G i ,S i ·. i , f ) AGFI RQLVETRQIT VAOILDSRM TKYDENDKLil EV ViTLKSKLVSDFRKDFQ FYKYREJ NYJiHAHD^
EIGKATA YFFYSNIMNFFKTEITLANGEIR j PLIETNGETGErVWDKGRDFATVRKV j . S VI 110 V X I V i 1■". V Q1 ' ( i ( I - i Π J l·Γ^ S Γ) K j J \ R K I ) \\ 1 ) 1 \' ( i ( j i■' 1 ) S P i V A V S V LVVAKVE GK-SKXLKSVKELLGITIMERSSFEKNPIDFLEAKGY EVKt DLIIKXP YS
LFELENGRKR¾/1LASAGELQ GNELALPSKYVNFLYLASHY KL- GSPEDNE0K0LF Vj;On nY .l fn OISf i S Vf LADAX .l VLSAYXKl jRO Pi OAl Nlll (I F ΊΊ. Γ ί. GAPAAF YFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGD
[00659] >Sp(N)Stl{C)Cas9
[006601 M DKK YSIG LDIGTNS V GW A VITD E Y VPSKKFKV LGNTD RH S IK NLIG A
IJ.EDSGETAEATRL RTARRRYTRRKNRJCYLQE:IFSNEMAKYDDSFFFIRL.EESFLVE
EDKKBERHPIFGNRVDEVAYHEKYPTIYHLR KLVDSTDKADLRLIYLALAHMI FRG
HFLIEGDLNPD SDVDKLFIOLVQT ¾TOLFEE PN\TASG 7DATLAILSARLSKSRRLENL
IAQLPGEKT GLFGNLIALSLGLTPNFKSNFDLAEDA LQLS DTYDDDLDNLLAQIG
DQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRO
QLPEKY EIFI:¾
IKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFL DNI EKIE JLTFRIPYYVGPLARG'N
SRFAWMTR EETITPWNFEEVVDKGASAOSFIERMTNFDKNLPNEKVLPKHSLLYE
YFTVTNELTKVKYYTEGMR AP^LSGEQ KARVDLLFKTNRKVTV QL EDYFK IE
CFDSVEISGVEDRFNASLGTYHDLI IIKDK FLDNEENEDILEPIVLTLTLFEDREMFFI
ERL TYAHLI D VMKQL RRRYTGWGRLSRKLINGIRDKQSGKTILPFLKSDGFAN
RNFMOLIHDDSLTF EDIQTLAO 7SGOGDSLHEHIANLAGSPAIKKGILQTV V 7DELV
KVMGRH PENIVLEMARETNEDPEKKAIO IQKAN PEKDAAML AANOYNGKA
ELPHSVFHGHKQLATKIRLWHQQGERCLYTGKTISIHDLINNSNQFEVDHILPLSI
TFDD SL A VX VYAT ANQEKGQRTP YQ ALD SMDD AWSFRELKAFVRE S TL SNK KKEYLLTEEDIS FDVR KFIER LVDTRYASRWLNALQEHFRAHKIDTK 'TSWR GQFTSQLRRH GIEKTRDTYHHHAVDALHAASSQLN LWK QKNTLVSYSEDQL
LDIETGELISDDEYKESW APYQHFVDTLKS EFEDSILFSYQVDS FN EJSDATI
YATRQAKVGKD ADETYVLGKiKDiYTQDGYDAFMKIY KDKSKFL YRHDPQT
FEKVIEPILENYPNKQINEKG EVPCNPFL YKEEHGYIRKYSKKGNGPEI SLKYY
DSiaGNHIDITPKDSNN VVLQSVSPWRADVYFN TTG YElLGLiGfADLQFE G
TGTYKISQEKY DI EGVDSDSEFKFTLYKNDLLLVKDTETKEQQLFRFLSRT
MPKQ H ELKPYDKQ FEGGEALIKVLG VANSGQC GLGKS ISIYKVRTD
VLGNQHHKNEGDKPKLDF
[00661] The benefit of making chimeric Cas9 include:
reduce toxicity
improve expression in eukaryotic cells
enhance specificity
reduce molecular weight of protein, make protein smaller by combining the smallest domains from different Cas9 homologs.
Altering the PAM sequence requirement
Example 13: Utilization ofCas9 as a generic DNA binding protein
[00662] Applicants used Cas9 as a generic DN A binding protein by mutating the two catalytic domains (D10 and H840) responsible for cleaving both strands of the DNA target. In order to upregulate gene transcription at a target locus Applicants fused the transcriptional activation domain (VP64) to Cas9. Applicants hypothesized that it would be important to see strong nuclear localization of the Cas9~VP64 fusion protein because transcription factor activation strength is a function of time spent at the target. Therefore, Applicants cloned a set of Cas9-VP64-GFP constmcts, transfected them into 293 cells and assessed their localization under a fluorescent microscope 12 hours post-trans fection.
[00663] The same constmcts were cloned as a 2A-GFP rather than a direct fusion in order to functionally test the constmcts without a bulky GFP present to interfere. Applicants elected to target the Sox2 locus with the Cas9 transactivator because it could be useful for cellular reprogram and the locus has already been validated as a target for TALE-TF mediated transcriptional activation. For the Sox2 locus Applicants chose eight targets near the transcriptional start site (TSS). Each target was 20bp long with a neighboring NGG protospacer adjacent motif (PAM). Each Cas9-VP64 construct was co-transfected with each PGR generated chimeric crispr RNA (chiRNA) in 293 cells. 72 hours post transfeetion the transcriptional activation was assessed using RT-qPCR.
[00664] To ftrrther optimize the transcriptional activator, Applicants titrated the ratio of chiRNA (Sox2.1 and Sox2.5) to Cas9 (NLS-VP64-NLS-hSpCas9-NLS-VP64-NLS), transfected into 293 cells, and quantified using RT-qPCR. These results indicate that Cas9 can he used as a generic DNA binding domain to upreguiate gene transcription at a target locus.
[00665] Applicants designed a second generation of constructs. (Table below).
Figure imgf000232_0001
pLenti-EFla-GFP-2A-6xHis-NLS-hSpCsnl(D10A, H840A)
[00666] Applicants use these constructs to assess transcriptional activation (VP64 fused constructs) and repression (Cas9 only) by RT-qPCR. Applicants assess the cellular localization of each construct using anti-His antibody, nuclease activity using a Surveyor nuclease assay, and DNA binding affinity using a gel shift assay. In a preferred embodiment of the invention, the gel shift assay is an EMSA gel shift assay.
Example 14: Cas9 transgenic and knock in mice
[00667] To generate a mouse that expresses the Cas9 nuclease Applicants submit two general strategies, transgenic and knock in. These strategies may be applied to generate any other model organism of interest, for e.g. Rat. For each of the general strategies Applicants made a eonstitutivcly active Cas9 and a Cas9 that is conditionally expressed (Cre recombinase dependent). The constitutively active Cas9 nuclease is expressed in the following context: pCAG-NLS-Cas9-NLS-P2A-EGFP-WPRE-bGHpolyA. pCAG is the promoter, NLS is a nuclear localization signal, P2A is the peptide cleavage sequence, EGFP is enhanced green fluorescent protein, WPRE is the woodchuck hepatitis virus posttranscriptional regulatory element, and bGHpolyA is the bovine growth hormone poly-A signal sequence (Figs. 25A-B). The conditional version has one additional stop cassette element, loxP-SV40 polyA x3-ioxP, after the promoter and before NLS-Cas9-NLS (i.e. pCAG oxP-SV40polyAx3-!oxP-NLS-Cas9-NLS- P2A-EGFP-WPRJE-bGHpolyA). The important expression elements can be visualized as in Fig. 26, The constitutive construct should be expressed in all cell types throughout development, whereas, the conditional construct will only al low Cas9 expression when the same cell is expressing the Cre recombinase. This latter version will allow for tissue specific expression of Cas9 when Cre is under the expression of a tissue specific promoter. Moreover, Cas9 expression could be induced in adult mice by putting Cre under the expression of an inducible promoter such as the TET on or off system.
[00668] Validation of Cas9 constructs: Each piasmid was functionally validated in three ways: 1) transient transfection. in 293 cells followed by confirmation of GFP expression; 2) transient transfection in 293 cells fol Sowed by immunofluorescence using a antibody recognizing the P2A sequence; and 3) transient transfection followed by Surveyor nuclease assay. The 293 cells may be 293 FT or 293 T cells depending on the cells that are of interest. In a preferred embodiment the cells are 293FT ceils. The results of the Surveyor were run out on the top and bottom row of the gel for the conditional and constitutive constructs, respectively. Each was tested in the presence and absence of chimeric RNA targeted to the hEMX l locus (chimeric RNA hEMXl.1). The results indicate that the construct can successfully target the hEMXl locus only in the presence of chimeric RNA (and Cre in the conditional case). The gel was quantified and the results are presented as average cutting efficiency and standard deviation for three samples.
[00669] Transgenic Cas9 mouse: To generate transgenic mice with constructs, Applicants inject pure, linear DNA into the pronucleus of a zygote from a pseudo pregnant CB56 female. Founders are identified, genotyped, and backcrossed to CB57 mice. The constructs were successfully cloned and verified by Sanger sequencing.
[00670] Knock in Cas9 mouse: To generate Cas9 knock in mice Applicants target the same constitutive and conditional constructs to the Rosa26 locus. Applicants did this by cloning each into a Rosa26 targeting vector with the fol lowing elements: Rosa26 short homology arm - constitutive/conditional Cas9 expression cassette - pPGK-Neo-Rosa26 long homology arm - pPGK-DTA. pPGK is the promoter for the positive selection marker Neo, which confers resistance to neomycin, a 1 kb short arm, a 4.3 kb long arm, and a negative selection diphtheria toxin (DTA driven by PGK. [00671] The two constructs were eiectroporated into Rl mESCs and allowed to grow for 2 days before neomycin selection was applied. Individual colonies that had survived by days 5-7 were picked and grown in individual wells. 5-7 days later the colonies were harvested, half were frozen and the other half were used for genotyping. Genotyping was done by genomic PGR, where one primer annealed within the donor plasmid (AttpF) and the other outside of the short homology arm (Rosa26-R) Of the 22 colonies harvested for the conditional case, 7 were positive (Left). Of the 27 colonies harvested for the constitutive case, zero were positive (Right). It is likely that Cas9 causes some level of toxicity in the mESC and for this reason there were no positive clones. To test this Applicants introduced a Cre expression plasmid into correctly targeted conditional Cas9 cells and found very low toxicity after many days in culture. The reduced copy number of Cas9 in correctly targeted conditional Cas9 cells (1 -2 copies per cell) is enough to allow stable expression and relatively no cytotoxicity. Moreover, this data indicates that the Cas9 copy number determines toxicity. After electroporation each cell should get several copies of Cas9 and this is likely why no positive colonies were found in the case of the constitutive Cas9 construct. This provides strong evidence that utilizing a conditional, Cre- dependent strategy should show reduced toxicity. Applicants inject correctly targeted cells into a blastocyst and implant into a female mouse. Chimerics are identified and backcrossed. Founders are identified and genotyped.
[00672] Utility of the conditional Cas9 mouse: Applicants have shown in 293 cells that the Cas9 conditional expression construct can be activated by co-expression with Cre. Applicants also show that the correctly targeted Rl mESCs can have active Cas9 when Cre is expressed. Because Cas9 is fol lowed by the P2A peptide cleavage sequence and then EGFP Applicants identify successful expression by observing EGFP. This same concept is what makes the conditional Cas9 mouse so useful. Applicants may cross their conditional Cas9 mouse with a mouse thai ubiquitously expresses Cre (ACTB-Cre line) and may arrive at a mouse that expresses Cas9 in every cell. It should only take the delivery of chimeric RNA to induce genome editing in embryoni c or adult mice. Interestingly, if the conditional Cas9 mouse is crossed wi th a mouse expressing Cre under a tissue specific promoter, there should only be Cas9 in the tissues that also express Cre. This approach may be used to edit the genome in only precise tissues by delivering chimeric RNA to the same tissue.
Example 15: Cas9 diversity and chimeric RNAs [00673] The CRISPR-Cas system is an adaptive immune mechanism against invading exogenous DNA employed by diverse species across bacteria and archaea. The type ΙΪ CRISPR- Cas system consists of a set of genes encoding proteins responsible for the "acquisition" of foreign DNA into the CRISPR locus, as well as a set of genes encoding the "execution" of the DNA cleavage mechanism; these include the DNA nuclease (Cas9), a non-coding transactivating er-RNA (tracrRNA), and an array of foreign DNA-derived spacers flanked by direct repeats (crRNAs). Upon maturation by Cas9, the tracrRNA and crRNA duplex guide the Cas9 nuclease to a target DNA sequence specified by the spacer guide sequences, and mediates double-stranded breaks in the DNA near a short sequence motif in the target DNA that is required for cleavage and specific to each CRISPR-Cas system. The type II CRISPR-Cas systems are found throughout the bacterial kingdom and highly diverse in in Cas9 protein sequence and size, tracrRNA and crRNA direct repeat sequence, genome organization of these elements, and the motif requirement for target cleavage. One species may have multiple distinct CRISPR-Cas systems.
[00674] Applicants evaluated 207 putative Cas9s from bacterial species identified based on sequence homology to known Cas9s and structures orthoiogous to known subdomains, including the HNH endonuciease domain and the RuvC endonuclease domains [information from the Eugene oonin and ira Makarova]. Phylogenetic analysis based on the protein sequence conservation of this set revealed five families of Cas9s, including three groups of large Cas9s (-1400 amino acids) and two of small Cas9s (-1100 amino acids) (Figs. l9A-D and 20A-F).
[00675] Applicants have also optimized Cas9 guide RNA using in vitro methods.
Example 16: Cas9 mutations
[00676] In this example. Applicants show that the following mutations can convert SpCas9 into a nicking enzyme: D10A, E762A, H840A, N854A, N863A, D986A.
[006771 Applicants provide sequences showing where the mutation points are located within the SpCas9 gene (Fig. 24A-M), Applicants also show that the nickases are still able to mediate homologous recombination. Furthermore, Applicants show that SpCas9 with these mutations (individually) do not induce double strand break.
[00678] Cas9 ortho!ogs all share the general organization of 3-4 RuvC1 domains and a FIN I domain. The 5' most RuvC domain cleaves the non-complementary strand, and the HNH domain cleaves the complementary strand. All notations are in reference to the guide sequence. [00679] The catalytic residue in the 5' RuvC domain is identified through homology comparison of the Cas9 of interest with other Cas9 orthologs (from S. pyogenes type II CRISPR locus, S, thermophilus CRISPR locus 1, S. themiophiius CRISPR locus 3, and Francisciila rsovieida type Π CRISPR locus), and the conserved Asp residue is mutated to alanine to convert Cas9 into a complementary-strand nicking enzyme. Similarly, the conserved His and Asn residues in the HN domains are mutated to Alanine to convert Cas9 into a non-compfementary- strand nicking enzyme.
Example 17: Cas9 Transcriptional Activation and Cas9 Repressor
[00680] Cas9 Transcriptional Activation
[00681] A second generation of constructs were designed and tested (Table 1). These constructs are used to assess transcriptional activation (VP64 fused constructs) and repression (Cas9 only) by RT-qPCR. Applicants assess the cellular localization of each construct usi g anti- Hi s antibody, nuclease activity using a Surveyor nuclease assay, and DNA binding affinity using a gel shift assay,
[00682] Cas Repressor
[006831 It has been shown previously that dCas9 can be used as a generic DNA binding domain to repress gene expression. Applicants report an improved dCas9 design as well as dCas9 fusions to the repressor domains KRAB and SlD4x. From the plasmid library created for modulating transcriptio using Cas9 i Table 1, the followi g repressor plasmids were functionally characterized by qPCR: pXRP27, pXRP28, pXRP29, pXRP48, pXRP49, pXRP50, pXRP51, pXRP52, pXRP53, pXRP56, pXRP58, pXRP59, pXRP61, and pXRP62.
[00684] Each dCas9 repressor plasmid was co-transfected with two guide RNAs targeted to the coding strand of the beta-catenin gene. RNA was isolated 72 hours after transfection and gene expression was quantified by RT-qPCR.. The endogenous control gene was GAPDH, Two validated shRNAs were used as positive controls. Negative controls were certain plasmids transfected without gRNA, these are denoted as "pXRP## control". The plasmids pXRP28, pXRP29, pXRP48, and pXRP49 could repress the beta-catenin gene when using the specified targeti g strategy. These plasmids correspond to dCas9 without a functional domain (pXRP28 and pXRP28) and dCas9 fused to S f i)4x (pXRP48 and pXRP49).
[00685] Further work investigates: repeating the above experiment, targeting different genes, utilizing other gRNAs to determine the optimal targeting position, and multiplexed repression. [C Table 1
Figure imgf000237_0001
pXRP031 ^Lenti2-pPO -VP64-mS-FLAG-Liiiker-Cas9-NLS-gLuc-2 A-GFP-WPRE
pXRP032^Lenti2-LTR-VP64-NLS-FLAG-Linker-Cas9-NLS-gLuc-2A-GFP-WPRE
ΧΚΡ033 Ι^ηΙΐ2 8ν40-νΡ 4-ΝΕ3-ΟΟ Ό8,£πΛβΓ-€389-ΝΕ3-^0-2Α ιΡΡ^ΡΚΕ
pXRP034^nti2^PGK-VP64-NLS-GOGGS3Linker^as9-NLS-gLuc-2A-GFP-WPRE
pXRP035-pLenti2-LTR T64~NLS K ¾
pXRP036^nti2^SV40-VP64-NLS-EAAAK3Linker-Cas9-NLS-gLuc-2A iFP-WPRE
pXIU>037-pLenti2-pPGK- 64-NLS-EAAAK3Linker-Cas9-NLS-gLiic-2A-GFP-WPRE
pXPJ>038-pLenti2-LTR-VP64-NLS-EAAAK3Liiiker-Cas9-NLS-gLuc-2A-GFP-WPRE
pXPJ>048-pLenti2-EFla-Simx-NLS-FLAG-Linker-Cas9-NLS-gLuc-2A-GFP-WPRE
pXRP(S49-pLenti2-Eiaa-SID4X-NLS iGGGS;Lirier-Cas9-NLS-gLuc-2A jil, VPIlE
pXPJ»050-pLenti2-EFla-Sro4X-NLS-EAAAK3Linker-Cas9-NLS-gLuc-2A-GFP-WPRE
pXRPOS 1 -pLer. ti2-EF 1 a-KRAB- LS-FLAG-Linker-Cas9-NLS-gLuc-2A-GFP-WPRE
pXRP052-pI rti2-EFla-KRAB-NLS-GGGGS3Linker as9-NLS-gLx!c-2A jF
pXRP053-pLenti2-EF 1 a-KRAB-NLS-EAAAK3Linker-Cas9-NLS-gLuc-2A-GFP-WPRE
pXRP054^Lenti2-EFla-Cas9-LiDker-FLAG- LS-W64-gLuc-2A- }FP-WPRE
pXRP055-pLenti2-EF 1 a-Cas9-LiDker-FL AG- LS-SrD4X-gLuc-2A-GFP-WPRE
pXRP056-pI^ti2-EFla-Cas9-Liiiker-FLAG-NLS-KRAB-gLuc-2A iFP-WPRE
pXRP057-pLeiiti2-EFla-Cas9-GGGGGS3-NLS-VP64-gLuc-2A-GFP-WPRE
pXRP058-pLenti2-EFla-Cas9-GGGGGS3-NLS-SID4X-gL c-2A-GFP-WPRE
pXRP059-pLenti2-EFla-Cas9-GGGGGS3-NLS-KRAB-gLuc-2A-GFP-WPRE
pXRP060-pLenti2-EFla-C.as9-EAAAK3-NLS-VP64-gLuc-2A-GFP-WPRE
pXPJ»061-pLenti2-EFla-Cas9-EAAAK3-NLS-S]I)4X-gLuc-2A-<iFP-WPRE
pXPJ»062-pLenti2-EFla-Cas9-EAAAK3-NLS-KRAB-gLuc-2A-GFP-WPRE
Example 18: Targeted deletion of genes involved in cholesterol biosynthesis, fatty acid biosynthesis, and other metabolic disorders, genes encoding mis-folded proteins involved in amyloid and other diseases, oncogenes leading to cellular transformation, latent viral genes, and genes leading to dominant-negative disorders, amongst other disorders.
[006871 Applicants demonstrate gene deliver}7 of a CRISPR-Cas system in the liver, brain, ocular, epithelial, hematopoetic, or another tissue of a subject or a patient in need thereof, suffering from metabolic disorders, amyloidosis and protein -aggregation related diseases, cellular transformation arising from genetic mutations and translocations, dominant negative effects of gene mutations, latent viraf infections, and other related symptoms, using either viral or nanoparticle delivery system.
[00688] Study Design: Subjects or patients in need thereof suffering from metabolic disorders, amyloidosis and protein aggregation related disease which include but are not limited to human, non-primate human, canine, feline, bovine, equine, other domestic animals and related mammals. The CRISPR-Cas system is guided by a chimeric guide RNA and targets a specific site of the human genomic loci to be cleaved. After cleavage and non -homologous end-joining mediated repair, frame-shift mutation results in knock out of genes.
[00689] Applicants select guide-RNAs targeting genes involved in above-mentioned disorders to be specific to endogenous loci with minimal off-target activity. Two or more guide RM As may be encoded into a single CRISPR array to induce simultaneous double-stranded breaks in DNA leading to micro-deletions of affected genes or chromosomal regions.
[00690] Identification and design of gene targets
[00691] For each candidate disease gene, Applicants select DN A sequences of interest include protein-coding exons, sequences including and flanking known dominant negative mutation sites, sequences including and flanking pathological repetitive sequences. For gene-knockout approaches, early coding exons closest to the start codon offer best options for achieving complete knockout and minimize possibility of truncated protein products retaining partial function.
[00692] Applicants analyze sequences of interest for ail possible targetable 20-bp sequences immediately 5' to a NGG motif (for SpCas9 system) or a NNAGAAW (for StlCas9 system). Applicants choose sequences for unique, single RJMA-guided Cas9 recognition in the genome to minimize off-target effects based on computational algorithm to determine specificity.
[00693] Cloning of guide sequences into a deliver}' system
[00694] Guide sequences are synthesized as double-stranded 20-2.4 bp oligonucleotides. After 5 '-phosphorylation treatment of oligos and annealing to form duplexes, oligos are ligated into suitable vector depending on the delivery method:
[00695] Virus-based delivery methods
[00696] AAV-based vectors (PX260, 330, 334, 335) have been described elsewhere
[00697] Lentiviral -based vectors use a similar cloning strategy of directly ligating guide sequences into a single vector carrying a U6 promoter-driven chimeric RNA scaffold and a EFla promoter-driven Cas9 or Cas9 nickase.
[00698] Virus production is described elsewhere.
[00699] Nanoparticie-based RNA delivery methods
[00700] 1 . Guide sequences are synthesized as an oligonucleotide duplex encoding T7 promoter— guide sequence— chimeric RNA. A T7 promoter is added 5' of Cas9 by PCR method. [00701] 2. T7~driven Cas9 and guide-chimeric RNAs are transcribed in vitro, and Cas9 mRNA is further capped and A-tailed using commercial kits. RNA products are purified per kit instructions.
[00702] Hydrodynamic tail vein deliver}? methods (for mouse)
[00703] Guide sequences are cloned into AAV plasmids as described above and elsewhere in this application.
[0Θ704] In vitro validation on cell lines
[00705] Transfeciion
[00706] 1. DNA plasmid transfeciion
[00707] Plasmids carrying guide sequences are transfected into human embryonic kidney (HEK293T) or human embryonic stem (hES) ceils, other relevant cel l types using lipid-, chemical-, or electroporation-based methods. For a 24-well transfeciion of HEK293T cells (-260,000 eel Is), 500ng of total DNA is transfected into each single well using Lipofectamine 2000. For a 12-well transfection of hES cells, lug of total DNA is transfected into a single well using Fugene 1 10.
[00708] 2. RNA transfection
[00709] Purified RNA described above is used for transfection into HEK293T cells. l-2ug of RNA may be transfected into -260,000 using Lipofectamine 2000 per manufacturer's instruction. RNA delivery of Cas9 and chimeric RNA is shown in Fig. 28.
[00710] Assay of indel formation in vitro
[00711] Cells are harvested 72-hours post-transfection and assayed for indel formation as an indication of double-stranded breaks.
[00712] Briefly, genomic region around target sequence is PGR amplified (-400-600 bp amplicon size) using high-fidelity polymerase. Products are purified, normalized to equal concentration, and slowly annealed from 95°C to 4°C to allow formation of DNA heteroduplexes. Post annealing, the Cel-I enzyme is used to cleave heteroduplexes, and resulting products are separated on a polyacryl amide gel and indel efficiency calculated.
[00713] In vivo proof of principle in animal
[00714] Deliver)? mechanisms
[00715] AAV or Lentivirus production is described elsewhere.
[0071 ] Nanoparticle formulation: RNA mixed into nanopariicle formulation [00717] Hydrodynamic tail vein injections with DNA piasmids in mice are conducted using a commercial kit
[00718] Cas9 and guide sequences are delivered as virus, nanoparticle-coated RNA mixture, or DNA piasmids, and injected into subject animals. A parallel set of control animals is injected with sterile saline, Cas9 and GFP, or guide sequence and GFP alone.
[00719] Three weeks after injection, animals are tested for amelioration of symptoms and sacrificed. Relevant organ systems analyzed for indel formation. Phenotypic assays include blood levels of HDL, LDL, lipids,
[00720] Assay for indel formation
[00721] DNA is extracted from tissue using commercial kits; indel assay will be performed as described for in vitro demonstration.
[00722] Therapeutic applications of the CRISPR-Cas system are amenable for achieving tissue-specific and temporally controlled targeted deletion of candidate disease genes. Examples include genes involved in cholesterol and fatty acid metabolism, amyloid diseases, dominant negative diseases, latent viral infections, among other disorders.
123] Examples of a single guide- NA to introduce targeted indeis at a gene locus isease PAM m References
Fluvastatin; a revie w of its pharmacology and use in the management of
GCCAAATTG hypercholestero 1 aemi a. ( Plosker
Hyperchole HMG- GACGACCCT GL et al. Drugs 1996, 51(3):433- sterolemia CR CGG Knockout 459)
Potential role of non statin cholesterol lowering agents
CGAGGAGAC (Trapani et al. 1IJBMB Life,
Hyperchole CCCCGTTTC Volume 63, Issue 11, pages 964- sterolemia GG Knockout 971, November 201 1 )
DGAT1 inhibitors as anti-obesity and anti-diabetic agents. (Birch
CCCGCCGCC AM et ai. Current Opinion in
Hyperlipid DG.AT GCCGTGGCT Drug Discovery & Development emia 1 CG AGG Knockout [2010, i 3(4 489-4965
Killing of leukemic cells with a
TGAGCTCTA BCR/ABL fusion gene by RNA
BCR- CGAGATCCA interference (RNAi).( Fuchs et al.
Leukemia ABL CA AGG Knockout Oncogene 2002, 21(37):5716- 5724)
Examples of a pair of guide-RNA to introduce chromosomal microdeleiion at a gene locus
echanis
m References
Perilipin-2 Null Mice are
Protected Against Diet-Induced Obesity, Adipose Inflammation and Fatty Liver Disease
(McManaman JL et al. The
CTCAAAATT Journal of Lipid Research,
Hyperiipid PLIN2 CATACCGGT Microdele ilr.M035063. First Published on emia guide 1 TG tion February >013)
CGTTAAACA
Hyperiipid PI .1X2 ACAACCGGA Viic eie
emia guide2 CT TGG tion
Inhibition of SREBP by a Small Molecule, Betulm, Improves Hyperlipidemia and Insulin Resistance and Reduces
TTCAC CCCG Atherosclerotic Plaques (Tang J et
SREBP CGGCGCTGA Microdele al. Cell Metabolism, Volume 13, emia guide 1 AT tion Issue 1, 44-56, 5 January 201 1)
ACCACTACC
Hyperiipid SREBP AGTCCGTCC Microdele
emia guide2 AC tion
Example 19: Targeted integration of repair for genes carrying disease-causing mutations; reconstitution of enzyme deficiencies and other related diseases.
[00725] Study design
I. Identification and design of gene targets • Described in Example 22
II. Cloning of guide sequences and repair templates into a delivery system • Described above in Example 22
® Applicants clone DNA repair templates to include homology arms with diseased allele as well a wild-type repair template
ΙΠ. In vitro validation on cell lines
a. Transfection is described above in Example 22; Cas9, guide RNAs, and repair template are co-transfected into relevant cell types. b. Assay for repair in vitro
i. Applicants harvest cells 72-ho rs post-transfection and assay for repair ii. Briefly, Applicants amplify genomic region around repair template PGR using high-fidelity polymerase. Applicants sequence products for decreased incidence of mutant allele.
IV. In vivo proof of principle in animal
a. Delivery mechanisms are described above Examples 22 and 34. b. A ssay for repair in vivo
i. Applicants perform the repair assay as described in the in vitro demonstration.
V. Therapeutic applications
The CRISPR-Cas system is amenable for achieving tissue-specific and temporally controlled targeted deletion of candidate disease genes. Examples include genes involved in cholesterol and fatty acid metabolism, amyloid diseases, dominant negative diseases, latent viral infections, among other disorders.
[00726] Example of one single missense mutation with repair template:
Disease GENE SPACER PAM
Familial amyloid polyneuropathy TTR AGCCTTTCTGAACACATGCA CGG Mechanism References
Transthyretin mutations in health and disease (Joao et al. Human Mutation, V30M repair Volume' 5, Issue 3, pages 191-196, 1995)
V30M
allele CCTGCCATCAATGTGGCCATGCATGTGTTCAGAAAGGCT
WT
allele CCTGCCATCAATGTGGCCGTGCATGTGTTCAGAAAGGCT
Example 20: Therapeutic application of the CRISPR-Cas system in Glaucoma, Amyloidosis, and Huntington 's disease
[00727] Glaucoma: Applicants design guide RNAs to target the first exon of the mycilin (MYOC) gene. Applicants use adenovirus vectors (Ad5) to package both Cas9 as well as a guide RNA targeting the MYOC gene. Applicants inject adenoviral vectors into the trabecular meshwork where cel ls have been implicated in the pathophysiology of glaucoma. Applicants initially test this out in mouse models carrying the mutated MYOC gene to see whether they improve visual acuity and decrease pressure in the eyes. Therapeutic application in humans employ a similar strategy.
[00728] Amyloidosis: Applicants design guide RNAs to target the first exon of the transthyretin (TT ) gene in the liver. Applicants use AAV8 to package Cas9 as well as guide RNA targeting the first exon of the TTR gene. AAV8 has been shown to have efficient targeting of the liver and will be administered intravenously. Cas9 can be driven either using liver specific promoters such as the albumin promoter, or using a constitutive promoter. A pol3 promoter drives the guide RNA.
[00729] Alternatively, Applicants utilize hydrodynamic delivery of plasmid DNA to knockout the TTR gene. Applicants deliver a plasmid encoding Cas9 and the guideRNA targeting Exonl of TTR.
[00730] As a further alternative approach. Applicants administer a combination of RNA (mRNA for Cas9, and guide RNA). RNA can be packaged using liposomes such as Iiivivofectamine from Life Technologies and delivered intravenously. To reduce RNA-induced immunogenicity, increase the level of Cas9 expression and guide RNA stability, Applicants modify the Cas9 mRNA using 5' capping. Applicants also incorporate modified RNA nucleotides into Cas9 mRNA and guide RNA to increase their stability and reduce immunogenicity (e.g. activation of TLR). To increase efficiency, Applicants administer multiple doses of the vims, DNA, or RNA,
[00731] Huntington's Disease: Applicants design guide RNA based on allele specific mutations in the HTT gene of patients. For example, in a patient who is heterozygous for HTT with expanded CAG repeat, Applicants identify nucleotide sequences unique to the mutant HTT allele and use it to design guideRNA. Applicants ensure that the mutant base is located within the last 9 bp of the guide RNA (which Applicants have ascertained has the ability to discriminate between single DNA base mismatches between the target size and the guide RNA).
[00732] Applicants package the mutant HTT allele specific guide RNA and Cas9 into AAV9 and deliver into the striatum of Huntington's patients. Virus is injected into the striatum stereotacticaliy via a craniotomy. AAV9 is known to transduce neurons efficiently. Applicants drive Cas9 using a neuron specific promoter such as human Synaps n 1.
Example 21: Therapeutic application of the CRISPR-Cas system in HIV [00733] Chronic viral infection is a source of significant morbidity and mortality. While there exists for many of these viruses conventional antiviral therapies that effectively target various aspects of viral replication, current therapeutic modalities are usually non-curative in nature due to "viral latency." By its nature, viral latency is characterized by a dormant phase in the viral life cycle without active viral production. During this period, the virus is largely able to evade both immune surveillance and conventional therapeutics allowing for it to establish long-standing viral reservoirs within the host from which subsequent re-activation can permit continued propagation and transmission of virus. Key to viral latency is the ability to stably maintain the viral genome, accomplished either through episomal or proviral latency, which stores the viral genome in the cytoplasm or integrates it into the host genome, respectively. In the absence of effective vaccinations which would prevent primary infection, chronic viral infections characterized by latent reservoirs and episodes of lytic activity can have significant consequences: human papilloma virus (HPV) can result in cervical cancer, hepatitis C virus (HCV) predisposes to hepatocellular carcinoma, and human immunodeficiency vims eventually destroys the host immune system resulting in susceptibility to opportunistic infections. As such, these infections require life-long use of currently available antiviral therapeutics. Further complicating matters is the high mutability of many of these viral genomes which lead to the evolution of resistant strains for which there exists no effective therapy.
[00734] The CRISPR-Cas system is a bacterial adaptive immune system able to induce double-stranded DNA breaks (DSB) in a multiplex-able, sequence-specific manner and has been recently re-constituted within mammalian cell systems. It has been shown that targeting DNA with one or numerous guide-RNAs can result in both indels and deletions of the intervening sequences, respectively. As such, this new technology represents a means by which targeted and multiplexed DNA mutagenesis can be accomplished within a single cell with high efficiency and specificity. Consequently, delivery of the CRISPR-Cas system directed against viral DNA sequences could allow for targeted disruption and deletion of latent viral genomes even in the absence of ongoing viral production.
[00735] As an example, chronic infection by HIV-1 represents a global health issue with 33 million individuals infected and an annual incidence of 2.6 million infections. The use of the multimodal highly active antiretroviral therapy (HAART), which simultaneously targets multiple aspects of viral replication, has allowed HIV infection to be largely managed as a chronic, not terminal, illness. Without treatment, progression of HIV to AIDS occurs usually within 9-10 years resulting in depletion of the host immune system and occurrence of opportunistic infections usually leading to death soon thereafter. Secondary to viral latency, discontinuation of HAA T invariably leads to viral rebound. Moreover, even temporary disruptions in therapy can select for resistant strains of HIV uncontrollable by available means. Additionally, the costs of HAART therapy are significant: within the US $10,000-15,0000 per person per year. As such, treatment approaches directly targeting the HIV genome rather than the process of viral replication represents a means by which eradication of latent reservoirs could allow for a curative therapeutic option.
[00736] Development and delivery of an HIV-1 targeted CR SPR-Cas system represents a unique approac differe liable from existing means of targeted D A mutagenesis, i.e. ZF and TALENs, with numerous therapeutic implications. Targeted disruption and deletion of the HIV-1 genome by CRISPR -mediated DSB and indeSs in conjunction with HAART could al low for simultaneous prevention of active viral production as well as depletion of latent viral reservoirs within the host.
[00737] Once integrated within the host immune system, the CRISPR-Cas system allows for generation of a HIV-1 resistant sub-population that, even in the absence of complete viral eradication, could allow for maintenance and re-constitution of host immune activity. This could potentially prevent primary infection by disruption of the viral genome preventing viral production and integration, representing a means to "vaccination". Multiplexed nature of the CRISPR-Cas system allows targeting of multiple aspects of the genome simultaneously within individual eel Is.
[00738] As in HAART, viral escape by mutagenesis is minimized by requiring acquisition of multiple adaptive mutations concurrently. Multiple strains of HIV-1 ca be targeted simultaneously which minimizes the chance of super-infection and prevents subsequent creation of new recombinants strains. Nucleotide, rather than protein, mediated sequence-specificity of the CRISPR-Cas system allows for rapid generation of therapeutics without need for significantly altering delivery mechanism.
[00739] In order to accomplish this, Applicants generate CRISPR-Cas guide RNAs that target the vast majority of the HIV- 1 genome while taking into account HIV- 1 strain variants for maximal coverage and effectiveness. Sequence analyses of genomic conservation between HIV- 1 subtypes and variants should allow for targeting of flanking conserved regions of the genome with the aims of deleting intervening viral sequences or induction of frame-shift mutations which would disrupt viral gene functions.
[0074Θ] Applicants accomplish deliver}' of the CRISPR-Cas system by conventional adenoviral or leiitiviral-mediated infection of the host immune system. Depending on approach, host immune cells could be a) isolated, transduced with CRISPR-Cas, selected, and reintroduced in to the host or b) transduced in vivo by systemic delivery of the CRISPR-Cas system. The first approach allows for generation of a resistant immune population whereas the second is more likely to target latent viral reservoirs within the host.
Exam le? » of potential HIV-1 targeted spacers adapted from Mcintyre et al, which generated shRNAs against HIV-1 optimized for maximal coverage of HIV-1 variants.
CACTGCTTAAGCCTCGCTCGAGG
TCACCAGCAATATTCGCTCGAGG
CACCAGCAATATTCCGCTCGAGG
TAGCAACAGACATACGCTCGAGG
GGGCAGTAGTAATACGCTCGAGG
CCAA.TTCCCATACATTATTGTAC
Example 22: Targeted correction of deltaFSOS or other mutations in cystic fibrosis
[00741] An aspect of the invention provides for a pharmaceutical composition that may comprise an CRISPR-Cas gene therapy particle and a biocompatible pharmaceutical carrier.
According to another aspect, a method of gene therapy for the treatment of a subject having a mutation in the CFTR gene comprises administering a therapeutically effective amount of a CRISPR-Cas gene therapy particle to the cells of a subject.
[00742] This Example demonstrates gene transfer or gene delivery of a CRISPR-Cas system in airways of subject or a patient in need thereof, suffering from cystic fibrosis or from cystic fibrosis related symptoms, using adeno-associated virus (AAV) particles.
[00743] Study Design; Subjects or patients in need there of: Human, non-primate human, canine, feline, bovine, equine and other domestic animals, related. This study tests efficacy of gene transfer of a CRISPR-Cas system by a AAV vector. Applicants determine transgene levels sufficient for gene expression and utilize a CRISPR-Cas system comprising a Cas9 enzyme to target deltaF508 or other CFTR-inducing mutations.
[00744] The treated subjects receive pharmaceutically effective amount of aerosolized AAV vector system per lung endobronchialiy delivered while spontaneously breathing. The control subjects receive equivalent amount of a pseudotyped AAV vector system with an internal control gene. The vector system may be delivered along with a pharmaceutically acceptable or biocompatible pharmaceutical carrier. Three weeks or an appropriate time interval following vector admin stration, treated subjects are tested for amelioration of cystic fibrosis related symptoms.
[00745] Applicants use an adenovirus or an AAV particle.
[00746] Applicants clone the following gene constructs, each operabiy linked to one or more regulatory sequences (Cbh or EFla promoter for Cas9. U6 or HI promoter for chimeric guide RNA), into one or more adenovirus or AAV vectors or any other compatible vector: A CFTRdelta508 targeting chimeric guide RNA (Fig. 3 IB), a repair template for deltaF508 mutation (Fig. 31.C) and a codon optimized Cas9 enzyme with optionally one or more nuclear localization signal or sequence(s) (NLS(s)), e.g., two (2) NLSs.
[00747] identification of Cas9 target site
[00748] Applicants analyzed the human CFTR genomic locus and identified the Cas9 target site (Fig. 31 A). (PAM may contain a NGG or a N AGAAW motif).
[00749] Gene Repair Strategy
[00750] Applicants introduce an adenovirus/ AAV vector system comprising a Cas9 (or Cas9 nickase) and the guide RNA along with a adenovirus/AAV vector system comprising the homology repair template containing the F508 residue into the subject via one of the methods of delivery discussed earlier. The CRISPR-Cas system is guided by the CFTRdelta 508 chimeric guide RNA and targets a specific site of the CFTR genomic locus to be nicked or cleaved. After cleavage, the repair template is inserted into the cleavage site via homologous recombination correcting the deletion that results in cystic fibrosis or causes cystic fibrosis related symptoms. This strategy to direct delivery and provide systemic introduction of CRISPR systems with appropriate guide R'NAs can be employed to target genetic mutations to edit or otherwise manipulate genes thai cause metabolic, li er, kidney and protein diseases and disorders such as those in Table B.
Example 23: Generation of Gene Knockout Cell Library
[00751] This example demonstrates how to generate a library of cel ls where each cell has a single gene knocked out: [00752] Applicants make a library of ES cells where each cell has a single gene knocked out, and the entire library of ES cells will have every single gene knocked out. This library is useful for the screening of gene function in cellular processes as well as diseases.
[00753] To make this cell library, Applicants integrate Cas9 driven by an inducible promoter (e.g. doxyeycline inducible promoter) into the ES ceil. In addition, Applicants integrate a single guide RNA targeting a specific gene in the ES cell. To make the ES cell library, Applicants simply mix ES cells with a library of genes encoding guide RNAs targeting each gene in the human genome. Applicants first introduce a single BxBl attB site into the AAVS! locus of the human ES cell. Then Applicants use the BxBl integrase to facilitate the integration of individual guide RNA genes into the BxBl attB site in AAVSl locus. To facilitate integration, each guide RNA gene is contained on a plasmid that carries of a single attP site. This way BxBl wil l recombine the attB site in the genome with the attP site on the guide RNA containing plasmid.
[00754] To generate the cel l library, Applicants take the library of cells that have single guide RNAs integrated and induce Cas9 expression. After induction, Cas9 mediates double strand break at sites specified by the guide RNA . To verify the diversity of this cel l library, Applicants cany out whole exome sequencing to ensure that Applicants are able to observe mutations in every single targeted gene. This cell library can be used for a variety of applications, including who library-based screens, or can be sorted into individual cell clones to facilitate rapid generation of clonal ceil lines with individual human genes knocked out.
Example 24: Engineering of Microaigae using Cas9
[00755] Methods of delivering Cas9
[00756] Method 1 : Applicants deliver Cas9 and guide RNA using a vector that expresses Cas9 under the control of a constitutive promoter such as Hsp70A-R.be S2 or Beta2 -tubulin.
[00757] Method 2: Applicants deliver Cas9 and T7 polymerase using vectors that expresses Cas9 and T7 polymerase under the control of a constitutive promoter such as Hsp70A-Rbc S2 or Beta2 -tubulin. Guide RNA will be delivered using a vector containing T7 promoter driving the guide RNA.
[00758] Method 3: Applicants deliver Cas9 mRNA and in vitro transcribed guide RNA to algae cells. RNA can be in vitro transcribed. Cas9 mRNA will consist of the coding region for Cas9 as well as 3'UTR from Co l to ensure stabilization of the Cas9 mRNA. [00759] For Homologous recombination, Applicants provide an additional homology directed repair template.
[00760] Sequence for a cassette driving the expression of Cas9 under the control of beta-2 tubulin promoter, followed by the 3' UTR of Copl.
TCTTTCTTGCGCTATGACACTTCCAGCAAAAGGTAGGGCGGGCTGCGA
Figure imgf000250_0001
CTTCGGGGCTGCATGGGCGCTCCGATGCCGCTCCAGGGCGAGCGCTGTTTAAATA
GCCAGGCCCCCGATTGCAAAGACATTATAGCGAGCTACCAAAGCCATATTCAAAC
ACCTAGATCACTACCACTTCTACACAGGCCACTCGAGCTTGTGATCGCACTCCGC
TAAGGGGGCGCCTCTTCCTCTTCGTTTCAGTCACAACCCGCAAACATGTACCCATA
( ί ;ΛΊ'(ίΊ'Ί'( ί Λ(ίΛΊ 'ΓΛί CiC'l FCXK (Χ^ΛΛί ϊΛΛΛΛΛί j(Xi( AACXi'I X AAGGGTi C GA
CAAGAAGTACAGCATCGGCCTGGACATCGGCACCAACTCTGTGGGCTGGGCCGTG
ATCACCGACGAGTACAAGGTGCCCAGCAAGAAATTCAAGGTGCTGGGCAACACC
GACCGGCACAGCATCAAGAAGAACCTGATCGGAGCCCTGCTGTTCGACAGCGGC
GAAACAGCCGAGGCCACCCGGCTGAAGAGAACCGCCAGAAGAAGATACACCAG
ACGGAAGAACCGGATCTGCTATCTGCAAGAGATCTTCAGCAACGAGATGGCCAA
GGTGGACGACAGCTTCTTCCACAGACTGGAAGAGTCCTTCCTGGTGGAAGAGGAT
AAGAAGCACGAGCGGCACCCCATCTTCGGCAACATCGTGGACGAGGTGGCCTAC
CACGAGAAGTACCCCACCATCTACCACCTGAGAAAGAAACTGGTGGACAGCACC
(lAC' AiiGi ( (ΪΑ(ΧΊΧ CiG( ΊΧ;ΛΊίΊΛΊΧΊΧΧ ΧΧΊ( Χ ί Λ('ΑΊΧ;ΛΊί AACirrCX"
GGGGCCACTTCCTGATCGAGGGCGACCTGAACCCCGACAACAGCGACGTGGACA
A(sC ΊΧ ΠΤ( ΆΤ( X A(sC ΊΧ XsTGCAG AC '( "ΓΑί ΛΛ( X 'Λί ΧΊ GTTC · Αί -G A ΑΑ Α( X 'ΛΤ
CAACGCCAGCGGCGTGGACGCCAAGGCCATCCTGTCTGCCAGACTGAGCAAGAG
CAGACGGCTGGAAAATCTGATCGCCCAGCTGCCCGGCGAGAAGAAGAATGGCCT
GTTCGGCAACCTGATTGCCCTGAGCCTGGGCCTGACCCCCAACTTCAAGAGCAAC
TTCGACCTGGCCGAGGATGCCAAACTGCAGCTGAGCAAGGACACCTACGACGAC
( ) A C ' ( " 1 'C ί · Λ ί A. A C C Ί X X Ί < X X X X A G A Τ< X X ϊ ( G A { ' Λ Τ A ( G C < X s A ( X T ' Π Ί ( TG <
CCGCCAAGAACCTGTCCGACGCCATCCTGCTGAGCGACATCCTGAGAGTGAACAC
( iAiiAIC'ACXAACK ί (XXXIGAGC C (ΊΧΊΛΊΧίΑΊΧ AAGAGAl'AC ί = Λ( CiACiCA
CCACCAGGACCTGACCCTGCTGAAAGCTCTCGTGCGGCAGCAGCTGCCTGAGAAG
TACAAAGAGATTTTCTTCGACCAGAGCAAGAACGGCTACGCCGGCTACATTGACG GCGGAGCCAGCCAGGAAGAGTTCTACAAGTTCATCAAGCCCATCCTGGAAAAGA TGGACGGCACCGAGGAACTGCTCGTGAAGCTGAACAGAGAGGACCTGCTGCGGA
AGCAGCGGACCTTCGACAACGGCAGCATCCCCCACCAGATCCACCTGGGAGAGC TC !<7\C XX X ΛΤ IX "!'G( GGi X XsC 'Λί sGAAGATT] ΤΤΛ( ( { ΛΤΤί X'TGAAi JGACAAC ( ) GGAAAAGATCGAGAAGATCCTGACCTTCCGCATCCCCTACTACGTGGGCCCTCTG
( XACiGCiGAAACAC ΛΟΛ ΓΊΧΧ ίΊ !(}ΛΊ :Λ(ΧΑ(;ΑΛΑ<;Α( iiACiGAAAC VrC-
Figure imgf000251_0001
TCGAGCGGATGACCAACTTCGATAAGAACCTGCCCAACGAGAAGGTGCTGCCCA AGCACAGCCTGCTGTACGAGTACTTCACCGTGTATAACGAGCTGACCAAAGTGAA ATACGTGACCGAGGGAATGAGAAAGCCCGCCTTCCTGAGCGGCGAGCAGAAAAA
( ί Λ Γ(Χ !ί;(}Λ(ΧΊ (ΊΧΠΊΧ \Λ(}Λ(ΧΑΛ( ί ιΛΑΛίΠ ίΛί C rrCiAAC 'A i Ί' GAAAGAGGACTACTTCAAGAAAATCGAGTGCTTCGACTCCGTGGAAATCTCCGGC
(Γ! (;ΛΛ(ίΛ Γ(Χ ΠΊΧ\ Λ(Χί(ΧΊΧΧΧΊ ( ί( Λ( ΛΊ \( ί A(X = A1(1G( ΊΧ;ΛΛΛΛΊΊ \ TCAAGGACAAGGACTTCCTGGACAATGAGGAAAACGAGGACATTCTGGAAGATA TCGTGCTGACCCTGACACTGTTTGAGGACAGAGAGATGATCGAGGAACGGCTGA AAACCTATGCCCACCTGTTCGACGACAAAGTGATGAAGCAGCTGAAGCGGCGGA GATACACCGGCTGGGGCAGGCTGAGCCGGAAGCTGATCAACGGCATCCGGGACA AGCAGTCCGGCAAGACAATCCTGGATTTCCTGAAGTCCGACGGCTTCGCCAACAG AAACTTCATGCAGCTGATCCACGACGACAGCCTGACCTTTAAAGAGGACATCCAG ΑΛΑ( '(Χ A( r!GX( X:XX ACiGCi(X.A1ACi('( ΊίΧ\ ί ;Α( 'Α(ΑΧΊ'(ί(ΧΑΛ Γ(ΊΧ: GCCGGCAGCCCCGCCATTAAGAAGGGCATCCTGCAGACAGTGAAGGTGGTGGAC GAGCTCGTGAAAGTGATGGGCCGGCACAAGCCCGAGAACATCGTGATCGAAATG GCCAGAGAGAACCAGACCACCCAGAAGGGACAGAAGAACAGCCGCGAGAGAAT GAAGCGGATCGAAGAGGGCATCAAAGAGCTGGGCAGCCAGATCCTGAAAGAACA CCCCGTGGAAAACACCCAGCTGCAGAACGAGAAGCTGTACCTGTACTACCTGCAG AATGGGCGGGATATGTACGTGGACCAGGAACTGGACATCAACCGGCTGTCCGAC TACGKmiGGACC TKrCGTGCCrCAGAGCTrrCrGAAGGACGAX rCCKTCGACA ACAAGGTGCTGACCAGAAGCGACAAGAACCGGGGCAAGAGCGACAACGTGCCCT
( GAAGAGGTCX5TGAAGAAGATGAAGAACTA.CTGGCGGCAGCTGCTGAACGCCA AGCTGATTACCCAGAGAAAGTTCGACAATCTGACCAAGGCCGAGAGAGGCGGCC TGAGCGAACTGGATAAGGCCGGCTTCATCAAGAGACAGCTGGTGGAAACCCGGC AGATCACAAAGCACGTGGCACAGATCCTGGACTCCCGGATGAACACTAAGTACG
ACGAGAATGACAAGCTGATCCGGGAAGTGAAAGTGATCACCCTGAAGTCCAAGC
TGGTGTCCGATTTCCGGAAGGATTTCCAGTTTTACAAAGTGCGCGAGATCAACAA
( Ί'Λ( '( Λ(Χ 'Λ(ΧΚ ( XA( GAC X ( Ί'Λ( '( Ί'ί = ΛΛ(ΧΚ ( Χ7Γ( ί Π Χ ::ΛΛ( ί ( '( ( Ί ΪΛΊ ^
AAAAAGTACCCTAAGCTGGAAAGCGAGTTCGTGTACGGCGACTACAAGGTGTAC
GA(XJTG(XJGAAGATGATCGCCAAGAGCGA.GCAGGAAATCGGCAAGGCTACCGCC
AAGTACTTCTTCTACAGCAACATCATGAACTTTTTCAAGACCGAGATTACCCTGG
CCAACGGCGAGATCCGGAAGCGGCCTCTGATCGAGACAAACGGCGAAACCGGGG
AGATCGTGTGGGATAAGGGCCGGGATTTTGCCACCGTGCGGAAAGTGCTGAGCA
TGCCCCAAGTGAATATCGTGAAAAAGACCGAGGTGCAGACAGGCGGCTTCAGCA
ΑΛ( ίΛ( ί'!Χ TATrCTGC C X 'AAGAGGAACACX GATAAGr FGATC XX X AGAAAGAAGG
ACTGGGACCCTAAGAAGTACGGCGGCTTCGACAGCCCCACCGTGGCCTATTCTGT
GCTGGTGGTGGCCAAAGTGGAAAAGGGCAAGTCCAAGAAACTGAAGAGTGTGAA
AGAGCTGCTGGGGATCACCATCATGGAAAGAAGCAGCTTCGAGAAGAATCCCAT
CGACTTTCTGGAAGCCAAGGGCTACAAAGAAGTGAAAAAGGACCTGATCATCAA
GCTGCCTAAGTACTCCCTGTTCGAGCTGGAAAACGGCCGGAAGAGAATGCTGGC
CTCTGCCGGCGAACTGCAGAAGGGAAACGAACTGGCCCTGCCCTCCAAATATGT
GAACTTCCTGTACCTGGCCAGCCACTATGAGAAGCTGAAGGGCTCCCCCGAGGAT
AATGAGCAGAAACAGCTGTTTGTGGAACAGCACAAGCACTACCTGGACGAGATC
ΑΊΧ' C Ϊ AC X 'AGATC 'Λί ΧΧ ί Α Ι'Ί TCi A AC sAC Ϊ AC Ϊ XGATC ΧΊ GGCX X J A{ X ΧΊ ΛΛ TCTGi J
ACAAAGTGCTGTCCGCCTACAACAAGCACCGGGATAAGCCCATCAGAGAGCAGG
C X sAGA ATATC W!X X ACX Ί GTT! AC XTGACX 'A ATCTGGGAGC X X TGC XXX X ΊΊ'
CAAGTACTTTGACACCACCATCGACCGGAAGAGGTACACCAGCACCAAAGAGGT
GCTGGACGCCACCCTGATCCACCAGAGCATCACCGGCCTGTACGAGACACGGAT
CGACCTGTCTCAGCTGGGAGGCGACAGCCCCAAGAAGAAGAGAAAGGTGGAGGC
CAGCTAAGGATCCGGCAAGACTGGCCCCGCTTGGCAACGCAACAGTGAGCCCCTC
C 'C "ΓΑί -TC jTGTTTGi XX J AT( -TC Ϊ AC X'ATGTATTC X H GTi ΠΊΧ XX X 'AAC XX' Χ.ΠΧ A AC X '
CGAACAGATTGATACCCGCCTTGGCATTTCCTGTCAGAATGTAACGTCAGTTGAT
GGTAC T
[00761] Sequence for a cassette driving the expression of T7 polymerase under the control of beta- 2 tubulin promoter, followed by the 3' UTR of Cop 1 : TCTTTCTTGCGCTATGACACTTCCAGCAAAAGGTAGGGCGGGCTGCGA
GACGGCTTCCCGGCGCTGCATGCAACACCGATGATGCTTCGACCCCCCGAAGCTC
CTTCGGGGCTGCATGGGCGCTCCGATGCCGCTCCAGGGCGAGCGCTGTTTAAATA
( X '{ A.GC )('( '{ '( ( 'GATTGCAA AG AC ΆΊΊ ATAGi C sAC "! AC '( 'AAAGCCATA TTC 'ΛΛΛί'
ACCTAGATCACTACCACTTCTACACAGGCCACTCGAGCTTGTGATCGCACTCCGC
TAAGGGGGCGCCTCTTCCTCTTCGTTTCAGTCACAACCCGCAAACatgcctaagaagaaga ggaaggttaacacgattaacatcgctaagaacgacitctctgacaicgaaciggctgctatcccgitcaacacictggctgaccati acggtgagcgtttagctcgcgaacagttggcccttgagcatgagtcttacgagatgggtgaagcacgcttccgcaagatgtttga gcgicaacttaaagctggtgaggttgcggataacgctgccgccaagccictcatcactaccctaciccciaagatgattgcacgc atcaacgactggtttgaggaagtgaaagctaagcgcggcaagcgcccgacagccttccagttcctgcaagaaatcaagccgga agccgtagcgtacatcaccatiaagaccactctggcttgcctaaccagtgctgacaatacaaccgttcaggctgtagcaagcgca atcggtcgggccattgaggacgaggctcgcttcggtcgtatccgtgaccttgaagctaagcacttcaagaaaaacgttgaggaa caactcaacaagcgcgtagggcacgtctacaagaaagcatitatgcaagtigtcgaggctgacatgcictciaagggtctactcg gtggcgaggcgtggtcttcgtggcataaggaagactctattcatgtaggagtacgctgcatcgagatgctcattgagtcaaccgg aatggttagcttacaccgccaaaatgctggcgtagtaggtcaagactctgagactatcgaactcgcacctgaatacgctgaggct atcgcaacccgigcaggtgcgctggctggcatctctccgatgttccaacctigcgtagttcctcctaagccgtggactggcattac tggtggtggctattgggctaacggicgtcgicctctggcgctggtgcgtactcacagtaagaaagcactgatgcg^
gittacatgccigaggtgtacaaagcgaiiaacattgcgcaaaacaccgcatggaaaaicaacaagaaagtcctagcggtcgcc aacgtaatcaccaagtggaagcattgtccggtcgaggacatccctgcgattgagcgtgaagaactcccgatgaaaccggaaga catcgacatgaatcctgaggctctcaccgcgtggaaacglgctgccgctgctgigtaccgcaaggacaaggctcgcaagtctcg ccgtatcagccttgagttcatgcttgagcaagccaataagtttgctaaccataaggccatctggttcccttacaacatggactggcg cggtcgtgtttacgctgtgtcaatgttcaacccgcaaggtaacgatatgaccaaaggacigcttacgctggcgaaaggiaaacca atcggtaaggaaggttactaciggcigaaaatccacggigcaaactgtgcgggtgtcgacaaggttccgticcctgagcgcatca agttcattgaggaaaaccacgagaacatcatggcttgcgctaagtctccactggagaacacttggtgggctgagcaagattctcc gttctgcttccttgcgttcigctttgagiacgctggggtacagcaccacggccigagctaiaacigctcccttccgctggcgttigac gggicttgctctggcaiccagcacttctccgcgatgctccgagatgaggtaggiggicgcgcggttaa
cgttcaggacatctacgggattgttgctaagaaagtcaacgagattctacaagcagacgcaatcaatgggaccgataacgaagla gttaccgtgaccgatgagaacactggtgaaatctctgagaaagtcaagctgggcactaaggcactggctggtcaatggctggct tacggtgttactcgcagtgtgactaagcgttcagtcatgacgctggcitacgggtccaaagagitcggcttccgtcaacaagtgct ggaagataccattcagccagctattgattccggcaagggtctgatgttcactcagccgaatcaggctgctggatacatggctaag ctgatttgggaatctgtgagcgtgacggtggtagctgcggttgaagcaatgaactggcttaagtctgctgctaagctgctggctgc tgaggtcaaagataagaagactggagagattcttcgcaagcgttgcgctgtgcattgggtaactcctgatggtttccctgtgtggc aggaaiacaagaagcctattcagacgcgctigaaccigatgttcctcggtcagttccgcttacagcctaccattaacaccaacaa agatagcgagattgatgcacacaaacaggagtctggtatcgctcctaactttgtacacagccaagacggtagccaccttcgtaag actgtagtglgggcacacgagaagtacggaatcgaatcitttgcactgattcacgactccttcggtacgattccggctgacgctgc gaacctgttcaaagcagtgcgcgaaac ggttgacaca gagtcttgtgatgtactggctgatttctacgaccagttcgctga ccagltgcacgagtcicaattggacaaaatgccagcacttccggctaaaggtaacttgaacctccgtgacatcttagagtcg
tcgcgttcgcgtaaGGATCCGGCAAGACTGGCCCCGCTTGGCAACGCAACAGTGAGCCC
CTCCCTAGTGTGTTTGGGGATGTGACTATGTATTCGTGTGTTGGCCAACGGGTCA
ACCCGAACAGATTGATACCCGCCTTGGCATTTCCTGTCAGAATGTAACGTCAGTT
GATGGTACT
[00762] Sequence of guide RNA driven by the T7 promoter (T7 promoter, Ns represent targeting sequence):
gaaat1^AATACGAC:TCAC i^ATANNNNNNNNNNNNNNNNNNNNgttttagagc
taGAAAtagcaagttaaaataaggctagtccgttatcaacttgaaaaagtggcaccgagtcggtgcttttttt
[00763] Gene delivery;
[007641 Chlamydomonas reinhardtii strain CC-124 and CC-125 from the Chlamydomonas Resource Center will be used for electroporation. Electro poration protocol follows standard recommended protocol from the GeneArt Chlamydomonas Engineering kit.
[00765] Also, Applicants generate a line of Chlamydomonas reinhardtii that expresses Cas9 constitutive])'. This can be done by using pC amy! (linearized using Pvul) and selecting for hygromycin resistant colonies. Sequence for pChiamyl containing Cas9 is below. In this way to achieve gene knockout one simply needs to deliver RNA for the guideRNA. For homologous recombination Applicants deliver guideRNA as well as a linearized homologous recombination template.
[00766 ] pChiamyl -Cas9 :
TGCGGTATTTCACACCGCATCAGGTGGCACTTTTCGGGGAAATGTGC
Figure imgf000254_0001
GATTATCAAAAAGGATCTTCACCTAGATCCTTTTAAATTAAAAATGAAGTTTTAA ΛΤ( Λ ΛΤ( ΊΑ ΛΛΟΊ ΛΊ^\Ί ΛΊ ί ;Λί Π^\ΛΛ( ΊΊ ( Γ ! ( ΊΧ}Λ( Α( Γ ! Ί^\( ί Λ ΛΊΧ : Ί Ί^\Α Γ( AGTGAGGCACCTATCTCAGCGATCTGTCTATTTCGTTCATCCATAGTTGCCTGACT CCCCGTCGTGTAGATAACTACGATACGGGAGGGCTTACCATCTGGCCCCAGTGCT GCAATGATACCGCGAGACCCACGCTCACCGGCTCCAGATTTATCAGCAATAAACC
AGCCAGCCGGAAGGGCCGAGCGCAGAAGTGGTCCTGCAACTTTATCCGCCTCCAT
CCAGTCTATTAATTGTTGCCGGGAAGCTAGAGTAAGTAGTTCGCCAGTTAATAGT
TTGCGCAACGTTGTTGCCATTGCTACAGGCATCGTG
TATGGCTTCATTCAGCTCCGGTTCCCAACGATCAAGGCGAGTTACATGATCCCCC
ATC ΠΊΧ Π Cii ΛΛΛΛΛΛ( X KJi' l AC ΧΊ (ΧΊΊ (X -G'l (X Ί ( X GATi C ΠΊ Π ("A ΑΛ( ·ΤΛ
AGTTGGCCGCAGTGTTATCACTCATGGTTATGGCAGCACTGCATAATTCTCTTACT
GTCATGCCATCCGTAAGATGCTTTTCTGTGACTGGTGAGTACTCAACCAAGTCATT
CTGAGAATAGTGTATGCGGCGACCGAGTTGCTCTTGCCCGGCGTCAATACGGGAT
AATACCGCGCCACATAGCAGAACTTTAAAAGTGCTCATCATTGGAAAACGTTCTT
CGGi JGC GAAAA ! <Ί CAAGGATC IIACCGCTGI Ί GAGATCCAG n XiATG'! AACC
CACTCGTGCACCCAACTGATCTTCAGCATCTTTTACTTTCACCAGCGTTTCTGGGT
( ) A ( ) ( ' A A A A A ( ' Λ G G Λ A G G C Λ A Λ A T G C C G C A Λ A Λ A Λ ( · C ( · Λ ' f ' Λ A C X · G C ί J Λ ί Λ ( ' ( · C
AAATGTTGAATACTCATACTCTTCCTTTTTCAATATTATTGAAGCATTTATCAGGG
TTATTGTCTCATGACCAAAATCCCTTAACGTGAGTTTTCGTTCCACTGAGCGTCAG
ACCCCGTAGAAAAGATCAAAGGATCTTCTTGAGATCCTTTTTTTCTGCGCGTAATC
TGCTGCTTGCAAACAAAAAAACCACCGCTACCAGCGGTGGTTTGTTTGCCGGATC
AAGAGCTACCAACTCTTTTTCCGAAGGTAACTGGCTTCAGCAGAGCGCAGATACC
AAATACTGTTCTTCTAGTGTAGCCGTAGTTAGGCCACCACTTCAAGAACTCTGTA
GC\\{ C GCC X ACATACC l CXsCTC ΊΧ Ί ΑΛΊ (ΧΊ (iTTACCACn Gi 'l G'iTGCCACn'Gi;
CGATAAGTCGTGTCTTACCGGGTTGGACTCAAGACGATAGTTACCGGATAAGGCG
C 'Λί J( XX ΠΧΧ XX TC sAACX ;G( XX iGTTCGTi JCAC WCA.GC C 'CAC ΧΊ TGi ·Λί ·( XXVAC t
ACCTACACCGAACTGAGATACCTACAGCGTGAGCTATGAGAAAGCGCCACGCTTC
CCGAAGGGAGAAAGGCGGACAGGTATCCGGTAAGCGGCAGGGTCGGAACAGGA
GAGCGCACGAGGGAGCTTCCAGGGGGAAACGCCTGGTATCTTTATAGTCCTGTCG
GGTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGG
Λ(ΧΧΊ \Ί (Κ;ΑΛΑΛΑ(Χ Χ \ί \ Λ(ΧΧ :Χ :ΧΊΊΊΊΊ Α(Χ ΠΊΧ ΧΊΧΧ Χ' ΠΊΎίΧΊΧ}
GCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTA
TTACCGCCTrmAGTGAGCTGAIA£CGCrCGCCGCAGCCGAACGACCGAGCGCAG
CGAGTCAGTGAGCGAGGAAGCGGTCGCTGAGGCTTGACATGATTGGTGCGTATGT
TTGTATGAAGCTACAGGACTGATTTGGCGGGCTATGAGGGCGGGGGAAGCTCTGG AAGGGCCGCGATGGGGCGCGCGGCGTCCAGAAGGCGCCATACGGCCCGCTGGCG
GCACCCATCCGGTATAAAAGCCCGCGACCCCGAACGGTGACCTCCACTTTCAGCG ACAAACGAGCACTTATACATACGCGACTATTCTGCCGCTATACATAACCACTCAG
ClAC llAACiAl ( ( \Ί'('ΛΛί :ΊΊΧ 'ΛΊΧ 'ί CiGCiCX X ( \ί!ΛΛ(Χ!Λί!ί( Λ(ίC· ( ΑΛ( \ ()θΛΊ ΛΊΪΠΊΊ·ί!ΑΙ Ο()0!ΛΊΊ !(iA(i( ACl' i 'AACX ( Π ATC CXXiAA GC X X ΧΧ Ί GGC X C 'AC AAAGGCl AGGC G(X Λ ATGCAAGC 'AGTTC CX'ATCX'AG X C '("!' GGAGCGGTGCCCTCCTGATAAACCGGCCAGGGGGCCTATGTTCTTTACTTTTTTAC AAGAGAAGTCACTCAACATCTTAAAATGGCCAGGTGAGTCGACGAGCAAGCCCG GCGGATCAGGCAGCGTGCTTGCAGATTTGACTTGCAACGCCCGCATTGTGTCGAC GAAGGCTTTTGGCTCCTCTGTCGCTGTCTCAAGCAGCATCTAACCCTGCGTCGCCG ΠΊ \Υ!Ί !Gi A( ;A<;All(XiACiGl A(X'AlXn \i (\νΓΑ(Χ}ΛΊΧΓ! Γ(ΧΑ(;ΑΊΊ Λ(Χ^ CTTCGCCGAAGAAAAAGCGCAAGGTCGAAGCGTCCGACAAGAAGTACAGCATCG
( X IX -GACATC X XiC A( X A. Λ( TC TC l\'G( XX IX XX XXX ΠΧ SATC ACX GAC C s AC Π AC A A GGTGCCCAGCAAGAAATTCAAGGTGCTGGGCAACACCGACCGGCACAGCATCAA GAAGAACCTGATCGGAGCCCTGCTGTTCGACAGCGGCGAAACAGCCGAGGCCAC CCGGCTGAAGAGAACCGCCAGAAGAAGATACACCAGACGGAAGAACCGGATCTG CTATCTGCAAGAGATCTTCAGCAACGAGATGGCCAAGGTGGACGACAGCTTCTTC CACAGACTGGAAGAGTCCTTCCTGGTGGAAGAGGATAAGAAGCACGAGCGGCAC CCCATCTTCGGCAACATCGTGGACGAGGTGGCCTACCACGAGAAGTACCCCACCA
Figure imgf000256_0001
!(ίA ΊΛ·!(Ί G( (ΧΊΧΚί(ΧΧ·Λ(\\!(ίΑ 'ΛΑ(ίΊΊ( (XK K X Α(ΊΊ( (Ί ^ΛΊ ί^Λ ( X ί ( X X j Λ C X Ί X s A A. < X X X G A ( ' A A ( ' A ( X ' ( · A ( G TG C · A ( A. A C X Ί G' Π ( ' A TC 'C A C X Ί G G T GCAGACCTACAACCAGCTGTTCGAGGAAAACCCCATCAACGCCAGCGGCGTGGA CGCCAAGGCCATCCTGTCTGCCAGACTGAGCAAGAGCAGACGGCTGGAAAATCT GATCGCCCAGCTGCCCGGCGAGAAGAAGAATGGCCTGTTCGGCAACCTGATTGC CCTGAGCCTGGGCCTGACCCCCAACTTCAAGAGCAACTTCGACCTGGCCGAGGAT
( XX ΛΛΛΓΊ GC A(s( "I ) CX ΛΛί iGACAC '( "!'A( GAC AC 'GACX"! GGAC AAC ΧΊ GC T J GCCCAGATCGGCGACCAGTACGCCGACCTGTTTCTGGCCGCCAAGAACCTGTCCG AC 'GC X ΛΊ (X Ί GC "f'G ACX C JAC ATCC'I GAGAGTC JAACAC '( 'GAGATC 'AC C V AGC XXX X CCTGAGCGCCTCTATGATCAAGAGATACGACGAGCACCACCAGGACCTGACCCTG CTGAAAGCTCTCGTGCGGCAGCAGCTGCCTGAGAAGTACAAAGAGATTTTCTTCG ACCAGAGCAAGAACGGCTACGCCGGCTACATTGACGGCGGAGCCAGCCAGGAAG AGTTCTACAAGTTCATCAAGCCCATCCTGGAAAAGATGGACGGCACCGAGGAAC
TGCTCGTGAAGCTGAACAGAGAGGACCTGCTGCGGAAGCAGCGGACCTTCGACA
A( GGi AGi ΛΊ (X X X 'Λί ( AGAI CX'ACC! GGGAGAGi TGCACGiX 'Λ'Π CTGi GGC X;
GCAGGAAGATTTTTACCCATTCCTGAAGGACAACCGGGAAAAGATCGAGAAGAT
('( '!'( ·Λ( ( Π (X GCATC X"! AC ΎΛ( (ΠΧΧΚΧ (X '!'( TGGi X 'AGGGGAAACAGCA A
TTCGCCTGGATGACCAGAAAGAGCGAGGAAACCATCACCCCCTGGAACTTCGAG
GAAGTGGTGGACAAGGGCGCTTCCGCCCAGAGCTTCATCGAGCGGATGACCAAC
TTCGATAAGAACCTGCCCAACGAGAAGGTGCTGCCCAAGCACAGCCTGCTGTAC
GAGTACTTCACCGTGTATAACGAGCTGACCAAAGTGAAATACGTGACCGAGGGA
AlXiACiAAACiCX'i Ci(X ΊΊ(Χ Ί'ί!Λί Χ :ΧίΛ(ί( \ί!ΛΑΛΑΛίΧΧ ( AICXnXiGACXX'
GCTGTTCAAGACCAACCGGAAAGTGACCGTGAAGCAGCTGAAAGAGGACTACTT
CAAGAAAAT(XiAGTG(JrTCGA(jr( GTGGAAAT(Tr( GGCGTGGAAGATCGGTTC
AACGCCTCCCTGGGCACATACCACGATCTGCTGAAAATTATCAAGGACAAGGACT
TCCTGGACAATGAGGAAAACGAGGACATTCTGGAAGATATCGTGCTGACCCTGA
CACTGTTTGAGGACAGAGAGATGATCGAGGAACGGCTGAAAACCTATGCCCACC
TGTTCGACGACAAAGTGATGAAGCAGCTGAAGCGGCGGAGATACACCGGCTGGG
GCAGGCTGAGCCGGAAGCTGATCAACGGCATCCGGGACAAGCAGTCCGGCAAGA
CAATCCTGGATTTCCTGAAGTCCGACGGCTTCGCCAACAGAAACTTCATGCAGCT
GAixxACGACGACAG(:x:nx Ac:x:i iAAAGAGGAcAixxAGAAAG(: :x:AGGi :rrc
CGGCCAGGGCGATAGCCTGCACGAGCACATTGCCAATCTGGCCGGCAGCCCCGC
CATTAAGAAGGGCATC ΊΧ AGACAGTGAAGGTGGl <K)ACX}AGi Ti GTGAAAGT
GATGGGCCGGCACAAGCCCGAGAACATCGTGATCGAAATGGCCAGAGAGAACCA
GACCACCCAGAAGGGACAGAAGAACAGCCGCGAGAGAATGAAGCGGATCGAAG
AGGGCATCAAAGAGCTGGGCAGCCAGATCCTGAAAGAACACCCCGTGGAAAACA
CCCAGCTGCAGAACGAGAAGCTGTACCTGTACTACCTGCAGAATGGGCGGGATA
TG FA( G r< = A(X AGGAAClCKiArATCAACXX TC^
ATATCGTGCCTCAGAGCTTTCTGAAGGACGACTCCATCGACAACAAGGTGCTGAC
CAGAAGCGACAAGAACCGGGGCAAGAGCGACAACGTGCCCTCCGAAGAGGTCG
TGAAGAAGATGAAGAACTACTGGCGGCAGCTGCTGAACGCCAAGCTGATTACCC
AGAGAAAGTTCGACAATCTGACCAAGGCCGAGAGAGGCGGCCTGAGCGAACTGG ATAAGGCCGGCTTCATCAAGAGACAGCTGGTGGAAACCCGGCAGATCACAAAGC
ACGTGGCACAGATCCTGGACTCCCGGATGAACACTAAGTACGACGAGAATGACA
AGCTGATCCGGGAAGTGAAAGTGATCACCCTGAAGTCCAAGCTGGTGTCCGATTT
C '( XX sAAGGATT l CX AGTHIACAAAGI ( ·( 'GC AG ATC Λ AC 'ΛΛΓΊ Λί X 'Λ( ί Λ( ( ·( '('
CACGACGCCTACCTGAACGCCGTCGTGGGAACCGCCCTGATCAAAAAGTACCCTA
Λ( Ί'( ;ΛΛΛ( ί!ΛίΠΊ :Γ!ΟΊ Λ( ;( ·Λ(Ί·Λ(·ΛΛΟ(ΠΤΓ! Λ(Χ}Λ( !·ί : ;ΛΛΟΛ
TGATCGCCAAGAGCGAGCAGGAAATCGGCAAGGCTACCGCCAAGTACTTCTTCTA
CAGCAACATCATGAACTTTTTCAAGACCGAGATTACCCTGGCCAACGGCGAGATC
CGGAAGCGGCCTCTGATCGAGACAAACGGCGAAACCGGGGAGATCGTGTGGGAT
AAGGGCCGGGATTTTGCCACCGTGCGGAAAGTGCTGAGCATGCCCCAAGTGAAT
ΛΊΧ (Γ!αΛΛΛΛΛΟΛ(Χ ί;Λί;αΊ'ί \\ί;Λί Λ( iiGill'C'AGi ΛΛΛίιΛίΠ'ί 'ΓΛΊΧΧΊα
CCCAAGAGGAACAGCGATAAGCTGATCGCCAGAAAGAAGGACTGGGACCCTAAG
Λ Λ( ) 1 AC X XX XX " Γ' Γ( '(.ίΛ('Λ( X X C C Λ( C ( ϊ !XX J( X " ! . ΥΠ ( Ί < il'i X Ί G( ϊ fXX ϊ IX XX X 'Λ
AAGTGGAAAAGGGCAAGTCCAAGAAACTGAAGAGTGTGAAAGAGCTGCTGGGG
ATCACCATCATGGAAAGAAGCAGCTTCGAGAAGAATCCCATCGACTTTCTGGAAG
CCAAGGGCTACAAAGAAGTGAAAAAGGACCTGATCATCAAGCTGCCTAAGTACT
CCCTGTTCGAGCTGGAAAACGGCCGGAAGAGAATGCTGGCCTCTGCCGGCGAAC
TGCAGAAGGGAAACGAACTGGCCCTGCCCTCCAAATATGTGAACTTCCTGTACC
TGGCCAGCCACTATGAGAAGCTGAAGGGCTCCCCCGAGGATAATGAGCAGAAAC
Λ( Ί'(ΠΊΊ (ΠΧ;(}ΛΛ( Λ(Χ\\ί ΛΛ(Ϊ('Λ(Ί \( i l iGACXiACiAIC'AlX ;Λ( 'Λ(}Λ·Γ(·Λ
GCGAGTTCTCCAAGAGAGTGATCCTGGCCGACGCTAATCTGGACAAAGTGCTGTC
C XX C ΤΛΓΑΛΓΛΛί X'AC X XX iGATAAGi X X 'A'! ( A G( AGC X iAGAATATCAT
CCACCTGTTTACCCTGACCAATCTGGGAGCCCCTGCCGCCTTCAAGTACTTTGACA
CCACCATCGACCGGAAGAGGTACACCAGCACCAAAGAGGTGCTGGACGCCACCC
TGATCCACCAGAGCATCACCGGCCTGTACGAGACACGGATCGACCTGTCTCAGCT
GGGAGGCGACAGCCCCAAGAAGAAGAGAAAGGTGGAGGCCAGCTAACATATGATT
CGAATGTCTTTCTrXGCGCTATGACACTTCCAGCAAAAGGTAGGGCG
GGCTGCGAGACGGCTTCCCGGCGCTGCATGCA, CACCGATGATGCTTCGACCCCC
( X ·ΛΛ(.ίί Ί C C '!"! ( ( X XX ΊΧ X'ATC X XX ·( ΊΧ XiA !XX C (X Ί ( C AGC XX 'GAGCi ΧΊ G
TTTAAATAGCCAGGCCCCCGATTGCAAAGACATTATAGCGAGCTACCAAAGCCAT
ATTCAAACACCTAGATCACTACCACTTCTACACAGGCCACTCGAGCTTGTGATCG CACTCCGCTAAGGGGGCGCCTCTTCCTCTTCGTTTCAGTCACAACCCGCAAACAT GACACAAGAATCCCTGTTACTTCTCGACCGTATTGATTCGGATGATTCCTACGCG
AGCCTGCGGAACGACCAGGAATTCTGGGAGGTGAGTCGACGAGCAAGCCCGGCG GATCAGGCAGCGTGCTTGCAGATTTGACTTGCAACGCCCGCAT^^
GGCTTTTGGCTCCTCTGTCGCTGTCTCAAGCAGCATCTAACCCTGCGTCGCCGTTT
<XATTTG<7\G<XGa GG<XXG<X A CX'G^
CCGGTGCTGCGGGTGCCCGGCGAGAGCACCAACCCCGTACTGGTCGGCGAGCCC
GGCCCGGTGATCAAGCTGTTCGGCGAGCACTGGTGCGGTCCGGAGAGCCTCGCG
TCGGAGTCGGAGGCGTACGCGGTCCTGGCGGACGCCCCGGTGCCGGTGCCCCGC
CTCCTCGGCCGCGGCGAGCTGCGGCCCGGCACCGGAGCCTGGCCGTGGCCCTACC
TGGTGATGAGCCGGATGACCGGCACCACCTGGCGGTCCGCGATGGACGGCACGA
CCGACCGGAACGCGCTGCTCGCCCTGGCCCGCGAACTCGGCCGGGTGCTCGGCCG
( Ί'(ί( \( AGC iGl i :X'( lX: ( XX !AAC ( ( C r i GC XX Λ('( ( ( XX ri ( ( JAC HX
TTCCCGGAACTGCTGCGGGAACGCCGCGCGGCGACCGTCGAGGACCACCGCGGG
TGGGGCTACCTCTCGCCCCGGCTGCTGGACCGCCTGGAGGACTGGCTGCCGGACG
TGGACACGCTGCTGGCCGGCCGCGAACCCCGGTTCGTCCACGGCGACCTGCACGG
GACCAACATCTTCGTGGACCTGGCCGCGACCGAGGTCACCGGGATCGTCGACTTC
ACCGACGTCTATGCGGGAGACTCCCGCTACAGCCTGGTGCAACTGCATCTCAACG
CCTTCCGGGGCGACCGCGAGATCCTGGCCGCGCTGCTCGACGGGGCGCAGTGGA
Α( 'ί !(}Λ(ΧΧ ·Λ( ::Α( ΊΊΧ Χ ( C X C iAA(l G( XX (X ί ΊΊ ('Λ(ΧΊ Γ(ΧΊ (}( Λ(
CGAGGTGTTCGAGGAGACCCCGCTGGATCTCTCCGGCTTCACCGATCCGGAGGAA
CTGGCGCAGTTCCTCTGGGGGCCGCCGGACACCGCCCCCGGCGCCTGATAAGGAT
CCGGCAAGACTGGCCCCGCTTGGCAACGCAACAGTGAGCCCCTCCCTAGTGTGTT
TGGGGATGTGACTATGTATTCGTGTGTTGGCCAACGGGTCAACCCGAACAGATTG
ATACCCGCCTTGGCATTTCCTGTCAGAATGTAACGTCAGTTGATGGTACT
[00767] For all modified Chl.amydoTn.onas reinhardtii cells, Applicants use PGR, SURVEYOR nuclease assay, and DMA sequencing to verify successful modification.
Example 25: Use ofCas9 to target a variety of disease types
[00768] Diseases that involve mutations in protein coding sequence:
[00769] Dominant disorders may be targeted by inactivating the dominant negative allele. Applicants use Cas9 to target a unique sequence in the dominant negative allele and introduce a mutation via NHEJ, The NHEJ -induced indel may be able to introduce a frame-shift mutation in the dominant negative al lele and eliminate the dominant negative protein. This may work if the gene is haplo-sufficient (e.g. MYOC mutation induced glaucoma and Huntington's disease).
[00770] Recessive disorders may be targeted by repairing the disease mutation in both alleles. For dividing ceils, Applicants use Cas9 to mtroduce double strand breaks near the mutation site and increase the rate of homologous recombination using an exogenous recombination template. For dividing cells, this may be achieved using multiplexed nickase activity to catalyze the replacement of the mutant sequence in both alleles via NHE J -mediated ligation of an exogenous DNA fragment carrying complementary overhangs.
[00771] Applicants also use Cas9 to introduce protective mutations (e.g. maetivation of CCR5 to prevent HIV infection, inactivation of PCSK.9 for cholesterol reduction, or introduction of the A673T into APP to reduce the likelihood of Alzheimer's disease).
[00772] Diseases that involve sion-eodmg sequences
[00773] Applicants use Cas9 to disrupt non-coding sequences in the promoter region, to alter transcription factor binding sites and alter enhancer or repressor elements. For example, Cas9 may be used to excise out the Kifl enhancer EHS 1 in hematopoietic stem cells to reduce BCLl la levels and reactivate fetal glob in gene expression in differentiated erythrocytes
[00774] Applicants also use Cas9 to disrupt functional motifs in the 5' or 3' untranslated regions. For example, for the treatment of myotonic dystrophy, Cas9 may be used to remove CTG repeat expansions in the DMP gene.
Example 26: Multiplexed Nickase
[00775] Aspects of optimization and the teachings of Cas9 detailed in this application may also be used to generate Cas9 nickases. Applicants use Cas9 nickases in combination with pairs of guide RNAs to generate DNA double strand breaks with defined overhangs. When two pairs of guide RNAs are used, it is possible to excise an intervening DNA fragment. If an exogenous piece of DNA. is cleaved by the two pairs of guide RNAs to generate compatible overhangs with the genomic DNA, then the exogenous DNA fragment may be Sigated into the genomic DNA to replace the excised fragment. For example, this may be used to remove trinucleotide repeat expansion in the huntintin (ΗΊ'Τ) gene to treat Huntington's Disease. [00776] If an exogenous DNA that bears fewer number of CAG repeats is provided, then it may be able to generate a fragment of DNA that bears the same overhangs and can be ligated into the HTT genomic locus and replace the excised fragment,
Ηϊΐ iocus with
fragment
excised by . . .
Figure imgf000261_0001
. .
Cas9 nickase . . fXCACTXCCC XriCTGGC TCCGCaxr∞¾CACCGAeiO:XCG. . .
and two pairs of
guide NAs
+
exogenous DNA
fragment with fewer
number of CAG repeats
also cieaved by Cas9 CGAO0CPG3AAA. r educe d n iher of CAG r epe a t s (XXXXXXO MXX:
nieakse and the C iTACCGCT ijACC TT GGCXSOGQOGG
two pairs of guide
RNAs
[00777] The ligation of the exogenous DNA fragment into the genome does not require homologous recombinatio machineries and therefore this method may be used in post -mitotic cells such as neurons.
Example 27: Delivery ofCRISPR System
[00778] Cas9 and its chimeric guide RNA, or combination of tracrRNA and crRNA, can be delivered either as DNA or RNA. Delivery of Cas9 and guide RNA both as RNA (normal or containing base or backbone modifications) molecules can be used to reduce the amount of time that Cas9 protein persist in the cell. This may reduce the level of off-target cleavage activity in the target ceil. Since delivery of Cas9 as mRNA takes time to be translated into protein, it might be advantageous to deliver the guide RNA several hours following the delivery of Cas9 mRNA, to maximize the level of guide RNA available for interactio with Cas9 protein.
[00779] In situations where guide RN A amount is limiting, it may be desirable to introduce Cas9 as mRNA and guide RNA in the form of a DNA expression cassette with a promoter driving the expression of the guide RNA. This way the amount of guide RNA available will be amplified via transcription.
[00780] A variety of delivery systems can be introduced to introduce Cas9 (DNA or RNA) and guide RNA (DNA or RNA) into the host cell. These include the use of liposomes, viral vectors, electroporation, nanoparticles , anowires (Shalek et ai., Nano Letters, 2012), exosomes. Molecular trojan horses liposomes (Pardridge et a!., Cold Spring Harb Protoc; 2010; doi: 10.110 l/pdb.prot5407) may be used to deliver Cas9 and guide RNA across the blood brain barrier.
Example 28: Therapeutic strategies for Trinucleotide repeat disorders [00781] As previously mentioned in the application, the target polynucleotide of a CRISPR complex may include a number of disease-associated genes and polynucleotides and some of these disease associated gene may belong to a set of genetic disorders referred to as Trinucleotide repeat disorders (referred to as also trinucleotide repeat expansion disorders, triplet repeat expansion disorders or codon reiteration disorders).
[00782 J These diseases are caused by mutations in which the trinucleotide repeats of certain genes exceed the normal, stable threshold which may usually differ in a gene. The discovery of more repeat expansion disorders has allowed for the classification of these disorders into a number of categories based on underlying similar characteristics. Huntington's disease (HD) and the spinocerebellar ataxias that are caused by a CAG repeat expansion in protein-coding portions of specific genes are included in Category I. Diseases or disorders with expansions that tend to make them phenotypically diverse and include expansions are usually small in magnitude and also found in exons of genes are included in Category II. Category III includes disorders or diseases which are characterized by much larger repeat expansions than either Category I or II and are generally located outside protein coding regions. Examples of Category III diseases or disorders include but are not limited to Fragile X syndrome, myotonic dystrophy, two of the spinocerebellar ataxias, juvenile myoclonic epilepsy, and Friedreich's ataxia.
[00783] Similar therapeutic strategies, like the one mentioned for Friedreich's ataxia below may be adopted to address other trinucleotide repeat or expansion disorders as well. For example, another triple repeat disease that can be treated using almost identical strategy is dystrophia myotonica 1 (DM1), where there is an expanded CTG motif in the 3' UTR. In Friedreich's ataxia, the disease results from expansion of GAA trinucleotides in the first intron of frataxin (FXN ). One therapeutic strategy using CRISPR is to excise the GAA repeat from the first intron. The expanded GAA repeat is thought to affect the DNA structure and leads to recruit the formation of heterochromatin which turn off the frataxin gene (Fig. 32A).
[00784] Competitive Advantage over other therapeutic strategies are listed below:
[00785] siRNA knockdown is not applicable in this case, as disease is due to reduced expression of frataxin. Viral gene therapy is currently being explored. HSV-1 based vectors were used to deliver the frataxin gene in animal models and have shown therapeutic effect. However, long ter efficacy of virus-based frataxin delivery suffer from several problems: First, it is difficult to regulate the expression of frataxin to match natural levels in health individuals, and second, long term over expression of frataxin leads to eel! death.
[00786] Nucleases may be used to excise the GAA repeat to restore healthy genotype, but Zmc Finger Nuclease and TALEN strategies require delivery of two pairs of high efficacy nucleases, which is difficult for both delivery as well as nuclease engineering (efficient excision of genomic DMA b ZFN or TALEN is difficult to achieve).
[00787] In contrast to above strategies, the CEJSPR-Cas system has clear advantages. The Cas9 enzyme is more efficient and more multiplexible, by which it is meant tha one or more targets cars be set at the same time. So far, efficient excision of genomic DNA > 30% by Cas9 in human cells and may be as high as 30%, and may be improved in the future. Furthermore, with regard to certain trinucleotide repeat disorders like Huntington's disease (FI D), trinucleotide repeats in the coding region may be addressed if there are differences between the two alleles. Specifically, if a HD patient is heterozygous for mutant ΗΪΤ and there are nucleotide differences such as SNPs between the wt and mutant HTT alleles, then Cas9 may be used to specifically target the mutant HTT allele. ZFN or TALENs will not have the ability to distinguish two alleles based on single base differences.
[00788] In adopting a strategy using the CRISPR-Cas 9 enzyme to address Friedreich's ataxia. Applicants design a number of guide R As targeting sites flanking the GAA expansion and the most efficient and specific ones are chosen (Fig. 32B).
[00789] Applicants deliver a combination of guide RNAs targeting die intron 1 of FXN along with Cas9 to mediate excision of the GAA expansion region, AAV9 may be used to mediate efficient delivery of Cas9 and in the spinal cord.
[00790] If the Aln element adjacent to the GAA expansion is considered important, there may be constraints to the number of sites that can be targeted but Applicants may adopt strategies to avoid disrupting it.
[00791] Alternative Strategies:
[00792] Rather than modifying the genome using Cas9, Applicants may also directly activate the FXN gene using Cas9 (nuclease activity deficient)-bascd DNA binding domain to target a transcription activation domain to the FXN gene. Applicants may have to address the robustness of the Cas9-rnediated artificial transcription activation to ensure that it is robust enough as compared to other methods (Trernbiay et ah, Transcription Activator-bike Effector Proteins 890.)
Example 29: Strategies for minimizing off-target cleavage using Cas9 nickase
[00793] As previous!)' mentioned in the application, Cas9 may be mutated to mediate single strand cleavage via one or more of the following mutations: D10A, E762A, and H840A.
[00794] To mediate gene knockout via NHEJ, Applicants use a nickase version of Cas9 along with two guide RNAs. Off-target nicking by each individual guide RNA may be primarily repaired without mutation, double strand breaks (which can lead to mutations via NHEJ) only occur when the target sites are adjacent to each other. Since double strand breaks introduced by double nicking are not blunt, co-expression of end-processing enzymes such as TREXl will increase the level of NHEJ activity.
[00795] The following list of targets in tabular form are for genes involved in the following diseases:
[00796] Lafora's Disease - target GSY1 or PPP1R3C (PTG) to reduce glycogen in neurons.
[00797] Hypercholesterolemia - target PCSK9
[00798] Target sequences are listed in pairs (L and R) with different number of nucleotides in the spacer (0 to 3bp). Each spacer .may also be used by itself with the wild type Cas9 to introduce double strand break at the target locus.
GYS1 (human) GGCC-L ACCCTTGTTAGCCACCTCCC
GGCC-R GAACGCAGTGCTCTTCGAAG
GGNCC-L CTCACGCCCTGCTCCGTGTA
GGNCC-R GGCGACAACTACTTCCTGGT
GGNNGC-L CTCACGCCCTGCTCCGTGTA
GGNNCC-R GGGCGACAACTACTTCCTGG
GGNNNCG-
L CCTCTTCAGGGCCGGGGTGG
GGNNNCC- R GAGGACCCAGGTGGAACTGC
PCSK9 (human) GGCC-L TCAGCTCCAGGCGGTCCTGG
GGCC-R AGCAGCAGCAGCAGTGGCAG
GGNCC-L TGGGCACCGTCAGCTCCAGG
GGNCC-R CAGCAGTGGCAGCGGCCACC
GGNNCC-L ACCTCTCCCCTGGCCCTCAT
GGNNCC-R
Figure imgf000264_0001
GGNNNCC-
L CCGTCAGCTCCAGGCGGTCC GGNNNCC- R AGCAGCAGCAGCAGTGGCAG
PPP1 R3C (PTG) (human) GGCC-L ATGTGCCAAGCAAAGCCTCA
GGCC-R TTCGGTCATGCCCGTGGATG
GGNCC-L GTCGTTGAAATTCATCGTAC
GGNCC-R ACCACCTGTGAAGAGTTTCC
GGNNCC-L CGTCGTTGAAATTCATCGTA
GGNNCC-R ACCACCTGTGAAGAGTTTCC
Gys1 (mouse) GGCC-L GAACGCAGTGCTTTTCGAGG
GGCC-R ACCCTTGTTGGCCACCTCCC
GGNCC-L GGTGACAACTACTATCTGGT
GGNCC-R CTCACACCCTGCTCCGTGTA
GGNNCC-L G G GTG AC AACTACTATCTG G
GGNNCC-R CTCACACCCTGCTCCGTGTA
GGNNNCC-
L CGAGAACGCAGTGCTTTTCG
GGNNNCC- R ACCCTTGTTGGCCACCTCCC
PPP1 R3C (PTG) (mouse) GGCC-L ATGAGCCAAGCAAATCCTCA
GGCC-R TTCCGTCATGCCCGTGGACA
GGNCC-L CTTCGTTGAAAACCATTGTA
GGNCC-R CCACCTCTGAAGAGTTTCCT
GGNNCC-L CTTCGTTGAAAACCATTGTA
GGNNCC-R ACCACCTGTGAAGAGTTTCC
GGNNNCC-
L CTTCCACTCACTCTGCGATT
GGNNNCC- R ACCATGTCTCAGTGTCAAGC
PCSK9 (mouse) GGCC-L GGCGGCAACAGCGGCAACAG
ACTGCTCTGCGTGGCTGCGG
GGNNCC-L CCGCAGCCACGCAGAGCAGT GGNNCC-R GCACCTCTCCTCGCCCCGAT
Alternative strategies for improving stability of guide RNA and increasing specificity [00800] 1 , Nucleotides in the 5' of the guide RNA may be linked via thiolester linkages rather than phosphoester linkage like in natural RNA. Thiolester linkage may prevent the guide RNA from being digested by endogenous RNA degradation machinery,
[00801 J 2. Nucleotides in the guide sequence (5' 20bp) of the guide RNA can use bridged nucleic acids (BNA) as the bases to improve the binding specificity.
Example 30: CRISPR-Cas for rapid, multiplex genome editing [00802] Aspects of the invention relate to protocols and methods by which efficiency and specificity of gene modification may be tested within 3-4 days after target design, and modified clonal ceil lines may be derived within 2-3 weeks.
[00803] Programmable nucleases are powerful technologies for mediating genome alteration with high precision. The RNA-guided Cas9 nuclease from the microbial CRISPR adaptive immune system can be used to facilitate efficient genome editing in eukaryotic cells by simply specifying a 20-nt targeting sequence in its guide RNA. Applicants describe a set of protocols for applying Cas9 to facilitate efficient genome editing in mammalian cells and generate cell lines for downstream functional studies. Beginning with target design, efficient and specific gene modification can be achieved within 3-4 days, and modified clonal cell lines can be derived within 2-3 weeks.
[00804] The ability to engineer biological systems and organisms holds enormous potential for applications across basic science, medicine, and biotechnology. Programmable sequence- specific endonucleases that facilitate precise editing of endogenous genomic loci are now enabling systematic interrogation of genetic elements and causal genetic variations in a broad range of species, including those that have not been genetically tractable previously. A number of genome editing technologies have emerged in recent years, including zinc finger nucleases (ZFNs), transcription activator-like effector nucleases (TALENs), and the RNA-guided CRISPR- Cas nuclease system. The first two technologies use a common strategy of tethering endonuclease catalytic domains to modular DNA-binding proteins for inducing targeted DNA double stranded breaks (DSB) at specific genomic loci. By contrast, Cas9 is a nuclease guided by small RNAs through Watson-Crick base-pairing with target DNA, presenting a system that is easy to design, efficient, and well-suited for high-throughput and multiplexed gene editing for a variety of cell types and organisms. Here Applicants describe a set of protocols for applying the recently developed Cas9 nuclease to facilitate efficient genome editing in mammalian cells and generate cell lines for downstream functional studies.
[00805] Like ZFNs and TALENs, Cas9 promotes genome editing by stimulating DSB at the target genomic loci. Upon cleavage by Cas9, the target locus undergoes one of two major pathways for DNA damage repair, the error-prone non-homologous end joining (NHEJ) or the high-fidelity homology directed repair (HDR) pathway. Both pathways may be utilized to achieve the desired editing outcome. [00806] NHEJ: In the absence of a repair template, the NHEJ process re-ligates DSBs, which may leave a scar in the form of indel mutations. This process can be harnessed to achieve gene knockouts, as indeis occurring within a coding exon may lead to frameshift mutations and a premature stop codon. Multiple DSBs may also be exploited to mediate larger deletions in the genome.
[00807] HDR: Homology directed repair is an alternate major DNA repair pathway to NHEJ. Although HDR typically occurs at lower frequencies than NHEJ, it may be harnessed to generate precise, defined modifications at a target locus in the presence of an exogenously introduced repair template. The repair template may be either in the form of double stranded DNA, designed similarly to conventional DNA targeting constructs with homology amis flanking the insertion sequence, or single-stranded DNA oligonucleotides (ssODNs). The latter provides an effective and simple method for making small edits in the genome, such as the introduction of single nucleotide mutations for probing causal genetic variations. Unlike NHEJ, HDR is generally active only in dividing cells and its efficiency varies depending on the cell type and state.
[00808] Overview of CR.1SPR: The CRISPR-Cas system, by contrast, is at minimum a two- component system consisting of the Cas9 nuclease and a short guide RNA. Re-targeting of Cas9 to different loci or simultaneous editing of multiple genes simply requires cloning a different 20- bp oligonucleotide. Although specificity of the Cas9 nuclease has yet to be thoroughly elucidated, the simple Watson-Crick base-pairing of the CRISPR-Cas system is likely more predictable than that of ZFN or TA.LEN domains.
[00809] The type II CRISPR-Cas (clustered regularly interspaced short palindromic repeats) is a bacterial adaptive immune system that uses Cas9, to cleave foreign genetic elements. Cas9 is guided by a pair of non-coding RNAs, a variable crRNA and a required auxiliary tracrRNA. The crRNA contains a 20-nt guide sequence determines specificity by locating the target DNA via Watson-Crick base-pairing. In the native bacterial system, multiple crR As are co-transcribed to direct Cas9 against various targets. In the CRISPR-Cas system derived from Streptococcus pyogenes, the target DNA must immediately precede a 5'-NGG NRG protospacer adjacent motif (PAM), which can vary for other CRISPR systems.
[00810] CRISPR-Cas is reconstituted in mammalian cells through the heterologous expression of human codon-optimized Cas9 and the requisite RNA components. Furthermore, the crRNA and tracrRNA can be fused to create a chimeric, synthetic guide RNA (sgRNA). Cas9 can thus be re-directed toward any target of interest by altermg the 20-nt guide sequence within the sgRNA.
[00811] Given its ease of implementation and multiplex capability, Cas9 has been used to generate engineered eukaryotic cells carrying specific mutations via both NHEJ and HDR. In addition, direct i jectio of sgRNA and mRNA encoding Cas9 into embryos has enabled the rapid generation of transgenic mice with multiple modified alleles; these results hold promise for editing organisms that are otherwise genetically intractable.
[00812] A mutant Cas9 carrying a disruption in one of its catalytic domains has been engineered to nick rather than cleave DNA, allowing for single-stranded breaks and preferential repair through HDR., potentially ameliorating unwanted indel mutations from off-target DSBs. Additional ly, a Cas9 mutant with both DNA-cleaving catalytic residues mutated has been adapted to enable transcriptional regulation in E. coli, demonstrating the potential of funetionalizing Cas9 for diverse applications. Certain aspects of the invention relate to the construction and application of Cas9 for multiplexed editing of human cells.
[00813] Applicants have provided a human codon-optimized, nuclear localization sequence- flanked Cas9 to facilitate eukaryotic gene editing. Applicants describe considerations for designing the 20-nt guide sequence, protocols for rapid construction and functional validation of sgR As, and finally use of the Cas9 nuclease to mediate both NHEJ- and HDR-based genome modifications in human embryonic kidney (HE -293FT) and human stem ceil (HUES9) lines. This protocol can likewise be applied to other cell types and organisms.
[00814] Target selection for sgRNA: There are two main considerations in the selection of the 20-nt guide sequence for gene targeting: 1 ) the target sequence should precede the 5'- GG PAM for S. pyogenes Cas9, and 2) guide sequences should be chosen to minimize off-target activity. Applicants provided an online Cas9 targeting design tool that takes an input sequence of interest and identifies suitable target sites. To experimentally assess off-target modifications for each sgRNA, Applicants also provide computationally predicted off-target sites for each intended target, ranked according to Applicants' quantitative specificity analysis on the effects of base- pairing mismatch identity, position, and distribution.
[00815] The detailed information on computationally predicted off-target sites is as follows:
[00816] Considerations for Off-target Cleavage Activities: Similar to other nucleases, Cas9 can cleave off-target DNA targets in the genome at reduced frequencies. The extent to which a given guide sequence exhibit off-target activity depends on a combination of factors including enzyme concentration, thermodynamics of the specific guide sequence employed, and the abundance of similar sequences in the target genome. For routine application of Cas9, it is important to consider ways to minimize the degree of off-target cleavage and also to be able to detect the presence of off -target cleavage.
[00817] Minimizing off-target activity: For application in cel l lines, Applicants recommend following two steps to reduce the degree of off-target genome modification. First, using our online CRISPR target selection tool, it is possible to computationally assess the likelihood of a given guide sequence to have off-target sites. These analyses are performed through an exhaustive search in the genome for off-target sequences that are similar sequences as the guide sequence. Comprehensi ve experimental investi gation of the effect of mismatching bases between the sgRNA and its target DNA revealed that mismatch tolerance is 1) position dependent - the 8- 14 bp on the 3' end of the guide sequence are less tolerant of mismatches than the 5' bases, 2) quantity dependent - in general more than 3 mismatches are not tolerated, 3) guide sequence dependent - some guide sequences are less tolerant of mismatches than others, and 4) concentration dependent - off-target cleavage is highly sensitive to the amount of transfected DNA. The Applicants' target site analysis web tool (available at the website genome- engineering.org/tools) integrates these criteria to provide predictions for likely off-target sites in the target genome. Second, Applicants recommend titrating the amount of Cas9 and sgRNA expression plasmid to minimize off-target activity.
[00818] Detection of off-target activities: Using Applicants' CRISPR targeting web tool, it is possible to generate a list of most likely off-target sites as well as primers performing SURVEYOR or sequencing analysis of those sites. For isogenic clones generated using Cas9, Applicants strongly recommend sequencing these candidate off-target sites to check for any undcsircd mutations. It is worth noting that there may be off target modifications in sites that are not included in the predicted candidate list and full genome sequence should be performed to completely verify the absence of off-target sites. Furthermore, in multiplex assays where several DSBs are induced within the same genome, there may be low rates of translocation events and can be evaluated using a variety of techniques such as deep sequencing.
[00819] The online tool provides the sequences for ail oiigos and primers necessary for 1) preparing the sgRNA constructs, 2) assaying target modification efficiency, and 3) assessing cleavage at potential off-target sites. It is worth noting that because the U6 RNA polymerase III promoter used to express the sgRNA prefers a guanine (G) nucleotide as the first base of its transcript, an extra G is appended at the 5 ' of the sgRNA where the 20-nt guide sequence does not begin with G.
[00820] Approaches for sgRNA construction and delivery: Depending on the desired application, sgRNA s may be delivered as either 1) PGR am pi icons containing an expression cassette or 2) sgRNA-expressing plasmids. PCR-based sgRNA delivery appends the custom sgRNA sequence onto the reverse PGR primer used to amplify a U6 promoter template. The resulting amp {icon may be co-transfected with a piasmid containing Cas9 (PX165). This method is optimal for rapid screening of multiple candidate sgRNAs, as cell transfections for functional testing can be performed mere hours after obtaining the sgRNA-encoding primers. Because this simple method obviates the need for plasmid-based cloning and sequence verification, it is well suited for testing or co-transfecting a large number of sgRNAs for generating large knockout libraries or other scale-sensitive applications. Note that the sgRNA-encoding primers are over IGO-bp, compared to the ~20-bp oligos required for plasmid-based sgRNA delivery.
[00821] Construction of an expression piasmid for sgRNA is also simple and rapid, involving a single cloning step with a pair of partially complementary oligonucleotides. After annealing the oligo pairs, the resulting guide sequences may be inserted into a piasmid bearing both Cas9 and an invariant scaffold bearing the remainder of the sgRNA sequence (PX330). The transfection plasmids may also be modified to enable virus production for in vivo deliver}'.
[00822] In addition to PGR and plasmid-based delivery methods, both Cas9 and sgRNA can be introduced into cel ls as RNA.
[00823] Design of repair template: Traditionally, targeted DNA modifications have required use of plasmid-based donor repair templates that contain homology arms flanking the site of alteration. The homology arms on each side can vary in length, but are typically longer than 500 bp. This method can be used to generate large modifications, including insertion of reporter genes such as fluorescent proteins or antibiotic resistance markers. The design and construction of targeting plasmids has been described elsewhere.
[00824] More recently, single-stranded DNA oligonucleotides (ssODNs) have been used in place of targeting plasmids for short modifications within a defined locus without cloning. To achieve high HDR efficiencies, ssODNs contain flanking sequences of at least 40 bp on each side that are homologous to the target region, and can be oriented in either the sense or antisense direction relative to the target locus.
[00825] Functional testing
[00826] SURVEYOR nuclease assay: Applicants detected irsdel mutations either by the SURVEYOR nuclease assay (or PGR amplicon sequencing. Applicants online CRISPR target design tool provides recommended primers for both approaches. However, SURVEYOR or sequencing primers may also be designed manually to amplify the region of interest from genomic DNA and to avoid non-specific amplicons using NCBl Primer-BLAST. SURVEYOR primers should be designed to amplify 300-400 bp (for a 600-800 bp total amplicon) on either side of the Cas9 target for allowing clear visualization of cleavage bands by gel electrophoresis. To prevent excessive primer dimer formation, SURVEYOR primers should be designed to be typically under 25-nt long with melting temperatures of ~60°C. Applicants recommend testing each pair of candidate primers for specific PGR amplicons as wel l as for the absence of nonspecific cleavage during the SURVEYOR nuclease digestion process.
[00827] Plasmid- or ssODN-mediated HDR: HDR can be detected via PCR-amplification and sequencing of the modified region. PGR primers for this purpose should anneal outside the region spanned by the homology arms to avoid false detection of residual repair template (HDR Fwd and Rev, Fig. 30). For ssODN-mediated HDR, SURVEYOR PGR primers can be used.
[00828] Detection of indeis or HDR by sequencing: Applicants detected targeted genome modifications by either Sanger or next-generation deep sequencing (NGS). For the former, genomic DNA from modified region can be amplified using either SURVEYOR or HDR primers. Amplicons should be subcioned into a plasmid such as pUC19 for transformation; individual colonies can be sequenced to reveal clonal genotype.
[00829] Applicants designed next-generation sequencing (NGS) primers for shorter amplicons, typically in the 100-200 bp size range. For detecting NHEJ mutations, it is important to design primers with at least 10-20 bp between the priming regions and the Cas9 target site to allow detection of longer indeis. Applicants provide guidelines for a two-step PGR method to attach barcoded adapters for multiplex deep sequencing. Applicants recommend the IUumina platform, due to its generally low levels of false positive indeis. Off-target analysis (described previously) can then be performed through read alignment programs such as ClustalW, Geneious, or simple sequence analysis scripts. [00830] Materials and Reagents
10Θ831 ] sgRNA preparation :
UltraPure DNaseRNase-free distilled water (Life Technologies, cat. no. 10977-023)
Herculase II fusion polymerase (Agilent Technologies, eat. no. 600679)
CRITICAL. Standard Taq polymerase, which lacks 3 '-5' exonuclease proofreading activity, has lower fidelity and can lead to amplification errors. Herculase II is a high-fidelity polymerase (equivalent fidelity to Pfii) that produces high yields of PGR product with minimal optimization. Other high-fidelity polymerases .may be substituted.
Herculase II reaction buffer (5x; Agilent Technologies, included with polymerase) dNTP solution mix (25 mM each; Enzymatics, cat. no. N205L)
MgC12 (25mM; ThermoScientific, cat, no. R0971 )
QIAquick gel extraction kit (Qiagen, cat, no. 28704)
QIAprep spin mini prep kit (Qiagen, cat. no. 27106)
UltraPure TBE buffer flOX; Life Technologies, cat. no. 15581-028)
SeaKem LE agarose (Lonza, cat. no. 50004)
SYBR Safe DNA stain (10,000x; Life Technologies, cat. no. S33102)
1-kb Plus DNA ladder (Life Technologies, cat. no. 10787-018)
Tracklt CyanOrange loading buffer (Life Technologies, cat. no. 10482-028) FastDigest Bbsl (Bpil) (Fermentas/ThermoScieiitific, cat, no. FD1014)
Fermentas Tango Buffer (Fermentas/ThermoScieiitific, cat. no. BY5)
DL-dithiothreitoi (DTT; Feimentas/TliermoScieiitific, cat, no. R0862)
T7 DNA ligase (Enzymatics, cat. no. L602L)
Critical: Do not substitute the more commonly used T4 ligase. T7 ligase has 1 ,000- fold higher activity on the sticky ends than on the blunt ends and higher overall activity than commercially available concentrated T4 ligases.
T7 2X Rapid Ligation Buffer (included with T7 DNA ligase, Enzymatics, cat. no,
L602L)
T4 Poly ucleotide Kinase (New England Bioiabs, cat. o M0201S)
T4 DNA Ligase Reaction Buffer (lOX; New England Bioiabs, cat. no B0202S) Ade osine 5 '-triphosphate (10 mM; New England Bioiabs, cat. no. P0756S) PlasmidSafe ATP-dependent DNase (Epicentre, cat. no. E3101 ) One Shot Stbl3 chemically competent Escherichia coli (E, coii) (Life Technologies, cat. no. C7373-03)
SOC medium (New England Biolabs, cat, no. B9020S)
LB medium (Sigma, cat. no. L3022)
LB agar medium (Sigma, cat. no. L2897)
Ampicillin, sterile filtered (100 mg ml-T; Sigma, cat. no. A5354)
0Θ832] Mammalian cell culture:
HEK293FT cells (Life Technologies, cat. no. R700-07)
Dulbecco's minimum Eagle's medium (DMEM, IX, high glucose; Life Technologies, cat. no. 10313-039)
Dulbecco's minimum Eagle's medium (DM EM, IX, high glucose, no phenol red; Life Technologies, cat. no. 31053-028)
Dulbecco's phosphate-buffered saline (DPBS, I X; Life Technologies, cat, no. 14190-
250)
Fetal bovine serum, qualified and heat inactivated (Life Technologies, cat. no. 10438-
034)
Opti-MEM I reduced-serum medium (FBS; Life Technologies, cat. no. 11058-021) Penicillin-streptomycin (lOOx; Life Technologies, cat. no. 15140-163)
TrypLE™ Express (IX, no Phenol Red; Life Technologies, cat. no. 12604-013) Lipofectamine 2000 transfection reagent (Life Technologies, cat. no. 11668027) Amaxa SF Cell Line 4D-Nucleofector® X Kit S (32 RCT; Lonza, cat. no V4XC-
2032)
HUES 9 cell line (HARVARD STEM CELL SCIENCE)
Geltrex LDEV-Free Reduced Growth Factor Basement Membrane Matrix (Life Technologies, cat. no. Λ 14132 1 }
mTeSRl medium (Stemcell Technologies, cat. no. 05850)
Accutase cell detachment solution (Stemcell Technologies, cat. no. 07920)
ROCK Inhibitor (Y-27632; Millipore, cat. no. SCM075)
Amaxa P3 Primary Cell 4D-Nucleofector® X Kit S (32 RCT; Lonza cat, no. V4XP-
3032)
[00833] Genotyping analysis: QuickExtract DNA extraction solution (Epicentre, cat. no. QE09050)
PCR primers for SURVEYOR, RFLP analysis, or sequencing (see Primer table)
Herculase II fusion polymerase (Agilent Technologies, cat. no. 600679)
CRITICAL. As Surveyor assay is sensitive to single-base mismatches, it is particularly important to use a high-fidelity polymerase. Other high-fidelity polymerases may be substituted.
Herculase II reaction buffer (5x; Agilent Technologies, included with polymerase) dNTP solution mix (25 m_M each; Enzymatics, cat. no. N205L)
QIAquick gel extraction kit (Qiagcn, cat. no. 28704)
Taq Buffer (lOx; Genscript, cat. no. B0005)
SURVEYOR mutation detection kit for standard gel electrophoresis (Transgenomic, cat. no. 706025)
UltraPure TBE buffer (lOx; Life Technologies, cat. no. 15581-028)
SeaKem LE agarose (Lonza, cat. no. 50004)
4-20% TBE Gels 1.0 mm, 15 Well (Life Technologies, cat. no. EC62255BOX) Novex® Hi-Density TBE Sample Buffer (5X; Life Technologies, cat. no. LC6678) SYBR Gold Nucleic Acid Gel Stain (10,000X; Life Technologies, cat. no. S-11494) 1-kb Plus DNA ladder (Life Technologies, cat. no. 10787-018)
Tracklt CyanQrange loading buffer (Life Technologies, cat. no. 10482-028) FastDigest Hindi II (Fermentas/ThennoSeientific, cat, no. FD0504)
0Θ834] Equipment
Filtered sterile pipette tips (Corning)
Standard 1.5ml microcentrifuge tubes (Eppendorf, cat. no. 0030 125.150)
Axygen 96-well PCR plates (VWR, cat. no. PCR-96M2-HSC)
Axygen 8-Strip PCR tubes (Fischer Scientific, cat. no. 14-222-250)
Falcon tubes, polypropylene, 15 ml (BD Falcon, cat, no. 352097)
Falcon tubes, polypropylene, 50 ml (BD Falcon, cat, no. 352070}
Round-bottom Tube with cell strainer cap, 5ml (BD Falcon, cat. no. 352235)
Petri dishes (60 mm x 15 mm; BD Biosciences, cat. no. 351007)
Tissue culture plate (24 well; BD Falcon, cat. no, 353047)
Tissue culture plate (96 well, flat bottom; BD Falcon, cat. no, 353075) 96-well thermocycler with programmable temperature stepping functionality (Applied Biosystems Veriti, cat, no. 4375786).
Desktop microcentrifuges 5424, 5804 (Eppersdorf)
Gel electrophoresis system (PowcrPac basic power supply, Bio-Rad, cat. no. 164- 5050, and Sub-Ceil GT System gel tray, Bio-Rad, cat. no. 170-4401)
Novex XCell SureLock Mini-Ceil (Life Technologies, cat. no. EI0001)
Digital gel imaging system (GefDoc EZ, Bio-Rad, cat. no. 170-8270, and blue sample tray, Bio-Rad, cat. no. 170-8273)
Blue light transillumirsator and orange filter goggles (Safelmager 2,0; mvitrogen, cat. no. G6600)
Gel quantification software (Bio-Rad, ImageLab, included with GeiDoc EZ,or open- source Image! from the National Institutes of Health, available at the website rsbweb.nih.gov/ij/) UV spectrophotometer (NanoDrop 2000c, Thermo Scientific)
[00835 j Reagesit Setup
[00836] Tris-borate EDTA (TBE) electrophoresis solution Dilute TBE buffer in distilled water to I X working solution for casting agarose gels and for use as a buffer for gel electrophoresis. Buffer may be stored at room temperature (18 - 22 °C) for at least 1 year.
[008371 4 ATP, 10 niM Divide 10 mM ATP into 50-μ1 aliquots and store at - 20 °C for up to 1 year; avoid repeated freeze-thaw cycles.
[00838] · DTT, 10 mM Prepare 10 mM DTT solution in distilled water and store in 20-!.· 1 aliquots at - 70 °C for up to 2 years; for each reaction, use a new aliquot, as DTT is easily oxidized.
[00839] · D10 culture medium For culture of HEK293FT cells, prepare D10 culture medium by supplementing DMEM with IX GlutaMAX and 10% (vol/vol) fetal bovine serum. As indicated in the protocol, this medium can also be supplemented with I X penicillin- streptomycin , D10 medium can be made in advance and stored at 4 °C for up to 1 month,
[00840] · mTeSRl culture medium For culture of human embryonic stem cells, prepare mTeSRl medium by supplementing the 5X supplement (included with mTeSRl basal medium), and 100 ug/ml Normocin. [00841] Procedure
[00842] Design of targeting components and use of the online tool * Timing 1 d
[00843] 1 j I put target genomic DNA sequence. Applicants provide an o line Cas9 targeting design tool that takes an input sequence of interest, identifies and ranks suitable target sites, and computationally predicts off-target sites for each intended target. Alternatively, one can manually select guide sequence by identifying the 20-bp sequence directly upstream of any 5'-
NGG.
[00844] 2j Order necessary oligos and primers as specified by the online tool. If the site is chosen manually, the oligos and primers should be designed.
[00845] Preparation of sgRNA. expression construct
[00846] 31 To generate the sgRNA expression construct, either the PGR- or piasmid-based protocol can be used.
[00847] (A) via PGR amplification · Timing 2 h
[00848] (i) Applicants prepare diluted U6 PGR template. Applica ts recommend using PX330 as a PGR. template, but any U6-containing plasmid may likewise be used as the PGR template. Applicants diluted template with ddH^O to a concentration of 10 ng'ui. Note that if a plasmid or cassette already containing an U6-driven sgRNA is used as a template, a gel extraction needs to be performed to ensure that the product contains only the intended sgRN A and no trace sgRNA carryover from template.
[00849] (ii) Applicants prepared diluted PGR oligos. U6-Fwd and U6-sgRNA-Rev primers are diluted to a final concentration of 10 uM in dd¾0 (add 10 ul of 100 uM primer to 90 ui ddH20).
[00850] (iii) U6-sgRNA PGR reaction. Applicants set up the following reaction for each U6~ sgRNA -Rev primer and mastermix as needed:
Component: Amount (ul) Final concentration
Flercuiase II PGR buffer, 5X 10 IX
dNTP, 100m VI (25mM each) 0.5 1 m
U6 template (PX330) I 0.2 iig/ul
U6~Fwd primer 1 0.2 uM
U6-sgRNA-Rev primer (variable) 1 0.2 uM
Flercuiase 11 Fusion polymerase 0.5 Distilled water
Total 50
[00851] (iv) Applicants performed PGR reaction on the reactions from step (iii) using the fo [lowing cycling conditions:
Cycle number Denature Anneal Extend
1 95°C, 2 m
2-31 95°C, 20 s 60°C, 20 s 72°C, 20 s
32 72°C, 3 m
[00852] (v) After the reaction is completed, Applicants ran the product on a gel to verify successful, single-band amplification. Cast a 2% (wt vol) agarose gel in I X TBE buffer with I X SYBR Safe dye. Run 5 ul of the PGR product in the gel at 15 V cm-1 for 20-30 min. Successful amplicons should yield one single 370-bp product and the template should be invisible. It should not be necessary to gel extract the PGR amplicon.
[00853] (vi) Applicants purified the PGR product using the QIAquick PGR purification kit according to the manufacturer's directions. Elute the DNA in 35 ul of Buffer EB or water. Purified PGR products may be stored at 4°C or -20°C.
[00854] (B) Cloning sgRNA Into Cas9-coniaiiiiiig Meistronie expression vector * Timing 3 d
[00855] (i) Prepare the sgRNA oligo inserts. Applicants resuspended the top and bottom strands of oligos for each sgRN A design to a final concentration of 100 uM. Phosphorylate and anneal the oligo as follows:
Oligo 1 (100 uM) 1 ul
Oligo 2 (100 uM) l l
T4 Ligation Buffer, I OX 1 ul
1 4 FN 1 ul
ddL¾0 6. ul
Total 10 ul
[00856] (ii) An eal in a themiocycler using the following parameters:
Figure imgf000277_0001
[00858] 95°C for 5 m
[00859] Ramp down to 25°C a 5°C per m [00860] (in) Applicants diluted phosphorylated. and annealed oligos 1 :200 by add lul of oligo to 199 ul room temperature ddH20.
[00861] (iv) Clone sgRNA oligo into PX330. Applicants set up Golden Gate reaction for each sgRNA. Applicants recommend also setting up a no-insert, PX330 only negative control.
PX330 (100 ng) x ul
Diluted oligo duplex from step (iii) 2 ul
Tango Buffer, 1 OX 2 ul
DTT, lOmM 1 ul
ATP, lOmM 1 ul
FasiDigest Bbsl 1 ul
T7 Ligase 0.5 ul
dd¾Q x ul
Total 20 ul
[00862] (v) Incubate the Golden Gate reaction for a total of 1 h:
[00863] Cycle number Condition
[00864] 1 -6 37°C for 5 m, 21°C for 5 m
[00865] (vi) Applicants treated Golden Gate reaction with. PlasmidSafe exonuclease to digest any residual linearized DNA. This step is optional but highly recommended.
Golden Gate reaction from step 4 I I ul
.1 OX PlasmidSafe Buffer 1 ,5 ul
ATP, 10 mM 1.5 ul
PJagrojdjSa^^ .11 ul
[00866] Total 15 ul
[00867] (vii) Applicants incubated the PlasmidSafe reaction at 37°C for 30 min, followed by inactivation at 70°C for 30 min. Pa se point: after completion, the reaction may be frozen and continued later. The circular DNA should be stable for at least 1 week.
[00868] (viii) Transformation. Applicants transformed the PlasmidSafe-treated plasmid into a competent E. coli strain, according to the protocol supplied with the ceils. Applicants recommend Stbl.3 for quick transformation. Briefly, Applicants added 5ul of the product from step (vii) into 20ul of ice-cold chemically competent Stbl3 ceils. This is then incubated on ice for 10 m, heat shocked at 42°C for 30 s, returned immediately to ice for 2 m, 100 ul of SOC medium is added, and this is plated onto an LB plate containing 100 ug-'ml ampicilim with incubation overnight at 37°C.
[00869] (ix) Day 2: Applicants inspected plates for colony growth. Typically, there are no colonies on the negative control plates (ligation of Bbsl -digested PX33Q only, no annealed sgRNA oligo), and tens to hundreds of colonies on the PX330-sgRNA cloni g plates.
[0087Q] (x) From each plate, Applicants picked 2-3 colonies to check correct insertion of sgRNA. Applicants used a sterile pipette tip to inoculate a single colony into a 3 ml culture of
LB medium with 100 ug/ml ampiciilin. Incubate and shake at 37°C overnight.
[00871] (xi) Day 3: Applicants isolated plasmid DNA from overnight cultures using a
QiAprep Spin miniprep kit according to the manufacturer's instructions.
[00872] (xii) Sequence validate CRISPR plasmid. Applicants verified the sequence of each colony by sequencing from the U6 promoter using the U6-Fwd primer. Optional: sequence the
Cas9 gene using primers listed in the following Primer table.
Figure imgf000279_0001
CTGGCCAGGCCCCTGCGTGGGCCCAAGCTGGACTCTGG
CCACTCCCT
AGGGAGTGGCCAGAGTCCAGCTTGGGCCCACGCAGGGG CCTGGCCAGCAGCAAGCAGCACTCTGCCCTCGTG
GGTTTGTGGTTGCCCACCGCTAGCAAGCTTGTCATTGGA EMX1 HDR
GGTGACATCGATGTCCTCCCCATTGGCCTGCTTCG (anti sense; ssODN- TGGCAATGCGCCACCGGTTGATGTGATGGGAGCCCTTC msertion antiscnse TTCTTCTG underlined)
EMX 1
SURVEYOR
EMX1- assay PCR, SURV-F CCATCCCCTTCTGTGAATGT sequencing
EMX 1
SURVEYOR
EMX1- assay PCR, SURV-R GGAGATTGGAGACACGGAGA sequencing
EMX 1 RFLP
EMX1- analysis PCR,
HDR-F GGCTCCCTGGGTTCAAAGTA sequencing
EMX1 RFLP
EMX1- analysis PCR, HDR-R AGAGGGGTCTGGATGTCGTAA. sequencing pUC19 multiple cloning site F primer, for Sanger pUC 19-F CGCCAGGGTTTTCCCAGTCACGAC sequencing
Applicants referenced the sequencing results against the PX330 cloning vector sequence to check that the 20 bp guide sequence was inserted between the U6 promoter and the remainder of the sgRNA scaffold. Details and sequence of the PX330 map in GenBank vector map format (*.gb file) can be found at the website crispr.genome-engineering.org.
[00874] (Optional) Design of ssODN template * Timing 3 d p!annmg ahead
[008751 3j Design and order ssODN. Either the sense or antisense ssODN can be purchased directly from supplier. Applicants recommend designing homology arms of at least 40 bp on either side and 90 bp for optimal HDR efficiency. In Applicants' experience, antisense oligos have slightly higher modification efficiencies.
[00876] 4j Applicants resuspended and dihited ssODN ultraniers to a final concentration of 10 uM. Do not combine or anneal the sense and antisense ssOD s. Store at -20°C. [00877] 5j Note for HDR applications, Applicants recommend cloning sgRNA into the PX330 plasmid.
[0Θ878] Fiisictloiial validation of sgRNAs: cell culture and transfectlons β Timing 3-4 d [00879] The CRISP -Cas system has been used in a number of mammalian cel l lines. Conditions may vary for each ceil line. The protocols below details transfection conditions for HEK239FT cells. Note for ssOD -mediated HDR transfectiorts, the Amaxa SF Cell Line Nucieofector Kit is used for optimal deliver}7 of ssODNs. This is described in the next section.
[00880] 7| HEK293FT maintenance. Cells are maintained according to the manufacturer's recommendations. Briefly, Applicants cultured cells in D10 medium (GlutaMax DM EM supplemented with 10% Fetal Bovine Serum), at 37°C and 5% C02.
[00881] 8| To passage, Applicants removed medium and rinsed once by gently adding DPBS to side of vessel, so as not to dislodge cells. Applicants added 2 mi of TrypLE to a T75 flask and incubated for 5 m at 37°C. 10 ml of warm D10 medium is added to inactivate and transferred to a 50 ml Falcon tube. Applicants dissociated cells by triturating gently, and re-seeded new flasks as necessary. Applicants typically passage cells every 2-3 d at a split ratio of 1 :4 or 1 :8, never allowing cells to reach more than 70% conflueney. Cell lines are restarted upon reaching passage number 15.
[00882] 9| Prepare ceils for transfection. Applicants plated well-dissociated cells onto 24-well plates in D10 medium without antibiotics 16-24 h before transfection at a seeding density of 1.3 x ] (Ϋ cells per well and a seeding volume of 500 ul. Scale up or down according to the manufacturer's manual as needed. It is suggested to not plate more ceils than recommended density as doing so may reduce transfection efficiency.
[00883] lOj On the day of transfection, cells are optimal at 70-90% conflueney. Cells may be transfected with Lipofectamine 2000 or Amaxa SF Cell Line Nucieofector Kit according to the manufacturer ' protocols.
[00884] (A) For sgRNAs cloned into PX330, Applicants transfected 500 ng of sequence- verified CRISPR plasmid; if transfeeting more than one plasmid, mix at equimolar ratio and no more than 500 ng total,
[00885] (B) For sgRNA amplified by PGR, Applicants mixed the fol lowing:
PX165 (Cas9 only) 200 ng
sgRNA amplicon (each) 40 ng pUC 19 fill up total DNA to 500 ng
[00886] Applicants recommend transfeeting in technical triplicates for reliable quantification and including transfection controls (e.g. GFP plasmid) to monitor transfection efficiency. I addition, PX330 cloning plasmid and/or sg A amplieon may be transfected alone as a negative control for downstream functional assays.
[00887] 1 1 1 Applicants added Lipofectaniine comple to cells gently as HEK293FT cells may detach easily from plate easily and result in lower transfection efficiency.
[00888] 12 j Applicants checked cells 24 h after transfection for efficiency by estimating the fraction of fluorescent cells in the control (e.g., GFP) transfection using a fluorescence microscope. Typically cells are more than 70% transfected.
[00889] 13j Applicants supplemented the culture medium with an additional 500 ul of warm D10 medium. Add D10 very slowly to the side of the well and do not use cold medium, as cells can detach easily.
[00890] 14j Cells are incubated for a total of 48-72 h post-transfection before harvested for indel analysis. Indel efficiency does not increase noticeably after 48 h.
[00891] (Optional) Co-transfection of CRISPR plasmids and ssODNs or targeting piasmids for HR · Timing 3-4 d
[00892] 15 j Linearize targeting plasmid. Targeting vector is linearized if possible by cutting once at a restriction site in the vector backbone near one of the homology arms or at the distal end of ei ther homology arm.
[00893] I6[ Applicants ran a small amou t of the li earized plasmid alongside uncut plasmid on a 0.8-1 % agarose gel to check successful linearization. Linearized plasmid should run above the supercoiled plasmid.
[00894] 17j Applicants purified linearized plasmid with the QIAQuick PCR Purification kit.
[00895] 18j Prepare ceils for transfection. Applicants cultured HEK293FT in T75 or T225 flasks. Sufficient ceil count before day of transfection is planned for. For the Amaxa strip- cuvette format, 2 x 10° cells are used per transfection.
[00896] 19j Prepare plates for transfection. Applicants added 1 mi of warm D10 medium into each well of a 12 well plate. Plates are placed into the incubator to keep medium warm.
[00897] 20j Nucleofection. Applicants transfected HEK293FT cells according to the Amaxa SF Ceil Line Nucleofector 4D Kit ma ufacturer's instructions, adapted in the steps below. [00898] a. For ssODN and CRISPR cotransfection, pre-mix the following DNA in PCR tubes:
pCRISPR plasm id (Cas9 + sgR A) 500 ng
ssO DN temp late (1 OuM) 1 ul
[00899] b. For HDR targeting plasmid and CRISPR cotransfection, pre -mix the following
DNA in PCR tubes:
CRISPR plasmid (Cas9 + sgRNA) 500 ng
Linearized targeting plasmid 500 ng
[00900] For transfection controls, see previous section. In addition, Applicants recommend transfeeting ssODN or targeting plasmid alone as a negative control.
[00901] 21 j Dissociate to single cells. Applicants removed medium and rinsed once gently with DPBS, taking care not to dislodge cells. 2 ml of TrypLE is added to a T75 flask and incubated for 5 m at 37°C. 10 ml of warm D10 medium is added to inactivate and triturated gently in a 50 ml Falcon tube. It is recommended that cells are triturated gently and dissociated to single cells. Large clumps will reduce transfection efficiency. Applicants took a 10 ul aliquot from the suspension and diluted into 90 ul of D 10 medium for counting. Applicants counted cells and calculated the number of cells and volume of suspension needed for transfection . Applicants typically transfected 2 x 105 ceils per condition using the Amaxa Nucleocuvette strips, and recommend calculating for 20% more cells than required to adjust for volume loss in subsequent pipetting steps. The volume needed is transferred into a new Falcon tube.
[00902] 23 [ Applicants spun down the new tube at 200 x g for 5 m.
[CI0903] Applicants prepared the transfection solution by mixing the SF solution and SI supplement as recommended by Amaxa. For Amaxa strip-cuvettes, a total of 20 ul of supplemented SF solution is needed per transfection. Likewise, Applicants recommend calculating for 20% more volume than required.
[00904] 25 j Applicants removed medium completely from pelleted cells from step 23 and gently resuspended in appropriate volume (20 ul per 2 x 10J cells) of SI -supplemented SF solution. Do not leave cells in SF solution for extended period of time.
[00905] 26| 20 ul of resuspended cells is pipetted into each DNA pre-mix from step 20. Pipette gently to mix and transfer to Nucleocuvette strip chamber. This is repeated for each transfection condition. [00906] Electroporate cells using the Nueleofeetor 4D program recommended by Amaxa, C -130.
[00907] 28 [ Applicants gently and slowly pipetted 100 ul of warm D10 medium into each Nucleocuvette strip chamber, and transferred all volume into the pre -warmed plate from step 19. CRITICAL. Ceils are very fragile at this stage and harsh pipetting can cause cell death. Incubate for 24 h. At this point, transfection efficiency can be estimated from fraction of fluorescent cells in positive transfection control. Nucieofection typically results in greater than 70-80% transfection efficiency. Applicants slowly added 1 ml warm D10 medium to each well without dislodging the cells. Incubate cells for a total of 72 h.
[00908] Human embryonic steal cell (HUES 9) culture anil transfection · Timing 3-4 d [00909] Maintaining hESC (HUES9) line. Applicants routinely maintain HUES9 cell line in feeder-free conditions with mTesRl medium. Applicants prepared mTeSRl medium by adding the 5.X supplement, included with basal medium and 1 00 ug/ml Normocin, Applicants prepared a 10 ml aliquot of mTeSRl medium supplemented further with 10 uM Rock Inhibitor. Coat tissue culture plate. Dilute cold GelTrex 1 : 100 in cold DMEM and coa the entire surface of a 100 mm tissue culture late.
[00910] Place plate in incubator for at least 30 m a 37°C. Thaw out a vial of cells at 37°C in a 15 ml Falcon tube, add 5 ml of mTeSRl medium, and pellet at 200 x g for 5 m. Aspirate off GelTrex coating and seed ~1 x 106 cells with 10 ml mTeSRl medium containing Rock Inhibitor. Change to normal mTeSRl medium 24 h after transfection and re-feed daily. Passaging cells. Re-feed cells with fresh mTeSRl medium daily and passage before reaching 70% confluency. Aspirate off mTeSR l medium and wash cells once with DPBS. Dissociate cel ls by adding 2 ml Accutase and incubating at 37°C for 3 - 5 m. Add 10 ml mTeSRl medium to detached cells, transfer to 15 ml Falcon tube and resuspend gently. Re -plate onto GelTrex-coated plates in mTeSRl medium with 10 uM Rock Inhibitor. Change to normal mTeSR l medium 24 h after plating.
[0091 1] Transfection. Applicants recommend culturing cells for at. least 1 week post -thaw before transfecting using the Amaxa P3 Primary Cell 4-D Nueleofeetor Kit (Lonza). Re-feed log-phase growing cells with fresh medium 2 h before transfection. Dissociate to single cells or small clusters of no more than 10 cells with accutase and gentle resuspension. Count the number of cells needed for nucieofection and spin down at 200 x. g for 5 m. Remove medium completely and resuspend in recommended volume of SI -supplemented P3 nucleofection solution. Gently plate electroporated cells into coated plates in presence of IX Rock Inhibitor.
[00912] Check transfection success and re-feed daily with regular mTeSRl medium beginning 24 h after nucleofection. Typical ly, Applicants observe greater than 70% transfection efficiency with Amaxa Nucleofection. Harvest DNA. 48-72 h post transfection, dissociate cells using accutase and inactivate by adding 5 x volume of mTeSR! . Spin cells down at 200 x g for 5 m. Pelleted cells can be directed processed for DNA extraction with QuickExtraet solution. It is recommended to not mechanically dissociate ceils without accutase. It is recommended to not spin cells down without inactivating accutase or above the recommended speed; doing so may cause cells to iyse.
[00913] Isolation of clonal cell Imes by FACS. Timing 8 2-3 h hands-ors; 2-3 weeks expansion
[00 J 4] Clonal isolation may be performed 24 h post-transfection by FACS or by serial dilution.
[00915] 541 Prepare FACS buffer. Cells that do not need sorting using colored fluorescence may be sorted in regular D 10 medium supplemented with I X peniciliin/streptmomycin. If colored fluorescence sorting is also required, a phenol-free DMEM or DPBS is substituted for normal DMEM. Supplement with IX penicilim/streptinomycin and filter through a .22 um Steriflip filter.
[00916] 551 Prepare 96 well plates. Applicants added 100 ul of D10 media supplemented wit IX penicillin/streptinomycin per well and prepared the number of plates as needed for the desired number of clones.
[00917] 56j Prepare cells for FACS. Applicants dissociated ceils by aspirating the medium completely and adding 100 ul TrypLE per well of a 24-weli plate. Incubate for 5 m and add 400 ul warm D10 media.
[00918] 57j Resuspended ceils are transferred into a 15 ml Falcon tube and gently triturated 20 times. Recommended to check under the microscope to ensure dissociation to single cells.
[00919] 581 Spin down cells at 200 x g for 5 minutes.
[00920] 59j Applicants aspirated the media, and resuspended the cells in 200 ul of FACS media. [00921] 601 Cel ls are filtered through a 35 urn mesh filter into labeled FACS tubes. Applicants recommend using the BD Falcon 12 x 75 mm Tube with Cell Strainer cap. Place cells on ice until sorting.
[00922] 61 j Applicants sorted single cel ls into 96-well plates prepared from step 55. Applicants recommend that in one single designated well on each plate, sort 100 cells as a positive control.
[009231 NOTE. The remainder of the cells may be kept and used for genotypmg at the population level to gauge overall modification efficiency.
[00924] 621 Applicants returned cells into the incubator and allowed them to expand for 2-3 weeks. 100 ul of warm D10 medium is added 5 d post sorting. Change 100 ul of medium every 3-5 d as necessary,
[00925] 63 j Colonies are inspected for "clonal" appearance 1 week post sorting: rounded colonies radiating from a central point. Mark off wells that are empty or may have been seeded with doublets or multiplets.
[00926] 6 j When cells are more than 60% confluent, Applicants prepared a set of replica plates for passaging. 100 ul of D10 medium is added to each well in the replica plates.
Applicants dissociated cells directly by pipetting up and down vigorously 20 limes. 20% of the resuspended volume was plated into the prepared replica plates to keep the clonal lines. Change the medium ever}.' 2-3 d thereafter and passage accordingly.
[00927] 651 Use the remainder 80% of cells for DNA isolation and genotypmg.
[00928] Optional: Isolation of clonal cell lines by dilution. Timing * 2-3 h hands-on; 2-3 weeks ex ansion
[00929] 66j Applicants dissociated cells from 24-well plates as described above. Make sure to dissociate to single cells. A cell strainer can be used to prevent clumping of cells.
[00930] 67j The number of cells are counted in each condition. Serially dilute each condition in DIG medium to a final concentration of 0.5 cells per 100 ul. For each 96 well plate, Applicants recommend diluting to a final count of 60 cel ls in 12 ml of D10. Accurate count of cell number is recommended for appropriate clonal dilution. Cells may be recounted at an intermediate serial dilution stage to ensure accuracy.
[00931] 68[ Multichannel pipette was used to pipette 100 ul of diluted ceils to each well of a 96 well plate. [00932] NOTE, The remainder of the cells may be kept and used for genotyping at the population level to gauge overall modification efficiency.
[00933] 69 [ Applica ts inspected colonies for "clonal" appearance ~1 week post plating: rounded colonies radiating from a central point. Mark off wel ls that may have seeded with doublets or multipiets.
[00934 J '701 Applicants returned cells to the mcubator and allowed them to expand for 2-3 weeks. Re-feed cells as needed as detailed in previous section.
[00935] SURVEYOR assay for CRISPR cleavage efficiency. Timing · 5-6 h
[00936] Before assaying cleavage efficiency of transfected cells, Applicants recommend testing each new SURVEYOR, primer on negative (untransfected) control samples through the step of SURVEYOR miclease digestion using the protocol described below. Occasionally, even single-band clean SURVEYOR PCR products can yield non-specific SURVEYOR nuclease cleavage bands and potential!)? interfere with accurate hide! analysis.
[00937] 71 i Harvest cells for DNA. Dissociate cells and spin down at 200 x g for 5 m. NOTE. Replica plate at this stage as needed to keep transfected cell lines.
[00938] 72 j Aspirate the supernatant completely.
[00939] 73 j Applicants used QuickExtraet DNA extraction solution according to the manufacturer's instructions. Applicants typically used 50 ui of the solution for each weli of a 24 well plate and 10 ul for a 96 well plate.
[00940 j 74j Applicants normalized extracted DNA to a final concentration of 100-200 ng/u! with dt!H20, Pause point: Extracted DNA may be stored at -20°C for several months.
[00941] 75! '^' up the SUR VEYOR PCR. Master mix the following using SURVEYOR primers provided by Applicants online/computer algorithm tool:
Component: Amount (ul) Final concentration
Herculase 11 PCR buffer, 5X 10 IX
dNTP, lOOmM (25mM each) 1 mM
SURVEYOR Fwd primer (lOu ) 0.2 uM
SURVEYOR Rev primer (IGuM) 1 0.2 uM
Herculase ( 1 Fusion pol merase 1
MgCi2 (25mM) 1 mM
Distilled water 33 Total 49 (for each reaction)
[0Θ942] 76 j Applicants added 100-200 ng of normalized genomic DNA template from step 74 for each reaction.
[00943] 77| PCR reaction was performed using the following cycling conditions, for no more than 30 amplification cycles:
Cycle number Denature Anneal Extend
1 95°C, 2 min
2-31 95°C, 20 s 60°C, 20 s 72°C, 30 s
32 72°C, 3 min
[00944] 781 Applicants ran 2-5 ul of PCR product on a 1% gel to check for single-band product. Although these PC conditions are designed to work with most pairs of SURVEYOR, primers, some primers may need additional optimization by adjusting the template concentration, MgCl2 concentration, and/or the annealing temperature.
[00945] 79 j Applicants purified the PCR reactions using the QIAQuick PCR purification kit and normalized eiuant to 20 ng/ul. Pause point: Purified PCR product may be stored at ~20°C.
80 j DNA heteroduplex formation. The annealing reaction was set up as follows:
Taq PCR buffer, 1 OX 2 ul
Normalized DNA (20 ng/ul) 18 ul
[00949] Total volume 20 ul
[00950] 81 j Anneal the reaction using the following conditions:
Cycle number Condition
1 95°C, 10 mn
2 95°C-85°C, -2°C/s
3 85°C, 1 min
4 85°C-75°C, -0.3 U s
5 75°C, I min
6 75°C-65°C, -0.3°C/s
7 65°C, 1 min
8 65°C-55°C, -0.3°C/s
9 55°C, i min
10 55°C-45°C, ~Q,3°C/s 1 1 45°C, I min
12 45°C-35°C, -0.3°C/s
13 35°C, 1 min
14 35°C-25°C, -0.3°C/s
15 25 C. 1 min
[00951J 82| SURVEYOR nuclease S digestion. Applicants prepared master-mix and added the following components on ice to annealed heterodupiexes from step 81 for a total final volume of 25 ul:
Component Amount (ul) Final Concentration
MgCl2 solution, 0.15M 2.5 15mM
ddl-hO 0.5
SURVEYOR nuclease S 1 IX
SURVEYOR enhancer S 1 IX
Total 5
[00952] 831 Vortex well and spin down. Incubate the reaction at 42°C for I h.
[009531 84j Optional: 2 ui of the Stop Solution from the SURVEYOR kit may be added. Pause point. The digested product may be stored at -20°C for analysis at a later time.
[00954] 85 S Visualize the SURVEYOR reaction. SURVEYOR nuclease digestion products may be visualized on a 2% agarose gel. For better resolution, products may be run on a 4-20% gradient Polyacrylamide TBE gel. Applicants loaded 10 ul of product with the recommended loading buffer and ran the gel according to manufacturer's instructions. Typically, Applicants run until the bromophenol blue dye has migrated to the bottom of the gel. Include DNA ladder and negative controls on the same gel.
[00955] 86| Applicants stained the gel with I X SYBR Gold dye diluted in TBE. The gel was gently rocked for 15 m.
[00956] 87| Applicants imaged the gel using a quantitative imaging system without overexposing the bands. The negative controls should have only one band corresponding to the size of the PCR product, but may have occasionally non-specific cleavage bands of other sizes. These will not interfere with analysis if the)' are different in size from target cleavage bands. The sum of target cleavage band sizes, provided by Applicants online/computer algorithm tool, should be equal to the size of the PCR. product . [00957] 881 Estimate the cleavage intensity. Applicants quantified the integrated intensity of each band using Image.) or other gel quantification software.
[00958] 89| For each la e, Applica ts calculated the fraction of the PGR product cleaved (fcut) using the following formula: fcut = (b + c) / (a + b + c), where a is the integrated intensity of the undigested PCR product and b and c are the integrated intensities of each cleavage product, 90 j Cleavage efficiency may be estimated using the following formula, based on the binomial probability distribution of duplex formation:
Sanger sequencing for assessing CRISPR cleavage efficiency. Timing « 3 d Initial steps are identical to Steps 71-79 of the SURVEYOR assay. Note: SURVEYOR primers may be used for Sanger sequencing if appropriate restriction sites are appended to the Forward and Reverse primers. For eSonirsg into the recommended pUC19 backbone, EcoRI may be used for the Fwd primer and Hindlll for the Rev primer.
[00962] 921 Ampl icon digestion. Set up the digestion reaction as follows:
Component Amount (ul)
Fast Digest buffer, 1 OX 3
FastDigest EcoRI 1
FastDigest Hindlll 1
Normalized DNA (20 ng/ul) 10
ddt K) 15
Total volume 30
[00963] 931 pUC 19 backbone digestion. Set up the digestion reaction as follows:
[00964] Component Amount (ul)
Fast Digest buffer, l OX 3
FastDigest EcoRI 1
FastDigest Hindlll I
FastAP Alkaline Phosphatase I
pUC19 vector (200 ng/ul ) 5
ddt K) 20
Total volume 30 [00965] 941 Applicants purified the digestion reactions using the QlAQuick PGR purification kit. Panse point: Purified PCR product may be stored at -20°C.
[00966] 95 [ Applicants ligated the digested pUC19 backbone and Sanger amplicons at a 1 :3 vector: insert ratio as follows:
[00967] Component Amount (ul)
Digested pUC 19 x (50 ng)
Digested insert x (1 :3 veetoninsert molar ratio)
T7 ligase 1
2X Rapid Ligation Buffer 10
d li h() x
Total volume 20
[00968] 96 [ Transformation, Applicants transformed the PlasmidSafe-treated plasmid into a competent E. coli strain, according to the protocol supplied with the cells. Applicants recommend Stbl3 for quick transformation. Briefly, 5ul of the product from step 95 is added into 20ul of ice-cold chemically competent Stbl3 cells, incubated on ice for 10 m, heat shocked at 42°C for 30 s, returned immediately to ice for 2 m, 100 ul of SOC medium is added, and plated onto an LB plate containing 100 ug ml ampiciilin. This is incubated overnight at 37°C.
[00969] 97| Day 2: Applicants inspected plates for colony growth. Typically, there are no colonies on the negative control plates (ligation of EcoRI-Hindlll digested pUC19 only, no Sanger amplicon insert), and tens to hundreds of colonies on the pUC19-Sanger amplicon cloning plates.
[00970] 98 j Day 3: Applicants isolated plasmid D A from overnight cultures using a QIAprep Spin miniprep kit according to the manufacturer's instructions.
[00971] 99| Sanger sequencing. Applicants verified the sequence of each colony by sequencing from the pUC 19 backbone using the pUC19-For primer. Applicants referenced the sequencing results against the expected genomic DNA sequence to check for the presence of Cas9-induced NHEJ mutations. % editing efficiency ::: (# modified c!ones)/(# total clones). It is important to pick a reasonable number of clones (>24) to generate accurate modification efficiencies.
[00972] Genotyping for mlcrodeletion. Timing * 2-3 d hands on; 2-3 weeks expansion [00973] l OQj Cells were transfected as described above with a pair of sgRNAs targeting the region to be deleted.
[00974] 101 [ 24 h post-transfection, clonal lines are isolated by FACS or serial dilution as described above.
[00975] 102| Cells are expanded for 2-3 weeks.
[00976] 1031 Applicants harvested DNA from clonal lines as described above using 10 ul QuickExtraet solution and normalized genomic DNA with ddH^O to a final concentration of 50- 100 ng/ul.
[00977] 104! PCR Amplify the modified region. The PGR reaction is set up as follows:
Component: Amount (ul) Final concentration
Herculase i f PCR buffer, 5X 10 I X
dNTP, IQQmM (25mM each) 1 niM
Out Fwd primer (IGuM) 0.2 uM
Out Rev primer (lOuM) 0.2 uM
Berculase Π Fusion polymerase
MgC12 (25mM) 2 1 raM
dd¾0 32
Total 48 (for each reaction)
[00978] Note: if deletion size is more than 1 kb, set up a parallel set of PCR reactions with In-
Fwd and In-Rev primers to screen for the presence of the wt allele.
[00979] 1051 To screen for inversions, a PCR reaction is set up as follows:
Component: Amount (ul) Final concentration
Herculase II PCR buffer, 5X 10 IX
dNTP, ! OOmVi (25mM each) I 1 mM
Out Fwd or Out-Rev primer ( 1 OuM) 1 0.2 uM
In Fwd or In-Rev primer (1 O M) 1 0.2 li.Vl
Herculase II Fusion polymerase I
MgCI2 (25mM) 2 1 mM
ddI-1,0 32
Total 48 (for each reaction)
[00980] Note: primers are paired either as Out-Fwd + In Fwd, or Out-Rev [00981] 106j Applicants added 100-200 ng of nomialized genomic DNA template from step 103 for each reaction.
[00982] 107! PGR reaction was performed using the following cycling conditions:
Cycle number Denature Anneal Extend
1 95°C, 2 min
95°C, 20 s 60°C, 20 s 72°C, 30 s
3? 72 C. 3 m
8i Applicants run 2-5 ul of PCR product on a 1-2% gel to check for product Although these PCR conditions are designed to work with most primers, some primers may need additional optimization by adjusting the template concentration, MgCl2 concentration, and/or the annealing temperature.
[00984] Genoiyping for targeted modifications via HDR, Timin · 2-3 d, 2-3 h hands on [00985] 109| Applicants harvested DNA as described above using QuickExtract solution and ormalized genomic DNA with TE to a final concentration of 100-200 ng'iil.
[00986] 1 10! PCR Amplify the modified region. The PCR. reaction is set up as follows:
Component: Amount (ii Final concentration
Herculase II PCR buffer, 5X 10 IX
dNTP, 100 mM (25 mM each) 1 1 mM
HDR Fwd primer (10 iiM) I 0.2 uM
HDR Rev primer (10 uM) 1 0.2 uM
Herculase II Fusion polymerase 1
MgCI2 (25mM) 1 mM
dd¾0 .3
Total 49 (for eac reaction)
[00987] 1 1 l j Applicants added 100-200 ng of genomic DNA template from step 109 for each reaction and run the following program.
Cycle number Denature Anneal Extend
1 95°C, 2 min
95°C, 20 s 60°C, 20 s 72°C, 30-60 s per kb
72°C, 3 min [00988] ! ! 2j Applicants ran 5 ul of PGR product on a 0.8-1 % gel to check for single-band product. Primers may need additional optimization by adjusting the template concentration, MgCl2 concentration, and/or the annealing temperature.
[00989] 1131 Applicants purified the PGR reactions using the QIAQuick PGR purification kit.
[00990] 114j In the HDR example, a HindlU restriction site is inserted into the EMX1 gene.
These are detected by a restriction digest of the PGR am pi icon:
Component Amount (ul)
Purified PGR amplicon (2GQ-300ng) x
F.D. buffer, Green 1
Hindlll 0.5
ddi-120 x
Total 10
[00991] i. The DNA is digested for 10 m at 37°C:
[00992] ii. Applicants ran 10 ul of the digested product with loading dye on a 4-20% gradient polyacryiamide TBE gel until the xylene cyanol band had migrated to the bottom of the gel.
[0Θ993] iii. Applicants stained the gel with IX SYBR Gold dye while rocking for 15 m.
[00994] iv. The cleavage products are imaged and quantified as described above in the SURVEYOR assay section. HDR efficiency is estimated by the formula: (b + c)/(a + b + c), where a is the integrated intensity for the undigested HDR PGR product, and b and c are the integrated intensities for the Hmdill-cut fragments.
[00995] 115! Alternatively, purified PGR ampiicons from step 113 may be cloned and genotyped using Sanger sequencing or NGS.
[00996] Deep sequencing m\d off-target analysis * Timing 1 - 2 d
[00997] The online CRISPR target design tool generates candidate genomic off-target sites for each identified target site. Off-target analysis at these sites can be performed by SURVEYOR nuclease assay, Sanger sequencing, or next-generation deep sequencing. Given the likelihood of low or undetectable modification rates at many of these sites, Applicants recommend deep sequencing with the Iilumina Miseq platform for high sensitivity and accuracy. Protocols will vary with sequencing platform; here, Applicants briefly describe a fusion PGR method for attaching sequencing adapters. [00998] 1 16| Design deep sequencing primers. Next-generation sequencing (NGS) primers are designed for shorter am iicons, typically in the 100-200 bp size range. Primers may be manually designed using NCBI Primer-Blast or generated with online CRISPR target design tools (website at genome-engineering.org/tools).
[00999] 117j Harvest genomic DNA from Cas9-targeted cells. Normalize QuickExtract genomic DNA to 100-200 ng/ul with ddH20.
0Θ1000] 1 18! Initial library preparation PCR. Using the NGS primers from step 1 16, prepare the initial library preparation PCR.
Component: Amount (ul Final concentration
Herculase Π PCR buffer, 5X 10 I X
dNTP, lOOmM (25mM each) 1 1 mM
NGS Fwd primer (lOuM) 0.2 uM
NGS Rev primer (lOuM) 0.2 uM
Herculase Π Fusion polymerase
MgC12 (25mM) 1 mM
ddH20 33
Total 49 (for each reaction)
[001002] 119j Add 100-200 ng of normalized genomic DNA template for each reaction,
Oj Perform PCR reaction using the following cycling conditions, for no more than amplification cycles:
Cycle number Denature Anneal Extend
1 95°C, 2 min
2-21 95°C, 20 s
72°C, 3 min
121 ! Run 2-5 ul of PCR product on a 1% gel to check for single-band product. A with all genomic DNA PCRs, NGS primers may require additional optimization by adjusting th template concentration, MgCl? concentration, and/or the annealing temperature.
1001005 Purify the PCR reactions using the QIAQuick PCR purification kit normalize eluant to 20 ng ul. Pause point: Purified PCR product may be stored at -20°C. [001006] 1231 Nextera XT DNA Sample Preparation Kit. Following the manufacturer's protocol, generate Miseq sequencing-ready libraries with unique barcodes for each sample.
[001007] 124! Analyze sequencing data. Off-target analysis may be performed through read alignment programs such as ClustalW, Geneious, or simple sequence analysis scripts.
[001008] Timing
[001009] Steps 1 - 2 Design and synthesis of sgRNA oligos and ssODNs: 1 -5 d, variable depending on supplier
[001010] Steps 3 - 5 Construction of CR ISPR. plasmid or PCR expression cassette: 2 h to 3 d [001011] Steps 6 - 53 Transfection into cell lines: 3 d (1 h hands-on time)
[001012] Steps 54 - 70 Optional derivation of clonal lines: 1-3 weeks, variable depending on cell type
[001013] Steps 71 - 91 Functional validation of NHEJ via SURVEYOR: 5-6 h
[001014] Steps 92 - 124 Genot pjng via Sanger or next-gen deep sequencing: 2-3 d (3-4 h hands on time)
[001015] Addressing Situations Concerning Herein Examples
Figure imgf000296_0001
Clumps or no cells in serial Recount cells; dissociate to single ceils and filter through dilution strainer; check serial dilution
High SURVEYOR
background on negative Redesign primers to prime from different locations
sample
Dirty SURVEYOR result Purify PGR product; reduce input DNA; reduce 42°C
on gel incubation to 30 m
Purify and normalize PGR. product; re-anneal with TaqB
No SURVEYOR cleavage buffer; Redesign sgRNAs; sequence verify Cas9 on px330
backbone
Samples do not sink in Supplement with MgCl2 to a final concentration of 15m
TBE acryiamide gel or add loading buffer containing glycerol
[001016] Disc ssion
[001017] CRISPR-Cas may be easily multiplexed to facilitate simultaneous modification of several genes and mediate chromosomal microdeletions at high efficiencies. Applicants used two sgRNAs to demonstrate simultaneous targeting of the human GRIN2B and DYRKIA loci at efficiencies of up to 68% in HEK293FT cells. Likewise, a pair of sgRNAs may be used to mediate microdeletions, such as excision of an exon, which can be genotyped by PGR on a clonal level. Note that the precise location of exon junctions can vary. Applicants also demonstrated the use of ssODNs and targeting vector to mediate HDR with both wildtype and nickase mutant of Cas9 in HEK 293 FT and HUES 9 ceils (Fig. 30). Note that Applicants have not been able to detect HDR in HUES9 cells using the Cas9 nickase, which may be due to low efficiency or a potential difference in repair activities in HUES9 cells. Although these values are typical, there is some variability in the cleavage efficiency of a given sgRNA, and on rare occasions certain sgRNAs may not work for reasons yet unknown. Applicants recommend designing two sgRNAs for each locus, and testing their efficiencies in the intended cell type. Example 31: NLSs
[001018] Cas9 Transcriptional Modulator: Applicants set out to turn the Cas9/gRNA CRISPR. system into a generalized DNA binding system in which functions beyond DNA cleavage can be executed. For instance, by fusing functional domain(s) onto a catalyticaily inactive Cas9 Applicants have imparted novel functions, such as transcriptional activation/repression, methylatiorvdemethylation, or chromatin modifications. To accomplish this goal Applicants made a catalyticaily inactive Cas9 mutant by changing two residues essential for nuclease activity, D10 and H840, to alanine. By mutating these two residues the nuclease activity of Cas9 is abolished while maintaining the ability to hind target DNA. The functional domains Applicants decided to focus on to test Applicants' hypothesis are the transcriptional activator VP64 and the transcriptional repressors SID and KRAB.
[001019] Cas9 Nuclear localization: Applicants hypothesized that the most effective Cas9 transcriptional modulator would be strongly localized to the nucleus where it would have its greatest influence on transcription. Moreover, any residual Cas9 in the cytoplasm could have unwanted effects. Applicants determined that wild-type Cas9 does not localize into the nucleus without including multiple nuclear localization signals (NLSs) (although a CR!SPR system need not have one or more NLSs but advantageously has at least one or more NLS(s)). Because multiple NLS sequences were required it was reasoned that, it is difficult, to get. Cas9 into the nucleus and any additional domain that is fused to Cas9 could disrupt the nuclear localization. Therefore, Applicants made four Cas9~VP64-GFP fusion constructs with different NLS sequences (pXRP02- pLenti2-EFla-NLS-hSpCsnl(10A,840A)-NLS-VP64-EGFP, pXRP04- pLenti2-EFla-NLS-hSpCsnl(10A,840A)-NLS-VP64-2A-EGFP-NLS, pXRP06- pLenti2-EFla- NLS-EGFP-VP64-NLS iSpCsnl( 10A,840A)-NLS, pXRP08- pLenti2~EFla-NLS-VP64-NLS- hSpCsnl(10A,840A)~NLS~VP64~EGFP-NLS). These constructs were cloned into a lenti backbone under the expression of the human EFla promoter. The WPRE element was also added for more robust protein expression. Each constmct was transiected into HEK 293FT cells using Lipofectame 2000 and imaged 24 hours post-transfection. The best nuclear localization is obtained when the fusion proteins have NLS sequences on both the N- and C-term of the fusion protein. The highest observed nuclear localization occurred in the constmct with four NLS elements.
[001020] To more robustly understand the influence of NLS elements on Cas9 Applicants made 16 Cas9-GFP fusions by adding the same alpha importin NLS sequence on either the N- or C-term looking at zero to three tandem repeats. Each construct was transiected into HEK 293 FT cel ls using Lipofectame 2000 and imaged 24 hours post-transfection. Notably, the number of NLS elements does not directly correlate with the extent of nuclear localization. Adding an NLS on the C-term has a greater influence on nuclear localization than adding on the N-term.
[001021] Cas9 Transcriptional Activator: Applicants functionally tested the Cas9-VP64 protein by targeting the Sox2 locus and quantifying transcriptional activation by RT-qPCR.. Eight DNA target sites were chosen to span the promoter of Sox2. Each constmct was transfected into HEK 293FT cells using Lipofectame 2000 and 72 hours post-transfection total R A was extracted from the ceils. 1 ug of RNA was reverse transcribed into cDNA (q Script Supermix) in a 40 ul reaction. 2 uS of reaction product was added into a single 20 ul TaqMan assay qPCR reaction. Each experiment was performed in biological and technical triplicates. No RT control and no template control reactions showed no amplification. Constructs that do not show strong nuclear localization, pXRP02 and pX PQ4, result in no activation. For the construct that did show strong nuclear localization, pXRP08, moderate activation was observed. Statistically significant activation was observed in the case of guide RNAs Sox2.4 and Sox2.5.
Example 32: in Vivo Mouse Data
[001022] Material and reagents
Herculase II fusion polymerase (Agilent Technologies, cat. no. 600679)
lOx EBuffer 4 (NEB, cat. No. B7004S)
Bsal HF (NEB, cat. No. R3535S)
T7 DNA ligase (Enzymaties, cat. no. L602L)
Fast Digest buffer, I QX (ThermoScientific, cat. No. B64)
FastDigest Notl (ThermoScientific, cat. No. FD0594)
FastAP Alkaline Phosphatase (ThermoScientific, cat. No. EF0651)
Lipofectamine2000 (Life Technologies, cat. No. 11668-019)
Trypsin (Life Technologies, cat. No. 15400054)
Forceps #4 (Sigma, cat. No. Z168777-1EA)
Forceps #5 (Sigma, cat. No. F6521-1 EA)
lOx Hank's Balanced Salt Solution (Sigma, cat. No. H4641 -500ML)
Penicillin/Streptomycin solution (Life Technologies, cat. No. P4333)
Neurohasal (Life Technologies, cat. No. 21 103049)
B27 Supplement (Life Technologies, cat. No. 17504044)
L-giutamine (Life Technologies, cat. No. 25030081)
Glutamate (Sigma, cat. No. RES5063G-A7)
β-mercaptoethanol (Sigma, cat. No. M6250-100ML)
HA rabbit antibody (Cell Signaling, cat. No. 3724S)
LIVE/DEAD® Cell Imaging Kit (Life Technologies, cat. No. R37601) 30G World Precision Instrument syringe (World Precision Instruments, cat. No. NANOFIL)
Stereotaxic apparatus ( opf Instruments)
UltraMicroPump3 (World Precision Instruments, cat. No. UMP3-4)
Sucrose (Sigma, cat. No. S7903)
Calcium chloride (Sigma, cat. No. C10I6)
Magnesium acetate (Sigma, cat. No. M0631 )
Tris-HCf (Sigma, cat. no T5941)
EDTA (Sigma, cat. No. E6758)
NP-40 (Sigma, cat. No. NP40)
Phenylmethanesulfonyl. fluoride (Sigma, cat. No. 78830)
Magnesium chloride (Sigma, cat. No. VI 266}
Potassium chloride (Sigma, cat. No. P9333)
β -glycerophosphate (Sigma, cat. No. G9422)
Glycerol (Sigma, cat. No. G90I2)
Vybrant® DyeCycle™ Ruby Stain (Life technologies, cat. No. S4942)
FACS Aria Flu-act-cell sorter (Koch Institute of MIT, Cambridge US)
DNAeasy Blood & Tissue Kit (Qiagen, cat. No. 69504)
[001023] Procedure
[001024] Constructing gRNA multiplexes for using in vivo in the brain
Applicants designed and PGR amplified single gRNAs targeting mouse TET and DNMT family members (as described herein) Targeting efficiency was assessed i N2a cell line (Fig, 33). To obtain simultaneous modification of several genes in vivo, efficient gRNA was multiplexed in AAV '-packaging vector (Fig. 34). To facilitate further analysis of system efficiency applicants added to the system expression cassette consistent of GFP-KA.SH domain fusion protein under control of human Synapsin I promoter (Fig. 34). This modification allows for further analysis of system efficiency in neuronal population (more detail procedure in section Sorting nuclei and in vivo results),
[001025] All 4 parts of the system were PCR amplified using Herculase II Fusion polymerase using following primers:
1 st U 6 Fw :
gagggtctcgtccttgcggccgcgctagcgagggcctatttcccatgattc 1st gRNA Rv:
ctcggtctcggtAAAAAAgcaccgactcggtgccactttttcaagttgataacggactagc cttattttaacttgctaT TCtagctctaaaacNNNNNNNNNNNNNNNNNNNNGGTGT TC GTCCTTTCCAC
2nd 06 Fw:
gagggtctcTTTaccggtgagggcctatttcccatgattcc
2nd gRNA Rv:
ctcggtctcctcAAAAAAgcaccgactcggtgccac11111caag11gataacggacta gc cttattttaacttgctaTTTCtagctctaaaacNKNNNKNNNKNNNKNNNKNNGGTGTTTC GTCCTTTCCAC
3rd U6 Fw:
gagggtctcTT gagctcgagggcctatttcccatgattc
3rd gRNA Rv:
ctcggtctcgcgtAAAAAAgcaccgactcggtgccactttttcaagttgataacggact ag ccttattttaacttgctaTTTCtagctctaaaacNNNNNNNNNNNNNNNNNNNNGGTGTTT CGTCCTTTCCA
hSyn GFP-kash Fw: gagggtctcTTacgcgtgtgtctagac
hSyn GFP-kash Rv:
Figure imgf000301_0001
GA GGCCAAGGTGGGTAGATCACCTGAGATTAGGAGTTGC
( NNNNNNNNNNNNNN is a reverse compliment targeted genomic sequence)
[001026] Applicants used Golden Gate strategy to assemble ail parts (1 : 1 molecular ratio) of the system in a single step reaction:
Figure imgf000301_0002
2nd U6_gRNA 18 ng
3,d U6_gRNA 18 ng
Syn GFP-kash 100 ng
l Ox NEBuffer 4 1 .0 μΙ
Figure imgf000301_0003
10 mM ATP 1.0 μΐ
Bsal HF 0.75 μΐ T7 ligase 0.25 μΐ
cidi bO 10 ul
Cycle number Condition
1-50 37°C for 5 ra, 21 °C for 5 m
[001027] Golden Gate reaction product was PCR amplified usi g Herculase II fusion polymerase and following primers:
F 5 ' cctgtccttgcggccgcg ctagcgagggcc
Rv 5"' cacqcqaccqcaaqqa oa g g g a a g g g a g c a g
[001028] PCR product was cloned into AAV backbone, between ΠΊ sequences using restriction sites:
PCR product digestion:
Fast Digest buffer, 10X 3 μΐ
FastDigest Notl 1 μΐ
DNA
ddH,0 up to 30 μΐ
1001029] AAV backbone digestion:
Fast Digest buffer, 10X 3 μΐ
FastDigest Notl 1 μΐ
FastAP Alkaline Phosphatase 1 μΐ
AAV backbone * μ§
ddH>0 up to 30 ul
[001030] After 20 min incubation in 37°C samples were purified using QIAQ ck purification kit. Standardized samples were ligated at a 1 :3 veetoninsert ratio as follows:
Digested pUC19 50 ng
Digested insert 1 :3 vector:insert molar ratio
T7 ligase 1 μΐ
2X Rapid Ligation Buffer 5 μΐ
ddH,0 up to 10 μ
031 ] After transformation of bacteria with ligation reaction product, applicants confirmed obtained clones with Sanger sequencing. [001032] Positive DNA clones were tested in N2a cells after co-transfection with Cas9 construct (Figs. 35 and 36).
j 0Θ1033] Design of new C s9 constructs for AA V delivery
[001034] AAV delivery system despite its unique features has packing limitation - to successfully deliver expressing cassette in vivo it has to be in size < then 4.7 kb. To decrease the size of SpCas9 expressing cassette and facilitate deliver}? applicants tested several alteration: different promoters, shorter polyA signal and finally a smaller version of Cas9 from Staphylococcus aureus (SaCas9) (Figs. 37 and 38). All tested promoters were previously tested and published to be active in neurons, including mouse Mecp2 (Gray et al., 201 1), rat Map lb and truncated rat Map lb (Liu and Fischer, 1996). Alternative synthetic polyA sequence was previously shown to be functional as well (Levitt et al., 1989; Gray et al., 201 1 ). AH cloned constructs were expressed in N2a ceils after transfection with Lipofectamine 2000, and tested with Western b lotting method (Fig. 39).
[001035] Testing AA V multiplex system in primary neurons
[001036] To confirm functionality of developed system in neurons, Applicants use primary neuronal cultures in vitro. Mouse cortical neurons was prepared according to the protocol published previously by Banker and Goslin (Banker and Goslin, 1988).
[001037] Neuronal ceils are obtained from embryonic day 16. Embryos are extracted from the euthanized pregnant female and decapitated, and the heads are placed in ice-cold HBSS. The brains are then extracted from the skulls with forceps (#4 and #5) and transferred to another change of ice-cold HBSS. Further steps are performed with the aid of a stereoscopic microscope in a Petri dish filled with ice-cold HBSS and #5 forceps. The hemispheres are separated from each other and the brainstem and cleared of meninges. The hippocampi are then very carefully dissected and placed in a 15 ml conical tube filled with ice-cold FIBSS. Cortices that remain after hippocampai dissection can be used for further ceil isolation using an analogous protocol after removing the brain steam residuals and olfactory bulbs. Isolated hippocampi are washed three times with 10 ml ice-cold HBSS and dissociated by 15 min incubation with tr psin in HBSS (4 mi HBSS with the addition of 10 μΐ 2.5% trypsin per hippocampus) at 37°C. After trypsinization, the hippocampi are very carefully washed three times to remove any traces of trypsin with FIBSS preheated to 37°C and dissociated in warm HBSS. Applicants usually dissociate cells obtained from 10-12 embryos in I ml HBSS using 1 ml pipette tips and dilute dissociated cells up to 4 ml. Cells are plated at a density of 250 ceils/mm2 and cultured at 37°C and 5% C02 for up to 3 week
[0010381 HBSS
435 ml H20
50 ml lOx Hank's Balanced Salt Solution
16.5 ml 0.3M HEPES pH 7.3
5 ml penicillin-streptomycin solution
Filter (0,2 urn) and store 4°C
[001039] Neuron Plating Medium (100 ml)
97 ml Neurobasal
2 ml 1327 Supplement
1 mi penicillin-streptomycin solution
250 μ ΐ glutamine
125 μΐ glutamate
[001040] Neurons are transduced with concentrated AAVl/2 vims or AAV1 virus from filtered medium of HEK293FT ceils, between 4-7 days in culture and keep for at least one week in culture after transduction to allow for delivered gene expression.
[001041] AA V-driven expression of the system
[001042] Applicants confirmed expression of SpCas9 and SaCas9 in neuronal cultures after AAV delivery using Western blot method (Fig. 42). One week after transduction neurons were collected in NuPage SDS loading buffer with β-mereaptoethanol to deiiaturate proteins in 95°C for 5 rain. Samples were separated on SDS PAGE gef and transferred on PVDF membrane for WB protein detection. Cas9 proteins were detected with HA antibody.
[001043] Expression of Syn-GFP-kash from gRNA multiplex AAV was confirmed with fluorescent microscopy (Fig. 50).
[001044] Toxicity
[001045] To assess the toxicity of AAV with CRISPR. system Applicants tested overall morphology of neurons one week after virus transduction (Fig. 45). Additionally, Applicants tested potential toxicity of designed system with the LIVE/DEAD® Cell Imaging Kit, which allows to distinguish live and dead cells in culture. It is based on the presence of intracellular esterase activity (as determined by the enzymatic conversion of the non-fluorescent calcein AM to the intensely green fluorescent calcein). On the other hand, the red, ce l-impermeant component of the Kit enters cells with damaged membranes only and bind to DNA generating fluorescence in dead ceils. Both flourophores can be easily visualized in living ceils with fluorescent microscopy. AAV-driven expression of Cas9 proteins and multiplex gRNA constructs in the primary cortical neurons was well tolerated and not toxic (Figs. 43 and 44), what indicates that designed AAV system is suitable for in vivo tests.
[001046 ] Virus production
[001047] Concentrated virus was produced according to the methods described in McCIure et al., 201 1 . Supernatant virus production occurred in EK293FT ceils.
[001048] Brain surgeries
[001049] For viral vector injections 10-15 week old male C57BL/6N mice were anesthetized with a Ketamine/Xyiazine cocktail ( etamine dose of 100 mg/kg and Xylazine dose of 10 mg/kg) by intraperitoneal injection. Intraperitoneal administration of Buprenex was used as a preemptive analgesic (1 mg/kg). Animals were immobilized in a Kopf stereotaxic apparatus using intra-aura positioning studs and tooth bar to maintain an immobile skull. Using a hand-held drill, a hole (l-2mm) at -3.0 mm posterior to Bregma and 3.5 mm lateral for injection in the CA 1 region of the hippocampus was made. Using 30G World Precision Instrument syringe at a depth of 2.5 mm, the solution of AAV viral particles in a total volume of 1 ui was injected. The injection was monitored by a 'World Precision Instruments UltraMieroPump3 ' injection pump at a flow rate of 0.5 ul/min to prevent tissue damage. When the injection was complete, the injection needle was removed slowly, at a rate of 0.5 mm/min. After injection, the skin was sealed with 6-0 Ethi!on sutures. Animals were postoperatively hydrated with 1 mL lactated Ringer's (subcutaneous) and housed in a temperature controlled (37°C) environment until achieving an ambulatory recovery. 3 weeks after surgery animals were euthanized by deep anesthesia followed by tissue removal for nuclei sorting or with 4% paraformaldehyde perfusion for imm unoche nistry .
[001050] Sorting nuclei and in vivo remits
[001051] Applicants designed a method to specifically genetically tag the gRNA targeted neuronal cell nuclei with GFP for Fluorescent Activated Cel l Sorting (FACS) of the labeled cell nuclei and downstream processing of DNA, RNA and nuclear proteins. To that purpose the applicants' multiplex targeting vector was designed to express both a fusion protein between GFP and the mouse nuclear membrane protein domain KASH (Starr DA, 2011. Current biology) and the 3 gRJMAs to target specific gene loci of interest (Fig. 34). GFP-KASH was expressed under the control of the human Synapsin promoter to specifically label neurons. The amino acid of the fusion protein GFP-KASH was:
MVSKGEELFTGVVPILVELDGD GHKFSVSGEGEGDATYGKLTLKFICT TG LPVPWPTLVTTLTYGVQCFS YPDHM QHDFFKSAMPEGYVQE TIFF DDGN
Y&TILAEYKFEGDTLVNRJELKGIDFK^
VNFK1RHN1EDGSVQLAD YQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEK.RDHMV LLEFVTAAGITLGMDELYKSGLRSI EEEEETDSRMPHLDSPGSSQPRRSFLSRVll AAL PLQLLLLLLLLLACLLPASEDDYSCTQANNFARSFYPMLRYTNGPPPT
[001052] One week after AAV 1/2 mediated delivery into the brain a robust expression of GFP- KASH was observed. For FACS and downstream processing of labeled nuclei, the hippocampi were dissected 3 weeks after surgery and processed for cell nuclei purification using a gradient centrifugation step. For that purpose the tissue was homogenized in 320 mM Sucrose, 5 mM CaCl, 3 mM Mg(Ac)2, 10 mM Tris pH 7.8, 0.1 mM EDTA, 0.1% NP40, 0.1 mM Phenylmethanesulfonyl fluoride (PMSF), 1 mM β-mercaptoethanol using 2ml Dounce homogenizer (Sigma) The homogenisate was centrifuged on a 25% to 29% Optiprep® gradient according to the manufacture's protocol for 30 min at 3.500 rpm at 4 °C. The nuclear pellet was resuspended in 340 mM Sucrose, 2 mM MgC12, 25 mM KCi, 65 mM glycerophosphate, 5% glycerol, 0.1 mM PMSF, 1 mM β-mercaptoethanol and Vy ran ) DyeCycfe™ Ruby Stain (Life technologies) was added to label cell nuclei (offers near-infrared emission for DNA). The labeled and purified nuclei were sorted by FACS using an Aria Flu-act-cell sorter and BDFACS Diva software. The sorted GFP+ and GFP- nuclei were finally used to purify genomic DNA using DNAeasy Blood & Tissue Kit (Qiagen) for Surveyor assay analysis of the targeted genomic regions. The same approach can be easily used to purify nuclear RNA or protein from targeted cells for downstream processing. Due to the 2-vector system (Fig. 34) the applicants using in this approach efficient Cas9 mediated DNA cleavage was expected to occur only in a small subset of cells in the brain (ceils which were co-infected with both the multiplex targeting vector and the Cas9 encoding vector). The method described here enables the applicants to specifical ly purify DNA, RNA and nuclear proteins from the ceil populatio expressing the 3 gRNAs of interest and therefore are supposed to undergo Cas9 mediated DNA. cleavage. By using this method the applicants were able to visualize efficient DNA cleavage in vivo occurring only in a small subset of cells.
[001053] Essentially, what Applicants have shown here is targeted in vivo cleavage. Furthermore, Applicants used a multiple approach, with several different sequences targeted at the same time, but independently. Presented system can be applied for studying brain pathologic conditions (gene knock out, e.g. Parkinson disease) and also open a field for further development of genome editing tools in the brain. By replacing nuclease activity with gene transcription regulators or epi genetic regulators it will be possible to answer whole spectrum of scientific question about role of gene regulation and epi genetic changes in the brain in not only in the pathologic conditions but also in physiological process as learning and memory formation. Finally, presented technology can be applied in more complex mammalian system as primates, what allows to overcome current technology limitations.
Example 33: Model Data
[001054] Several disease models have been specifically investigated. These include de novo autism risk genes CHD8, KATNAL2, and SCN2A; and the syndromic autism (Angelman Syndrome) gene UBE3A. These genes and resulting autism models are of course preferred, but show that the invention may be applied to any gene and therefore any model is possible.
[001055] Applicants have made these cells lines using Cas9 nuclease in human embryonic stem cells (hESCs). The lines were created by transient transtection of liESCs with Cbh-Cas9-2A- EGFP and pU6-sgRNA. Two sgR As are designed for each gene targeting most often the same exons in which patient nonsense (knock-out) mutations have been recently described from whole exome sequencing studies of autistic patients. The Cas9-2A~EGFP and pU6 plasmids were created specifically for this project.
Example 34: AA V production system or protocol
[001056] An AAV production system or protocol that was developed for, and works particularly well with, high through put screening uses is provided herein, but it has broader applicability in the present invention as well. Manipulating endogenous gene expression presents various challenges, as the rate of expression depends on many factors, including regulatory elements, mRNA processing, and transcript stability. To overcome this challenge, Applicants developed an adeno-associated virus (AAV)-based vector for the delivery. AAV has an ssDNA-based. genome and is therefore less susceptible to recombination . [001057] AAV i/2 (serotype AAV 1/2, i.e., hybrid or mosaic AAVl / AAV2 capsid AAV) heparin purified concentrated virus protocol
1001058] Media: DIP + HEPES
500ml bottle DMEM high glucose + G Sutamax (GIBCO)
50ml Hyclone FBS (heat-inactivated) (Thermo Fischer)
5.5ml HEPES solution (1M, GIBCO)
Cells: low passage HEK293FT (passage <10 at time of vims production, thaw new cells of passage 2-4 for vims production, grow up for 3-5 passages)
[001059] Transfeetion reagent: Poiyethylenimine (FEI) 44 Max"
Dissolve 50mg PEI "Max" in 50ml sterile UUrapure H20
Adjust pH to 7.1
Filter with 0.22um fliptop filter
Seal tube and wrap with parafilm
Freeze aliquots at -20°C (for storage, can also be used immediately)
[001060] Cell .Culture
Culture low passage HEK293FT in D10 + HEPES
Passage everyday between 1 :2 and 1 :2.5
Advantageously do not allow cells to reach more than 85% confluency
[001061] For T75
- Warm 10ml HBSS (~Mg2+, -Ca2+, GIBCO) + 1 ml TrypLE Express (GIBCO) per flask to 37°C (Waterbath)
Aspirate media full
- Add 10ml warm HBSS gently (to wash out media completely)
- Add 1ml TrypLE per Flask
- Place flask in incubator (37°C) for Imin
- Rock flask to detach cells
- Add 9mi Dl 0 + HEPES media (37°C)
- Pipette up and down 5 times to generate single ceil suspension
- Split at 1 :2 - 1 :2,5 (12ml media for T75) ratio (if cel ls are growing more slowly, discard and thaw a new batch, they are not in optimal growth) - transfer to T225 as soon as enough cells are present (for ease of handling large amounts of ceils)
[001062] AAV production (5*15cm dish scale per construct):
Plate 10 mil lion cells in 21 ,5 ml media into a 15cm dish
Incubate for 18-22 hours at 37°C
Transfection is ideal at 80% confluence
[0010631 Per plate
Prewarm 22ml media (D10 + tl EPES)
[001064] Prepare tube with DNA mixture (use endofree maxiprep DNA):
5.2 ug vector of interest plasmid
4.35 ug AAV 1 serot pe plasmid
4.35 ug AAV 2 serotype plasmid
10.4 ug pDF6 plasmid (adenovirus helper genes)□ Vortex to mix
Add 434 uL DMEM (no serum!)
Add 130 ul PEI solution
Vortex 5- 10 seconds
Add DNA/DMEM/PFJ mixture to prewarmed media
Vortex briefly to mix
Replace media in 15cm dish with DNA/DMEM/PEI mixture
Return to 37°C incubator
Incubate 8h before harvesting (make sure medium isn't turning too acidic)
[001065] Virus harvest:
1. aspirate media carefully from 15cm dish dishes (advantageously do not dislodge cells)
2. Add 25 ml RT DPBS (Invitrogen) to each plate and gently remove cells with a ceil scraper. Collect suspension in 50 ml tubes.
3. Pellet cells at 800x g for 10 minutes.
4. Discard supernatant
[001066] panse point: freeze ceil pellet at -80C if desired
5. resuspend pellet in 150 mM aCl, 20 mM Tris pH 8.0, use 10 ml per tissue culture plate. 6. Prepare a fresh solution of 10% sodium deoxycholate in d 20. A dd 1 .25 ml of this per tissue culture plate for a final concentration of 0.5%. Add benzonase nuclease to a final concentration of 50 units per ml. Mix tube thoroughly.
7. Incubate at 37°C for 1 hour (Waterbath).
8. Remove cellular debris by eentrifuging at 3000 x g for 15 mins. Transfer to fresh 50 ml tube and ensure all cell debris has been removed to prevent blocking of heparm columns.
[001067] Heparin coiumn purification of AAVl/2:
[001068] 1. Set up HiTrap heparin columns using a peristaltic pump so that solutions flow through the column at 1 ml per minute. It is important to ensure no air bubbles are introduced into the heparm column.
[0010691 2. Equilibrate the column with 10 ml 150 mM NaCl, 20 mM Tris, pH 8.0 using the peristaltic pump.
[0010701 3. Binding of virus: Apply 50 ml virus solution to column and al low to flow through.
[001071] 4. Wash step 1 : coiumn with 20 ml 100 mM NaCL 20 mM Tris, pH 8.0. (using the peristaltic pump)
[001072] 5. Wash step 2: Using a 3 mi or 5 ml syringe continue to wash the coiumn with 1 ml 200 m NaCL 20 m Tris, pH 8.0, followed by I ml 300 mM NaCl, 20 mM Tris, pH 8.0.
Discard the flow-through.
(prepare the syxinges with different buffers during the 50min flow through of vims solution above)
[001073] 6. Elution Using 5 ml syringes and gentle pressure (flow rate of < lml/min) elute the virus from the column by applying:
1.5 ml 400 mM NaCL 20 mM Tris, pH 8.0
3.0 ml 450 mM NaCl, 20 mM Tris, pi:l 8.0
1 .5 mi 500 mM NaCL 20 mM Tris, pH 8.0
Collect these in a 15 ml centrifuge tube.
[001074] Concentration of AAVl/2:
[001075] 1. Concentration step 1 : Concentrate the eiuted virus using Amicon ultra 15ml centrifugal filter units with a 100,000 molecular weight cutoff. Load column eluate into the concentrator and centrifuge at 2000x g for 2 minutes (at room temperature. Check concentrated volume - it should be approximately 500 μΐ. If necessary, centrifuge in Imin intervals until correct volume is reached.
[001076] 2, buffer exchange: Add 1ml sterile DPBS to filter unit, centrifuge in Imin intervals until correct -volume (500ul) is reached.
[001077] 3. Concentration step 2: Add 500ul concentrate to an Amicon Ultra 0.5ml 100 filter unit. Centrifuge at 6000g for 2min. Check concentrated volume - it should be approximately 1 00 μΐ. If necessary, centrifuge in Imin intervals until correct volume is reached.
[001078] 4. Recovery: Invert filter insert and insert, into fresh collection tube. Centrifuge at lOOOg for 2min.
Aliquot and freeze at -80°C
!ul is typically required per injection site, small aliquots (e.g. 5ul) are therefore recommended (avoid freeze-thaw of virus).
determine DNasel-resistant GC particle titer using qPCR. (see separate protocol)
[001079] Materials
Amicon Ultra, 0.5ml, 100 ; MiLLIPORE; UFC510024
Amicon Ultra, 15ml, 100K; MILLIPORE; UFC910024
Benzonase nuclease; Sigma- Aldrich, E 1014
HiTrap Heparin cartridge; Sigma-Aldrich; 54836
Sodium deoxycholate; Sigma-Aldrich; D5670
[001080] AAVl supernatant production protocol
Media: D10 + HEPES
500ml bottle DMEM high glucose + Glutamax (Invitrogen)
50ml yclone FBS (heat-inactivated) (Thermo Fischer)
5.5ml HEPES solution (1M, GIBCO)
Cel ls: low passage HEK293FT (passage <10 at time of vims production)
Thaw new ceils of passage 2-4 for virus production, grow up for 2-5 passages
Transfeetion reagent: Polyethylenimine (PEI) "Max"
Dissolve 50mg PEI "Max" in 50ml sterile Ultrapure H20
Adjust. pH to 7.1
Filter with 0.22um fliptop filter
Seal tube and wrap with para H i Freeze a!iquots at ~20°C (for storage, can also be used immediately)
Ceil Culture
Culture low passage HEK293FT in D10 + HEPES Passage everyday between 1 :2 and 1 :2.5 Advantageously do let cells reach more than 85% confluency
For T75
- Warm 10ml HBSS (~Mg2+, -Ca2+, GIBCO) + 1 ml TrypLE Express (GIBCO) per flask to 37°C (Waterbath)
~ Aspirate media fully
- Add 10ml warm HBSS gently (to wash out media completely)
- Add 1ml TrypLE per Flask
- Place flask in incubator (37°C) for Imin
- Rock flask to detach ceils
- Add 9mi D10 + HEPES media (37°C)
- Pipette up and down 5 times to generate single ceil suspension
- Split at 1 :2 - 1 :2.5 (12ml media for T75) ratio (if cells are growing more slowly, discard and thaw a new batch, they are not in optimal growth)
- transfer to T225 as soon as enough cells are present (for ease of handling large amounts of cells)
AAV production (single 15cm dish scale)
Plate 10 million cel ls in 21.5 ml media into a 15cm dish
Incubate for 18-22 hours at 37°C
Transfeetion is ideal at 80% confluence per plate
Prewarm 22ml media (D 10 + HEPES)
Prepare tube with DNA mixture (use endofree maxiprep DNA):
5.2 ug vector of interest plasmid
8.7 ug AAV 1 serotype plasmid
10.4 ug DF6 plasmid (adenovirus helper genes)
Vortex to mix
Add 434 uL DM EM (no semm!) Add 130 ul PEI solution
Vortex 5-10 seconds
Add DNA/DMEM/PFJ mixture to prewarmed media Vortex briefly to mix
Replace media in 15cm dish with D A/DMEM/PEI mixture
Return to 37°C incubator
Incubate 48h before harvesting (advantageously monitor to ensure medium is not turning too acidic)
[0010811 Virus harvest:
Remove supernatant from 15cm dish
Filter with 0.45 urn filter (low protein binding) Aliquot and freeze at -80°C
Transduction (primary neuron cultures in 24-weli format, 5DIV)
Replace complete neurobasal media in each well of neurons to be transduced with, fresh neurobasal (usually 40Gu! out of 50()ul per wel l is replaced ;
Thaw AAV7 supernatant in 37°C waterbath
Let. equilibrate in incubator for 30min
Add 250 ui AAV supernatant to each well
Incubate 24h at MX
Remove media/supernatant and replace with fresh complete neurobasal
Expression starts to be visible after 48h, saturates around 6-7 Days Post Infection
Constructs for AAV plasmid with GOI should not exceed 4.8kb including both FTRS.
[001082] Example of a human codon optimized sequence (i.e. being optimized for expression in humans) sequence : SaCas9 is provided below:
ACCGGTGCCACCATGTACCCATACGATGTTCCAGATTACGC
TT(Xi(X^GAAGAAAAA.GCGCAAGGTCGAAG(XiTCX^ATGAAAAGGAACTACATTCT
GGGGCTGGACATCGGGATTACAAGCGTGGGGTATGGGATTATTGACTATGAAAC
AAGGGACGTGATCGACGCAGGCGTCAGACTGTTCAAGGAGGCCAACGTGGAAAA
CAATGAGGGACGGAGAAGCAAGAGGGGAGCCAGGCGCCTGAAACGACGGAGAA
GGCACAGAATCCAGAGGGTGAAGAAACTGCTGTTCGATTACAACCTGCTGACCG
A( '{ ATTC I iAC X l C iAC n iGA Al l AAI C 'l'I Al i iAAGi C ^^i .Gi n iAAAC X ' rGA
GTCAGAAGCTGTCAGAGGAAGAGTTTTCCGCAGCTCTGCTGCACCTGGCTAAGC
GC X' 'GAGGAC ΠΧΧ ATAACGTi Λ ΛΊ jAGGTi iGAAGAi iGACAC X' XX X'AAC ( · i X'TG
TCTACAAAGGAACAGATCTCACGCAATAGCAAAGCTCTGGAAGAGAAGTATGTC
GCAGAGCTGCAGCTGGAACGGCTGAAGAAAGATGGCGAGGTGAGAGGGTCAATT AATAGGTTCAAGACAAGCGACTACGTCAAAGAAGCCAAGCAGCTGCTGAAAGTG CAGAAGGCTTACCACCAGCTGGATCAGAGCTTCATCGATACTTATATCGACCTGC
TGGAGACTCGGAGAACCTACTATGAGGGACCAGGAGAAGGGAGCCCCTTCGGAT
GGAAAGACA.TCAAGGAA.TGGTACGAGATGCTGATGGG.ACATTGCACCTATTTTCC
AGAAGAGCTGAGAAGCGTCAAGTACGCTTATAACGCAGATCTGTACAACGCCCT
(ιΛΑΊ ΪΛί (ΊΧΪΑΛ('ΑΛί ( ΊΧΪΟΊί Λ Γ(Α( C \iJGiJAl'(!AAAA('G/\GAAA(-1GCiAA rA
CTATGAGAAGTTCCAGATCATCGAAAACGTGTTTAAGCAGAAGAAAAAGCCTAC
ACTGAAACAGATTGCTAAGGAGATCCTGGTCAACGAAGAGGACATCAAGGGCTA
CCGGGTGACAAGCACTGGAAAACCAGAGTTCACCAATCTGAAAGTGTATCACGA
TATTAAGGACATCACAGCACGGAAAGAAATCATTGAGAACGCCGAACTGCTGGA
Ί(Α(;ΑΊΊί Ί \Α(:ΑΊΧΧΊΧ}Λ(Ί νΓ(Ί'Α(ΧΑ(;Λ(;(Ί(Χ'ί;Λί;(}Λ(ΑΊ ( ί ::ΑΑ(!Α(!
CTGACTAACCTGAACAGCGAGCTGACCCAGGAAGAGATCGAACAGATTAGTAAT
Figure imgf000314_0001
TGGATGAGCTGTGGCATACAAACGACAATCAGATTGCAATCTTTAACCGGCTGAA
GCTGGTCCCAAAAAAGGTGGACCTGAGTCAGCAGAAAGAGATCCCAACCACACT
GGTGGACGATTTCATTCTGTCACCCGTGGTCAAGCGGAGCTTCATCCAGAGCATCAA
AGTGATCAACGCCA.TCATCAAGAAGTACGGCCTGCCCAATGATATCA.TTATCGAGCT
GGCTAGGGAGAAGAACAGCAAGGACGCACAGAAGATGATCAATGAGATGCAGAAA
CGAAACCGGCAGACCAATGAACGCATTGAAGAGATTATCCGAACTACCGGGAAAGA
(IAACX AAAGX A(X1GA11X:AAAAAA1(-AA(X1X ACXiAI AliX-ACiGAGCiGAAAG'!'
GTCTGTATTCTCTGGAGGCCATCCCCCTGGAGGACCTGCTGAACAATCCATTCAACT
A( iiAiiGl'C ί;ΛΊ'('ΛΊΑΊ ΓΛΊ'('ί ( C\\{JAAGi (ΠΧ7Γ('ίΊΊ'( ί;Λί ΛΛΧΊ'('ίΊΊΊ ΛΛ(ΑΛ('Λ
AGGTGCTGGTCAAGCAGGAAGAGAACTCTAAAAAGGGCAATAGGACTCCTTTCCAG
TACCTGTCTAGTTCAGATTCCAAGATCTCTTACGAAACCTTTAAAAAGCACATTCTG
AATCTGGCCAAAGGAAAGGGCCGCATCAGCAAGACCAAAAAGGAGTACCTGCTGG
AAGAGCGGGACATCAACAGATTCTCCGTCCAGAAGGATTTTATTAACCGGAATCTG
( Π GGAC ACAAGATAC XX TAC1 CGC XX ·( ΧΊ GATG A A'! C'l GC TC )G( · ΑΊ ( ( ΤΑΊΊΊ ( { GG
GTGAACAATCTGGATGTGAAAGTCAAGTCCATCAACGGCGGGTTCACATCTTTTCTG
AGGCGCAAATGOAAGTITAAAAAGGAGCGCAACAAAGGGTACAAGCACCATGCCG
AAGATGCTCTGATTATCGCAAATGCCGACTTCATCTTTAAGGAGTGGAAAAAGCTGG
ACAAAGCCAAGAAAGTGATGGAGAACC AGATGTTCGAAGAGAAGCAGGCCGAATC TATGCCCGAAATCGAGACAGAACAGGAGTACAAGGAGATTTTCATCACTCCTCACC
AGATCAAGCATATCAAGGATTTCAAGGACTACAAGTACTCTCACCGGGTGGATAAA
AAGCCCAACAGAGAGCTGATCAATGACACCCTGTATAGTACAAGAAAAGACGATAA
( ιΛ ΛΊΑί Χ ί Ί·ί ; ΛΊΊ ΟΊ ί ; ΛΛ( ΑΛ· Γ( ΊΤ: Λ Λί ( iAC l C nAC iAC 'A AAG VrAA' rC i AC Λ
AGCTGAAAAAGCTGATCAACAAAAGTCCCGAGAAGCTGCTGATGTACCACCATGAT
( '( T( AGACATATC 'AC s AA AC TC s AAGC TC s ATTATC sGA.GC AC ·ΤΛ ( C ;G( C S AC i AG Λί J AA
CCCACTGTATAAGTACTATGAAGAGACTGGGAACTACCTGACCAAGTATAGCAAAA
AGGATAATGGCCCCGTGATCAAGAAGATCAAGTACTATGGGAACAAGCTGAATGCC
CATCTGGACATCACAGACGATTACCCTAACAGTCGCAACAAGGTGGTCAAGCTGTC
ACTGAAGCCATACAGATTCGATGTCTATCTGGACAACGGCGTGTATAAATTTGTGAC
TGTCAAGAATCTGGATGTCATCAAAAAGGAGAACTACTATGAAGTGAATAGCAAGT
GCTACGAAGAGGCTAAAAAGCTGAAAAAGATTAGCAACCAGGCAGAGTTCATCGCC
T( ( Τ!ΤΓΛ( ΛΛΓΛΛ ^
GTGAACAATGATCTGCTGAACCGCATTGAAGTGAATATGATTGACATCACTTACCGA GAGTATCTGGAAAACATGAATGATAAGCGCCCCCCTCGAATTATCAAAACAATTGC
CTCTAAGACTCAGAGTATCAAAAAGTACTCAACCGACATTCTGGGAAACCTGTATGA GGTGAAGAGCAAAAAGCACCCTCAGATTATCAAAAAGGGCTAAGAATTC
Example 35: Minimizing off-target cleavage using Cas9 nickase and two guide RNAs
[001083] Cas9 is a RNA-guided DNA nuclease that may be targeted to specific locations in the genome with the help of a 20bp RNA guide. However the guide sequence may tolerate some mismatches between the guide sequence and the DNA-target sequence. The flexibility is undesirable due to the potential for off-target cleavage, when the guide RNA targets Cas9 to a an off-target sequence that has a few bases different from the guide sequence. For all experimental applications (gene targeting, crop engineering, therapeutic applications, etc) it is important to be able to improve the specificity of Cas9 mediated gene targeting and reduce the likelihood of off- target modification by Cas9.
[001084] Applicants developed a method of using a Cas9 nickase mutant in combination with two guide RNAs to facilitate targeted double strand breaks in the genome without off-target modifications. The Cas9 nickase mutant may be generated from a Cas9 nuclease by disabling its cleavage activity so that instead of both strands of the DNA duplex being cleaved only one strand is cleaved. The Cas9 nickase may be generated by inducing mutations in one ore more domains of the Cas9 nuclease, e.g. Ruvcl or HNH. These mutations may include but are not limited to mutations in a Cas9 catalytic domain, e.g in SpCas9 these mutations may be at positions D10 or H840. These mutations may include but are not limited to DIOA, E762A, H840A, N854A, N863A or D986A in SpCas9 but niekases may be generated by inducing mutations at corresponding positions in other CRISPR enzymes or Cas9 orthologs. In a most preferred embodiment of the invention the Cas9 nickase mutant is a SpCas9 mckase with a DIOA mutation.
[001085] The way this works is that each guide RNA in combination with Cas9 nickase would induce the targeted single strand break of a duplex DNA target. Since each guide RNA nicks one strand, the net result is a double strand break. The reason this method eliminates off-target mutations is because it is very unlikely to have an off-target site that has high degrees of similarity for both guide sequences (20bp+2bp(PAM) = 22bp specificity for each guide, and two guides means any off-target site will have to have close to 44bp of homologous sequence). Although it is still likely that individual guides may have off-targets, but those off-targets will only be nicked, which is unlikely to be repaired by the mutagenic NHEJ process. Therefore the multiplexing of DNA double strand nicking provides a powerful way of introducing targeted DNA double strand breaks without off-target mutagenic effects.
[001086] Applicants carried out experiments involving the co-transfection of HE 293FT ceils with a plasmid encoding Cas9(D10A) nickase as well as DNA expression cassettes for one or more guides. Applicants transfected cells using Lipofectamme 2000, and transfected cells were harvested 48 or 72 hours after transfections. Double nicking-induced NHEJ were detected using the SURVEYOR nuclease assay as described previously herein (Figs. 51, 52 and 53).
[001087] Applicants have further identified parameters that relate to efficient cleavage by the Cas9 nickase mutant when combined with two guide RNAs and these parameters include but are not limited to the length of the 5' overhang. Efficient cleavage is reported for 5' overhang of at least 26 base pairs. In a preferred embodiment of the invention, the 5' overhang is at least 30 base pairs and more preferably at least 34 base pairs. Overhangs of up to 200 base pairs may be acceptable for cleavage, while 5' overhangs less than 100 base pairs are preferred and 5' overhangs less than 50 base pairs are most preferred (Figs. 54 and 55).
Example 36: Behavior Protocols [001088] Elevated Phis Maze. The Elevated Plus-Maze is used to assess anxiety-like behavior, exploiting the conflict between the innate fear that rodents have of open areas versus their desire to explore novel environments,
[001089] The apparatus used for the elevated plus maze test is made of stainless steel and consists of four arms (two open without walls and two enclosed by 15 cm high wails) 35 cm long and 5 em wide. Each ann of the maze is attached to sturdy metal legs such that it is elevated 40 cm off of the floor:
[001090] Mice are housed up to three per cage in a room with a 12 hr light/dark cycle with ad libitum access to food and water.
[001091] Behavioral testing is performed between 9:00 A.M. and 6:00 P.M in the brightly lighted room. All the cages containing mice are transferred to the behavior testing room 30 mm before the first trial begins.
[001092] A mouse is taken out of its cage and place at the junction of the open and closed arms, facing the open arm opposite to where the experimenter is and let for freely explore the maze for 5 min. During that lime animal is recorded and behavior is tracked. The total distance traveled in the open arms, time spent in open arms, the total number of transitions between amis, and the latency to enter the open ami are measured automatically with the Noldus software. At the end of the 5-min test, remove the rodent from the plus maze and place into a transport cage. Place back inside its homecage. The elevated plus maze is cleaned carefully and dry with paper towels before testing with another mouse.
[0Θ1093] Fear conditiomssg
[001094] Animals: 4-weeks old male mice (BL6J/57); 10 per group
[001095] Foot shock: 2 s; 0.5 mA
[001096] Protocol involved three phases:
0Θ1097] 1 . Exposure, which allowed the mice to acclimate and become familiar with the training chamber. For unpaired group: 2 min of acclimation, followed by presentation of the 20- sec tone cue, followed by an 80-sec interval, repeated six times. For paired group the acclimation period was 12 min.
[0010981 2. Training; mice were presented with the CS and or US stimuli. Acclimation period - 4 min. Six conditioning trials involving a tone (CS) and a shock (US) were run in trial epochs that lasted 100 sec (including the intertrial interval). For the paired group, each trial consisted of a 20-sec "baseline" interval, a 20-sec tone presentation, an 18-sec trace interval, a 2-sec shock, and a 40-sec post-shock interval. Trials were the same for the unpaired groups of mice except that the tone was omitted.
[001099] 3. Testing; mice were observed for freezing in response to each context and to the tone and trace-CS. Each phase occurred at 24-h intervals. Mice were allowed to move freely in the training (familiar) and test (altered; flat floor with a grid, bw patterns on the walls; vanillin scent) contexts for 3 min. Ail mice received four 100-sec testing trials. For all mice, each trial began with a 20-sec interval and the 20-sec tone presentation was followed by a 60-sec interval.
[001100] Scoring: All scoring was done based on video. The % of freezing was observed in 5- sec increments throughout each context test exposure and each 100-sec trial epoch. Freezing was scored as 1 or 0 i each time bin, if animal froze for at least 2s.
[001101] The data presented on the column charts is the average for the group of 7 animals, error bars represent SEM. The data on the line charts representing training testing process in time, and each point is the average of 7 animals, from 6 or 4 trials (training and testing protocol, respectively). Error bars represent SEM.
[001 02] Opera field. The Open Field apparatus is broadly used to assess exploratory behaviour and is validated for use in the measurement of anxiety related behaviours. Animals are placed in the square arena (40x40cm) for 10 min while their behavior is recorded. The total distance moved, velocity and time spent in the center of arena are scored.
[001103] Novel object recognition. The Novel Object Recognition test (NOR) is a popular test to stud)' learning and memory in rodents. It is based on their tendency to interact more with a novel object than with a familiar object. In general, animals are first placed in an apparatus and allowed to explore an object. After a prescribed interval, the animal is returned to the apparatus, which now contains the familiar object and a novel object. Object recognition is distinguished by more lime spent interacting with the novel object. The NOR. task is particularly attractive because it requires no external motivation, reward, or punishment but a little training or habituatio is required, and it can be completed i a relatively short time.
[001104] I Pretraining:
1. Followi g arrival in the colony, the animals are allowed to acclimatize for at least 3-7 d. 2. At lest 3 days before starting experiment animals are handled daily for at least 3 min per day and exposed to the transport routine.
3. Familiarization with the testing environment - 24 h before experiment animals are exposed to testing arena (40x40x35cm, clear walls) in the behavior room for 10 min.
[001105] II Object recognition training:
1. Two 'identical' to-be-familiarized (sample) objects are placed in the back left and right corners of the apparatus
2. Animal is placed at the mid-point of the wall opposite the sample objects, what
prevents any unintentional bias in placing the animal such that it is oriented more towards a particular side/object
3. The experimenter is recording the animal behavior using camera, staying behind the curtain so as not to serve as a cue for the animal or to introduce unintentional bias into the study.
4. After the planned sample-object exposure time (5-10 min), the animal is removed from the apparatus and return to the colony for planned training~to~testmg interval. The apparatus is cleaned with 70% ethanol between animals.
[0011 6] III Delay phase. Commonly used training-to-testing intervals vary from Ih (for robust object recognition) to 24 h.
[001107] IV Obj ect recognition test :
1. To test for object recognition after the training-to-testing interval, one of the familiar sample objects is placed in one back corner of the apparatus; the novel object Is placed in the other back corner.
2. Animal is placed in the apparatus as in step 11.2. The experimenter is recording
animal behavior, staying behind the curtain.
3. After the planned objects exposure time (3-5 min) animals is removed from apparatus and returned to colony. The apparatus is cleaned with 70% ethanol between animals.
[0011 OS] Data analysis: Recorded videos are used for later data analysis: a) directed contact scoring (total duration of animal contact with an object); b) within area scoring (an animal as "interacting" with the object when its nose is in contact with the object or directed at the object within minimal distance of 2cm). Commonly used measures include time with familiar object versus novel object, a difference score (novel object interaction - familiar object interaction), a discrimination ratio (novel object interaction/total interaction with, both objects). Object recognition in these measures is reflected by more time interacting with the novel than familiar object, a positive difference score or a discrimination ratio above 0.5, respectively.
[001109] Barnes maze. Carol Barnes developed a dry-land maze test for spatial Seaming and memory in 1979 where animals escaped from a brightly lit, exposed circular open platform surface to a smal l dark recessed chamber located under one of the 1 8 holes around the perimeter of the platform. Although it was initially invented for rats, the Barnes maze (BM) has become more popular to assess spatial memory in mice, taking advantage of their superior abilities to find and escape through small holes.
[001 110] Procedure:
[001111 ] 1 . Adaptation. Mouse is placed in a cylindrical black start chamber in the middle of the maze. After 10 s have elapsed chamber is removed and the buzzer is turned on together with strong light. Mouse is gently guided to the escape box. Once the mouse is inside the box, buzzer and light are turned off. The mouse should stay in the escape box for 2 min.
[00111.2] 2. Spatial acquisition. Mouse is placed in the cylindrical black start, chamber in the middle of the maze. After 10 s have the chamber is lifted and the buzzer and light are on. Mouse is allowed to explore the maze for 3 minutes. The trial ends when the mouse enters the goal tunnel or after 3 min have elapsed. Immediately after the mouse enters the tunnel, the buzzer and the light are turned off and the mouse is allowed to stay in the tunnel for 1 min.If the mouse does not reach the goal within 3 minutes the experimenter is guiding it gently to the escape box and leave the mouse inside for 1 min. Mouse stays in the home cage u til next trial. Whole trial is repeated 4 times in 15 minutes intervals during next 3-4 days.
[001113] 3. Reference memory trial. 24 h after the last training day, the probe trial is conducted. The target hole must be closed. Animal is placed in the middle of the maze under the cylindrical black start chamber and after 10 s the chamber is removed, the buzzer and the light are turned on. Mouse is removed from the maze after 90 s. The probe trial is done in order to determine if the animal remembers where the target goal was located. Number of pokes (errors) in each hole and latency and path length to reach the virtually target hole are measured .
Example 37: SaCas9 update
[001114] Figure 69 shows an AAV-Sa-Cas9 vector, a liver-specific AAV-Sa-Cas9 vector and an alternate AAV~Sa-Cas9 vector. [001115] Figure 70 shows data on optimized CMV-SaCas9~NLS-U6-sgRNA vector (submitted vector design last time); new data compares N'-term vs C'-term tagged SaCas9 and shows enhanced cleavage efficiency using C'-term NLS tagging.
[0011161 New targets were chosen in exons 4 and 5 of the mouse Pcsk9 gene (sequences and locations below). Exons 4-5 lie downstream of a Pcsk9 N-terminal pro-domain region that is proteo lyrically cleaved upon protein maturation, and indels in this downstream region are expected to lead to protein degradation. Pcsk9 is involved in cycling and negative regulation of the LDL-reeeptor, and loss of Pcsk9 should indirectly lead to lowered plasma cholesterol levels.
[001117] SgRNAs were cloned into AAV vector and tested for indel activity in Hepal -6 mouse hepatocyte cell line in single vector transfection. 500ng of vector was transfected into 200,000 Hepal -6 cells by Lipofeetamine 2000 and DNA collected for SURVEYOR assay, showing cleavage of Pcsk9.
pAAV-CMV-SaCas9-NLS-U6-sgRNA(231 : atctcttagataccagcatc)
pAAV-CMV-SaCas9-NLS-U6-sgRNA(232: tcaatctcccgatgggcacc)
pAAV-CMV-SaCas9-NLS-U6-sgRNA(233 : gcccatcgggagattgaggg)
pAAV-CMV-SaCas9-NLS-U6-sgRNA(234: acttcaacagcgtgccggag)
pAAV-CMV-SaCas9-NLS-U6-sgRNA(235 : ccgctgaccacacctgccag)
pAAV-CMV-SaCas9-NLS-U6-sgRNA(236: tggcaggtgtggtcagcggc)
[001118] Figure 71 shows SURVEYOR image showing indels generated by new Pcsk9 targets.
[0011191 Figure 72 shows SaCas9 specificity: genome-wide off target sites (GWOTs) are predicted based on 2 criteria: they contain 4 or fewer mismatched bases to intended SaCas9 target and bear the least restrictive PAM for SaCas9, NNGRR. HEK 293 FT cells are transfected with either SpCas9 or SaCas9 with their corresponding sgRNAs at a target site (EMX1 : TAGGGTTAGGGGCCCCAGGC) that has CGGGGT as a PAM so that it can be cut by either SpCas9 (CGG) or SaCas9 (CGGGGT). DNAs from cells are harvested and analyzed for indels by Illumina sequencing at on-target and 41 predicted off-target loci (following protocols from Hsu et al. Nature Biotech 2013 and data analysis pipeline developed by David Scott and Josh Weinstein).
[0011201 Figure 73 shows that that SaCas9 may have a higher level of off-target activity than SpCas9 at certain loci. [001121] While preferred embodiments of the present invention have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the invention. It should be understood that various alternatives to the embodiments of the invention described herein may be employed in practicing the invention.
References
Banker G, Gosiin K. Developments in neuronal cell culture. Nature. 1988 Nov 10;336(6195): 185-6.
Bedell, V.M. et al. In vivo genome editing using a high-efficiency TALEN system. Nature 491, 1 14-U133 (2012).
Bhaya, D., Davison, M. &. Barrangou, R. CRISPR-Cas systems in bacteria and archaea: versatile small RNAs for adaptive defense and regulation, Annu Rev Genet 45, 273-297 (2011).
Bobis-Wozowicz, S., Osiak, A., Rahman, S.H. & Cathomen, T. Targeted genome editing in pluripotent stem cells using zinc-finger nucleases. Methods 53, 339-346 (2011).
Boeh, J. et al. Breaking the code of DNA binding specificity of TAL-type III effectors. Science 326, 1509-1512 (2009).
Bogenhagen, D.F. & Brown, D.D. Nucleotide sequences in Xenopus 5S DNA required for transcription termination. Ceil 24, 261-270 (1981).
Bultmann, S. et al. Targeted transcriptional activation of silent oct4 pluripotency gene by combining designer TALEs and inhibition of epigenetic modifiers. Nucleic Acids Res 40, 5368- 5377 (2012).
Carlson, D.F. et al. Efficient TALEN-mediated gene knockout in livestock. Proc Natl Acad Sci U S A 109, 17382-17387 (2012).
Chen, F.Q. et al. High-frequency genome editing using ssDNA oligonucleotides with zinc-finger nucleases. Nat Methods 8, 753-U796 (201 1 ).
Cho, S.W., Kim, S., Kim, J.M. & Kim, J.S. Targeted genome engineering in human cells with the Cas9 RNA-euided endonuclease. Nat Biotechnol 31, 230-232 (2013).
Christian, M. et al. Targeting DNA double-strand breaks with TAL effector nucleases. Genetics 186, 757-761 (2010). Cong, L. et al. Multiplex genome engineering using CRISPR-Cas systems. Science 339, 819-823 (2013).
Deltcheva, E, et ai. CRISPR RNA maturation by trans-encoded small RNA and host factor RNase III Nature 471 , 602-607 (201 1 ).
Deveau, EL, Gameau, J.E. & Moineau, S. CRISPR-Cas system and its role in phage- bacteria interactions. Annu Rev Microbiol 64, 475-493 (2010).
Ding, Q. et ai. A TALEN genome-editing system for generating human stem cell-based disease models. Cell Stem Ceil 12, 238-251 (2013).
Gameau, J.E. et ai. The CRISPR-Cas bacterial immune system cleaves bacteriophage and plasmid DNA. Nature 468, 67-71 (2010).
Gasiunas, G., Barrangou, R., Horvath, P. & Siksuy.s. V. Cas9-crRNA ribonucleoprotein complex mediates specific DNA cleavage for adaptive immunity in bacteria. Proc Natl Acad Sci U S A 109, E2579-2586 (2012).
Geurts, A.M. et ai. Knockout Rats via Embryo Microinjection of Zinc-Finger Nucleases. Science 325, 433-433 (2009).
Gray SJ, Foti SB, Schwartz JW, Bachaboina L, Taylor-Blake B, Coleman J, Ehlers MD, Zylka MJ, McCown TJ, Samulski RJ. Optimizing promoters for recombinant adeno-associated virus-mediated gene expression in the peripheral and central nervous system using self- complementary vectors. Hum Gene Ther. 2011 Sep;22(9): l 143-53. doi: 10.1089/hum.2010.245.
Gusehirs, D.Y. et al. A rapid and general assay for monitoring endogenous gene modification. Methods Mol Biol 649, 247-256 (2010).
Hasty, P., Rivera-Perez, J. & Bradley, A. The length of homology required for gene targeting in embryonic stem cells. Mol Cell Biol 1 1, 5586-5591 (1991 ).
Horvath, P. & Barrangou, R. CRISPR-Cas, the immune system of bacteria and archaea. Science 327, 167-170 (2010).
Hsu, P.D. & Zhang, F. Dissecting neural function using targeted genome engineering technologies. ACS Chem Neurosci 3, 603-610 (2012).
Hwang, W.Y. et al. Efficient genome editing in zebrafish using a CRISPR-Cas system. Nat Biotechnol 31, 227-229 (2013).
Jiang, W., Bikard, D., Cox, D., Zhang, F. & Marraffmi, L.A. RNA-guided editing of bacterial genomes using CRISPR-Cas systems. Nat Biotechnol 31, 233-239 (2013). Jinek, M. et al, A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity. Science 337, 816-821 (2012).
Jinek, M, et al. RNA-programmed genome editing in human cells. eLife 2, e00471
(2013).
Kaplitt, M.G., et al, Safety and toierability of gene therapy with an adeno-associated vims (AAV) borne GAD gene for Parkinson's disease: an open label, phase I trial. Lancet. 2007 Jun 23;369(9579):2097-105.
Levitt N. Briggs D. Gil A. Proudfooi N.J. Definition of an efficient synthetic poly(A) site. Genes Dev. 1989;3 : 1019- 1025.
Liu D, Fischer I. Two alternative promoters direct neuron-specific expression of the rat microtubule-associated protein I B gene. J eurosci. 1996 Aug 15;16(! 6):5026~36.
Lopes, V.S., etc al., Retinal gene therapy with a large MY07A cDNA using adeno- assocaited virus. Gene Ther, 2013 Jan 24. doi: 10.1038/gt 2013.3. [Epub ahead of print]
Mahfouz, M.M. et al, De novo-engineered transcription activator-like effector (TALE) hybrid nuclease with novel DNA binding specificity creates double-strand breaks. Proc Natl Acad Sci U S A 108, 2623-2628 (201 1 ).
Makarova, K.S. et al. EvoliUion and classification of the CRJSPR-Cas systems. Nat Rev Microbiol 9, 467-477 (201 1).
Mali, P. et al. RNA-guided human genome engineering via Cas9. Science 339, 823-826
(2013).
McClure C, Cole KL, Wulff P, Klugmann M, Murray AJ. Production and titering of recombinant adeno-associated viral vectors. J Vis Exp. 2011 Nov 27;(57):e3348. doi:
10.3791/3348.
Michaelis, L.M., Maud "Die kinetik der invertinwirkung. " . Biochem. z (1913).
Miller, j.C. et ai. An improved zinc-finger nuclease architecture for highly specific genome editing. Nat Biotechnoi 25, 778-785 (2007).
Miller, J.C. et al. A TALE nuclease architecture for efficient genome editing. Nat Biotechnoi 29, 143-148 (2011).
Moscou, M.J. & Bogdanove, AJ. A simple cipher governs DNA recognition by TAL effectors. Science 326, 1501 (2GQ9).Porteus, M.H. & Baltimore, D, Chimeric nucleases stimulate gene targeting in human cells. Science 300, 763 (2003). Mussolino, C. et al. A novel TALE nuclease scaffold enables high genome editing activity in combination with low toxicity. Nucleic acids research 39, 9283-9293 (2011).
Nathwani, A.C., et al., Adenovirus-associated vims vector-mediated gene transfer in hemophilia B. N Engl J Med. 201 1 Dec 22;365(25):2357-65. doi: 10.1056 NEJMoal 108046. Epub 2011 Dec 10.
Oliveira, T.Y. et al. Translocation capture sequencing: a method for high throughput mapping of chromosomal rearrangements. J Immunol Methods 375, 176- 181 (2012).
Perez, E.E. et al. Establishment of HIV- 1 resistance in CD4(+) T cells by genome editing using zinc-finger nucleases. Nat Biotechnol 26, 808-816 (2008).
Qi, L.S. et al. Repurposing CRISPR as an RNA-guided platform for sequence-specific control of gene expression. Cel l 152, 1173-1183 (2013).
REMINGTON'S PHARMACEUTICAL SCIENCES (Mack Pub. Co., N.J. 1991)
Reyon, D. et al. FLASH assembly of TALENs for high-throughput genome editing. Nat Biotechnol 30, 460-465 (2012).
Saleh-Gohari, N. & Helleday, T. Conservative homologous recombination preferentially repairs DNA double-strand breaks in the S phase of the cell cycle in human cells. Nucleic Acids Res 32, 3683-3688 (2004).
Sander, J.D. et al. Selection-free zinc-fingcr-nuclease engineering by context-dependent assembly (CoDA). Nat Methods 8, 67-69 (2011).
Sanjana, N.E, et al. A transcription activator-like effector toolbox for genome engineering. Nat Protoc 7, 171-192 (2012).
Sapranauskas, R. et al The Streptococcus thermophiius CRISPR-Cas system provides immunity in Escherichia coli. Nucleic Acids Res 39, 9275-9282 (201 1).
Shen, B. et al. Generation of gene-modified mice via Cas9/RNA-mediated gene targeting. Cell Res 23, 720-723 (2013).
Smithies, O., Gregg, R.G., Boggs, S.S., oralewski, M.A. & Kucherlapati, R.S. Insertion of DNA sequences into the human chromosomal beta-globin locus by homologous recombination. Nature 317, 230-234 (1985).
Soldner, F, et al. Generation of isogenic pluripotent stem cells differing exclusively at two early onset Parkinson point mutations. Ceil 146, 318-331 (2011). Takasu, Y. et al. Targeted mutagenesis in the silkworm Bombyx mori using zinc finger nuclease mR A injection. Insect Biochem Molec 40, 759-765 (2010).
Tangri S, et al., Rationally engineered therapeutic proteins with reduced immunogenicity, J Immunol. 2005 Mar 15; 174(6):3187-96.
Thomas, .R., Foiger, .R. & Capecchi, M.R. High frequency targeting of genes to specific sites in the mammalian genome. Cell 44, 419-428 (1986),
Tuschl, T. Expanding small RNA interference. Nat Biotechnoi 20, 446-448 (2002).
Urnov, F.D., Rebar, E.J., Holmes, M.C., Zhang, H.S. & Gregory, P.D. Genome editing with engineered zinc finger nucleases. Nat Rev Genet 11, 636-646 (2010).
Va!ton, J. et al. Overcoming transcription activator-like effector (TALE) DNA binding domain sensitivity to cytosine methylation. .1 Biol Che 287, 38427-38432 (2012).
Wang, H. et al. One-Step Generation of Mice Carrying Mutations in Multiple Genes by CRISPR-Cas-Mediated Genome Engineering. Cell 153, 910-91 8 (2013).
Watanabe, T. et al. Non-transgenic genome modifications in a hemimetabolous insect using zinc-finger and TAL effector nucleases. Nat Commun 3 (2012).
Wilson, E.B. Probable inference, the law of succession, and statistical inference. J Am Stat Assoc 22, 209-212 (1927).
Wood, A.J. et al. Targeted genome editing across species using ZFNs and TALENs. Science 333, 307 (2011).
Wu, S., Yirsg, G.X., Wu, Q. & Capecchi, M.R. A protocol for constructing gene targeting vectors: generating knockout mice for the cadherin family and beyond. Nat Protoc 3, 1056-1076 (2008).
Zhang, F. et al. Efficient construction of sequence-specific TAL effectors for modulating mammalian transcription. Nat Biotechnoi 29, 149-153 (2011).

Claims

WHAT IS CLAIMED IS:
I . A method of modifying an organism or a non-human organism by manipulation of a target sequence in a genomic locus of interest comprising
delivering a non-natural ly occurring or engineered composition comprising :
A) - L a CRISPR-Cas system chimeric RNA (chiRNA) polynucleotide sequence, wherein the polynucleotide sequence comprises:
(a) a guide sequence capable of hybridizing to a target sequence in a eukaryotic cel l,
(b) a tracr mate sequence, and
(c) a tracr sequence, and
II. a polynucleotide sequence encoding a CRISPR enzyme, optionally comprising at least one or more nuclear localization sequences,
wherein (a), (b) and (c) are arranged in a 5' to 3' orientation,
wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR comple to the target sequence, and
wherein the CRISPR complex comprises the CRISPR enzyme complexed with ( 1 ) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence and the polynucleotide sequence encoding a CRISPR enzyme is DNA or RNA,
or
(B) I. polynucleotides comprising:
(a) a guide sequence capable of hybridizing to a target sequence in a eukaryotic cell, and
(b) at least one or more tracr mate sequences,
II. a polynucleotide sequence encoding a CRISPR enzyme, and
III. a polynucleotide sequence comprising a tracr sequence,
wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and
wherein the CRISPR. complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence, and the polynucleotide sequence encoding a CRISPR enzyme is DNA or RNA.
2. The method of claim 1, wherein any or all of the polynucleotide sequence encoding a CRISPR enzyme, guide sequence, tracr mate sequence or tracr sequence, is/are RNA.
3. The method of claim 1 or 2, wherein the polynucleotides encoding the seque ce encoding a CRISPR enzyme, the guide sequence, tracr mate sequence or tracr sequence is/are RNA and are delivered via liposomes, nanoparticies, exosomes, microvesicles, or a gene-gun.
4. The method of any of claims 1 to 3, wherein the polynucleotides are comprised within a vector system comprising one or more vectors.
5. A method of modifying an organism or a non -human organism by manipulation of a target sequence in a genomic locus of interest comprising
delivering a non-naturally occurri g or engineered compositio comprising a viral vector system comprising one or more viral vectors operably encoding a composition for expression thereof, wherein the composition comprises:
(A) a non-naturally occurring or engineered composition comprising a vector system comprising one or more vectors comprising
I. a first regulatory element operably linked to a CRISP R-Cas system chimeric RNA (chiRNA) polynucleotide sequence, wherein the polynucleotide sequence comprises
(a) a guide sequence capable of hybridizing to a target sequence in a eukaryotic cell,
(b) a tracr mate sequence, and
(c) a tracr sequence, and
II. a second regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme, optionally comprising at least one or more nuclear localization sequences, wherein (a), (b) and (c) are arranged in a 5' to 3' orientation,
wherein components I and II are located on the same or different vectors of the system, wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and
wherein the CR ISPR complex comprises the CRISPR enzyme complexed with (1 ) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence, or
(B) a non-naturally occurring or engineered composition comprising a vector system comprising one or more vectors comprising
I. a first regulator}? element operably linked to
(a) a guide sequence capable of hybridizing to a target sequence in a eukaryotic cell, and
(b) at least one or more tracr mate sequences,
II. a second regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme, and
ΙΪΪ. a third regulatory element operably linked to a tracr sequence,
wherein components L II and I II are located on the same or different vectors of the system,
wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and
wherein the CRISPR. complex comprises the CRISPR enzyme complexed with (1 ) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence.
6. The method of claim 5, wherein one or more of the viral vectors are delivered via liposomes, nanoparticles, exosomes, microvesicles, or a gene-gun.
7. A method of treating or inhibiting a condition caused by a defect in a target sequence in a genomic locus of interest in a subject or a non-human subject in need thereof comprising modifying the subject or a non-human subject by manipulation of the target sequence and wherein the condition is susceptible to treatment or inhibition by manipulation of the target sequence comprising providing treatment comprising:
delivering a non-naturally occurring or engineered composition comprising an AAV or lenti virus vector system, comprising one or more AAV or lentivirus vectors operably encoding a composition for expression thereof, wherein the target sequence is manipulated by the composition when expressed, wherein the composition comprises:
(A) a non-natural Sy occurring or engineered composition comprising a vector system comprising one or more vectors comprising ]. a first regulatory element operably linked to a CRISPR-Cas system chimeric RNA (chiRNA) polynucleotide sequence, wherein the polynucleotide sequence comprises
(a) a guide sequence capable of hybridizing to a target sequence in a eukaryotic ceil,
(b) a tracr mate sequence, and
(c) a tracr sequence, and
Π. a second regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme comprising at least one or more nuclear localization sequences,
wherein (a), (b) and (c) are arranged in a 5' to 3' orientation,
wherein components I and II are located on the same or different vectors of the system, wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR comple to the target sequence, and
wherein the CRISPR complex comprises the CRISPR enzyme complexed with ( 1 ) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence,
or
(B) a non-naturally occurring or engineered composition comprising a vector system comprising one or more vectors comprising
I. a first regulatory element operably linked to
(a) a guide sequence capable of hybridizing to a target sequence in a eukaryotic cell, and
(b) at least one or more tracr mate sequences,
II. a second regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme, and
HI. a third regulatory element operably linked to a tracr sequence,
wherein components 1, II and III are located on the same or different vectors of the system,
wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and wherein the CRISPR complex comprises the CRISPR enzyme eomplexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence.
8. The method of any preceding claim, wherein the method is carried out in vitro, and/or ex vivo,
9. The method of any preceding claim including inducing expression.
10. The method of any preceding claim wherein the organism or subject is a eukaryote.
1 1. The method of claim 10 wherein the organism or subject is a non-human eukaryote.
12. The method of any of claims 1 to 1 1 wherein the organism or subject is a mammal or a non~hurnan mammal.
13. The method of any of claims 4 to 8 wherein the viral vector is an AAV or lenti viral vector.
14. The method according to any preceding claim wherein the CRISPR enzyme is a Cas9.
15. The method according to any preceding claim wherein expression of the guide sequence is under the control of the T7 promoter and is driven by the expression of T7 polymerase.
16. A method of delivering a CRISPR enzyme of any preceding claim, comprising delivering to a cell mRNA encoding the CRISPR enzyme.
17. The method of any one of claims 1 to 16, wherein the polynucleotide or enzyme coding sequence encoding the CRISPR enzyme is delivered to the ceil by delivering mRNA encoding the CRISPR enzyme to the cell.
1 8. A method of preparing the AAV or lentivirus vector of claim 7 comprising transfecting piasmid(s) containing or consisting essentially of nucleic acid moleeulc(s) coding for the AA.V or lenti virus into AAV~mfected or lentivirus-infected cells, and supplying AAV AAV or lentiviras rep and/or cap and/or helper nucleic acid molecules obligatory for replication and packaging of the AAV or lentivirus.
19. A method of preparing an AAV or lentivirus vector for use in the method of claim 7, comprising transfecting plasmid(s) containing or consisting essentially of nucleic acid molecule(s) coding for the AAV or lentivirus into AAV-infected or lentivirus-infected cells, and supplying AAV AAV or lentivirus rep and/or cap and/or helper nucleic acid molecules obligatory for replication and packaging of the AAV or lentivirus.
20. The method of claim 18 or 19 wherein the AAV or lentivirus rep and/or cap obligatory for replication and packaging of the AAV or lentivirus are supplied by transfecting the ceils with helper plasmid(s) or helper virus(es).
21. The method of claim 20 wherein the helper vims is a poxvirus, adenovirus, lentivirus, herpesvirus or bacuio virus.
22. The method of claim 21 wherein the poxvirus is a vaccinia virus.
23. The method of any of claims 18 to 22 wherein the cells are mammalian ceils.
24. The method of any of claims 18 to 22 wherein the cells are insect cells and the helper virus (where present) is baeulovirus.
25. The method of any of claims 1 to 15 wherein the target sequence is flanked at its 3' end or followed by 5' -NRG (where N is any Nucleotide), or where the CR iSPR enzyme is (or is derived from) a genus belonging to the group consisting of Corynebacter, Sutterella, Legionella, Treponema, Filifactor, Eubacterium, Streptococcus, Lactobacillus, Mycoplasma, Bacteroides, Flaviivola, Flavobacterium, Sphaerochaeta, Azospirillum, Gluconacetobacter, Neisseria, Roseburia, Parvibaculum, Staphylococcus, Nitratifractor, Mycoplasma and Campylobacter. ,
26. A composition as defined in any of claims 1 -25 for use in medicine or in therapy.
27. A composition as defined in any of claims 1-25 for use in a method of modifying an organism or a non-human organism by manipulation of a target sequence in a genomic locus of interest or in a method of treating or inhibiting a condition caused by a defect in a target sequence in a genomic locus of interest.
28. Use of a composition as defined in any of claims 1-25 in ex vivo gene or genome editing.
29. Use of a composition as defined in any of claims 1-25 in the manufacture of a medicamen t for ex vivo gene or genome editing or for use in a method of modifying an organism or a non-human organism by manipulation of a target sequence in a genomic locus of interest or in a method of treating or inhibiting a condition caused by a defect in a target sequence in a genomic locus of interest.
30. A composition comprising:
A) - I. a CRISPR-Cas system chimeric RNA (chiRNA) polynucleotide sequence, wherein the polynucleotide sequence comprises:
(a) a guide sequence capable of hybridizing to a target sequence in a eukaryotic cell, (b) a tracr mate sequence, and
(c) a tracr sequence, and
II. a polynucleotide sequence encoding a CRISPR enzyme, optionally comprising at least one or more nuclear localization sequences,
wherein (a), (b) and (c) are arranged in a 5' to 3' orientation,
wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and
wherein the CRISPR complex comprises the CRISPR enzyme complexed with ( 1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence and the polynucleotide sequence encoding a CRISPR enzyme is DNA or RNA,
or
(B) I. poly ucleotides comprisi g:
(a) a guide sequence capable of hybridizing to a target sequence in a eukaryotic cell, and ( b) at least one or more tracr mate sequences,
II. a polynucleotide sequence encoding a CRISPR enzyme, and
III. a polynucleotide sequence comprising a tracr sequence,
wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and
wherein the CR ISPR complex comprises the CRISPR enzyme complexed wit (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence, and the polynucleotide sequence encoding a CRISPR enzyme is DNA or RNA;
for use in medicine or therapy; or for use in a method of modifying an organism or a non- human organism by manipulation of a target sequence in a genomic locus of interest; or for use in a method of treating or inhibiting a condition caused by a defect in a target sequence in a genomic locus of mterest; or for use in ex vivo gene or genome editing.
31. The composition of claim 30, wherein the polynucleotides are comprised within a vector system comprising one or more vectors.
PCT/US2013/074667 2012-12-12 2013-12-12 Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications Ceased WO2014093622A2 (en)

Priority Applications (103)

Application Number Priority Date Filing Date Title
SG11201504523UA SG11201504523UA (en) 2012-12-12 2013-12-12 Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
EP23192255.0A EP4299741A3 (en) 2012-12-12 2013-12-12 Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
EP15179123.3A EP3031921B1 (en) 2012-12-12 2013-12-12 Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
HK16102950.6A HK1215048B (en) 2012-12-12 2013-12-12 Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
EP25158109.6A EP4549566A3 (en) 2012-12-12 2013-12-12 Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
ES13814362.3T ES2658401T3 (en) 2012-12-12 2013-12-12 Supply, modification and optimization of systems, methods and compositions for the manipulation of sequences and therapeutic applications
JP2015547543A JP2016501531A (en) 2012-12-12 2013-12-12 Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
IL293526A IL293526A (en) 2012-12-12 2013-12-12 C delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
RU2015128057A RU2721275C2 (en) 2012-12-12 2013-12-12 Delivery, construction and optimization of systems, methods and compositions for sequence manipulation and use in therapy
KR1020157018653A KR20150105956A (en) 2012-12-12 2013-12-12 Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
EP17199166.4A EP3327127B1 (en) 2012-12-12 2013-12-12 Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
CA2894681A CA2894681C (en) 2012-12-12 2013-12-12 Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
AU2013359199A AU2013359199C1 (en) 2012-12-12 2013-12-12 Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
MX2015007550A MX389793B (en) 2012-12-12 2013-12-12 SUPPLY, MODIFICATION AND OPTIMIZATION OF SYSTEMS, METHODS AND COMPOSITIONS FOR SEQUENCE MANIPULATION AND THERAPEUTIC APPLICATIONS.
BR112015013784A BR112015013784A2 (en) 2012-12-12 2013-12-12 application, manipulation and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
DK13814362.3T DK2931897T3 (en) 2012-12-12 2013-12-12 CONSTRUCTION, MODIFICATION AND OPTIMIZATION OF SYSTEMS, PROCEDURES AND COMPOSITIONS FOR SEQUENCE MANIPULATION AND THERAPEUTICAL APPLICATIONS
EP13814362.3A EP2931897B1 (en) 2012-12-12 2013-12-12 Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
CN201380072752.2A CN105164264B (en) 2012-12-12 2013-12-12 Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
IL239317A IL239317B (en) 2012-12-12 2013-12-12 Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
PCT/US2014/041803 WO2014204725A1 (en) 2013-06-17 2014-06-10 Optimized crispr-cas double nickase systems, methods and compositions for sequence manipulation
KR1020167001293A KR20160034901A (en) 2013-06-17 2014-06-10 Optimized crispr-cas double nickase systems, methods and compositions for sequence manipulation
SG11201510284XA SG11201510284XA (en) 2013-06-17 2014-06-10 Delivery and use of the crispr-cas systems, vectors and compositions for hepatic targeting and therapy
CA2915842A CA2915842C (en) 2013-06-17 2014-06-10 Delivery and use of the crispr-cas systems, vectors and compositions for hepatic targeting and therapy
RU2016101200A RU2716420C2 (en) 2013-06-17 2014-06-10 Delivery and use of systems of crispr-cas, vectors and compositions for targeted action and therapy in liver
HK16111707.3A HK1223645B (en) 2013-06-17 2014-06-10 Optimized crispr-cas double nickase systems, methods and compositions for sequence manipulation
EP20195409.6A EP3825406A1 (en) 2013-06-17 2014-06-10 Delivery and use of the crispr-cas systems, vectors and compositions for hepatic targeting and therapy
DK14734710.8T DK3011031T3 (en) 2013-06-17 2014-06-10 PERFORMANCE AND APPLICATION OF CRISPR-CAS SYSTEMS, VECTORS AND COMPOSITIONS FOR LIVER TARGET DIRECTION AND THERAPY
MX2015017312A MX2015017312A (en) 2013-06-17 2014-06-10 SUPPLY AND USE OF CRISPR-CAS COMPOSITIONS, VECTORS AND SYSTEMS FOR DIRECTED MODIFICATION AND HEPATIC THERAPY.
KR1020247039028A KR20240172759A (en) 2013-06-17 2014-06-10 Delivery and use of the crispr-cas systems, vectors and compositions for hepatic targeting and therapy
CN201480045707.2A CN107995927B (en) 2013-06-17 2014-06-10 Delivery and use of CRISPR-CAS systems, vectors and compositions for liver targeting and therapy
KR1020167001295A KR20160030187A (en) 2013-06-17 2014-06-10 Delivery and use of the crispr-cas systems, vectors and compositions for hepatic targeting and therapy
CA2915837A CA2915837A1 (en) 2013-06-17 2014-06-10 Optimized crispr-cas double nickase systems, methods and compositions for sequence manipulation
EP23166208.1A EP4245853A3 (en) 2013-06-17 2014-06-10 Optimized crispr-cas double nickase systems, methods and compositions for sequence manipulation
AU2014281028A AU2014281028B2 (en) 2013-06-17 2014-06-10 Delivery and use of the CRISPR-Cas systems, vectors and compositions for hepatic targeting and therapy
JP2016521451A JP6738728B2 (en) 2013-06-17 2014-06-10 Delivery and use of CRISPR-Cas systems, vectors and compositions for liver targeting and therapy
AU2014281027A AU2014281027A1 (en) 2013-06-17 2014-06-10 Optimized CRISPR-Cas double nickase systems, methods and compositions for sequence manipulation
SG10201710486XA SG10201710486XA (en) 2013-06-17 2014-06-10 Delivery and Use of the Crispr-Cas Systems, Vectors and Compositions for Hepatic Targeting and Therapy
CN201480045703.4A CN105492611A (en) 2013-06-17 2014-06-10 Optimized CRISPR-CAS double nickase systems, methods and compositions for sequence manipulation
JP2016521450A JP6665088B2 (en) 2013-06-17 2014-06-10 Optimized CRISPR-Cas double nickase system, method and composition for sequence manipulation
BR112015031608A BR112015031608A2 (en) 2013-06-17 2014-06-10 APPLICATION AND USE OF CRISPR-CAS SYSTEMS, VECTORS AND COMPOSITIONS FOR LIVER TARGETING AND THERAPY
EP14734710.8A EP3011031B1 (en) 2013-06-17 2014-06-10 Delivery and use of the crispr-cas systems, vectors and compositions for hepatic targeting and therapy
EP14734709.0A EP3011030B1 (en) 2013-06-17 2014-06-10 Optimized crispr-cas double nickase systems, methods and compositions for sequence manipulation
PCT/US2014/041804 WO2014204726A1 (en) 2013-06-17 2014-06-10 Delivery and use of the crispr-cas systems, vectors and compositions for hepatic targeting and therapy
CN202110793075.XA CN113425857B (en) 2013-06-17 2014-06-10 Delivery and use of CRISPR-Cas systems, vectors and compositions for liver targeting and treatment
JP2016521453A JP6702858B2 (en) 2013-06-17 2014-06-11 Delivery, use and therapeutic applications of CRISPR-Cas systems and compositions for targeting disorders and diseases using viral components
CN201480045708.7A CN105683379A (en) 2013-06-17 2014-06-11 Delivery, engineering and optimization of systems, methods and compositions for targeting and modeling diseases and disorders of post mitotic cells
CN201480045709.1A CN105793425B (en) 2013-06-17 2014-06-11 Delivery, use and therapeutic applications of CRISPR-CAS systems and compositions for targeting disorders and diseases using viral components
CA2915845A CA2915845A1 (en) 2013-06-17 2014-06-11 Delivery, engineering and optimization of systems, methods and compositions for targeting and modeling diseases and disorders of post mitotic cells
EP14735795.8A EP3011032B1 (en) 2013-06-17 2014-06-11 Delivery, engineering and optimization of systems, methods and compositions for targeting and modeling diseases and disorders of post mitotic cells
BR122021009076-9A BR122021009076B1 (en) 2013-06-17 2014-06-11 VIRAL VECTOR CONTAINING HETEROLOGOUS NUCLEIC ACID MOLECULE(S), COMPOSITION, USE AND METHODS THEREOF
RU2016101178A RU2725502C2 (en) 2013-06-17 2014-06-11 Delivery, construction and optimization of systems, methods and compositions for targeted action and modeling of diseases and disorders of postmitotic cells
JP2016521452A JP6738729B2 (en) 2013-06-17 2014-06-11 Delivery, engineering and optimization of systems, methods and compositions for targeting and modeling postmitotic cell diseases and disorders
SG10201710487VA SG10201710487VA (en) 2013-06-17 2014-06-11 Delivery, Use and Therapeutic Applications of the Crispr-Cas Systems and Compositions for Targeting Disorders and Diseases Using Viral Components
SG10201710488TA SG10201710488TA (en) 2013-06-17 2014-06-11 Delivery, Engineering and Optimization of Systems, Methods and Compositions for Targeting and Modeling Diseases and Disorders of Post Mitotic Cells
PCT/US2014/041808 WO2014204728A1 (en) 2013-06-17 2014-06-11 Delivery, engineering and optimization of systems, methods and compositions for targeting and modeling diseases and disorders of post mitotic cells
CA2915795A CA2915795C (en) 2013-06-17 2014-06-11 Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using viral components
EP19171576.2A EP3620524A1 (en) 2013-06-17 2014-06-11 Delivery, engineering and optimization of systems, methods and compositions for targeting and modeling diseases and disorders of post mitotic cells
SG11201510327TA SG11201510327TA (en) 2013-06-17 2014-06-11 Delivery, engineering and optimization of systems, methods and compositions for targeting and modeling diseases and disorders of post mitotic cells
AU2014281031A AU2014281031B2 (en) 2013-06-17 2014-06-11 Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for targeting disorders and diseases using viral components
PCT/US2014/041809 WO2014204729A1 (en) 2013-06-17 2014-06-11 Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using viral components
DK14735795.8T DK3011032T3 (en) 2013-06-17 2014-06-11 MANUFACTURING, MODIFICATION AND OPTIMIZATION OF SYSTEMS, PROCEDURES AND COMPOSITIONS FOR TARGETING AGAINST AND MODELING DISEASES AND DISORDERS IN POSTMITOTIC CELLS
EP14736206.5A EP3011034B1 (en) 2013-06-17 2014-06-11 Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using viral components
KR1020167001039A KR20160019553A (en) 2013-06-17 2014-06-11 Delivery, engineering and optimization of systems, methods and compositions for targeting and modeling diseases and disorders of post mitotic cells
KR1020257000942A KR20250012194A (en) 2013-06-17 2014-06-11 Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using viral components
MX2015017311A MX374531B (en) 2013-06-17 2014-06-11 SUPPLY, MODIFICATION AND OPTIMIZATION OF SYSTEMS, METHODS AND COMPOSITIONS FOR GENERATING MODELS AND ACTING ON DISEASES AND DISORDERS OF POSMITOTIC CELLS.
KR1020167001296A KR20160056869A (en) 2013-06-17 2014-06-11 Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using viral components
RU2016101198A RU2716421C2 (en) 2013-06-17 2014-06-11 Delivery, use and use in therapy of crispr-cas systems and compositions for targeted action on disorders and diseases using viral components
BR112015031611A BR112015031611A2 (en) 2013-06-17 2014-06-11 application, manipulation and optimization of systems, methods and compositions for targeting and modeling post-mitotic cell diseases and disorders
BR112015031610-7A BR112015031610B1 (en) 2013-06-17 2014-06-11 COMPOSITION FOR MODIFYING A BRAIN OR NEURONAL CELL IN VIVO INTO A EUKARYOTIC ORGANISM AND USE OF A VIRAL VECTOR IN THE TREATMENT OF A CEREBRAL OR NEUROLOGICAL DISEASE OR DISORDER
CN202111206158.0A CN114015726B (en) 2013-06-17 2014-06-11 Delivery, use and therapeutic applications of CRISPR-CAS systems and compositions targeting disorders and diseases using viral components
ES14735795T ES2767318T3 (en) 2013-06-17 2014-06-11 Supply, modification and optimization of systems, methods and compositions to generate models and act on postmitotic cell diseases and disorders
AU2014281030A AU2014281030B2 (en) 2013-06-17 2014-06-11 Delivery, engineering and optimization of systems, methods and compositions for targeting and modeling diseases and disorders of post mitotic cells
SG11201510286QA SG11201510286QA (en) 2013-06-17 2014-06-11 Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using viral components
MX2015017313A MX374532B (en) 2013-06-17 2014-06-11 SUPPLY, USE AND THERAPEUTIC APPLICATIONS OF CRISPR-CAS SYSTEMS AND COMPOSITIONS, TO ACT ON DISORDERS AND DISEASES USING VIRAL COMPONENTS.
EP19171567.1A EP3597755A1 (en) 2013-06-17 2014-06-11 Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using viral components
US14/481,339 US20150020223A1 (en) 2012-12-12 2014-09-09 Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
ZA2015/04132A ZA201504132B (en) 2012-12-12 2015-06-08 Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
ZA2015/08961A ZA201508961B (en) 2013-06-17 2015-12-08 Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using viral components
MX2021001308A MX2021001308A (en) 2013-06-17 2015-12-15 SUPPLY AND USE OF COMPOSITIONS, VECTORS AND CRISPR-CAS SYSTEMS FOR TARGETED MODIFICATION AND LIVER THERAPY.
US14/971,169 US20160153004A1 (en) 2013-06-17 2015-12-16 Delivery, engineering and optimization of systems, methods and compositions for targeting and modeling diseases and disorders of post mitotic cells
US14/970,967 US10946108B2 (en) 2013-06-17 2015-12-16 Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for targeting disorders and diseases using viral components
US14/971,356 US10577630B2 (en) 2013-06-17 2015-12-16 Delivery and use of the CRISPR-Cas systems, vectors and compositions for hepatic targeting and therapy
IL243195A IL243195B (en) 2013-06-17 2015-12-17 Provision, use and therapeutic applications of crisps-cas systems and preparations aimed at disorders and diseases using viral components
US14/972,523 US10711285B2 (en) 2013-06-17 2015-12-17 Optimized CRISPR-Cas double nickase systems, methods and compositions for sequence manipulation
IL243196A IL243196B (en) 2013-06-17 2015-12-17 Provision and use of cas-crispr systems, vectors and preparations for targeting the liver and treatment
IL243197A IL243197B (en) 2013-06-17 2015-12-17 Delivery, engineering and optimization of systems, methods and compositions for targeting and modeling diseases and disorders of post mitotic cells
US15/349,603 US11041173B2 (en) 2012-12-12 2016-11-11 Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
JP2019172824A JP2020063238A (en) 2013-06-17 2019-09-24 Delivery, engineering and optimization of systems, methods and compositions for targeting and modeling diseases and disorders of postmitotic cells
JP2019172819A JP2020026438A (en) 2013-06-17 2019-09-24 Delivery and use of CRISPR-Cas systems, vectors and compositions for liver targeting and therapy
AU2019283878A AU2019283878B2 (en) 2012-12-12 2019-12-18 Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
JP2020025947A JP7083364B2 (en) 2013-06-17 2020-02-19 Optimized CRISPR-Cas dual nickase system, method and composition for sequence manipulation
US16/844,548 US11597949B2 (en) 2013-06-17 2020-04-09 Optimized CRISPR-Cas double nickase systems, methods and compositions for sequence manipulation
AU2020286222A AU2020286222B2 (en) 2013-06-17 2020-12-09 Delivery and use of the CRISPR-Cas systems, vectors and compositions for hepatic targeting and therapy
US17/245,952 US12252707B2 (en) 2012-12-12 2021-04-30 Delivery, Engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
JP2021186813A JP2022028812A (en) 2013-06-17 2021-11-17 Delivery and use of CRISPR-Cas systems, vectors and compositions for liver targeting and treatment
JP2022031416A JP7383062B2 (en) 2013-06-17 2022-03-02 Optimized CRISPR-Cas dual nickase system, methods and compositions for sequence manipulation
AU2022203759A AU2022203759B2 (en) 2012-12-12 2022-06-01 Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
AU2022218558A AU2022218558A1 (en) 2013-06-17 2022-08-18 Delivery and use of the CRISPR-Cas systems, vectors and compositions for hepatic targeting and therapy
JP2023184342A JP2024023194A (en) 2013-06-17 2023-10-27 Delivery and use of CRISPR-Cas systems, vectors and compositions for liver targeting and therapy
JP2023189768A JP7682975B2 (en) 2013-06-17 2023-11-07 Optimized CRISPR-Cas dual nickase system for sequence engineering, methods and compositions
US19/079,830 US20250382642A1 (en) 2012-12-12 2025-03-14 Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
AU2025202331A AU2025202331A1 (en) 2013-06-17 2025-04-02 Delivery and use of the CRISPR-Cas systems, vectors and compositions for hepatic targeting and therapy
AU2025203782A AU2025203782A1 (en) 2012-12-12 2025-05-22 Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications

Applications Claiming Priority (26)

Application Number Priority Date Filing Date Title
US201261736527P 2012-12-12 2012-12-12
US61/736,527 2012-12-12
US201361748427P 2013-01-02 2013-01-02
US61/748,427 2013-01-02
US201361758468P 2013-01-30 2013-01-30
US61/758,468 2013-01-30
US201361769046P 2013-02-25 2013-02-25
US61/769,046 2013-02-25
US201361791409P 2013-03-15 2013-03-15
US201361802174P 2013-03-15 2013-03-15
US61/791,409 2013-03-15
US61/802,174 2013-03-15
US201361806375P 2013-03-28 2013-03-28
US61/806,375 2013-03-28
US201361814263P 2013-04-20 2013-04-20
US61/814,263 2013-04-20
US201361819803P 2013-05-06 2013-05-06
US61/819,803 2013-05-06
US201361828130P 2013-05-28 2013-05-28
US61/828,130 2013-05-28
US201361836123P 2013-06-17 2013-06-17
US201361835931P 2013-06-17 2013-06-17
US61/835,931 2013-06-17
US61/836,123 2013-06-17
US201361847537P 2013-07-17 2013-07-17
US61/847,537 2013-07-17

Related Child Applications (6)

Application Number Title Priority Date Filing Date
EP15179123.3A Previously-Filed-Application EP3031921B1 (en) 2012-12-12 2013-12-12 Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
PCT/US2014/041803 Continuation-In-Part WO2014204725A1 (en) 2013-06-17 2014-06-10 Optimized crispr-cas double nickase systems, methods and compositions for sequence manipulation
PCT/US2014/041804 Continuation-In-Part WO2014204726A1 (en) 2013-06-17 2014-06-10 Delivery and use of the crispr-cas systems, vectors and compositions for hepatic targeting and therapy
PCT/US2014/041809 Continuation-In-Part WO2014204729A1 (en) 2013-06-17 2014-06-11 Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using viral components
PCT/US2014/041808 Continuation-In-Part WO2014204728A1 (en) 2013-06-17 2014-06-11 Delivery, engineering and optimization of systems, methods and compositions for targeting and modeling diseases and disorders of post mitotic cells
US14/481,339 Continuation US20150020223A1 (en) 2012-12-12 2014-09-09 Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications

Publications (4)

Publication Number Publication Date
WO2014093622A2 true WO2014093622A2 (en) 2014-06-19
WO2014093622A3 WO2014093622A3 (en) 2014-08-07
WO2014093622A9 WO2014093622A9 (en) 2014-11-06
WO2014093622A8 WO2014093622A8 (en) 2014-12-04

Family

ID=49883289

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2013/074667 Ceased WO2014093622A2 (en) 2012-12-12 2013-12-12 Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications

Country Status (15)

Country Link
US (10) US20140179770A1 (en)
EP (5) EP4549566A3 (en)
JP (5) JP2016501531A (en)
KR (1) KR20150105956A (en)
CN (2) CN110872583A (en)
AU (4) AU2013359199C1 (en)
BR (1) BR112015013784A2 (en)
DK (2) DK3327127T3 (en)
ES (2) ES2883590T3 (en)
IL (2) IL239317B (en)
MX (2) MX389793B (en)
RU (1) RU2721275C2 (en)
SG (3) SG10201912328UA (en)
WO (1) WO2014093622A2 (en)
ZA (1) ZA201504132B (en)

Cited By (593)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20140356956A1 (en) * 2013-06-04 2014-12-04 President And Fellows Of Harvard College RNA-Guided Transcriptional Regulation
WO2014204726A1 (en) 2013-06-17 2014-12-24 The Broad Institute Inc. Delivery and use of the crispr-cas systems, vectors and compositions for hepatic targeting and therapy
EP2828386A1 (en) 2012-03-20 2015-01-28 Vilnius University RNA-DIRECTED DNA CLEAVAGE BY THE Cas9-crRNA COMPLEX
WO2015040402A1 (en) 2013-09-18 2015-03-26 Kymab Limited Methods. cells & organisms
WO2015065964A1 (en) 2013-10-28 2015-05-07 The Broad Institute Inc. Functional genomics using crispr-cas systems, compositions, methods, screens and applications thereof
WO2015089465A1 (en) 2013-12-12 2015-06-18 The Broad Institute Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for hbv and viral diseases and disorders
WO2015089351A1 (en) 2013-12-12 2015-06-18 The Broad Institute Inc. Compositions and methods of use of crispr-cas systems in nucleotide repeat disorders
WO2015088643A1 (en) 2013-12-11 2015-06-18 Regeneron Pharmaceuticals, Inc. Methods and compositions for the targeted modification of a genome
WO2015089419A2 (en) 2013-12-12 2015-06-18 The Broad Institute Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using particle delivery components
WO2015089486A2 (en) 2013-12-12 2015-06-18 The Broad Institute Inc. Systems, methods and compositions for sequence manipulation with optimized functional crispr-cas systems
WO2015089364A1 (en) 2013-12-12 2015-06-18 The Broad Institute Inc. Crystal structure of a crispr-cas system, and uses thereof
US9068179B1 (en) 2013-12-12 2015-06-30 President And Fellows Of Harvard College Methods for correcting presenilin point mutations
EP2764103B1 (en) 2012-12-12 2015-08-19 The Broad Institute, Inc. Crispr-cas systems and methods for altering expression of gene products
EP2896697B1 (en) 2012-12-12 2015-09-02 The Broad Institute, Inc. Engineering of systems, methods and optimized guide compositions for sequence manipulation
US9163284B2 (en) 2013-08-09 2015-10-20 President And Fellows Of Harvard College Methods for identifying a target site of a Cas9 nuclease
WO2015188109A1 (en) 2014-06-06 2015-12-10 Regeneron Pharmaceuticals, Inc. Methods and compositions for modifying a targeted locus
WO2015200334A1 (en) * 2014-06-23 2015-12-30 Regeneron Pharmaceuticals, Inc. Nuclease-mediated dna assembly
WO2015200805A2 (en) 2014-06-26 2015-12-30 Regeneron Pharmaceuticals, Inc. Methods and compositions for targeted genetic modifications and methods of use
US9228207B2 (en) 2013-09-06 2016-01-05 President And Fellows Of Harvard College Switchable gRNAs comprising aptamers
US9234213B2 (en) 2013-03-15 2016-01-12 System Biosciences, Llc Compositions and methods directed to CRISPR/Cas genomic engineering systems
EP2966170A1 (en) * 2014-07-10 2016-01-13 Heinrich-Pette-Institut Leibniz-Institut für experimentelle Virologie-Stiftung bürgerlichen Rechts - HBV inactivation
US9260752B1 (en) 2013-03-14 2016-02-16 Caribou Biosciences, Inc. Compositions and methods of nucleic acid-targeting nucleic acids
WO2016033246A1 (en) * 2014-08-27 2016-03-03 Caribou Biosciences, Inc. Methods for increasing cas9-mediated engineering efficiency
EP2931898B1 (en) 2012-12-12 2016-03-09 The Broad Institute, Inc. Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains
EP2898075B1 (en) 2012-12-12 2016-03-09 The Broad Institute, Inc. Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation
WO2016036754A1 (en) 2014-09-02 2016-03-10 The Regents Of The University Of California Methods and compositions for rna-directed target dna modification
WO2016049163A2 (en) 2014-09-24 2016-03-31 The Broad Institute Inc. Use and production of chd8+/- transgenic animals with behavioral phenotypes characteristic of autism spectrum disorder
WO2016049251A1 (en) 2014-09-24 2016-03-31 The Broad Institute Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for modeling mutations in leukocytes
EP3009511A2 (en) 2015-06-18 2016-04-20 The Broad Institute, Inc. Novel crispr enzymes and systems
WO2016061374A1 (en) 2014-10-15 2016-04-21 Regeneron Pharmaceuticals, Inc. Methods and compositions for generating or maintaining pluripotent cells
JP2016512264A (en) * 2013-03-15 2016-04-25 ザ ジェネラル ホスピタル コーポレイション RNA-induced targeting of genomic and epigenomic regulatory proteins to specific genomic loci
US9322037B2 (en) 2013-09-06 2016-04-26 President And Fellows Of Harvard College Cas9-FokI fusion proteins and uses thereof
US9322006B2 (en) 2011-07-22 2016-04-26 President And Fellows Of Harvard College Evaluation and improvement of nuclease cleavage specificity
WO2016069591A2 (en) 2014-10-27 2016-05-06 The Broad Institute Inc. Compositions, methods and use of synthetic lethal screening
WO2016049024A3 (en) * 2014-09-24 2016-05-12 The Broad Institute Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for modeling competition of multiple cancer mutations in vivo
JP2016514479A (en) * 2013-04-04 2016-05-23 トラスティーズ・オブ・ダートマス・カレッジ Compositions and methods for in vivo excision of HIV-1 proviral DNA
WO2016081923A2 (en) 2014-11-21 2016-05-26 Regeneron Pharmaceuticals, Inc. METHODS AND COMPOSITIONS FOR TARGETED GENETIC MODIFICATION USING PAIRED GUIDE RNAs
WO2016086197A1 (en) 2014-11-25 2016-06-02 The Brigham And Women's Hospital, Inc. Method of identifying and treating a person having a predisposition to or afflicted with a cardiometabolic disease
WO2016086227A2 (en) 2014-11-26 2016-06-02 The Regents Of The University Of California Therapeutic compositions comprising transcription factors and methods of making and using the same
WO2016083811A1 (en) 2014-11-27 2016-06-02 Imperial Innovations Limited Genome editing methods
US9359599B2 (en) 2013-08-22 2016-06-07 President And Fellows Of Harvard College Engineered transcription activator-like effector (TALE) domains and uses thereof
WO2016094874A1 (en) 2014-12-12 2016-06-16 The Broad Institute Inc. Escorted and functionalized guides for crispr-cas systems
WO2016094867A1 (en) 2014-12-12 2016-06-16 The Broad Institute Inc. Protected guide rnas (pgrnas)
WO2016094880A1 (en) 2014-12-12 2016-06-16 The Broad Institute Inc. Delivery, use and therapeutic applications of crispr systems and compositions for genome editing as to hematopoietic stem cells (hscs)
WO2016100974A1 (en) 2014-12-19 2016-06-23 The Broad Institute Inc. Unbiased identification of double-strand breaks and genomic rearrangement by genome-wide insert capture sequencing
WO2016100857A1 (en) 2014-12-19 2016-06-23 Regeneron Pharmaceuticals, Inc. Stem cells for modeling type 2 diabetes
WO2016106244A1 (en) 2014-12-24 2016-06-30 The Broad Institute Inc. Crispr having or associated with destabilization domains
WO2016106236A1 (en) 2014-12-23 2016-06-30 The Broad Institute Inc. Rna-targeting system
WO2016108926A1 (en) 2014-12-30 2016-07-07 The Broad Institute Inc. Crispr mediated in vivo modeling and genetic screening of tumor growth and metastasis
JP2016521554A (en) * 2013-06-04 2016-07-25 プレジデント アンド フェローズ オブ ハーバード カレッジ RNA-induced transcriptional regulation
JP2016523564A (en) * 2013-07-11 2016-08-12 モデルナ セラピューティクス インコーポレイテッドModerna Therapeutics,Inc. Compositions comprising synthetic polynucleotides encoding CRISPR-related proteins and synthetic sgRNAs and methods of use
WO2016057835A3 (en) * 2013-07-09 2016-08-25 President And Fellows Of Harvard College THERAPEUTIC USES OF GENOME EDITING WITH CRISPR/Cas SYSTEMS
WO2016138488A2 (en) 2015-02-26 2016-09-01 The Broad Institute Inc. T cell balance gene expression, compositions of matters and methods of use thereof
US9434782B2 (en) 2009-07-08 2016-09-06 Kymab Limited Animal models and therapeutic molecules
WO2016138574A1 (en) 2015-03-02 2016-09-09 Sinai Health System Homologous recombination factors
JP2016528894A (en) * 2013-07-26 2016-09-23 プレジデント アンド フェローズ オブ ハーバード カレッジ Genome engineering
EP3071695A2 (en) * 2013-11-18 2016-09-28 Crispr Therapeutics AG Crispr-cas system materials and methods
KR20160122197A (en) * 2014-02-11 2016-10-21 더 리전츠 오브 더 유니버시티 오브 콜로라도, 어 바디 코퍼레이트 Crispr enabled multiplexed genome engineering
EP2840140B1 (en) 2012-12-12 2016-11-16 The Broad Institute, Inc. Crispr-Cas component systems, methods and compositions for sequence manipulation
WO2016182893A1 (en) 2015-05-08 2016-11-17 Teh Broad Institute Inc. Functional genomics using crispr-cas systems for saturating mutagenesis of non-coding elements, compositions, methods, libraries and applications thereof
US9504236B2 (en) 2009-07-08 2016-11-29 Kymab Limited Animal models and therapeutic molecules
WO2016187717A1 (en) * 2015-05-26 2016-12-01 Exerkine Corporation Exosomes useful for genome editing
WO2016205728A1 (en) 2015-06-17 2016-12-22 Massachusetts Institute Of Technology Crispr mediated recording of cellular events
WO2016205749A1 (en) 2015-06-18 2016-12-22 The Broad Institute Inc. Novel crispr enzymes and systems
WO2016205764A1 (en) 2015-06-18 2016-12-22 The Broad Institute Inc. Novel crispr enzymes and systems
WO2016205745A2 (en) 2015-06-18 2016-12-22 The Broad Institute Inc. Cell sorting
WO2016205613A1 (en) 2015-06-18 2016-12-22 The Broad Institute Inc. Crispr enzyme mutations reducing off-target effects
US9526784B2 (en) 2013-09-06 2016-12-27 President And Fellows Of Harvard College Delivery system for functional nucleases
WO2017023801A1 (en) * 2015-07-31 2017-02-09 Regents Of The University Of Minnesota Intracellular genomic transplant and methods of therapy
JP2017504312A (en) * 2013-12-12 2017-02-09 ザ・ブロード・インスティテュート・インコーポレイテッド Delivery, use and therapeutic application of CRISPR-Cas systems and compositions for genome editing
WO2017027910A1 (en) 2015-08-14 2017-02-23 The University Of Sydney Connexin 45 inhibition for therapy
WO2017070605A1 (en) 2015-10-22 2017-04-27 The Broad Institute Inc. Type vi-b crispr enzymes and systems
WO2017069958A2 (en) 2015-10-09 2017-04-27 The Brigham And Women's Hospital, Inc. Modulation of novel immune checkpoint targets
WO2017075465A1 (en) 2015-10-28 2017-05-04 The Broad Institute Inc. Compositions and methods for evaluating and modulating immune responses by detecting and targeting gata3
WO2017075294A1 (en) 2015-10-28 2017-05-04 The Board Institute Inc. Assays for massively combinatorial perturbation profiling and cellular circuit reconstruction
WO2017075451A1 (en) 2015-10-28 2017-05-04 The Broad Institute Inc. Compositions and methods for evaluating and modulating immune responses by detecting and targeting pou2af1
WO2017074788A1 (en) 2015-10-27 2017-05-04 The Broad Institute Inc. Compositions and methods for targeting cancer-specific sequence variations
WO2017075478A2 (en) 2015-10-28 2017-05-04 The Broad Institute Inc. Compositions and methods for evaluating and modulating immune responses by use of immune cell gene signatures
EP2800811B1 (en) 2012-05-25 2017-05-10 The Regents of The University of California Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription
WO2017087708A1 (en) 2015-11-19 2017-05-26 The Brigham And Women's Hospital, Inc. Lymphocyte antigen cd5-like (cd5l)-interleukin 12b (p40) heterodimers in immunity
WO2017106657A1 (en) 2015-12-18 2017-06-22 The Broad Institute Inc. Novel crispr enzymes and systems
WO2017114497A1 (en) 2015-12-30 2017-07-06 Novartis Ag Immune effector cell therapies with enhanced efficacy
WO2017127807A1 (en) 2016-01-22 2017-07-27 The Broad Institute Inc. Crystal structure of crispr cpf1
WO2017147196A1 (en) 2016-02-22 2017-08-31 Massachusetts Institute Of Technology Methods for identifying and modulating immune phenotypes
US20170253925A1 (en) * 2015-11-25 2017-09-07 Integrated Dna Technologies Methods for variant detection
JP2017525696A (en) * 2014-08-11 2017-09-07 ザ ボード オブ リージェンツ オブ ザ ユニバーシティー オブ テキサス システム Prevention of muscular dystrophy by CRISPR / CAS9-mediated gene editing
EP3219799A1 (en) 2016-03-17 2017-09-20 IMBA-Institut für Molekulare Biotechnologie GmbH Conditional crispr sgrna expression
WO2017161325A1 (en) 2016-03-17 2017-09-21 Massachusetts Institute Of Technology Methods for identifying and modulating co-occurant cellular phenotypes
WO2017170803A1 (en) * 2016-03-29 2017-10-05 株式会社国際電気通信基礎技術研究所 Pharmaceutical composition or food composition, and method for assessing effect of active ingredient in vivo
US9783593B2 (en) 2013-05-02 2017-10-10 Kymab Limited Antibodies, variable domains and chains tailored for human use
US9783618B2 (en) 2013-05-01 2017-10-10 Kymab Limited Manipulation of immunoglobulin gene diversity and multi-antibody therapeutics
US9788534B2 (en) 2013-03-18 2017-10-17 Kymab Limited Animal models and therapeutic molecules
WO2017184768A1 (en) 2016-04-19 2017-10-26 The Broad Institute Inc. Novel crispr enzymes and systems
WO2017184786A1 (en) 2016-04-19 2017-10-26 The Broad Institute Inc. Cpf1 complexes with reduced indel activity
EP2931897B1 (en) 2012-12-12 2017-11-01 The Broad Institute, Inc. Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
WO2017189542A1 (en) * 2016-04-26 2017-11-02 University Of Georgia Research Foundation, Inc. Plants having reduced methylation of cytosine nucleotides and methods of use
WO2017189308A1 (en) 2016-04-19 2017-11-02 The Broad Institute Inc. Novel crispr enzymes and systems
US9822370B2 (en) 2013-04-04 2017-11-21 President And Fellows Of Harvard College Method of making a deletion in a target sequence in isolated primary cells using Cas9 and two guide RNAs
WO2017201476A1 (en) 2016-05-20 2017-11-23 Regeneron Pharmaceuticals, Inc. Methods for breaking immunological tolerance using multiple guide rnas
US9834791B2 (en) 2013-11-07 2017-12-05 Editas Medicine, Inc. CRISPR-related methods and compositions with governing gRNAS
US9834786B2 (en) 2012-04-25 2017-12-05 Regeneron Pharmaceuticals, Inc. Nuclease-mediated targeting with large targeting vectors
WO2017219027A1 (en) 2016-06-17 2017-12-21 The Broad Institute Inc. Type vi crispr orthologs and systems
WO2017216392A1 (en) * 2016-09-23 2017-12-21 Dsm Ip Assets B.V. A guide-rna expression system for a host cell
WO2018005873A1 (en) 2016-06-29 2018-01-04 The Broad Institute Inc. Crispr-cas systems having destabilization domain
WO2018013840A1 (en) 2016-07-13 2018-01-18 Vertex Pharmaceuticals Incorporated Methods, compositions and kits for increasing genome editing efficiency
US9877988B2 (en) 2012-07-11 2018-01-30 Sangamo Therapeutics, Inc. Method of treating lysosomal storage diseases using nucleases and a transgene
WO2018023014A1 (en) 2016-07-29 2018-02-01 Regeneron Pharmaceuticals, Inc. Mice comprising mutations resulting in expression of c-truncated fibrillin-1
US9885026B2 (en) 2011-12-30 2018-02-06 Caribou Biosciences, Inc. Modified cascade ribonucleoproteins and uses thereof
US9888673B2 (en) 2014-12-10 2018-02-13 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
WO2018035388A1 (en) 2016-08-17 2018-02-22 The Broad Institute, Inc. Novel crispr enzymes and systems
WO2018035364A1 (en) 2016-08-17 2018-02-22 The Broad Institute Inc. Product and methods useful for modulating and evaluating immune responses
WO2018035250A1 (en) 2016-08-17 2018-02-22 The Broad Institute, Inc. Methods for identifying class 2 crispr-cas systems
WO2018035387A1 (en) 2016-08-17 2018-02-22 The Broad Institute, Inc. Novel crispr enzymes and systems
WO2018049025A2 (en) 2016-09-07 2018-03-15 The Broad Institute Inc. Compositions and methods for evaluating and modulating immune responses
US9924705B2 (en) 2012-03-28 2018-03-27 Kymab Limited Animal models and therapeutic molecules
WO2018054911A1 (en) 2016-09-23 2018-03-29 Bayer Cropscience Nv Targeted genome optimization in plants
US9938521B2 (en) 2014-03-10 2018-04-10 Editas Medicine, Inc. CRISPR/CAS-related methods and compositions for treating leber's congenital amaurosis 10 (LCA10)
WO2018067991A1 (en) 2016-10-07 2018-04-12 The Brigham And Women's Hospital, Inc. Modulation of novel immune checkpoint targets
US20180100148A1 (en) * 2016-10-07 2018-04-12 Integrated Dna Technologies, Inc. S. pyogenes cas9 mutant genes and polypeptides encoded by same
US9963716B2 (en) 2011-09-26 2018-05-08 Kymab Limited Chimaeric surrogate light chains (SLC) comprising human VpreB
WO2018083606A1 (en) 2016-11-01 2018-05-11 Novartis Ag Methods and compositions for enhancing gene editing
WO2018107129A1 (en) 2016-12-09 2018-06-14 The Broad Institute, Inc. Crispr effector system based diagnostics
WO2018136758A1 (en) 2017-01-23 2018-07-26 Regeneron Pharmaceuticals, Inc. Hsd17b13 variants and uses thereof
WO2018147343A1 (en) * 2017-02-07 2018-08-16 Edigene Corporation Method of treating diseases associated with elevated kras expression using crispr-gndm system
JP2018525983A (en) * 2015-07-28 2018-09-13 ダニスコ・ユーエス・インク Genome editing system and method of use
US10077453B2 (en) 2014-07-30 2018-09-18 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
WO2018170340A1 (en) 2017-03-15 2018-09-20 The Broad Institute, Inc. Crispr effector system based diagnostics for virus detection
WO2018170333A1 (en) 2017-03-15 2018-09-20 The Broad Institute, Inc. Novel cas13b orthologues crispr enzymes and systems
WO2018170515A1 (en) 2017-03-17 2018-09-20 The Broad Institute, Inc. Methods for identifying and modulating co-occurant cellular phenotypes
WO2018191520A1 (en) 2017-04-12 2018-10-18 The Broad Institute, Inc. Respiratory and sweat gland ionocytes
WO2018191388A1 (en) 2017-04-12 2018-10-18 The Broad Institute, Inc. Novel type vi crispr orthologs and systems
WO2018191553A1 (en) 2017-04-12 2018-10-18 Massachusetts Eye And Ear Infirmary Tumor signature for metastasis, compositions of matter methods of use thereof
WO2018191750A2 (en) 2017-04-14 2018-10-18 The Broad Institute Inc. Novel delivery of large payloads
WO2018195486A1 (en) 2017-04-21 2018-10-25 The Broad Institute, Inc. Targeted delivery to beta cells
WO2018195019A1 (en) 2017-04-18 2018-10-25 The Broad Institute Inc. Compositions for detecting secretion and methods of use
US10113163B2 (en) 2016-08-03 2018-10-30 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
JP2018532408A (en) * 2015-07-02 2018-11-08 ポセイダ セラピューティクス, インコーポレイテッド Compositions and methods for delivering genetic editing tools using polymer vesicles
WO2018208910A1 (en) 2017-05-09 2018-11-15 The Broad Institute Inc. Gut microbiome function predicts response to anti-integrin biologic therapy in inflammatory bowel diseases
US10149462B2 (en) 2013-10-01 2018-12-11 Kymab Limited Animal models and therapeutic molecules
WO2018237107A1 (en) 2017-06-23 2018-12-27 University Of Kentucky Research Foundation Method
US10167457B2 (en) 2015-10-23 2019-01-01 President And Fellows Of Harvard College Nucleobase editors and uses thereof
WO2019003193A1 (en) 2017-06-30 2019-01-03 Novartis Ag Methods for the treatment of disease with gene editing systems
WO2019005884A1 (en) 2017-06-26 2019-01-03 The Broad Institute, Inc. Crispr/cas-adenine deaminase based compositions, systems, and methods for targeted nucleic acid editing
WO2019006471A2 (en) 2017-06-30 2019-01-03 Arbor Biotechnologies, Inc. Novel crispr rna targeting enzymes and systems and uses thereof
WO2019018440A1 (en) 2017-07-17 2019-01-24 The Broad Institute, Inc. Cell atlas of the healthy and ulcerative colitis human colon
WO2019028023A2 (en) 2017-07-31 2019-02-07 Regeneron Pharmaceuticals, Inc. Methods and compositions for assessing crispr/cas-mediated disruption or excision and crispr/cas-induced recombination with an exogenous donor nucleic acid in vivo
WO2019028032A1 (en) 2017-07-31 2019-02-07 Regeneron Pharmaceuticals, Inc. Cas-transgenic mouse embryonic stem cells and mice and uses thereof
WO2019023770A1 (en) 2017-07-31 2019-02-07 Universidade Federal Do Rio Grande Do Sul Composition for gene therapy of the central nervous system, process of production and use thereof
WO2019028029A1 (en) 2017-07-31 2019-02-07 Regeneron Pharmaceuticals, Inc. Assessment of crispr/cas-induced recombination with an exogenous donor nucleic acid in vivo
EP3460063A1 (en) 2013-12-11 2019-03-27 Regeneron Pharmaceuticals, Inc. Methods and compositions for the targeted modification of a genome
WO2019060746A1 (en) 2017-09-21 2019-03-28 The Broad Institute, Inc. Systems, methods, and compositions for targeted nucleic acid editing
WO2019067872A1 (en) * 2017-09-29 2019-04-04 Intellia Therapeutics, Inc. Compositions and methods for ttr gene editing and treating attr amyloidosis
WO2019067875A1 (en) 2017-09-29 2019-04-04 Regeneron Pharmaceuticals, Inc. Non-human animals comprising a humanized ttr locus and methods of use
US10251377B2 (en) 2012-03-28 2019-04-09 Kymab Limited Transgenic non-human vertebrate for the expression of class-switched, fully human, antibodies
WO2019070755A1 (en) 2017-10-02 2019-04-11 The Broad Institute, Inc. Methods and compositions for detecting and modulating an immunotherapy resistance gene signature in cancer
WO2019071054A1 (en) 2017-10-04 2019-04-11 The Broad Institute, Inc. Methods and compositions for altering function and structure of chromatin loops and/or domains
WO2019087113A1 (en) 2017-11-01 2019-05-09 Novartis Ag Synthetic rnas and methods of use
US10286084B2 (en) 2014-02-18 2019-05-14 Duke University Compositions for the inactivation of virus replication and methods of making and using the same
US10287575B2 (en) 2016-06-24 2019-05-14 The Regents Of The University Of Colorado, A Body Corporate Methods for generating barcoded combinatorial libraries
US10286086B2 (en) 2014-06-19 2019-05-14 Modernatx, Inc. Alternative nucleic acid molecules and uses thereof
EP2931891B1 (en) 2012-12-17 2019-05-15 President and Fellows of Harvard College Rna-guided human genome engineering
WO2019094983A1 (en) 2017-11-13 2019-05-16 The Broad Institute, Inc. Methods and compositions for treating cancer by targeting the clec2d-klrb1 pathway
WO2019099943A1 (en) 2017-11-16 2019-05-23 Astrazeneca Ab Compositions and methods for improving the efficacy of cas9-based knock-in strategies
WO2019126709A1 (en) 2017-12-22 2019-06-27 The Broad Institute, Inc. Cas12b systems, methods, and compositions for targeted dna base editing
US10337028B2 (en) 2017-06-23 2019-07-02 Inscripta, Inc. Nucleic acid-guided nucleases
US10337001B2 (en) 2014-12-03 2019-07-02 Agilent Technologies, Inc. Guide RNA with chemical modifications
WO2019138083A1 (en) 2018-01-12 2019-07-18 Basf Se Gene underlying the number of spikelets per spike qtl in wheat on chromosome 7a
EP3514246A1 (en) 2014-02-27 2019-07-24 The Broad Institute Inc. T cell balance gene expression and methods of use thereof
WO2019143678A1 (en) 2018-01-17 2019-07-25 Vertex Pharmaceuticals Incorporated Dna-pk inhibitors
WO2019143675A1 (en) 2018-01-17 2019-07-25 Vertex Pharmaceuticals Incorporated Dna-pk inhibitors
WO2019148206A1 (en) 2018-01-29 2019-08-01 The Broad Institute, Inc. Crispr effector system based diagnostics
US10377998B2 (en) 2013-12-12 2019-08-13 The Broad Institute, Inc. CRISPR-CAS systems and methods for altering expression of gene products, structural information and inducible modular CAS enzymes
US10385088B2 (en) 2013-10-02 2019-08-20 Modernatx, Inc. Polynucleotide molecules and uses thereof
US10385359B2 (en) 2013-04-16 2019-08-20 Regeneron Pharmaceuticals, Inc. Targeted modification of rat genome
WO2019168950A1 (en) * 2018-02-27 2019-09-06 The University Of North Carolina At Chapel Hill Methods and compositions for treating angelman syndrome
US10407683B2 (en) 2014-07-16 2019-09-10 Modernatx, Inc. Circular polynucleotides
WO2019178428A1 (en) 2018-03-14 2019-09-19 Arbor Biotechnologies, Inc. Novel crispr dna and rna targeting enzymes and systems
WO2019178427A1 (en) 2018-03-14 2019-09-19 Arbor Biotechnologies, Inc. Novel crispr dna targeting enzymes and systems
WO2019183123A1 (en) 2018-03-19 2019-09-26 Regeneron Pharmaceuticals, Inc. Transcription modulation in animals using crispr/cas systems
US10428319B2 (en) 2017-06-09 2019-10-01 Editas Medicine, Inc. Engineered Cas9 nucleases
EP3360964B1 (en) 2012-12-06 2019-10-02 Sigma Aldrich Co. LLC Crispr-based genome modification and regulation
US10435714B2 (en) 2017-06-23 2019-10-08 Inscripta, Inc. Nucleic acid-guided nucleases
WO2019204585A1 (en) 2018-04-19 2019-10-24 Massachusetts Institute Of Technology Single-stranded break detection in double-stranded dna
EP3560330A1 (en) 2018-04-24 2019-10-30 KWS SAAT SE & Co. KGaA Plants with improved digestibility and marker haplotypes
WO2019210268A2 (en) 2018-04-27 2019-10-31 The Broad Institute, Inc. Sequencing-based proteomics
US10471108B2 (en) 2015-11-20 2019-11-12 4D Pharma Research Limited Compositions comprising bacterial strains
WO2019222555A1 (en) 2018-05-16 2019-11-21 Arbor Biotechnologies, Inc. Novel crispr-associated systems and components
US10485830B2 (en) 2016-12-12 2019-11-26 4D Pharma Plc Compositions comprising bacterial strains
US10493112B2 (en) 2015-06-15 2019-12-03 4D Pharma Research Limited Compositions comprising bacterial strains
WO2019232542A2 (en) 2018-06-01 2019-12-05 Massachusetts Institute Of Technology Methods and compositions for detecting and modulating microenvironment gene signatures from the csf of metastasis patients
US10500237B2 (en) 2015-06-15 2019-12-10 4D Pharma Research Limited Compositions comprising bacterial strains
EP3283625B1 (en) 2015-04-16 2019-12-11 Wageningen Universiteit Nuclease-mediated genome editing
WO2020002592A1 (en) 2018-06-29 2020-01-02 Stichting Het Nederlands Kanker Instituut - Antoni Van Leeuwenhoek Ziekenhuis Traf2 inhibitors for use in the treatment of a cancer
WO2020006036A1 (en) 2018-06-26 2020-01-02 Massachusetts Institute Of Technology Crispr effector system based amplification methods, systems, and diagnostics
WO2020006067A1 (en) 2018-06-26 2020-01-02 The Broad Institute, Inc. Crispr double nickase based amplification compositions, systems, and methods
WO2020006049A1 (en) 2018-06-26 2020-01-02 The Broad Institute, Inc. Crispr/cas and transposase based amplification compositions, systems and methods
US10526591B2 (en) 2015-08-28 2020-01-07 The General Hospital Corporation Engineered CRISPR-Cas9 nucleases
EP3597755A1 (en) * 2013-06-17 2020-01-22 The Broad Institute, Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using viral components
WO2020025963A2 (en) 2018-08-02 2020-02-06 British American Tobacco (Investments) Limited Method
WO2020028555A2 (en) 2018-07-31 2020-02-06 The Broad Institute, Inc. Novel crispr enzymes and systems
WO2020033601A1 (en) 2018-08-07 2020-02-13 The Broad Institute, Inc. Novel cas12b enzymes and systems
WO2020041380A1 (en) 2018-08-20 2020-02-27 The Broad Institute, Inc. Methods and compositions for optochemical control of crispr-cas9
WO2020041384A1 (en) 2018-08-20 2020-02-27 The Broad Institute, Inc. 3-phenyl-2-cyano-azetidine derivatives, inhibitors of rna-guided nuclease activity
WO2020041387A1 (en) 2018-08-20 2020-02-27 The Brigham And Women's Hospital, Inc. Degradation domain modifications for spatio-temporal control of rna-guided nucleases
US10583158B2 (en) 2016-03-04 2020-03-10 4D Pharma Plc Compositions comprising bacterial strains
WO2020051507A1 (en) 2018-09-06 2020-03-12 The Broad Institute, Inc. Nucleic acid assemblies for use in targeted delivery
WO2020068304A2 (en) 2018-08-20 2020-04-02 The Broad Institute, Inc. Inhibitors of rna-guided nuclease target binding and uses thereof
US10610550B2 (en) 2015-11-20 2020-04-07 4D Pharma Research Limited Compositions comprising bacterial strains
US10610549B2 (en) 2016-07-13 2020-04-07 4D Pharma Plc Composition comprising bacterial strains
WO2020072816A1 (en) 2018-10-03 2020-04-09 The Broad Institute, Inc. Crispr effector system based diagnostics for hemorrhagic fever detection
WO2020077236A1 (en) 2018-10-12 2020-04-16 The Broad Institute, Inc. Method for extracting nuclei or whole cells from formalin-fixed paraffin-embedded tissues
WO2020077135A1 (en) 2018-10-10 2020-04-16 Dana-Farber Cancer Institute, Inc. Modulating resistance to bcl-2 inhibitors
WO2020081730A2 (en) 2018-10-16 2020-04-23 Massachusetts Institute Of Technology Methods and compositions for modulating microenvironment
US10633642B2 (en) 2015-08-28 2020-04-28 The General Hospital Corporation Engineered CRISPR-Cas9 nucleases
WO2020092057A1 (en) 2018-10-30 2020-05-07 Yale University Compositions and methods for rapid and modular generation of chimeric antigen receptor t cells
WO2020089645A1 (en) 2018-11-02 2020-05-07 British American Tobacco (Investments) Limited Method of modulating the alkaloid content of a plant
US10648020B2 (en) 2015-06-18 2020-05-12 The Broad Institute, Inc. CRISPR enzymes and systems
EP3653048A1 (en) 2014-12-19 2020-05-20 Regeneron Pharmaceuticals, Inc. Methods and compositions for targeted genetic modification through single-step multiple targeting
WO2020099875A1 (en) 2018-11-16 2020-05-22 British American Tobacco (Investments) Limited Methods and means for modifying the alkaloid content of plants
WO2020102608A2 (en) 2018-11-14 2020-05-22 President And Fellows Of Harvard College Multiplexing highly evolving viral variants with sherlock
WO2020102610A1 (en) 2018-11-14 2020-05-22 The Broad Institute, Inc. Crispr system based droplet diagnostic systems and methods
US10667501B2 (en) 2012-05-17 2020-06-02 Kymab Limited Transgenic non-human vertebrate for the in vivo production of dual specificity immunoglobulins or hypermutated heavy chain only immunoglobulins
WO2020123377A1 (en) 2018-12-10 2020-06-18 Neoimmunetech, Inc. Nrf-2 deficient cells and uses thereof
WO2020124050A1 (en) 2018-12-13 2020-06-18 The Broad Institute, Inc. Tiled assays using crispr-cas based detection
WO2020131632A1 (en) 2018-12-20 2020-06-25 Regeneron Pharmaceuticals, Inc. Nuclease-mediated repeat expansion
WO2020131862A1 (en) 2018-12-17 2020-06-25 The Broad Institute, Inc. Crispr-associated transposase systems and methods of use thereof
WO2020131586A2 (en) 2018-12-17 2020-06-25 The Broad Institute, Inc. Methods for identifying neoantigens
US10711285B2 (en) 2013-06-17 2020-07-14 The Broad Institute, Inc. Optimized CRISPR-Cas double nickase systems, methods and compositions for sequence manipulation
EP3686279A1 (en) 2014-08-17 2020-07-29 The Broad Institute, Inc. Genome editing using cas9 nickases
WO2020152466A1 (en) 2019-01-23 2020-07-30 British American Tobacco (Investments) Limited Method for decreasing the alkaloid content of a tobacco plant
WO2020160044A1 (en) 2019-01-28 2020-08-06 The Broad Institute, Inc. In-situ spatial transcriptomics
US10736926B2 (en) 2015-06-15 2020-08-11 4D Pharma Research Limited Compositions comprising bacterial strains
US10745677B2 (en) 2016-12-23 2020-08-18 President And Fellows Of Harvard College Editing of CCR5 receptor gene to protect against HIV infection
WO2020172343A2 (en) 2019-02-19 2020-08-27 Massachusetts Institute Of Technology Methods for treating injuries
US10760064B2 (en) 2013-03-15 2020-09-01 The General Hospital Corporation RNA-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci
US10767175B2 (en) 2016-06-08 2020-09-08 Agilent Technologies, Inc. High specificity genome editing using chemically modified guide RNAs
EP3708155A1 (en) * 2014-10-31 2020-09-16 Massachusetts Institute Of Technology Massively parallel combinatorial genetics for crispr
WO2020186213A1 (en) 2019-03-14 2020-09-17 The Broad Institute, Inc. Novel nucleic acid modifiers
WO2020186231A2 (en) 2019-03-14 2020-09-17 The Broad Institute, Inc. Crispr effector system based multiplex diagnostics
WO2020186223A1 (en) 2019-03-14 2020-09-17 The Broad Institute, Inc. Sherlock assays for tick-borne diseases
WO2020186237A1 (en) 2019-03-13 2020-09-17 The Broad Institute, Inc. Microglial progenitors for regeneration of functional microglia in the central nervous system and therapeutics uses thereof
WO2020182941A1 (en) 2019-03-12 2020-09-17 MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. Cas9 variants with enhanced specificity
WO2020186235A1 (en) 2019-03-14 2020-09-17 The Broad Institute, Inc. Compositions and methods for modulating cgrp signaling to regulate intestinal innate lymphoid cells
WO2020186101A1 (en) 2019-03-12 2020-09-17 The Broad Institute, Inc. Detection means, compositions and methods for modulating synovial sarcoma cells
US10780134B2 (en) 2015-06-15 2020-09-22 4D Pharma Research Limited Compositions comprising bacterial strains
US10781444B2 (en) 2013-06-17 2020-09-22 The Broad Institute, Inc. Functional genomics using CRISPR-Cas systems, compositions, methods, screens and applications thereof
WO2020191069A1 (en) 2019-03-18 2020-09-24 The Broad Institute, Inc. Modulation of type 2 immunity by targeting clec-2 signaling
WO2020191102A1 (en) 2019-03-18 2020-09-24 The Broad Institute, Inc. Type vii crispr proteins and systems
WO2020190927A1 (en) 2019-03-18 2020-09-24 Regeneron Pharmaceuticals, Inc. Crispr/cas dropout screening platform to reveal genetic vulnerabilities associated with tau aggregation
WO2020190932A1 (en) 2019-03-18 2020-09-24 Regeneron Pharmaceuticals, Inc. Crispr/cas screening platform to identify genetic modifiers of tau seeding or aggregation
WO2020191079A1 (en) 2019-03-18 2020-09-24 The Broad Institute, Inc. Compositions and methods for modulating metabolic regulators of t cell pathogenicity
WO2020206036A1 (en) 2019-04-01 2020-10-08 The Broad Institute, Inc. Novel nucleic acid modifier
WO2020205681A1 (en) 2019-03-29 2020-10-08 Massachusetts Institute Of Technology Constructs for continuous monitoring of live cells
WO2020206162A1 (en) 2019-04-03 2020-10-08 Regeneron Pharmaceuticals, Inc. Methods and compositions for insertion of antibody coding sequences into a safe harbor locus
WO2020206046A1 (en) 2019-04-01 2020-10-08 The Broad Institute, Inc. Methods and compositions for cell therapy
WO2020206139A1 (en) 2019-04-04 2020-10-08 Regeneron Pharmaceuticals, Inc. Non-human animals comprising a humanized coagulation factor 12 locus
WO2020206134A1 (en) 2019-04-04 2020-10-08 Regeneron Pharmaceuticals, Inc. Methods for scarless introduction of targeted modifications into targeting vectors
WO2020223539A1 (en) 2019-04-30 2020-11-05 The Broad Institute, Inc. Methods and compositions for barcoding nucleic acid libraries and cell populations
WO2020225719A1 (en) * 2019-05-03 2020-11-12 Specific Biologics Inc. Lipid-encapsulated dual-cleaving endonuclease for dna and gene editing
WO2020229830A1 (en) 2019-05-14 2020-11-19 British American Tobacco (Investments) Limited Method
WO2020229533A1 (en) 2019-05-13 2020-11-19 KWS SAAT SE & Co. KGaA Drought tolerance in corn
WO2020232271A1 (en) 2019-05-14 2020-11-19 The Broad Institute, Inc. Compositions and methods for targeting multinucleated cells
WO2020236967A1 (en) 2019-05-20 2020-11-26 The Broad Institute, Inc. Random crispr-cas deletion mutant
WO2020236972A2 (en) 2019-05-20 2020-11-26 The Broad Institute, Inc. Non-class i multi-component nucleic acid targeting systems
US10851137B2 (en) 2013-04-10 2020-12-01 4D Pharma Research Limited Polypeptide and immune modulation
US10851380B2 (en) 2012-10-23 2020-12-01 Toolgen Incorporated Methods for cleaving a target DNA using a guide RNA specific for the target DNA and Cas protein-encoding nucleic acid or Cas protein
WO2020243661A1 (en) 2019-05-31 2020-12-03 The Broad Institute, Inc. Methods for treating metabolic disorders by targeting adcy5
WO2020243371A1 (en) 2019-05-28 2020-12-03 Massachusetts Institute Of Technology Methods and compositions for modulating immune responses
WO2020239680A2 (en) 2019-05-25 2020-12-03 KWS SAAT SE & Co. KGaA Haploid induction enhancer
US10858647B2 (en) 2013-03-15 2020-12-08 Modernatx, Inc. Removal of DNA fragments in mRNA production process
WO2020247452A1 (en) 2019-06-04 2020-12-10 Regeneron Pharmaceuticals, Inc. Non-human animals comprising a humanized ttr locus with a beta-slip mutation and methods of use
WO2020247812A1 (en) 2019-06-07 2020-12-10 Regeneron Pharmaceuticals, Inc. Non-human animals comprising a humanized albumin locus
WO2020252340A1 (en) 2019-06-14 2020-12-17 Regeneron Pharmaceuticals, Inc. Models of tauopathy
US10883103B2 (en) 2015-06-02 2021-01-05 Monsanto Technology Llc Compositions and methods for delivery of a polynucleotide into a plant
WO2021001659A1 (en) 2019-07-03 2021-01-07 British American Tobacco (Investments) Limited Method for modifying alkaloid content in plants
WO2021001658A1 (en) 2019-07-03 2021-01-07 British American Tobacco (Investments) Limited Method for modulating the alkaloid content of a tobacco plant
WO2021003432A1 (en) 2019-07-02 2021-01-07 Fred Hutchinson Cancer Research Center Recombinant ad35 vectors and related gene therapy improvements
US10898574B2 (en) 2011-03-31 2021-01-26 Modernatx, Inc. Delivery and formulation of engineered nucleic acids
US10912797B2 (en) 2016-10-18 2021-02-09 Intima Bioscience, Inc. Tumor infiltrating lymphocytes and methods of therapy
EP3772542A1 (en) 2019-08-07 2021-02-10 KWS SAAT SE & Co. KGaA Modifying genetic variation in crops by modulating the pachytene checkpoint protein 2
US20210040460A1 (en) 2012-04-27 2021-02-11 Duke University Genetic correction of mutated genes
WO2021030627A1 (en) 2019-08-13 2021-02-18 The General Hospital Corporation Methods for predicting outcomes of checkpoint inhibition and treatment thereof
US10930367B2 (en) 2012-12-12 2021-02-23 The Broad Institute, Inc. Methods, models, systems, and apparatus for identifying target sequences for Cas enzymes or CRISPR-Cas systems for target sequences and conveying results thereof
WO2021041922A1 (en) 2019-08-30 2021-03-04 The Broad Institute, Inc. Crispr-associated mu transposase systems
WO2021046257A1 (en) 2019-09-03 2021-03-11 The Broad Institute, Inc. Crispr effector system based multiplex cancer diagnostics
WO2021050974A1 (en) 2019-09-12 2021-03-18 The Broad Institute, Inc. Engineered adeno-associated virus capsids
WO2021050940A1 (en) 2019-09-13 2021-03-18 Regeneron Pharmaceuticals, Inc. Transcription modulation in animals using crispr/cas systems delivered by lipid nanoparticles
WO2021055855A1 (en) 2019-09-20 2021-03-25 The Broad Institute, Inc. Compositions and methods for delivering cargo to a target cell
WO2021055874A1 (en) 2019-09-20 2021-03-25 The Broad Institute, Inc. Novel type vi crispr enzymes and systems
US10973872B2 (en) 2014-12-23 2021-04-13 4D Pharma Research Limited Pirin polypeptide and immune modulation
JP2021058202A (en) * 2015-03-03 2021-04-15 ザ ジェネラル ホスピタル コーポレイション Engineered crispr-cas9 nucleases with altered pam specificity
WO2021074367A1 (en) 2019-10-17 2021-04-22 KWS SAAT SE & Co. KGaA Enhanced disease resistance of crops by downregulation of repressor genes
US10987409B2 (en) 2015-07-02 2021-04-27 Poseida Therapeutics, Inc. Compositions and methods for improved encapsulation of functional proteins in polymeric vesicles
US10987387B2 (en) 2017-05-24 2021-04-27 4D Pharma Research Limited Compositions comprising bacterial strain
US11001829B2 (en) 2014-09-25 2021-05-11 The Broad Institute, Inc. Functional screening with optimized functional CRISPR-Cas systems
WO2021092513A1 (en) 2019-11-08 2021-05-14 Regeneron Pharmaceuticals, Inc. Crispr and aav strategies for x-linked juvenile retinoschisis therapy
US11008588B2 (en) 2013-06-17 2021-05-18 The Broad Institute, Inc. Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation
US11007233B2 (en) 2017-06-14 2021-05-18 4D Pharma Research Limited Compositions comprising a bacterial strain of the genus Megasphera and uses thereof
WO2021108363A1 (en) 2019-11-25 2021-06-03 Regeneron Pharmaceuticals, Inc. Crispr/cas-mediated upregulation of humanized ttr allele
US11028388B2 (en) 2014-03-05 2021-06-08 Editas Medicine, Inc. CRISPR/Cas-related methods and compositions for treating Usher syndrome and retinitis pigmentosa
EP3835309A1 (en) 2019-12-13 2021-06-16 KWS SAAT SE & Co. KGaA Method for increasing cold or frost tolerance in a plant
AU2019275586B2 (en) * 2018-08-16 2021-06-17 Lart Bio Co., Ltd. Transgenic animals and transgenic embryos producing an engineered nuclease
CN112997966A (en) * 2021-03-08 2021-06-22 国家卫生健康委科学技术研究所 Mouse model knocking-in miRNA-125a based on CRISPR/Cas9 technology and construction method
WO2021133829A1 (en) * 2019-12-23 2021-07-01 The Regents Of The University Of California Crispr-cas effector polypeptides and methods of use thereof
US11051497B2 (en) 2011-09-19 2021-07-06 Kymab Limited Manipulation of immunoglobulin gene diversity and multi-antibody therapeutics
US11072816B2 (en) 2017-05-03 2021-07-27 The Broad Institute, Inc. Single-cell proteomic assay using aptamers
US11092607B2 (en) 2015-10-28 2021-08-17 The Board Institute, Inc. Multiplex analysis of single cell constituents
US11098325B2 (en) 2017-06-30 2021-08-24 Intima Bioscience, Inc. Adeno-associated viral vectors for gene therapy
US11104937B2 (en) 2017-03-15 2021-08-31 The Broad Institute, Inc. CRISPR effector system based diagnostics
EP3872190A1 (en) 2020-02-26 2021-09-01 Antibodies-Online GmbH A method of using cut&run or cut&tag to validate crispr-cas targeting
US11111521B2 (en) 2011-12-22 2021-09-07 President And Fellows Of Harvard College Compositions and methods for analyte detection
WO2021178556A1 (en) 2020-03-04 2021-09-10 Regeneron Pharmaceuticals, Inc. Methods and compositions for sensitization of tumor cells to immune therapy
US11123379B2 (en) 2017-06-14 2021-09-21 4D Pharma Research Limited Compositions comprising bacterial strains
US11123378B2 (en) 2017-05-22 2021-09-21 4D Pharma Research Limited Compositions comprising bacterial strains
WO2021188734A1 (en) 2020-03-17 2021-09-23 The Broad Institute, Inc. Crispr system high throughput diagnostic systems and methods
WO2021195079A1 (en) 2020-03-23 2021-09-30 Regeneron Pharmaceuticals, Inc. Non-human animals comprising a humanized ttr locus comprising a v30m mutation and methods of use
WO2021202800A1 (en) 2020-03-31 2021-10-07 Arbor Biotechnologies, Inc. Compositions comprising a cas12i2 variant polypeptide and uses thereof
WO2021202938A1 (en) 2020-04-03 2021-10-07 Creyon Bio, Inc. Oligonucleotide-based machine learning
US11141493B2 (en) 2014-03-10 2021-10-12 Editas Medicine, Inc. Compositions and methods for treating CEP290-associated disease
WO2021205000A2 (en) 2020-04-09 2021-10-14 R.J. Reynolds Tobacco Company Method
US11174515B2 (en) 2017-03-15 2021-11-16 The Broad Institute, Inc. CRISPR effector system based diagnostics
US11180793B2 (en) 2015-04-24 2021-11-23 Editas Medicine, Inc. Evaluation of Cas9 molecule/guide RNA molecule complexes
WO2021239986A1 (en) 2020-05-29 2021-12-02 KWS SAAT SE & Co. KGaA Plant haploid induction
US20210395799A1 (en) * 2015-11-25 2021-12-23 Integrated Dna Technologies, Inc. Methods for variant detection
US11214800B2 (en) 2015-08-18 2022-01-04 The Broad Institute, Inc. Methods and compositions for altering function and structure of chromatin loops and/or domains
US11213594B2 (en) 2016-04-29 2022-01-04 Poseida Therapeutics, Inc. Poly(histidine)-based micelles for complexation and delivery of proteins and nucleic acids
WO2022010286A1 (en) * 2020-07-08 2022-01-13 경상국립대학교산학협력단 Donor nucleic acid used for gene correction through microhomology-mediated end joining and uses thereof
US11224620B2 (en) 2016-07-13 2022-01-18 4D Pharma Plc Compositions comprising bacterial strains
WO2022018667A1 (en) 2020-07-24 2022-01-27 Pfizer Inc. Combination therapies using cdk2 and cdc25a inhibitors
US11236313B2 (en) 2016-04-13 2022-02-01 Editas Medicine, Inc. Cas9 fusion molecules, gene editing systems, and methods of use thereof
US11242525B2 (en) 2014-03-26 2022-02-08 Editas Medicine, Inc. CRISPR/CAS-related methods and compositions for treating sickle cell disease
US11244760B2 (en) 2015-06-25 2022-02-08 Karydo Therapeutix, Inc. Prediction device based on inter-organ cross talk system
WO2022032228A1 (en) 2020-08-07 2022-02-10 The Broad Institute, Inc. Therapeutic targeting of phosphate dysregulation in cancer via the xpr1:kidins220 protein complex
US11268082B2 (en) 2017-03-23 2022-03-08 President And Fellows Of Harvard College Nucleobase editors comprising nucleic acid programmable DNA binding proteins
US11266698B2 (en) 2011-10-07 2022-03-08 4D Pharma Research Limited Bacterium for use as a probiotic for nutritional and medical applications
US11285193B2 (en) 2013-08-29 2022-03-29 Temple University—Of the Commonwealth System of Higher Education Methods and compositions for RNA-guided treatment of HIV infection
WO2022068912A1 (en) 2020-09-30 2022-04-07 Huigene Therapeutics Co., Ltd. Engineered crispr/cas13 system and uses thereof
US11299767B2 (en) 2013-03-12 2022-04-12 President And Fellows Of Harvard College Method for generating a three-dimensional nucleic acid containing matrix
US11306324B2 (en) 2016-10-14 2022-04-19 President And Fellows Of Harvard College AAV delivery of nucleobase editors
US11306309B2 (en) 2015-04-06 2022-04-19 The Board Of Trustees Of The Leland Stanford Junior University Chemically modified guide RNAs for CRISPR/CAS-mediated gene regulation
US11319532B2 (en) 2017-08-30 2022-05-03 President And Fellows Of Harvard College High efficiency base editors comprising Gam
US11332736B2 (en) 2017-12-07 2022-05-17 The Broad Institute, Inc. Methods and compositions for multiplexing single cell and single nuclei sequencing
US11339437B2 (en) 2014-03-10 2022-05-24 Editas Medicine, Inc. Compositions and methods for treating CEP290-associated disease
EP4001429A1 (en) 2020-11-16 2022-05-25 Antibodies-Online GmbH Analysis of crispr-cas binding and cleavage sites followed by high-throughput sequencing (abc-seq)
WO2022120022A1 (en) 2020-12-02 2022-06-09 Regeneron Pharmaceuticals, Inc. Crispr sam biosensor cell lines and methods of use thereof
CN114634930A (en) * 2015-08-25 2022-06-17 杜克大学 Compositions and methods for improving genome engineering specificity using RNA-guided endonucleases
US11377470B2 (en) 2013-03-15 2022-07-05 Modernatx, Inc. Ribonucleic acid purification
US11389493B2 (en) 2015-06-15 2022-07-19 4D Pharma Research Limited Compositions comprising bacterial strains
US11390884B2 (en) 2015-05-11 2022-07-19 Editas Medicine, Inc. Optimized CRISPR/cas9 systems and methods for gene editing in stem cells
EP3891276A4 (en) * 2018-12-05 2022-07-27 Fred Hutchinson Cancer Center PRODUCTION WITH REDUCED AND MINIMAL HANDLING OF GENETICALLY MODIFIED CELLS
US11414657B2 (en) 2015-06-29 2022-08-16 Ionis Pharmaceuticals, Inc. Modified CRISPR RNA and modified single CRISPR RNA and uses thereof
WO2022174099A2 (en) 2021-02-11 2022-08-18 Arbor Biotechnologies, Inc. Compositions comprising a variant cas12i4 polypeptide and uses thereof
WO2022188039A1 (en) 2021-03-09 2022-09-15 Huigene Therapeutics Co., Ltd. Engineered crispr/cas13 system and uses thereof
WO2022188797A1 (en) 2021-03-09 2022-09-15 Huigene Therapeutics Co., Ltd. Engineered crispr/cas13 system and uses thereof
US11447770B1 (en) 2019-03-19 2022-09-20 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US11447527B2 (en) 2018-09-18 2022-09-20 Vnv Newco Inc. Endogenous Gag-based capsids and uses thereof
US11453891B2 (en) 2017-05-10 2022-09-27 The Regents Of The University Of California Directed editing of cellular RNA via nuclear delivery of CRISPR/CAS9
US11453907B2 (en) 2020-03-23 2022-09-27 The Broad Institute, Inc. Crispr effector system based coronavirus diagnostics
US11466271B2 (en) 2017-02-06 2022-10-11 Novartis Ag Compositions and methods for the treatment of hemoglobinopathies
US11499151B2 (en) 2017-04-28 2022-11-15 Editas Medicine, Inc. Methods and systems for analyzing guide RNA molecules
WO2022240846A1 (en) 2021-05-10 2022-11-17 Sqz Biotechnologies Company Methods for delivering genome editing molecules to the nucleus or cytosol of a cell and uses thereof
US11512311B2 (en) 2016-03-25 2022-11-29 Editas Medicine, Inc. Systems and methods for treating alpha 1-antitrypsin (A1AT) deficiency
WO2022251644A1 (en) 2021-05-28 2022-12-01 Lyell Immunopharma, Inc. Nr4a3-deficient immune cells and uses thereof
WO2022247873A1 (en) 2021-05-27 2022-12-01 中国科学院动物研究所 Engineered cas12i nuclease, effector protein and use thereof
WO2022256437A1 (en) 2021-06-02 2022-12-08 Lyell Immunopharma, Inc. Nr4a3-deficient immune cells and uses thereof
US11542554B2 (en) 2015-11-03 2023-01-03 President And Fellows Of Harvard College Method and apparatus for volumetric imaging
US11542496B2 (en) 2017-03-10 2023-01-03 President And Fellows Of Harvard College Cytosine to guanine base editor
US11542509B2 (en) 2016-08-24 2023-01-03 President And Fellows Of Harvard College Incorporation of unnatural amino acids into proteins using base editing
US11547614B2 (en) 2017-10-31 2023-01-10 The Broad Institute, Inc. Methods and compositions for studying cell evolution
US11560566B2 (en) 2017-05-12 2023-01-24 President And Fellows Of Harvard College Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation
WO2023004422A2 (en) 2021-07-22 2023-01-26 Arbor Biotechnologies, Inc. Crispr-associated transposon systems and methods of using same
WO2023004367A2 (en) 2021-07-20 2023-01-26 The Broad Institute, Inc. Engineered targeting compositions for endothelial cells of the central nervous system vasculature and methods of use thereof
US11566263B2 (en) 2016-08-02 2023-01-31 Editas Medicine, Inc. Compositions and methods for treating CEP290 associated disease
WO2023006933A1 (en) 2021-07-30 2023-02-02 KWS SAAT SE & Co. KGaA Plants with improved digestibility and marker haplotypes
US11578118B2 (en) 2017-10-20 2023-02-14 Fred Hutchinson Cancer Center Systems and methods to produce B cells genetically modified to express selected antibodies
US11578312B2 (en) 2015-06-18 2023-02-14 The Broad Institute Inc. Engineering and optimization of systems, methods, enzymes and guide scaffolds of CAS9 orthologs and variants for sequence manipulation
WO2023019243A1 (en) 2021-08-12 2023-02-16 Arbor Biotechnologies, Inc. Compositions comprising a variant cas12i3 polypeptide and uses thereof
US11591601B2 (en) 2017-05-05 2023-02-28 The Broad Institute, Inc. Methods for identification and modification of lncRNA associated with target genotypes and phenotypes
US11597924B2 (en) 2016-03-25 2023-03-07 Editas Medicine, Inc. Genome editing systems comprising repair-modulating enzyme molecules and methods of their use
US11603544B2 (en) 2017-06-05 2023-03-14 Fred Hutchinson Cancer Center Genomic safe harbors for genetic therapies in human stem cells and engineered nanoparticles to provide targeted genetic therapies
US11617783B2 (en) 2015-11-16 2023-04-04 Research Institute At Nationwide Children's Hospital Repairing a mutant human titin gene using CRISPR technology
US11618928B2 (en) 2017-04-12 2023-04-04 The Broad Institute, Inc. CRISPR effector system based diagnostics for malaria detection
WO2023064924A1 (en) 2021-10-14 2023-04-20 Codiak Biosciences, Inc. Modified producer cells for extracellular vesicle production
US11633732B2 (en) 2017-10-04 2023-04-25 The Broad Institute, Inc. CRISPR effector system based diagnostics
WO2023077053A2 (en) 2021-10-28 2023-05-04 Regeneron Pharmaceuticals, Inc. Crispr/cas-related methods and compositions for knocking out c5
US11649444B1 (en) 2021-11-02 2023-05-16 Huidagene Therapeutics Co., Ltd. CRISPR-CAS12i systems
US11661590B2 (en) 2016-08-09 2023-05-30 President And Fellows Of Harvard College Programmable CAS9-recombinase fusion proteins and uses thereof
WO2023093862A1 (en) 2021-11-26 2023-06-01 Epigenic Therapeutics Inc. Method of modulating pcsk9 and uses thereof
US11667911B2 (en) 2015-09-24 2023-06-06 Editas Medicine, Inc. Use of exonucleases to improve CRISPR/CAS-mediated genome editing
US11667903B2 (en) 2015-11-23 2023-06-06 The Regents Of The University Of California Tracking and manipulating cellular RNA via nuclear delivery of CRISPR/CAS9
US20230175015A1 (en) * 2020-05-12 2023-06-08 Myogene Bio Llc Immunosuppressive agents and viral delivery re-dosing methods for gene therapy
WO2023108047A1 (en) 2021-12-08 2023-06-15 Regeneron Pharmaceuticals, Inc. Mutant myocilin disease model and uses thereof
US11680296B2 (en) 2017-10-16 2023-06-20 Massachusetts Institute Of Technology Mycobacterium tuberculosis host-pathogen interaction
US11680268B2 (en) 2014-11-07 2023-06-20 Editas Medicine, Inc. Methods for improving CRISPR/Cas-mediated genome-editing
US20230193301A1 (en) * 2021-12-14 2023-06-22 Institute of Medicinal Plant Development (IMPLAD), CAMS & PUMC Method and use for identifying plant species based on whole genome analysis and genome editing
WO2023129974A1 (en) 2021-12-29 2023-07-06 Bristol-Myers Squibb Company Generation of landing pad cell lines
US11707056B2 (en) 2013-05-02 2023-07-25 Kymab Limited Animals, repertoires and methods
US11713485B2 (en) 2016-04-25 2023-08-01 President And Fellows Of Harvard College Hybridization chain reaction methods for in situ molecular detection
EP4219699A1 (en) 2013-12-12 2023-08-02 The Broad Institute, Inc. Engineering of systems, methods and optimized guide compositions with new architectures for sequence manipulation
WO2023150181A1 (en) 2022-02-01 2023-08-10 President And Fellows Of Harvard College Methods and compositions for treating cancer
WO2023150620A1 (en) 2022-02-02 2023-08-10 Regeneron Pharmaceuticals, Inc. Crispr-mediated transgene insertion in neonatal cells
WO2023148478A1 (en) 2022-02-03 2023-08-10 Nicoventures Trading Limited Method of modulating alkaloid content in tobacco plants
WO2023148475A1 (en) 2022-02-04 2023-08-10 Nicoventures Trading Limited Method of modulating alkaloid content in tobacco plants
WO2023148476A1 (en) 2022-02-03 2023-08-10 Nicoventures Trading Limited Method of modulating alkaloid content in tobacco plants
WO2023150637A1 (en) 2022-02-02 2023-08-10 Inscripta, Inc. Nucleic acid-guided nickase fusion proteins
US11723933B2 (en) 2014-12-23 2023-08-15 Cj Bioscience, Inc. Composition of bacteroides thetaiotaomicron for immune modulation
US11732274B2 (en) 2017-07-28 2023-08-22 President And Fellows Of Harvard College Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE)
US11733235B2 (en) 2016-12-27 2023-08-22 Chugai Seiyaku Kabushiki Kaisha Method for evaluating immunogenicity of test substance
US11739156B2 (en) 2019-01-06 2023-08-29 The Broad Institute, Inc. Massachusetts Institute of Technology Methods and compositions for overcoming immunosuppression
WO2023163131A1 (en) 2022-02-28 2023-08-31 国立大学法人東海国立大学機構 Medicine for disease caused by frame-shift mutation
WO2023194746A1 (en) 2022-04-07 2023-10-12 Nicoventures Trading Limited Method for modulating the alkaloid content of tobacco
WO2023196818A1 (en) 2022-04-04 2023-10-12 The Regents Of The University Of California Genetic complementation compositions and methods
WO2023194747A1 (en) 2022-04-07 2023-10-12 Nicoventures Trading Limited Method of modulating the alkaloid content of tobacco
WO2023199064A1 (en) 2022-04-14 2023-10-19 Nicoventures Trading Limited Method of modulating the alkaloid content of tobacco
WO2023199065A1 (en) 2022-04-14 2023-10-19 Nicoventures Trading Limited Method of modulating the alkaloid content of tobacco
US11795443B2 (en) 2017-10-16 2023-10-24 The Broad Institute, Inc. Uses of adenosine base editors
US11793787B2 (en) 2019-10-07 2023-10-24 The Broad Institute, Inc. Methods and compositions for enhancing anti-tumor immunity by targeting steroidogenesis
EP4268831A2 (en) 2018-09-12 2023-11-01 Fred Hutchinson Cancer Center Reducing cd33 expression to selectively protect therapeutic cells
WO2023212677A2 (en) 2022-04-29 2023-11-02 Regeneron Pharmaceuticals, Inc. Identification of tissue-specific extragenic safe harbors for gene therapy approaches
WO2023209372A1 (en) 2022-04-27 2023-11-02 Nicoventures Trading Limited Method of modulating the alkaloid content of tobacco
WO2023209373A1 (en) 2022-04-27 2023-11-02 Nicoventures Trading Limited Method of modulating the alkaloid content of tobacco
WO2023220603A1 (en) 2022-05-09 2023-11-16 Regeneron Pharmaceuticals, Inc. Vectors and methods for in vivo antibody production
WO2023225665A1 (en) 2022-05-19 2023-11-23 Lyell Immunopharma, Inc. Polynucleotides targeting nr4a3 and uses thereof
WO2023225564A1 (en) 2022-05-18 2023-11-23 The Broad Institute, Inc. Engineered viral capsids with increased stability and methods of use thereof
WO2023235726A2 (en) 2022-05-31 2023-12-07 Regeneron Pharmaceuticals, Inc. Crispr interference therapeutics for c9orf72 repeat expansion disease
WO2023235725A2 (en) 2022-05-31 2023-12-07 Regeneron Pharmaceuticals, Inc. Crispr-based therapeutics for c9orf72 repeat expansion disease
US11844800B2 (en) 2019-10-30 2023-12-19 Massachusetts Institute Of Technology Methods and compositions for predicting and preventing relapse of acute lymphoblastic leukemia
US11866697B2 (en) 2017-05-18 2024-01-09 The Broad Institute, Inc. Systems, methods, and compositions for targeted nucleic acid editing
US11866726B2 (en) 2017-07-14 2024-01-09 Editas Medicine, Inc. Systems and methods for targeted integration and genome editing and detection thereof using integrated priming sites
WO2024016003A2 (en) 2022-07-14 2024-01-18 The Broad Institute, Inc. Aav capsids that enable cns-wide gene delivery through interactions with the transferrin receptor
WO2024020557A1 (en) 2022-07-22 2024-01-25 Arbor Biotechnologies, Inc. Compositions comprising a variant nuclease and uses thereof
WO2024020567A1 (en) 2022-07-22 2024-01-25 Arbor Biotechnologies, Inc. Compositions comprising a variant polypeptide and uses thereof
US11884915B2 (en) 2021-09-10 2024-01-30 Agilent Technologies, Inc. Guide RNAs with chemical modification for prime editing
WO2024026474A1 (en) 2022-07-29 2024-02-01 Regeneron Pharmaceuticals, Inc. Compositions and methods for transferrin receptor (tfr)-mediated delivery to the brain and muscle
WO2024031053A1 (en) 2022-08-05 2024-02-08 Regeneron Pharmaceuticals, Inc. Aggregation-resistant variants of tdp-43
US11898158B2 (en) 2012-07-11 2024-02-13 Sangamo Therapeutics, Inc. Methods and compositions for the treatment of lysosomal storage diseases
US11897953B2 (en) 2017-06-14 2024-02-13 The Broad Institute, Inc. Compositions and methods targeting complement component 3 for inhibiting tumor growth
US11898179B2 (en) 2017-03-09 2024-02-13 President And Fellows Of Harvard College Suppression of pain by gene editing
US11913075B2 (en) 2017-04-01 2024-02-27 The Broad Institute, Inc. Methods and compositions for detecting and modulating an immunotherapy resistance gene signature in cancer
US11912985B2 (en) 2020-05-08 2024-02-27 The Broad Institute, Inc. Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence
US11911415B2 (en) 2015-06-09 2024-02-27 Editas Medicine, Inc. CRISPR/Cas-related methods and compositions for improving transplantation
US11913015B2 (en) 2017-04-17 2024-02-27 University Of Maryland, College Park Embryonic cell cultures and methods of using the same
WO2024042199A1 (en) 2022-08-26 2024-02-29 KWS SAAT SE & Co. KGaA Use of paired genes in hybrid breeding
WO2024064958A1 (en) 2022-09-23 2024-03-28 Lyell Immunopharma, Inc. Methods for culturing nr4a-deficient cells
WO2024064952A1 (en) 2022-09-23 2024-03-28 Lyell Immunopharma, Inc. Methods for culturing nr4a-deficient cells overexpressing c-jun
WO2024073606A1 (en) 2022-09-28 2024-04-04 Regeneron Pharmaceuticals, Inc. Antibody resistant modified receptors to enhance cell-based therapies
WO2024077174A1 (en) 2022-10-05 2024-04-11 Lyell Immunopharma, Inc. Methods for culturing nr4a-deficient cells
US11957695B2 (en) 2018-04-26 2024-04-16 The Broad Institute, Inc. Methods and compositions targeting glucocorticoid signaling for modulating immune responses
US11963982B2 (en) 2017-05-10 2024-04-23 Editas Medicine, Inc. CRISPR/RNA-guided nuclease systems and methods
US11965159B2 (en) 2019-01-29 2024-04-23 The Broad Institute, Inc. Compositions and methods for regulating proteins and nucleic acids activities
US11963966B2 (en) 2017-03-31 2024-04-23 Dana-Farber Cancer Institute, Inc. Compositions and methods for treating ovarian tumors
US11970710B2 (en) 2015-10-13 2024-04-30 Duke University Genome engineering with Type I CRISPR systems in eukaryotic cells
WO2024098002A1 (en) 2022-11-04 2024-05-10 Regeneron Pharmaceuticals, Inc. Calcium voltage-gated channel auxiliary subunit gamma 1 (cacng1) binding proteins and cacng1-mediated delivery to skeletal muscle
US11981900B2 (en) 2020-09-10 2024-05-14 Monsanto Technology Llc Increasing gene editing and site-directed integration events utilizing meiotic and germline promoters
US11981922B2 (en) 2019-10-03 2024-05-14 Dana-Farber Cancer Institute, Inc. Methods and compositions for the modulation of cell interactions and signaling in the tumor microenvironment
WO2024107765A2 (en) 2022-11-14 2024-05-23 Regeneron Pharmaceuticals, Inc. Compositions and methods for fibroblast growth factor receptor 3-mediated delivery to astrocytes
US11994512B2 (en) 2018-01-04 2024-05-28 Massachusetts Institute Of Technology Single-cell genomic methods to generate ex vivo cell systems that recapitulate in vivo biology with improved fidelity
WO2024124044A1 (en) 2022-12-07 2024-06-13 The Brigham And Women’S Hospital, Inc. Compositions and methods targeting sat1 for enhancing anti¬ tumor immunity during tumor progression
WO2024133600A1 (en) 2022-12-20 2024-06-27 Nanocell Therapeutics B.V. Integrating and self-inactivating viral vectors and constructs and uses thereof
US12031154B2 (en) 2015-05-08 2024-07-09 President And Fellows Of Harvard College Universal donor stem cells and related methods
US12031132B2 (en) 2018-03-14 2024-07-09 Editas Medicine, Inc. Systems and methods for the treatment of hemoglobinopathies
US12036240B2 (en) 2018-06-14 2024-07-16 The Broad Institute, Inc. Compositions and methods targeting complement component 3 for inhibiting tumor growth
WO2024153938A1 (en) 2023-01-20 2024-07-25 Nicoventures Trading Limited Method
WO2024155597A1 (en) 2023-01-17 2024-07-25 Inscripta, Inc. Methods and compositions of co-expression of t7rna polymerase and inhibitory rna aptamers
US12048720B2 (en) 2017-06-14 2024-07-30 Cj Bioscience, Inc. Compositions comprising bacterial strains
US12049643B2 (en) 2017-07-14 2024-07-30 The Broad Institute, Inc. Methods and compositions for modulating cytotoxic lymphocyte activity
WO2024159071A1 (en) 2023-01-27 2024-08-02 Regeneron Pharmaceuticals, Inc. Modified rhabdovirus glycoproteins and uses thereof
US12054754B2 (en) 2017-11-02 2024-08-06 Arbor Biotechnologies, Inc. CRISPR-associated transposon systems and components
WO2024163842A2 (en) 2023-02-03 2024-08-08 The Broad Institute, Inc. Delivering genes to the brain endothelium to treat lysosomal storage disorder-derived neuropathology
US12058986B2 (en) 2017-04-20 2024-08-13 Egenesis, Inc. Method for generating a genetically modified pig with inactivated porcine endogenous retrovirus (PERV) elements
WO2024168265A1 (en) 2023-02-10 2024-08-15 Possible Medicines Llc Aav delivery of rna guided recombination system
WO2024168253A1 (en) 2023-02-10 2024-08-15 Possible Medicines Llc Delivery of an rna guided recombination system
US12077483B2 (en) 2018-12-05 2024-09-03 Intellia Therapeutics, Inc. Modified amine lipids
WO2024180236A1 (en) 2023-03-02 2024-09-06 Universitetet I Oslo Brassica plants with improved seed retention
US12091701B2 (en) 2016-03-29 2024-09-17 Karydo Therapeutix, Inc. Screening method for candidate substances for active component to prevent or treat at least one disease selected from the group consisting of renal hypofunction, chronic kidney disease and kidney failure
WO2024192141A1 (en) 2023-03-13 2024-09-19 Dana-Farber Cancer Institute, Inc. Treatment of cancers having a drug-resistant mesenchymal cell state
US12098425B2 (en) 2018-10-10 2024-09-24 Readcoor, Llc Three-dimensional spatial molecular indexing
US12098399B2 (en) 2022-06-24 2024-09-24 Tune Therapeutics, Inc. Compositions, systems, and methods for epigenetic regulation of proprotein convertase subtilisin/kexin type 9 (PCSK9) gene expression
WO2024197185A1 (en) 2023-03-21 2024-09-26 The Broad Institute, Inc. Methods and compositions for dissecting organelle physiology
WO2024206911A2 (en) 2023-03-30 2024-10-03 Children's Hospital Medical Center Clinical-grade organoids
US12109274B2 (en) 2015-09-17 2024-10-08 Modernatx, Inc. Polynucleotides containing a stabilizing tail region
US12110545B2 (en) 2017-01-06 2024-10-08 Editas Medicine, Inc. Methods of assessing nuclease cleavage
RU2829155C2 (en) * 2016-05-20 2024-10-24 Регенерон Фармасьютикалс, Инк. Methods of overcoming immunological tolerance using multiple targeting rnas
WO2024220741A1 (en) 2023-04-19 2024-10-24 Flagship Pioneering Innovations Vii, Llc Compositions and methods for the production of libraries
WO2024226838A2 (en) 2023-04-25 2024-10-31 The Brigham And Women's Hospital, Inc. Treatment of autoimmune diseases having a pathogenic t cell state
WO2024238977A2 (en) 2023-05-18 2024-11-21 Children's Hospital Medical Center Liver organoids with intrahepatic sympathetic nerves, and methods of use thereof
WO2024236547A1 (en) 2023-05-18 2024-11-21 Inceptor Bio, Llc Modified phagocytic cells expressing chimeric antigen receptors comprising a herpes virus entry mediator (hvem) co-stimulatory domain and uses thereof
US12157760B2 (en) 2018-05-23 2024-12-03 The Broad Institute, Inc. Base editors and uses thereof
US12165747B2 (en) 2020-01-23 2024-12-10 The Broad Institute, Inc. Molecular spatial mapping of metastatic tumor microenvironment
US12165743B2 (en) 2018-11-09 2024-12-10 The Broad Institute, Inc. Compressed sensing for screening and tissue imaging
US12161694B2 (en) 2017-03-24 2024-12-10 The Broad Institute, Inc. Methods and compositions for regulating innate lymphoid cell inflammatory responses
WO2024259309A1 (en) 2023-06-15 2024-12-19 Regeneron Pharmaceuticals, Inc. Gene therapy for hearing disorders
WO2024255823A1 (en) 2023-06-16 2024-12-19 益杰立科(上海)生物科技有限公司 Epigenetic editing tool for targeting hepatitis b virus gene
US12171783B2 (en) 2017-11-13 2024-12-24 The Broad Institute, Inc. Methods and compositions for targeting developmental and oncogenic programs in H3K27M gliomas
WO2024263961A2 (en) 2023-06-23 2024-12-26 Children's Hospital Medical Center Methods of matrix-free suspension culture
US12180263B2 (en) 2014-11-06 2024-12-31 President And Fellows Of Harvard College Cells lacking B2M surface expression and methods for allogeneic administration of such cells
WO2025006963A1 (en) 2023-06-30 2025-01-02 Regeneron Pharmaceuticals, Inc. Methods and compositions for increasing homology-directed repair
WO2025006419A1 (en) 2023-06-26 2025-01-02 Flagship Pioneering Innovations Vii, Llc Engineered plasmodia and related methods
US12188059B2 (en) 2016-09-13 2025-01-07 The Broad Institute, Inc. Proximity-dependent biotinylation and uses thereof
US12195725B2 (en) 2019-10-03 2025-01-14 Dana-Farber Cancer Institute, Inc. Compositions and methods for modulating and detecting tissue specific TH17 cell pathogenicity
US12195723B2 (en) 2019-11-08 2025-01-14 The Broad Institute, Inc. Engineered antigen presenting cells and uses thereof
US12203136B2 (en) 2020-08-17 2025-01-21 Readcoor, Llc Methods and systems for spatial mapping of genetic variants
US12201699B2 (en) 2014-10-10 2025-01-21 Editas Medicine, Inc. Compositions and methods for promoting homology directed repair
US12214056B2 (en) 2016-07-19 2025-02-04 Duke University Therapeutic applications of CPF1-based genome editing
US12215366B2 (en) 2015-02-09 2025-02-04 Duke University Compositions and methods for epigenome editing
US12215382B2 (en) 2019-03-01 2025-02-04 The General Hospital Corporation Liver protective MARC variants and uses thereof
US12214054B2 (en) 2015-11-30 2025-02-04 Duke University Therapeutic targets for the correction of the human dystrophin gene by gene editing and methods of use
US12215345B2 (en) 2013-03-19 2025-02-04 Duke University Compositions and methods for the induction and tuning of gene expression
WO2025029654A2 (en) 2023-07-28 2025-02-06 Regeneron Pharmaceuticals, Inc. Use of bgh-sv40l tandem polya to enhance transgene expression during unidirectional gene insertion
WO2025029657A2 (en) 2023-07-28 2025-02-06 Regeneron Pharmaceuticals, Inc. Anti-tfr:gaa and anti-cd63:gaa insertion for treatment of pompe disease
WO2025029662A1 (en) 2023-07-28 2025-02-06 Regeneron Pharmaceuticals, Inc. Anti-tfr: acid sphingomyelinase for treatment of acid sphingomyelinase deficiency
US12221720B2 (en) 2017-11-13 2025-02-11 The Broad Institute, Inc. Methods for determining spatial and temporal gene expression dynamics during adult neurogenesis in single cells
US12221636B2 (en) 2017-10-04 2025-02-11 The Broad Institute, Inc. Systems methods, and compositions for targeted nucleic acid editing
US12227578B2 (en) 2016-11-11 2025-02-18 The Broad Institute, Inc. Modulation of intestinal epithelial cell differentiation, maintenance and/or function through T cell action
US12226479B2 (en) 2017-05-11 2025-02-18 The General Hospital Corporation Methods and compositions of use of CD8+ tumor infiltrating lymphocyte subtypes and gene signatures thereof
US12227742B2 (en) 2017-10-23 2025-02-18 The Broad Institute, Inc. Nucleic acid modifiers
WO2025038750A2 (en) 2023-08-14 2025-02-20 President And Fellows Of Harvard College Methods and compositions for treating cancer
EP4512819A2 (en) 2015-08-12 2025-02-26 The General Hospital Corporation Compositions and methods that promote hypoxia or the hypoxia response for treatment and prevention of mitochondrial dysfunction and oxidative stress disorders
US12239646B2 (en) 2017-07-19 2025-03-04 Dana-Farber Cancer Institute, Inc. Cancer diagnostic and treatment
US12241830B2 (en) 2019-12-06 2025-03-04 Broad Institute, Inc. Living biosensors
US12241090B2 (en) 2014-05-28 2025-03-04 Children's Hospital Medical Center Methods and systems for converting precursor cells into gastric tissues through directed differentiation
WO2025046513A1 (en) 2023-08-29 2025-03-06 Inceptor Bio, Llc Methods of manufacturing myeloid-derived cells from hematopoietic stem cells and compositions and uses thereof
WO2025049788A1 (en) 2023-08-29 2025-03-06 The Broad Institute, Inc. Optical genetic screens of intracellular and intercellular transcriptional circuits with perturb-fish
WO2025049524A1 (en) 2023-08-28 2025-03-06 Regeneron Pharmaceuticals, Inc. Cxcr4 antibody-resistant modified receptors
US12252705B2 (en) 2020-01-17 2025-03-18 The Broad Institute, Inc. Small type II-D Cas proteins and methods of use thereof
WO2025059533A1 (en) 2023-09-13 2025-03-20 The Broad Institute, Inc. Crispr enzymes and systems
US12258594B2 (en) 2018-12-05 2025-03-25 The Broad Institute, Inc. Cas proteins with reduced immunogenicity and methods of screening thereof
US12258573B2 (en) 2019-08-21 2025-03-25 Research Institute At Nationwide Children's Hospital Adeno-associated virus vector delivery of alpha-sarcoglycan and the treatment of muscular dystrophy
US12258584B2 (en) 2010-05-06 2025-03-25 Children's Hospital Medical Center Methods and systems for converting precursor cells into intestinal tissues through directed differentiation
US12264323B2 (en) 2018-12-17 2025-04-01 The Broad Institute, Inc. CRISPR CPF1 direct repeat variants
US12263230B2 (en) 2018-01-31 2025-04-01 Research Institute At Nationwide Children's Hospital Gene therapy for limb-girdle muscular dystrophy type 2C
US12264367B2 (en) 2019-09-19 2025-04-01 The Broad Institute, Inc. Methods of in vivo evaluation of gene function
WO2025072383A1 (en) 2023-09-25 2025-04-03 The Broad Institute, Inc. Viral open reading frames, uses thereof, and methods of detecting the same
WO2025072803A1 (en) 2023-09-29 2025-04-03 Children's Hospital Medical Center Ntrk2 signaling-mediated alveolar capillary injury and repair
US12269804B2 (en) 2018-01-17 2025-04-08 Vertex Pharmaceuticals Incorporated Quinoxalinone compounds, compositions, methods, and kits for increasing genome editing efficiency
WO2025075911A1 (en) 2023-10-02 2025-04-10 Inscripta, Inc. Engineered gpp synthases
US12281334B2 (en) 2017-04-14 2025-04-22 Children's Hospital Medical Center Multi donor stem cell compositions and methods of making same
US12281338B2 (en) 2018-10-29 2025-04-22 The Broad Institute, Inc. Nucleobase editors comprising GeoCas9 and uses thereof
WO2025085423A1 (en) 2023-10-19 2025-04-24 The Broad Institute, Inc. Method of multi-locus crispri targeting with a single truncated guide
US12286727B2 (en) 2016-12-19 2025-04-29 Editas Medicine, Inc. Assessing nuclease cleavage
US12285497B2 (en) 2021-10-15 2025-04-29 Research Institute At Nationwide Children's Hospital Self-complementary adeno-associated virus vector and its use in treatment of muscular dystrophy
WO2025096916A1 (en) 2023-11-03 2025-05-08 The Broad Institute, Inc. Multi-site editing in living cells
WO2025097055A2 (en) 2023-11-02 2025-05-08 The Broad Institute, Inc. Compositions and methods of use of t cells in immunotherapy
US12297426B2 (en) 2019-10-01 2025-05-13 The Broad Institute, Inc. DNA damage response signature guided rational design of CRISPR-based systems and therapies
US12297457B2 (en) 2017-10-10 2025-05-13 Children's Hospital Medical Center Esophageal tissue and/or organoid compositions and methods of making same
US12297436B2 (en) 2017-05-18 2025-05-13 The Broad Institute, Inc. Systems, methods, and compositions for targeted nucleic acid editing
WO2025117544A1 (en) 2023-11-29 2025-06-05 The Broad Institute, Inc. Engineered omega guide molecule and iscb compositions, systems, and methods of use thereof
US12331347B2 (en) 2014-07-11 2025-06-17 President And Fellows Of Harvard College Methods for high-throughput labelling and detection of biological features in situ using microscopy
WO2025129158A1 (en) 2023-12-15 2025-06-19 The Broad Institute, Inc. Engineered arc delivery vesicles and uses thereof
US12338436B2 (en) 2018-06-29 2025-06-24 Editas Medicine, Inc. Synthetic guide molecules, compositions and methods relating thereto
US12351837B2 (en) 2019-01-23 2025-07-08 The Broad Institute, Inc. Supernegatively charged proteins and uses thereof
WO2025155923A1 (en) 2024-01-17 2025-07-24 The Broad Institute, Inc. Aav capsid modifications that enable improved cns-wide gene delivery through interactions with the transferrin receptor
WO2025160155A1 (en) 2024-01-22 2025-07-31 The Broad Institute, Inc. Epigenetic targeting of prion diseases
US12377170B2 (en) 2019-02-26 2025-08-05 Research Institute At Nationwide Children's Hospital Adeno-associated virus vector delivery of β-sarcoglycan and the treatment of muscular dystrophy
US12379372B2 (en) 2017-12-21 2025-08-05 Children's Hospital Medical Center Digitalized human organoids and methods of using same
WO2025166152A1 (en) 2024-02-02 2025-08-07 The Broad Institute, Inc. Multiplexed perturbation and decoding in pooled genetic screens
US12391928B2 (en) 2018-06-29 2025-08-19 Research Institute At Nationwide Children's Hospital Recombinant adeno-associated virus products and methods for treating limb girdle muscular dystrophy 2A
US12390514B2 (en) 2017-03-09 2025-08-19 President And Fellows Of Harvard College Cancer vaccine
US12402610B2 (en) 2018-11-09 2025-09-02 The Broad Institute, Inc. Methods and compositions for modulating innate lymphoid cell pathogenic effectors
US12404514B2 (en) 2016-12-09 2025-09-02 The Broad Institute, Inc. CRISPR-systems for modifying a trait of interest in a plant
US12406749B2 (en) 2017-12-15 2025-09-02 The Broad Institute, Inc. Systems and methods for predicting repair outcomes in genetic engineering
WO2025184567A1 (en) 2024-03-01 2025-09-04 Regeneron Pharmaceuticals, Inc. Methods and compositions for re-dosing aav using anti-cd40 antagonistic antibody to suppress host anti-aav antibody response
US12410447B2 (en) 2019-10-16 2025-09-09 The Broad Institute, Inc. Engineered muscle targeting compositions
US12415000B2 (en) 2017-07-07 2025-09-16 The Broad Institute, Inc. CRISPR system based antiviral therapy
US12414967B2 (en) 2016-11-04 2025-09-16 Children's Hospital Medical Center Compositions and methods of treating liver disease
US12421500B2 (en) 2018-07-26 2025-09-23 Children's Hospital Medical Center Hepato-biliary-pancreatic tissues and methods of making same
US12421557B2 (en) 2019-08-16 2025-09-23 The Broad Institute, Inc. Methods for predicting outcomes and treating colorectal cancer using a cell atlas
US12428622B2 (en) 2018-09-12 2025-09-30 Children's Hospital Medical Center Organoid compositions for the production of hematopoietic stem cells and derivatives thereof
US12428631B2 (en) 2016-04-13 2025-09-30 Duke University CRISPR/Cas9-based repressors for silencing gene targets in vivo and methods of use
US12435330B2 (en) 2019-10-10 2025-10-07 The Broad Institute, Inc. Methods and compositions for prime editing RNA
WO2025212920A1 (en) 2024-04-03 2025-10-09 Children's Hospital Medical Center Multi-zonal liver organoids
WO2025217174A1 (en) 2024-04-08 2025-10-16 The Broad Institute, Inc. Aav capsid modifications that enable improved cns-wide gene delivery through interactions with carbonic anhydrase iv
WO2025217202A1 (en) 2024-04-08 2025-10-16 Children's Hospital Medical Center Bile duct organoid
WO2025217398A1 (en) 2024-04-10 2025-10-16 Lyell Immunopharma, Inc. Methods for culturing cells with improved culture medium
WO2025217163A2 (en) 2024-04-08 2025-10-16 The Broad Institute, Inc. Novel aav capsids binding to human cd59
US12454687B2 (en) 2012-12-12 2025-10-28 The Broad Institute, Inc. Functional genomics using CRISPR-Cas systems, compositions, methods, knock out libraries and applications thereof
US12460231B2 (en) 2014-04-02 2025-11-04 Editas Medicine, Inc. Crispr/CAS-related methods and compositions for treating primary open angle glaucoma
US12467086B2 (en) 2011-10-14 2025-11-11 President And Fellows Of Harvard College Sequencing by structure assembly
WO2025235388A1 (en) 2024-05-06 2025-11-13 Regeneron Pharmaceuticals, Inc. Transgene genomic identification by nuclease-mediated long read sequencing
US12473543B2 (en) 2019-04-17 2025-11-18 The Broad Institute, Inc. Adenine base editors with reduced off-target effects
WO2025244671A1 (en) 2024-05-22 2025-11-27 The Scripps Research Institute Compositions for use in treating haploinsufficiency diseases
WO2025250808A1 (en) 2024-05-29 2025-12-04 The Brigham And Women’S Hospital, Inc. Anti-crispr delivery compositions and methods
US12499971B2 (en) 2016-09-28 2025-12-16 The Broad Institute, Inc. Systematic screening and mapping of regulatory elements in non-coding genomic regions, methods, compositions, and applications thereof
US12497597B2 (en) 2019-05-31 2025-12-16 Children's Hospital Medical Center Methods of generating and expanding hematopoietic stem cells
WO2025259669A1 (en) 2024-06-10 2025-12-18 Regeneron Pharmaceuticals, Inc. Methods and systems for characterizing modified oligonucleotides
WO2025265017A1 (en) 2024-06-20 2025-12-26 Regeneron Pharmaceuticals, Inc. Ass1 gene insertion for the treatment of citrullinemia type i
US12509492B2 (en) 2018-01-19 2025-12-30 Duke University Genome engineering with CRISPR-Cas systems in eukaryotes
US12522807B2 (en) 2018-07-09 2026-01-13 The Broad Institute, Inc. RNA programmable epigenetic RNA modifiers and uses thereof
US12534709B2 (en) 2019-05-31 2026-01-27 Children's Hospital Medical Center Shaped organoid compositions and methods of making same
US12548638B2 (en) 2017-07-07 2026-02-10 The Broad Institute, Inc. Methods for designing guide sequences for guided nucleases
US12559790B2 (en) 2020-01-29 2026-02-24 10X Genomics, Inc. Compositions and methods for analyte detection
US12565671B2 (en) 2016-08-31 2026-03-03 President And Fellows Of Harvard College Methods of combining the detection of biomolecules into a single assay using fluorescent in situ sequencing
WO2026047626A1 (en) 2024-08-30 2026-03-05 Inceptor Bio, Llc Compositions and methods involving immune cells engineered for binding bispecific antibodies for use in cell therapy

Families Citing this family (315)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9217155B2 (en) 2008-05-28 2015-12-22 University Of Massachusetts Isolation of novel AAV'S and uses thereof
WO2010138263A2 (en) 2009-05-28 2010-12-02 University Of Massachusetts Novel aav 's and uses thereof
EP2561075B1 (en) 2010-04-23 2018-06-27 University of Massachusetts Aav-based treatment of cholesterol-related disorders
ES2705236T3 (en) 2010-05-12 2019-03-22 Univ Columbia Procedures for producing enteroendocrine cells that produce and secrete insulin
BR112013024337A2 (en) 2011-03-23 2017-09-26 Du Pont complex transgenic trace locus in a plant, plant or seed, method for producing in a plant a complex transgenic trace locus and expression construct
EP3318634A1 (en) 2011-04-21 2018-05-09 University of Massachusetts Raav-based compositions and methods for treating diseases involving dominant-negative or gain of function mutations
US9745548B2 (en) 2012-03-15 2017-08-29 Flodesign Sonics, Inc. Acoustic perfusion devices
US9752113B2 (en) 2012-03-15 2017-09-05 Flodesign Sonics, Inc. Acoustic perfusion devices
US10704021B2 (en) 2012-03-15 2020-07-07 Flodesign Sonics, Inc. Acoustic perfusion devices
US10322949B2 (en) 2012-03-15 2019-06-18 Flodesign Sonics, Inc. Transducer and reflector configurations for an acoustophoretic device
US9950282B2 (en) 2012-03-15 2018-04-24 Flodesign Sonics, Inc. Electronic configuration and control for acoustic standing wave generation
US9458450B2 (en) 2012-03-15 2016-10-04 Flodesign Sonics, Inc. Acoustophoretic separation technology using multi-dimensional standing waves
US10689609B2 (en) 2012-03-15 2020-06-23 Flodesign Sonics, Inc. Acoustic bioreactor processes
US10967298B2 (en) 2012-03-15 2021-04-06 Flodesign Sonics, Inc. Driver and control for variable impedence load
WO2013139861A1 (en) 2012-03-20 2013-09-26 Luc Montagnier Methods and pharmaceutical compositions of the treatment of autistic syndrome disorders
US10737953B2 (en) 2012-04-20 2020-08-11 Flodesign Sonics, Inc. Acoustophoretic method for use in bioreactors
EP2847215A1 (en) * 2012-05-07 2015-03-18 Synthes GmbH Methods and devices for treating intervertebral disc disease
AU2014207618A1 (en) 2013-01-16 2015-08-06 Emory University Cas9-nucleic acid complexes and uses related thereto
US11332719B2 (en) * 2013-03-15 2022-05-17 The Broad Institute, Inc. Recombinant virus and preparations thereof
CN116083487A (en) * 2013-05-15 2023-05-09 桑格摩生物治疗股份有限公司 Methods and compositions for treating genetic conditions
JP7065564B2 (en) * 2013-05-29 2022-05-12 セレクティス Methods for Providing Accurate DNA Cleavage Using CAS9 Nickase Activity
US10011850B2 (en) 2013-06-21 2018-07-03 The General Hospital Corporation Using RNA-guided FokI Nucleases (RFNs) to increase specificity for RNA-Guided Genome Editing
AU2014287397B2 (en) * 2013-07-10 2019-10-10 President And Fellows Of Harvard College Orthogonal Cas9 proteins for RNA-guided gene regulation and editing
US9663782B2 (en) * 2013-07-19 2017-05-30 Larix Bioscience Llc Methods and compositions for producing double allele knock outs
MX363842B (en) * 2013-08-22 2019-04-05 Du Pont Methods for producing genetic modifications in a plant genome without incorporating a selectable transgene marker, and compositions thereof.
US9745569B2 (en) 2013-09-13 2017-08-29 Flodesign Sonics, Inc. System for generating high concentration factors for low cell density suspensions
US10787684B2 (en) * 2013-11-19 2020-09-29 President And Fellows Of Harvard College Large gene excision and insertion
US9725710B2 (en) 2014-01-08 2017-08-08 Flodesign Sonics, Inc. Acoustophoresis device with dual acoustophoretic chamber
JP2017510542A (en) * 2014-01-31 2017-04-13 ファクター バイオサイエンス インコーポレイテッド Methods and products for nucleic acid production and delivery
US10072251B2 (en) 2014-02-19 2018-09-11 University Of Massachusetts Recombinant AAVS having useful transcytosis properties
AU2015231294B2 (en) 2014-03-18 2020-10-29 University Of Massachusetts rAAV-based compositions and methods for treating amyotrophic lateral sclerosis
WO2015164786A1 (en) 2014-04-25 2015-10-29 University Of Massachusetts Recombinant aav vectors useful for reducing immunity against transgene products
CA2947270A1 (en) * 2014-04-28 2015-11-05 Rxi Pharmaceuticals Corporation Methods for treating cancer using nucleic acids targeting mdm2 or mycn
US10280419B2 (en) * 2014-05-09 2019-05-07 UNIVERSITé LAVAL Reduction of amyloid beta peptide production via modification of the APP gene using the CRISPR/Cas system
WO2015178343A1 (en) * 2014-05-20 2015-11-26 国立大学法人北海道大学 LIPID MEMBRANE STRUCTURE FOR siRNA INTRACELLULAR DELIVERY
BR112016028023A2 (en) * 2014-05-30 2017-08-22 Univ Leland Stanford Junior COMPOSITIONS AND METHODS OF ADMINISTRATION OF TREATMENTS FOR LATENT VIRAL INFECTIONS
WO2015187825A2 (en) 2014-06-03 2015-12-10 University Of Massachusetts Compositions and methods for modulating dysferlin expression
KR102425438B1 (en) 2014-06-23 2022-07-27 더 제너럴 하스피탈 코포레이션 Genomewide unbiased identification of dsbs evaluated by sequencing (guide-seq)
WO2015200901A1 (en) 2014-06-26 2015-12-30 The Trustees Of Columbia University In The City Of New York Inhibition of serotonin expression in gut enteroendocrine cells results in conversion to insulin-positive cells
US9744483B2 (en) 2014-07-02 2017-08-29 Flodesign Sonics, Inc. Large scale acoustic separation device
US10081816B1 (en) * 2014-07-03 2018-09-25 Nant Holdings Ip, Llc Mechanical transfection devices and methods
US10760040B1 (en) 2014-07-03 2020-09-01 NanoCav, LLC Mechanical transfection devices and methods
WO2016007347A1 (en) 2014-07-11 2016-01-14 E. I. Du Pont De Nemours And Company Compositions and methods for producing plants resistant to glyphosate herbicide
BR122023024818A2 (en) * 2014-07-11 2023-12-26 Pioneer Hi-Bred International, Inc. GUIDE RNA, POLYNUCLEOTIDE AND RIBONUCLEOPROTEIN COMPLEX
US9850521B2 (en) * 2014-08-01 2017-12-26 Agilent Technologies, Inc. In vitro assay buffer for Cas9
CN107429241B (en) * 2014-08-14 2025-10-24 百奥赛图(北京)医药科技股份有限公司 DNA knock-in system
CA2956487A1 (en) 2014-09-12 2016-03-17 E. I. Du Pont De Nemours And Company Generation of site-specific-integration sites for complex trait loci in corn and soybean, and methods of use
CN104293831A (en) * 2014-09-28 2015-01-21 上海云舜生物技术有限公司 Method for establishing hypertension mouse model and application of hypertension mouse model
EP3795580A1 (en) 2014-10-03 2021-03-24 University of Massachusetts High efficiency library-identified aav vectors
WO2016054554A1 (en) 2014-10-03 2016-04-07 University Of Massachusetts Heterologous targeting peptide grafted aavs
US9943612B2 (en) 2014-10-09 2018-04-17 Seattle Children's Hospital Long poly(A) plasmids and methods for introduction of long poly(A) sequences into the plasmid
DK3204022T3 (en) 2014-10-09 2021-03-08 Celularity Inc PLACENTA-DERIVED ADHERENT CELL EXOSOMES AND USES THEREOF
US20170354745A1 (en) * 2014-10-09 2017-12-14 The Regents Of The University Of California Targeted disruption of a csf1-dap12 pathway member gene for the treatment of neuropathic pain
US11174506B2 (en) 2014-10-17 2021-11-16 Howard Hughes Medical Institute Genomic probes
AU2015331848B2 (en) 2014-10-17 2022-03-03 Children's Hospital Medical Center, D/B/A Cincinnati Children's Hospital Medical Center In vivo model of human small intestine using pluripotent stem cells and methods of making and using same
WO2016065001A1 (en) 2014-10-21 2016-04-28 University Of Massachusetts Recombinant aav variants and uses thereof
US11071790B2 (en) 2014-10-29 2021-07-27 Massachusetts Eye And Ear Infirmary Method for efficient delivery of therapeutic molecules in vitro and in vivo
CN112553229A (en) 2014-11-05 2021-03-26 沃雅戈治疗公司 AADC polynucleotides for treating Parkinson's disease
RU2020108189A (en) 2014-11-14 2020-03-11 Вояджер Терапьютикс, Инк. COMPOSITIONS AND METHODS OF TREATMENT OF LATERAL AMYOTROPHIC SCLEROSIS (ALS)
MX2017006217A (en) 2014-11-14 2018-05-02 Voyager Therapeutics Inc Modulatory polynucleotides.
EP3230452B1 (en) 2014-12-12 2025-06-11 The Broad Institute, Inc. Dead guides for crispr transcription factors
SG11201704272YA (en) 2014-12-31 2017-06-29 Synthetic Genomics Inc Compositions and methods for high efficiency in vivo genome editing
WO2016114972A1 (en) 2015-01-12 2016-07-21 The Regents Of The University Of California Heterodimeric cas9 and methods of use thereof
US10059940B2 (en) * 2015-01-27 2018-08-28 Minghong Zhong Chemically ligated RNAs for CRISPR/Cas9-lgRNA complexes as antiviral therapeutic agents
LT3250691T (en) 2015-01-28 2023-09-11 Caribou Biosciences, Inc. Crispr hybrid dna/rna polynucleotides and methods of use
EP3250689B1 (en) 2015-01-28 2020-11-04 The Regents of The University of California Methods and compositions for labeling a single-stranded target nucleic acid
US10584321B2 (en) * 2015-02-13 2020-03-10 University Of Massachusetts Compositions and methods for transient delivery of nucleases
CN104673816A (en) * 2015-03-05 2015-06-03 广东医学院 PCr-NHEJ (non-homologous end joining) carrier as well as construction method of pCr-NHEJ carrier and application of pCr-NHEJ carrier in site-specific knockout of bacterial genes
CN106032540B (en) * 2015-03-16 2019-10-25 中国科学院上海生命科学研究院 Adeno-associated virus vector construction and application of CRISPR/Cas9 endonuclease system
GB2536650A (en) 2015-03-24 2016-09-28 Augmedics Ltd Method and system for combining video-based and optic-based augmented reality in a near eye display
US20180066253A1 (en) * 2015-03-26 2018-03-08 Yale University Methods and compositions for modifying endothelial cells
US10450576B2 (en) 2015-03-27 2019-10-22 E I Du Pont De Nemours And Company Soybean U6 small nuclear RNA gene promoters and their use in constitutive expression of small RNA genes in plants
CA3000187A1 (en) * 2015-04-02 2016-10-06 Agenovir Corporation Gene delivery methods and compositions
ES2959608T3 (en) * 2015-04-03 2024-02-27 Dana Farber Cancer Inst Inc Composition and editing methods of the B cell genome
CA3021949C (en) 2015-04-24 2023-10-17 University Of Massachusetts Modified aav constructs and uses thereof
US11377651B2 (en) 2016-10-19 2022-07-05 Flodesign Sonics, Inc. Cell therapy processes utilizing acoustophoresis
US11021699B2 (en) 2015-04-29 2021-06-01 FioDesign Sonics, Inc. Separation using angled acoustic waves
US11708572B2 (en) 2015-04-29 2023-07-25 Flodesign Sonics, Inc. Acoustic cell separation techniques and processes
US20160346360A1 (en) * 2015-05-29 2016-12-01 Agenovir Corporation Compositions and methods for cell targeted hpv treatment
US10117911B2 (en) 2015-05-29 2018-11-06 Agenovir Corporation Compositions and methods to treat herpes simplex virus infections
MX2017015582A (en) 2015-06-01 2018-09-06 Univ Temple Methods and compositions for rna-guided treatment of hiv infection.
GB201509578D0 (en) * 2015-06-03 2015-07-15 Univ Singapore Vectors
WO2016196655A1 (en) 2015-06-03 2016-12-08 The Regents Of The University Of California Cas9 variants and methods of use thereof
CN108368502B (en) 2015-06-03 2022-03-18 内布拉斯加大学董事委员会 DNA editing using single-stranded DNA
WO2016205688A2 (en) * 2015-06-18 2016-12-22 Bowles Robert D Rna-guided transcriptional regulation and methods of using the same for the treatment of back pain
EP3313416A4 (en) * 2015-06-26 2019-02-20 The Trustees of Columbia University in the City of New York GENETICALLY MODIFIED IPS CELLS HAVING A MARKER FOR SIGNALING THE EXPRESSION OF NEUROGENIN3, TPH2, FOXO1 AND / OR INSULIN GENES
US10808247B2 (en) 2015-07-06 2020-10-20 Phio Pharmaceuticals Corp. Methods for treating neurological disorders using a synergistic small molecule and nucleic acids therapeutic approach
ES2948559T3 (en) * 2015-07-25 2023-09-14 Habib Frost A system, device and method for providing a therapy or cure for cancer and other disease states
US11459540B2 (en) 2015-07-28 2022-10-04 Flodesign Sonics, Inc. Expanded bed affinity selection
US11474085B2 (en) 2015-07-28 2022-10-18 Flodesign Sonics, Inc. Expanded bed affinity selection
WO2017040348A1 (en) 2015-08-28 2017-03-09 The General Hospital Corporation Engineered crispr-cas9 nucleases
IL241462A0 (en) 2015-09-10 2015-11-30 Yeda Res & Dev Heterologous engineering of betalain pigments in plants
WO2017044843A1 (en) 2015-09-11 2017-03-16 The General Hospital Corporation Full interrogation of nuclease dsbs and sequencing (find-seq)
US9850484B2 (en) 2015-09-30 2017-12-26 The General Hospital Corporation Comprehensive in vitro reporting of cleavage events by sequencing (Circle-seq)
WO2017062754A1 (en) * 2015-10-07 2017-04-13 New York University Compositions and methods for enhancing crispr activity by polq inhibition
US11426469B2 (en) 2015-10-22 2022-08-30 University Of Massachusetts Prostate-targeting adeno-associated virus serotype vectors
WO2017070525A1 (en) 2015-10-22 2017-04-27 University Of Massachusetts Methods and compositions for treating metabolic imbalance in neurodegenerative disease
WO2017075335A1 (en) 2015-10-28 2017-05-04 Voyager Therapeutics, Inc. Regulatable expression using adeno-associated virus (aav)
EP3373938A4 (en) * 2015-11-09 2019-05-15 Seattle Children's Hospital (DBA Seattle Children's Research Institute) NEW RNA-BASED VECTOR SYSTEM FOR TRANSIENT AND STABLE GENE EXPRESSION
EP3374494A4 (en) * 2015-11-11 2019-05-01 Coda Biotherapeutics, Inc. Crispr compositions and methods of using the same for gene therapy
EP4036228A1 (en) 2015-11-13 2022-08-03 Avellino Lab USA, Inc. Methods for the treatment of corneal dystrophies
US11905521B2 (en) 2015-11-17 2024-02-20 The Chinese University Of Hong Kong Methods and systems for targeted gene manipulation
IL259576B (en) 2015-12-04 2022-09-01 Novartis Ag Grna molecule comprising tracr and crrna, pharmaceutical composition comprising same and method of preparing cells for immunotherapy
CN105624196A (en) * 2015-12-24 2016-06-01 江苏大学 Method for establishing CYP2C11 gene knockout rat model
CN105624191A (en) * 2015-12-24 2016-06-01 江苏大学 Method for establishing CYP2D1 gene knockout rat model
CN105548420B (en) * 2015-12-30 2019-08-02 上海泽润生物科技有限公司 The detection method of MOPS residual quantity
MX2018008344A (en) 2016-01-11 2018-12-06 Univ Leland Stanford Junior CHEMICAL PROTEINS AND METHODS TO REGULATE GENE EXPRESSION.
JP7012645B2 (en) 2016-01-11 2022-01-28 ザ ボード オブ トラスティーズ オブ ザ レランド スタンフォード ジュニア ユニバーシティー Chimeric proteins and immunotherapeutic methods
US10053693B2 (en) 2016-01-19 2018-08-21 Mubin I. Syed Method for controlling obesity using minimally invasive means
EP3411059A4 (en) 2016-02-02 2019-10-16 University Of Massachusetts METHOD FOR IMPROVING THE EFFICACY OF ADMINISTRATION TO THE CENTRAL NERVOUS SYSTEM OF AAV GENE BY SYSTEMIC PATHWAY
EP3413928B1 (en) 2016-02-12 2022-04-20 University of Massachusetts Anti-angiogenic mirna therapeutics for inhibiting corneal neovascularization
WO2017142835A1 (en) * 2016-02-15 2017-08-24 Temple University - Of The Commonwealth System Of Higher Education Excision of retroviral nucleic acid sequences
CN116763942A (en) 2016-02-18 2023-09-19 宾州研究基金会 Intra-brain generation of GABAergic neurons
US20190249172A1 (en) 2016-02-18 2019-08-15 The Regents Of The University Of California Methods and compositions for gene editing in stem cells
US10286073B2 (en) * 2016-02-23 2019-05-14 Ilisa Tech, Inc. Magnetic control of gene delivery in vivo
EP3420089B1 (en) * 2016-02-26 2021-12-29 LanzaTech NZ, Inc. Crispr/cas systems for c-1 fixing bacteria
EP3423083A4 (en) 2016-03-04 2019-10-02 Indoor Biotechnologies Inc. FEL D 1 INACTIVATIONS AND RELATED COMPOSITIONS AND METHODS BASED ON GENOMIC EDITION OF CRISPR-CAS9
JP2019515654A (en) 2016-03-16 2019-06-13 ザ ジェイ. デヴィッド グラッドストーン インスティテューツ Methods and compositions for treating obesity and / or diabetes, and methods and compositions for identifying candidate treatment agents
SMT202500211T1 (en) * 2016-03-30 2025-07-22 Intellia Therapeutics Inc Lipid nanoparticle formulations for crispr/cas components
US11207426B2 (en) 2016-04-05 2021-12-28 University Of Massachusetts Compositions and methods for selective inhibition of grainyhead-like protein expression
WO2017181105A1 (en) 2016-04-15 2017-10-19 University Of Massachusetts Methods and compositions for treating metabolic imbalance
US11214789B2 (en) 2016-05-03 2022-01-04 Flodesign Sonics, Inc. Concentration and washing of particles with acoustics
US11085035B2 (en) 2016-05-03 2021-08-10 Flodesign Sonics, Inc. Therapeutic cell washing, concentration, and separation utilizing acoustophoresis
CN109415685B (en) 2016-05-05 2023-07-04 儿童医院医疗中心 Method for producing gastric fundus tissue in vitro and compositions related thereto
AU2017267665C1 (en) 2016-05-18 2023-10-05 Voyager Therapeutics, Inc. Modulatory polynucleotides
WO2017218852A1 (en) 2016-06-15 2017-12-21 University Of Massachusetts Recombinant adeno-associated viruses for delivering gene editing molecules to embryonic cells
EP3474849B1 (en) 2016-06-27 2025-05-21 The Broad Institute, Inc. Compositions and methods for detecting and treating diabetes
CN109789185A (en) * 2016-07-28 2019-05-21 基础科学研究院 For treating the albumen containing CAS9 of eye disease and the pharmaceutical composition of guide RNA
US11078481B1 (en) 2016-08-03 2021-08-03 KSQ Therapeutics, Inc. Methods for screening for cancer targets
ES2998057T3 (en) * 2016-08-12 2025-02-18 Toolgen Inc Manipulated immunoregulatory element and immunity altered thereby
AU2017313917B2 (en) * 2016-08-18 2023-12-21 The Regents Of The University Of California CRISPR-Cas genome engineering via a modular AAV delivery system
WO2020225754A1 (en) 2019-05-06 2020-11-12 Mcmullen Tara Crispr gene editing for autosomal dominant diseases
US20220056440A1 (en) * 2016-08-20 2022-02-24 Tara Moore Crispr gene editing for autosomal dominant diseases
CN109963945A (en) 2016-08-20 2019-07-02 阿维利诺美国实验室股份有限公司 Single guide RNA, CRISPR/CAS9 system and its application method
WO2019165322A1 (en) * 2018-02-22 2019-08-29 Moore Tara Crispr/cas9 systems, and methods of use thereof
US11078483B1 (en) 2016-09-02 2021-08-03 KSQ Therapeutics, Inc. Methods for measuring and improving CRISPR reagent function
JP7215994B2 (en) 2016-09-06 2023-01-31 ザ チルドレンズ メディカル センター コーポレーション Immune cells derived from induced pluripotent stem cells
IL247752A0 (en) 2016-09-11 2016-11-30 Yeda Res & Dev Compositions and methods for regulating gene expression for targeted mutagenesis
US10457940B2 (en) 2016-09-22 2019-10-29 University Of Massachusetts AAV treatment of Huntington's disease
WO2018064352A1 (en) 2016-09-30 2018-04-05 The Regents Of The University Of California Rna-guided nucleic acid modifying enzymes and methods of use thereof
JP2019532644A (en) 2016-09-30 2019-11-14 ザ リージェンツ オブ ザ ユニバーシティ オブ カリフォルニア RNA-induced nucleic acid modifying enzyme and method of using the same
US10669539B2 (en) 2016-10-06 2020-06-02 Pioneer Biolabs, Llc Methods and compositions for generating CRISPR guide RNA libraries
US11578340B2 (en) 2016-10-13 2023-02-14 University Of Massachusetts AAV capsid designs
GB201617559D0 (en) 2016-10-17 2016-11-30 University Court Of The University Of Edinburgh The Swine comprising modified cd163 and associated methods
KR20190127655A (en) 2016-10-19 2019-11-13 프로디자인 소닉스, 인크. Affinity cell extraction by acoustics
WO2018088694A2 (en) 2016-11-14 2018-05-17 주식회사 툴젠 Artificially engineered sc function control system
CA3045145A1 (en) 2016-12-05 2018-06-14 Children's Hospital Medical Center Colonic organoids and methods of making and using same
CA3045134A1 (en) 2016-12-14 2018-06-21 Ligandal, Inc. Compositions and methods for nucleic acid and/or protein payload delivery
WO2018119354A1 (en) * 2016-12-23 2018-06-28 President And Fellows Of Harvard College Gene editing of pcsk9
CN106632693B (en) * 2017-01-19 2021-05-25 上海科技大学 SpyCas9 protein with multiple nuclear localization sequences and its application
WO2018152418A1 (en) * 2017-02-17 2018-08-23 Temple University - Of The Commonwealth System Of Higher Education Gene editing therapy for hiv infection via dual targeting of hiv genome and ccr5
EP3589751A4 (en) * 2017-03-03 2021-11-17 The Regents of The University of California RNA TARGETING OF MUTATIONS VIA SUPPRESSOR TRNAS AND DEAMINASES
US10687520B2 (en) 2017-03-07 2020-06-23 The Board Of Regents Of The University Of Texas System Generation and correction of a humanized mouse model with a deletion of dystrophin exon 44
WO2018170184A1 (en) 2017-03-14 2018-09-20 Editas Medicine, Inc. Systems and methods for the treatment of hemoglobinopathies
WO2018175502A2 (en) * 2017-03-21 2018-09-27 Shuber Anthony P Treating cancer with cas endonuclease complexes
CA3054621A1 (en) * 2017-03-22 2018-09-27 Novartis Ag Compositions and methods for immunooncology
BR112019021719A2 (en) 2017-04-21 2020-06-16 The General Hospital Corporation CPF1 VARIANT (CAS12A) WITH CHANGED PAM SPECIFICITY
WO2018201090A1 (en) * 2017-04-28 2018-11-01 Exicure, Inc. Synthesis of spherical nucleic acids using lipophilic moieties
CA3061652A1 (en) 2017-05-05 2018-11-08 Voyager Therapeutics, Inc. Compositions and methods of treating amyotrophic lateral sclerosis (als)
AU2018264636B2 (en) 2017-05-08 2022-03-17 Toolgen Incorporated Artificially manipulated immune cell
EP3622073A4 (en) 2017-05-09 2021-01-06 University of Massachusetts AMYOTROPHIC LATERAL SCLEROSIS (ALS) TREATMENT METHODS
EP3622091A4 (en) * 2017-05-12 2021-02-17 President and Fellows of Harvard College Universal early cancer diagnostics
EP3624942A1 (en) * 2017-05-16 2020-03-25 Wisconsin Alumni Research Foundation System and method for en masse patterning of molecule structures
EP3630970A4 (en) 2017-05-25 2020-12-30 The General Hospital Corporation BASE EDITORS WITH IMPROVED PRECISION AND SPECIFICITY
JOP20190269A1 (en) 2017-06-15 2019-11-20 Voyager Therapeutics Inc Aadc polynucleotides for the treatment of parkinson's disease
RU2019143627A (en) * 2017-06-28 2021-07-28 Юниверсити Оф Соус Флорида MODIFIED UBE3A GENE FOR GENE THERAPY OF ANGELMAN'S SYNDROME
WO2019017321A1 (en) * 2017-07-18 2019-01-24 国立大学法人京都大学 METHOD OF INDUCING GENETIC MUTATION
EP3672612A4 (en) 2017-08-23 2021-09-29 The General Hospital Corporation MANIPULATED CRISPR-CAS9-NUCLEASES WITH CHANGED PAM SPECIFICITY
WO2019055169A1 (en) * 2017-09-15 2019-03-21 The Board Of Trustees Of The Leland Stanford Junior University Mitochondrial aldehyde dehydrogenase-2 modulators for protecting, expanding and increasing the potency of hematopoietic stem cells
JP7397488B2 (en) 2017-09-22 2023-12-13 ユニバーシティ オブ マサチューセッツ SOD1 dual expression vector and its use
WO2019067452A1 (en) * 2017-09-27 2019-04-04 Pioneer Hi-Bred International, Inc. Soil application of crop protection agents
JP2020535160A (en) * 2017-09-28 2020-12-03 タンデム カンパニー,リミテッド Endoplasmic reticulum based on a novel recombinant plasma membrane for cancer treatment
US11725228B2 (en) 2017-10-11 2023-08-15 The General Hospital Corporation Methods for detecting site-specific and spurious genomic deamination induced by base editing technologies
WO2019089804A1 (en) 2017-11-01 2019-05-09 The Regents Of The University Of California Casy compositions and methods of use
US12458411B2 (en) 2017-12-07 2025-11-04 Augmedics Ltd. Spinous process clamp
US12521201B2 (en) 2017-12-07 2026-01-13 Augmedics Ltd. Spinous process clamp
JP2021507561A (en) 2017-12-14 2021-02-22 フロデザイン ソニックス, インク.Flodesign Sonics, Inc. Acoustic Transducer Driver and Controller
US20210032300A1 (en) * 2018-02-02 2021-02-04 The Penn State Research Foundation Methods and materials for treating brain injuries
US20210361693A1 (en) * 2018-02-09 2021-11-25 Empirico Inc. Process to inhibit or eliminate eosinophilic diseases of the airway and related conditions
WO2019165168A1 (en) 2018-02-23 2019-08-29 Pioneer Hi-Bred International, Inc. Novel cas9 orthologs
KR101889683B1 (en) * 2018-03-14 2018-08-17 유병탁 Constructing method for steel frame structure
AU2019236204B2 (en) 2018-03-15 2026-02-26 KSQ Therapeutics, Inc. Gene-regulating compositions and methods for improved immunotherapy
JP2021519067A (en) * 2018-03-23 2021-08-10 ザ・トラスティーズ・オブ・コロンビア・ユニバーシティ・イン・ザ・シティ・オブ・ニューヨーク Gene editing for autosomal dominant disorders
US20210155959A1 (en) 2018-04-06 2021-05-27 Children's Medical Center Corporation Compositions and methods for somatic cell reprogramming and modulating imprinting
WO2019204378A1 (en) 2018-04-17 2019-10-24 The General Hospital Corporation Sensitive in vitro assays for substrate preferences and sites of nucleic acid binding, modifying, and cleaving agents
WO2019211741A1 (en) 2018-05-02 2019-11-07 Augmedics Ltd. Registration of a fiducial marker for an augmented reality system
CN112512595A (en) * 2018-05-03 2021-03-16 哈佛学院校长同事会 In vivo homology-directed repair in cardiac, skeletal muscle and muscle stem cells
WO2019213660A2 (en) 2018-05-04 2019-11-07 The Broad Institute, Inc. Compositions and methods for modulating cgrp signaling to regulate innate lymphoid cell inflammatory responses
KR20250134703A (en) 2018-05-11 2025-09-11 빔 테라퓨틱스, 인크. Methods of substituting pathogenic amino acids using programmable base editor systems
AU2019268330A1 (en) 2018-05-15 2020-11-26 Voyager Therapeutics, Inc. Compositions and methods for the treatment of Parkinson's disease
CN112654710A (en) 2018-05-16 2021-04-13 辛瑟高公司 Methods and systems for directing RNA design and use
CN108707628B (en) * 2018-05-28 2021-11-23 上海海洋大学 Preparation method of zebra fish notch2 gene mutant
US12163129B2 (en) 2018-06-08 2024-12-10 University Of Massachusetts Antisense oligonucleotides to restore dysferlin protein expression in dysferlinopathy patient cells
GB201809588D0 (en) * 2018-06-12 2018-07-25 Univ Bristol Materials and methods for modulating intraocular and intracranial pressure
CA3105658A1 (en) 2018-07-13 2020-01-16 The Regents Of The University Of California Retrotransposon-based delivery vehicle and methods of use thereof
WO2020023529A1 (en) * 2018-07-24 2020-01-30 The Regents Of The University Of California Rna-guided nucleic acid modifying enzymes and methods of use thereof
JP2021533784A (en) 2018-08-18 2021-12-09 プレジデント アンド フェローズ オブ ハーバード カレッジ In situ gene editing
WO2020041456A1 (en) 2018-08-22 2020-02-27 The Regents Of The University Of California Variant type v crispr/cas effector polypeptides and methods of use thereof
US12331320B2 (en) 2018-10-10 2025-06-17 The Research Foundation For The State University Of New York Genome edited cancer cell vaccines
CN109295081B (en) * 2018-10-17 2020-06-12 中国人民解放军第四军医大学 A kind of LDLR-Lamp2b fusion gene, expression vector and application thereof
US11407995B1 (en) 2018-10-26 2022-08-09 Inari Agriculture Technology, Inc. RNA-guided nucleases and DNA binding proteins
WO2020092163A1 (en) 2018-11-01 2020-05-07 E. I. Du Pont De Nemours And Company Systems and methods for manufacture of controlled release of agricultural cores
US11434477B1 (en) 2018-11-02 2022-09-06 Inari Agriculture Technology, Inc. RNA-guided nucleases and DNA binding proteins
AU2019374883A1 (en) 2018-11-09 2021-05-20 Inari Agriculture Technology, Inc. RNA-guided nucleases and DNA binding proteins
CN111172192B (en) * 2018-11-13 2024-04-23 四川横竖生物科技股份有限公司 Method for constructing chimeric animal model based on hNPY gene overexpression and its application
US11766296B2 (en) 2018-11-26 2023-09-26 Augmedics Ltd. Tracking system for image-guided surgery
US12365888B2 (en) 2018-12-14 2025-07-22 Pioneer Hi-Bred International, Inc. CRISPR-Cas systems for genome editing
US20220064635A1 (en) * 2019-01-07 2022-03-03 Emendobio Inc. Crispr compositions and methods for promoting gene editing of adenosine deaminase 2 (ada2)
US11116778B2 (en) 2019-01-15 2021-09-14 Empirico Inc. Prodrugs of ALOX-15 inhibitors and methods of using the same
WO2020163396A1 (en) 2019-02-04 2020-08-13 The General Hospital Corporation Adenine dna base editor variants with reduced off-target rna editing
US12460230B2 (en) 2019-02-10 2025-11-04 The J. David Gladstone Institutes Modified mitochondrion and methods of use thereof
US20220235347A1 (en) 2019-02-13 2022-07-28 Beam Therapeutics Inc. Compositions and methods for treating hemoglobinopathies
CN119896751A (en) * 2019-02-13 2025-04-29 比姆医疗股份有限公司 Use of adenylate deaminase base editors to disrupt splice acceptor sites of disease-associated genes, including for the treatment of genetic diseases
EP3935156A4 (en) 2019-03-07 2022-12-28 The Regents of The University of California CRISPR-CAS EFFECTOR POLYPEPTIDES AND METHODS OF USE
CN111733225A (en) * 2019-03-25 2020-10-02 北京大学第一医院 A PRKG1 gene SNP marker that can be used to assist the precision medicine of clopidogrel
US20230190819A1 (en) * 2019-05-11 2023-06-22 Youngsuk Yi Compositions and methods containing exosomes
CN114555813A (en) * 2019-05-21 2022-05-27 国家医疗保健研究所 Expression vector of cholesterol 24-hydrolase for treating Rett syndrome
US12188045B2 (en) 2019-06-07 2025-01-07 KSQ Therapeutics, Inc. Guide RNA combinations and methods of use
WO2020257514A1 (en) * 2019-06-21 2020-12-24 Children's Medical Center Corporation Methods and compositions for allele specific gene editing
US12178666B2 (en) 2019-07-29 2024-12-31 Augmedics Ltd. Fiducial marker
US11980506B2 (en) 2019-07-29 2024-05-14 Augmedics Ltd. Fiducial marker
CN114245803A (en) 2019-08-06 2022-03-25 儿童医疗中心有限公司 Methods and compositions for reconstituting microglia
GB201913974D0 (en) * 2019-09-27 2019-11-13 King S College London Vector
CN110684801A (en) * 2019-11-13 2020-01-14 武汉华美生物工程有限公司 Method for gene editing by transducing cas9 gene into mammalian cell
US20240016735A1 (en) 2019-11-22 2024-01-18 President And Fellows Of Harvard College Ionic liquids for drug delivery
US11382712B2 (en) 2019-12-22 2022-07-12 Augmedics Ltd. Mirroring in image guided surgery
CN115397974A (en) 2020-01-23 2022-11-25 儿童医疗中心有限公司 Stromal-free T cell differentiation from human pluripotent stem cells
US12312613B2 (en) 2020-01-24 2025-05-27 The General Hospital Corporation Unconstrained genome targeting with near-PAMless engineered CRISPR-Cas9 variants
WO2021151085A2 (en) 2020-01-24 2021-07-29 The General Hospital Corporation Crispr-cas enzymes with enhanced on-target activity
CN113281130B (en) * 2020-02-20 2024-08-23 中国科学院上海高等研究院 Efficient Golgi dyeing method for large-size brain tissue
BR112022017070A2 (en) * 2020-02-28 2022-11-16 Huigene Therapeutics Co Ltd CRISPR-CAS SYSTEM TYPE VI-E AND TYPE VI-F AND USES THEREOF
CN111321150B (en) * 2020-03-13 2020-12-04 广西壮族自治区水产科学研究院 A kind of LvCTL4 gene and encoded protein, protein acquisition method, expression vector, recombinant bacteria and application
US20230121577A1 (en) * 2020-04-15 2023-04-20 The Regents Of The University Of California Compositions and Methods for Treatment
WO2021216622A1 (en) 2020-04-21 2021-10-28 Aspen Neuroscience, Inc. Gene editing of gba1 in stem cells and method of use of cells differentiated therefrom
US20230165909A1 (en) 2020-04-21 2023-06-01 Aspen Neuroscience, Inc. Gene editing of lrrk2 in stem cells and method of use of cells differentiated therefrom
WO2021224633A1 (en) 2020-05-06 2021-11-11 Orchard Therapeutics (Europe) Limited Treatment for neurodegenerative diseases
CN111521826A (en) * 2020-05-21 2020-08-11 江海松 Application of Notch3 protein in peripheral blood exosome as molecular marker and detection kit
EP4176434A4 (en) * 2020-05-29 2024-09-11 The General Hospital Corporation SYSTEMS AND METHODS FOR STABLE AND INHERITABLE MODIFICATION BY PRECISION EDITING (SHAPE)
US11389252B2 (en) 2020-06-15 2022-07-19 Augmedics Ltd. Rotating marker for image guided surgery
US20230321278A1 (en) * 2020-07-10 2023-10-12 President And Fellows Of Harvard College Aav vector delivery systems
CN111979241B (en) * 2020-07-23 2021-10-01 上海市第一人民医院 Method for preparing a non-human mammalian model of retinitis pigmentosa
US12239385B2 (en) 2020-09-09 2025-03-04 Augmedics Ltd. Universal tool adapter
US12502163B2 (en) 2020-09-09 2025-12-23 Augmedics Ltd. Universal tool adapter for image-guided surgery
CN114250228A (en) * 2020-09-22 2022-03-29 广州瑞风生物科技有限公司 gRNA of target CTGF gene and application thereof
WO2022079083A1 (en) 2020-10-15 2022-04-21 F. Hoffmann-La Roche Ag Nucleic acid constructs for va rna transcription
RU2749307C1 (en) * 2020-10-30 2021-06-08 Федеральное государственное бюджетное научное учреждение "Всероссийский научно-исследовательский институт сельскохозяйственной биотехнологии" (ФГБНУ ВНИИСБ) New compact type ii cas9 nuclease from anoxybacillus flavithermus
CN114796493B (en) * 2021-01-28 2026-02-10 中国科学技术大学 Use of vasogenic BACE1 as a therapeutic target for diseases related to small vessel injury in the brain
WO2022204543A1 (en) * 2021-03-25 2022-09-29 The Regents Of The University Of California Methods and materials for treating huntington's disease
CN113180015A (en) * 2021-05-25 2021-07-30 四川省农业机械研究设计院 Silkworm rearing room and three-section type assembly line silkworm rearing method
EP4355351A1 (en) * 2021-06-18 2024-04-24 Innovative Cellular Therapeutics Holdings, Ltd. Modified cells targeting tumor ecm and therapy thereof
US11896445B2 (en) 2021-07-07 2024-02-13 Augmedics Ltd. Iliac pin and adapter
US12150821B2 (en) 2021-07-29 2024-11-26 Augmedics Ltd. Rotating marker and adapter for image-guided surgery
CN113607963B (en) * 2021-08-11 2024-05-24 河南省人民医院 Protein marker for predicting retinal aging process, screening method and application thereof
CN113373178A (en) * 2021-08-13 2021-09-10 上海南方模式生物科技股份有限公司 Construction method and application of TLR8 gene humanized animal model
US12475662B2 (en) 2021-08-18 2025-11-18 Augmedics Ltd. Stereoscopic display and digital loupe for augmented-reality near-eye display
JP7125727B1 (en) 2021-09-07 2022-08-25 国立大学法人千葉大学 Compositions for modifying nucleic acid sequences and methods for modifying target sites in nucleic acid sequences
EP4596697A3 (en) 2021-09-28 2025-08-27 Acrigen Biosciences Compositions and methods for nucleic acid modifications
JP2024538700A (en) 2021-10-08 2024-10-23 プレジデント・アンド・フェロウズ・オブ・ハーバード・カレッジ Ionic Liquids for Drug Delivery
CN113913428A (en) * 2021-10-14 2022-01-11 南通大学 Small interfering RNA targeting Tfap2a gene and its application in the preparation of drugs for treating chronic pain
WO2023077148A1 (en) 2021-11-01 2023-05-04 Tome Biosciences, Inc. Single construct platform for simultaneous delivery of gene editing machinery and nucleic acid cargo
CA3237482A1 (en) 2021-11-03 2023-05-11 The J. David Gladstone Institutes, A Testamentary Trust Established Under The Will Of J. David Gladstone Precise genome editing using retrons
CN114107231B (en) * 2021-12-13 2023-08-18 重庆大学 Recombinant adeno-associated virus for whole-brain postsynaptic neuron cell body labeling and its application
GB202118058D0 (en) 2021-12-14 2022-01-26 Univ Warwick Methods to increase yields in crops
US20230279442A1 (en) 2021-12-15 2023-09-07 Versitech Limited Engineered cas9-nucleases and method of use thereof
WO2023115041A1 (en) 2021-12-17 2023-06-22 Sana Biotechnology, Inc. Modified paramyxoviridae attachment glycoproteins
EP4448549A2 (en) 2021-12-17 2024-10-23 Sana Biotechnology, Inc. Modified paramyxoviridae fusion glycoproteins
AU2022420615A1 (en) 2021-12-22 2024-07-04 Tome Biosciences, Inc. Co-delivery of a gene editor construct and a donor template
EP4463135A2 (en) 2022-01-10 2024-11-20 Sana Biotechnology, Inc. Methods of ex vivo dosing and administration of lipid particles or viral vectors and related systems and uses
WO2023141602A2 (en) 2022-01-21 2023-07-27 Renagade Therapeutics Management Inc. Engineered retrons and methods of use
WO2023150518A1 (en) 2022-02-01 2023-08-10 Sana Biotechnology, Inc. Cd3-targeted lentiviral vectors and uses thereof
EP4473097A1 (en) 2022-02-02 2024-12-11 Sana Biotechnology, Inc. Methods of repeat dosing and administration of lipid particles or viral vectors and related systems and uses
CN114480497B (en) * 2022-02-28 2023-09-15 湖南师范大学 Construction and application method of ep400 gene knockout zebra fish heart failure model
WO2023205744A1 (en) 2022-04-20 2023-10-26 Tome Biosciences, Inc. Programmable gene insertion compositions
WO2023203521A1 (en) 2022-04-21 2023-10-26 Augmedics Ltd. Systems and methods for medical image visualization
WO2023215831A1 (en) 2022-05-04 2023-11-09 Tome Biosciences, Inc. Guide rna compositions for programmable gene insertion
WO2023225670A2 (en) 2022-05-20 2023-11-23 Tome Biosciences, Inc. Ex vivo programmable gene insertion
GB2621813A (en) 2022-06-30 2024-02-28 Univ Newcastle Preventing disease recurrence in Mitochondrial replacement therapy
CN115053861A (en) * 2022-06-30 2022-09-16 南方医科大学南方医院 Construction method and application of animal model of schizophrenia based on immune activation
AU2023311964A1 (en) 2022-07-18 2025-01-30 Renagade Therapeutics Management Inc. Gene editing components, systems, and methods of use
WO2024020587A2 (en) 2022-07-22 2024-01-25 Tome Biosciences, Inc. Pleiopluripotent stem cell programmable gene insertion
CN115109799A (en) * 2022-07-26 2022-09-27 华中科技大学同济医学院附属协和医院 Fusion plasmid of a small molecule peptide and its application in antitumor drugs
CN115247149B (en) * 2022-08-22 2023-06-16 华域生物科技(天津)有限公司 Culture medium composition suitable for NK cells and culture method
US20260055146A1 (en) 2022-08-24 2026-02-26 Sana Biotechnology, Inc. Delivery of heterologous proteins
WO2024044723A1 (en) 2022-08-25 2024-02-29 Renagade Therapeutics Management Inc. Engineered retrons and methods of use
IL319523A (en) 2022-09-13 2025-05-01 Augmedics Ltd Augmented reality eyewear for image-guided medical intervention
WO2024064838A1 (en) 2022-09-21 2024-03-28 Sana Biotechnology, Inc. Lipid particles comprising variant paramyxovirus attachment glycoproteins and uses thereof
EP4602174A1 (en) 2022-10-13 2025-08-20 Sana Biotechnology, Inc. Viral particles targeting hematopoietic stem cells
WO2024119157A1 (en) 2022-12-02 2024-06-06 Sana Biotechnology, Inc. Lipid particles with cofusogens and methods of producing and using the same
WO2024138194A1 (en) 2022-12-22 2024-06-27 Tome Biosciences, Inc. Platforms, compositions, and methods for in vivo programmable gene insertion
WO2024155830A2 (en) * 2023-01-18 2024-07-25 Fred Hutchinson Cancer Center Viral particle producer cells with landing pad-integrated viral vectors
CN121358859A (en) * 2023-03-20 2026-01-16 维乎医疗有限公司 In vivo editing of the LPA gene based on nicking enzyme for the treatment of cardiovascular disease
EP4698665A1 (en) 2023-04-18 2026-02-25 Sana Biotechnology, Inc. Engineered protein g fusogens and related lipid particles and methods thereof
WO2024220598A2 (en) 2023-04-18 2024-10-24 Sana Biotechnology, Inc. Lentiviral vectors with two or more genomes
EP4698666A1 (en) 2023-04-18 2026-02-25 Sana Biotechnology, Inc. Universal protein g fusogens and adapter systems thereof and related lipid particles and uses
CN121712899A (en) * 2023-04-27 2026-03-20 伦斯勒理工学院 Recombinant enzymes for accurate insertion of DNA sequences in eukaryotic cells
WO2024234006A1 (en) 2023-05-11 2024-11-14 Tome Biosciences, Inc. Systems, compositions, and methods for targeting liver sinusodial endothelial cells (lsecs)
WO2024238817A2 (en) * 2023-05-16 2024-11-21 Fallon Jim Deceased Systems and methods for an intranasal drug delivery system
WO2024243340A1 (en) 2023-05-23 2024-11-28 Sana Biotechnology, Inc. Tandem fusogens and related lipid particles
WO2025049959A2 (en) 2023-09-01 2025-03-06 Renagade Therapeutics Management Inc. Gene editing systems, compositions, and methods for treatment of vexas syndrome
WO2025050069A1 (en) 2023-09-01 2025-03-06 Tome Biosciences, Inc. Programmable gene insertion using engineered integration enzymes
WO2025054202A1 (en) 2023-09-05 2025-03-13 Sana Biotechnology, Inc. Method of screening a sample comprising a transgene with a unique barcode
WO2025064408A1 (en) 2023-09-18 2025-03-27 The Broad Institute, Inc. Compositions and methods for treating cardiovascular disease
WO2025064591A1 (en) * 2023-09-19 2025-03-27 The Regents Of The University Of California In vivo gene editing of tau locus via liponanoparticle delivery
GB202314578D0 (en) 2023-09-22 2023-11-08 Univ Manchester Methods of producing homoplasmic modified plants or parts thereof
WO2025081042A1 (en) 2023-10-12 2025-04-17 Renagade Therapeutics Management Inc. Nickase-retron template-based precision editing system and methods of use
WO2025151838A1 (en) 2024-01-12 2025-07-17 Sana Biotechnology, Inc. Safety switches to control in vitro and in vivo proliferation of cell therapy products
WO2025155753A2 (en) 2024-01-17 2025-07-24 Renagade Therapeutics Management Inc. Improved gene editing system, guides, and methods
WO2025174765A1 (en) 2024-02-12 2025-08-21 Renagade Therapeutics Management Inc. Lipid nanoparticles comprising coding rna molecules for use in gene editing and as vaccines and therapeutic agents
WO2025184529A1 (en) 2024-03-01 2025-09-04 Sana Biotechnology, Inc. Viral particles with fusogen display and related compositions and methods
WO2025211949A1 (en) * 2024-04-05 2025-10-09 재단법인대구경북과학기술원 Composition for improving memory and cognitive function or preventing or treating neurodegenerative nerve diseases, comprising serpina1e protein as active ingredient
WO2025224107A1 (en) 2024-04-22 2025-10-30 Basecamp Research Ltd Method and compositions for detecting off-target editing
WO2025224182A2 (en) 2024-04-23 2025-10-30 Basecamp Research Ltd Single construct platform for simultaneous delivery of gene editing machinery and nucleic acid cargo
CN118376795B (en) * 2024-05-10 2025-10-31 厦门大学 Application of N-glycosylated protein combination in urine as target in early diagnosis of Alzheimer disease
WO2026006542A2 (en) 2024-06-26 2026-01-02 Yale University Compositions and methods for crispr/cas9 based reactivation of human angelman syndrome
CN119570025A (en) * 2024-11-19 2025-03-07 中国药科大学 A polyethyleneimine derivative and its application as a gene drug carrier

Citations (100)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US303910A (en) 1884-08-19 Enbaker
US4186183A (en) 1978-03-29 1980-01-29 The United States Of America As Represented By The Secretary Of The Army Liposome carriers in chemotherapy of leishmaniasis
US4217344A (en) 1976-06-23 1980-08-12 L'oreal Compositions containing aqueous dispersions of lipid spheres
US4235871A (en) 1978-02-24 1980-11-25 Papahadjopoulos Demetrios P Method of encapsulating biologically active materials in lipid vesicles
US4261975A (en) 1979-09-19 1981-04-14 Merck & Co., Inc. Viral liposome particle
US4485054A (en) 1982-10-04 1984-11-27 Lipoderm Pharmaceuticals Limited Method of encapsulating biologically active materials in multilamellar lipid vesicles (MLV)
US4501728A (en) 1983-01-06 1985-02-26 Technology Unlimited, Inc. Masking of liposomes from RES recognition
EP0264166A1 (en) 1986-04-09 1988-04-20 Genzyme Corporation Transgenic animals secreting desired proteins into milk
US4774085A (en) 1985-07-09 1988-09-27 501 Board of Regents, Univ. of Texas Pharmaceutical administration systems containing a mixture of immunomodulators
US4797368A (en) 1985-03-15 1989-01-10 The United States Of America As Represented By The Department Of Health And Human Services Adeno-associated virus as eukaryotic expression vector
US4837028A (en) 1986-12-24 1989-06-06 Liposome Technology, Inc. Liposomes with enhanced circulation time
US4873316A (en) 1987-06-23 1989-10-10 Biogen, Inc. Isolation of exogenous recombinant proteins from the milk of transgenic mammals
US4897355A (en) 1985-01-07 1990-01-30 Syntex (U.S.A.) Inc. N[ω,(ω-1)-dialkyloxy]- and N-[ω,(ω-1)-dialkenyloxy]-alk-1-yl-N,N,N-tetrasubstituted ammonium lipids and uses therefor
US4946787A (en) 1985-01-07 1990-08-07 Syntex (U.S.A.) Inc. N-(ω,(ω-1)-dialkyloxy)- and N-(ω,(ω-1)-dialkenyloxy)-alk-1-yl-N,N,N-tetrasubstituted ammonium lipids and uses therefor
US5049386A (en) 1985-01-07 1991-09-17 Syntex (U.S.A.) Inc. N-ω,(ω-1)-dialkyloxy)- and N-(ω,(ω-1)-dialkenyloxy)Alk-1-YL-N,N,N-tetrasubstituted ammonium lipids and uses therefor
WO1991016024A1 (en) 1990-04-19 1991-10-31 Vical, Inc. Cationic lipids for intracellular delivery of biologically active molecules
WO1991017424A1 (en) 1990-05-03 1991-11-14 Vical, Inc. Intracellular delivery of biologically active substances by means of self-assembling lipid complexes
US5173414A (en) 1990-10-30 1992-12-22 Applied Immune Sciences, Inc. Production of recombinant adeno-associated virus vectors
US5210015A (en) 1990-08-06 1993-05-11 Hoffman-La Roche Inc. Homogeneous assay system using the nuclease activity of a nucleic acid polymerase
WO1993024641A2 (en) 1992-06-02 1993-12-09 The United States Of America, As Represented By The Secretary, Department Of Health & Human Services Adeno-associated virus with inverted terminal repeat sequences as promoter
US5445934A (en) 1989-06-07 1995-08-29 Affymax Technologies N.V. Array of oligonucleotides on a solid substrate
US5580859A (en) 1989-03-21 1996-12-03 Vical Incorporated Delivery of exogenous DNA sequences in a mammal
WO1996039154A1 (en) 1995-06-06 1996-12-12 Isis Pharmaceuticals, Inc. Oligonucleotides having phosphorothioate linkages of high chiral purity
WO1997000321A1 (en) 1995-06-14 1997-01-03 Commonwealth Scientific And Industrial Research Organisation Immune response modulators and uses therefor
US5593972A (en) 1993-01-26 1997-01-14 The Wistar Institute Genetic immunization
US5846946A (en) 1996-06-14 1998-12-08 Pasteur Merieux Serums Et Vaccins Compositions and methods for administering Borrelia DNA
US6479808B1 (en) 1999-07-07 2002-11-12 The United States Of America As Represented By The Administrator Of The National Aeronautics And Space Administration Method and systems for collecting data from multiple fields of view
US6603061B1 (en) 1999-07-29 2003-08-05 Monsanto Company Agrobacterium-mediated plant transformation method
US20040013648A1 (en) 2000-10-06 2004-01-22 Kingsman Alan John Vector system
US6750059B1 (en) 1998-07-16 2004-06-15 Whatman, Inc. Archiving of vectors
US20040171156A1 (en) 1995-06-07 2004-09-02 Invitrogen Corporation Recombinational cloning using nucleic acids having recombination sites
US20050019923A1 (en) 2001-10-19 2005-01-27 Ijeoma Uchegbu Dendrimers for use in targeted delivery
EP1519714A1 (en) 2002-06-28 2005-04-06 Protiva Biotherapeutics Inc. Method and apparatus for producing liposomes
US20050287127A1 (en) 2003-11-13 2005-12-29 Huawei Li Use of stem cells to generate inner ear cells
US20060030837A1 (en) 2004-01-29 2006-02-09 The Charles Stark Draper Laboratory, Inc. Drug delivery apparatus
EP1664316A1 (en) 2003-09-15 2006-06-07 Protiva Biotherapeutics Inc. Polyethyleneglycol-modified lipid compounds and uses thereof
US20060281180A1 (en) 2003-10-30 2006-12-14 Philippa Radcliffe Vectors
US20070054961A1 (en) 1999-03-31 2007-03-08 Malcolm Maden Factor
EP1766035A1 (en) 2004-06-07 2007-03-28 Protiva Biotherapeutics Inc. Lipid encapsulated interfering rna
US7206639B2 (en) 2002-03-15 2007-04-17 Sarcos Investments Lc Cochlear drug delivery system and method
US20070093878A1 (en) 2005-09-08 2007-04-26 Albert Edge Cochlear implants containing biological cells and uses thereof
EP1781593A2 (en) 2004-06-07 2007-05-09 Protiva Biotherapeutics Inc. Cationic lipids and methods of use
US7351585B2 (en) 2002-09-03 2008-04-01 Oxford Biomedica (Uk) Ltd. Retroviral vector
US20080267903A1 (en) 2004-10-14 2008-10-30 Ijeoma Uchegbu Bioactive Polymers
US20090007284A1 (en) 2001-12-21 2009-01-01 Philippa Radcliffe Transgenic organism
US20090017543A1 (en) 2005-12-22 2009-01-15 Fraser Wilkes Viral Vectors
US20090100536A1 (en) 2001-12-04 2009-04-16 Monsanto Company Transgenic plants with enhanced agronomic traits
US20090222937A1 (en) 2006-02-13 2009-09-03 Cellectis Meganuclease variants cleaving a dna target sequence from a xeroderma pigmentosum gene and uses thereof
US20090271881A1 (en) 2006-07-18 2009-10-29 Cellectis Meganuclease variants cleaving a dna target sequence from a rag gene and uses thereof
US20100146651A1 (en) 2006-11-14 2010-06-10 Cellectis Meganuclease variants cleaving a dna target sequence from the hprt gene and uses thereof
US7776321B2 (en) 2001-09-26 2010-08-17 Mayo Foundation For Medical Education And Research Mutable vaccines
US20100229252A1 (en) 2007-07-23 2010-09-09 Cellectis Meganuclease variants cleaving a dna target sequence from the human hemoglobin beta gene and uses thereof
US20100291048A1 (en) 2009-03-20 2010-11-18 Sangamo Biosciences, Inc. Modification of CXCR4 using engineered zinc finger proteins
US7838658B2 (en) 2005-10-20 2010-11-23 Ian Maclachlan siRNA silencing of filovirus gene expression
US20100311124A1 (en) 2008-10-29 2010-12-09 Sangamo Biosciences, Inc. Methods and compositions for inactivating glutamine synthetase gene expression
US7868149B2 (en) 1999-07-20 2011-01-11 Monsanto Technology Llc Plant genome sequence and uses thereof
US20110016540A1 (en) 2008-12-04 2011-01-20 Sigma-Aldrich Co. Genome editing of genes associated with trinucleotide repeat expansion disorders in animals
US20110023145A1 (en) 2008-12-04 2011-01-27 Sigma-Aldrich Co. Genomic editing of genes involved in autism spectrum disorders
US20110023153A1 (en) 2008-12-04 2011-01-27 Sigma-Aldrich Co. Genomic editing of genes involved in alzheimer's disease
US20110023139A1 (en) 2008-12-04 2011-01-27 Sigma-Aldrich Co. Genomic editing of genes involved in cardiovascular disease
US20110023146A1 (en) 2008-12-04 2011-01-27 Sigma-Aldrich Co. Genomic editing of genes involved in secretase-associated disorders
US20110023144A1 (en) 2008-12-04 2011-01-27 Sigma-Aldrich Co. Genomic editing of genes involved in amyotrophyic lateral sclerosis disease
US20110059502A1 (en) 2009-09-07 2011-03-10 Chalasani Sreekanth H Multiple domain proteins
WO2011028929A2 (en) 2009-09-03 2011-03-10 The Regents Of The University Of California Nitrate-responsive promoter
US7915399B2 (en) 2006-06-09 2011-03-29 Protiva Biotherapeutics, Inc. Modified siRNA molecules and uses thereof
US20110091441A1 (en) 2007-08-03 2011-04-21 Cellectis Meganuclease variants cleaving a dna target sequence from the human interleukin-2 receptor gamma chain gene and uses thereof
US20110117189A1 (en) 2008-07-08 2011-05-19 S.I.F.I. Societa' Industria Farmaceutica Italiana S.P.A. Ophthalmic compositions for treating pathologies of the posterior segment of the eye
US20110142917A1 (en) 2008-06-06 2011-06-16 Egvenia Alpert Compositions and methods for treatment of ear disorders
US20110158957A1 (en) 2009-11-10 2011-06-30 Sangamo Biosciences, Inc. Targeted disruption of T cell receptor genes using engineered zinc finger protein nucleases
US7982027B2 (en) 2003-07-16 2011-07-19 Protiva Biotherapeutics, Inc. Lipid encapsulated interfering RNA
US20110182867A1 (en) 2008-09-15 2011-07-28 Children's Medical Center Corporation Modulation of bcl11a for treatment of hemoglobinopathies
US20110195123A1 (en) 2008-06-30 2011-08-11 Silenseed Ltd. Methods, compositions and systems for local delivery of drugs
US20110225664A1 (en) 2008-09-08 2011-09-15 Cellectis Meganuclease variants cleaving a dna target sequence from a glutamine synthetase gene and uses thereof
US20110230839A1 (en) 2007-08-14 2011-09-22 Fred Hutchinson Cancer Research Center Needle Array Assembly and Method for Delivering Therapeutic Agents
US20110253040A1 (en) 2008-05-08 2011-10-20 Chung Yuan Christian University Apparatus For Forming Composite Membrane With Porous Coating Layer
US20110265198A1 (en) 2010-04-26 2011-10-27 Sangamo Biosciences, Inc. Genome editing of a Rosa locus using nucleases
US8058069B2 (en) 2008-04-15 2011-11-15 Protiva Biotherapeutics, Inc. Lipid formulations for nucleic acid delivery
US20110293703A1 (en) 2008-11-07 2011-12-01 Massachusetts Institute Of Technology Aminoalcohol lipidoids and uses thereof
US20110293571A1 (en) 2010-05-28 2011-12-01 Oxford Biomedica (Uk) Ltd. Method for vector delivery
US8101741B2 (en) 2005-11-02 2012-01-24 Protiva Biotherapeutics, Inc. Modified siRNA molecules and uses thereof
US20120159653A1 (en) 2008-12-04 2012-06-21 Sigma-Aldrich Co. Genomic editing of genes involved in macular degeneration
US20120164118A1 (en) 2009-05-04 2012-06-28 Fred Hutchinson Cancer Research Center Cocal vesiculovirus envelope pseudotyped retroviral vectors
US8236943B2 (en) 2009-07-01 2012-08-07 Protiva Biotherapeutics, Inc. Compositions and methods for silencing apolipoprotein B
US20120204282A1 (en) 2011-02-04 2012-08-09 Sangamo Biosciences, Inc. Methods and compositions for treating occular disorders
US20120251618A1 (en) 2011-03-31 2012-10-04 modeRNA Therapeutics Delivery and formulation of engineered nucleic acids
US8283333B2 (en) 2009-07-01 2012-10-09 Protiva Biotherapeutics, Inc. Lipid formulations for nucleic acid delivery
US20120295960A1 (en) 2011-05-20 2012-11-22 Oxford Biomedica (Uk) Ltd. Treatment regimen for parkinson's disease
US20120328580A1 (en) 2008-02-07 2012-12-27 Albert Edge Compounds that enhance atoh1 expression
US8404658B2 (en) 2007-12-31 2013-03-26 Nanocor Therapeutics, Inc. RNA interference for the treatment of heart failure
US20130122591A1 (en) 2011-10-27 2013-05-16 The Regents Of The University Of California Methods and compositions for modification of the hprt locus
US8454972B2 (en) 2004-07-16 2013-06-04 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Method for inducing a multiclade immune response against HIV utilizing a multigene and multiclade immunogen
US20130145487A1 (en) 2010-05-12 2013-06-06 Cellectis Meganuclease variants cleaving a dna target sequence from the dystrophin gene and uses thereof
US20130171732A1 (en) 2011-10-06 2013-07-04 Sangamo Biosciences, Inc. Methods and compositions for regulating hiv infection
US20130183282A1 (en) 2010-05-12 2013-07-18 Cellectis Meganuclease variants cleaving a DNA target sequence from the rhodopsin gene and uses thereof
US20130202678A1 (en) 2008-07-29 2013-08-08 Academia Sinica Puf-a and related compounds for treatment of retinopathies and sight-threatening ophthalmologic disorders
WO2013126794A1 (en) 2012-02-24 2013-08-29 Fred Hutchinson Cancer Research Center Compositions and methods for the treatment of hemoglobinopathies
US20130236946A1 (en) 2007-06-06 2013-09-12 Cellectis Meganuclease variants cleaving a dna target sequence from the mouse rosa26 locus and uses thereof
US20130244279A1 (en) 2011-12-16 2013-09-19 modeRNA Therapeutics Formulation and delivery of plga microspheres
WO2013163628A2 (en) 2012-04-27 2013-10-31 Duke University Genetic correction of mutated genes
US20130302401A1 (en) 2010-08-26 2013-11-14 Massachusetts Institute Of Technology Poly(beta-amino alcohols), their preparation, and uses thereof

Family Cites Families (162)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPS6395765U (en) 1986-12-11 1988-06-21
US4783989A (en) 1987-03-05 1988-11-15 Atlantic Richfield Company Vapor pressure measurement apparatus and method
US5593970A (en) 1990-06-11 1997-01-14 Biochem Pharma Inc. Heterocyclic anthracycline analogs
US7150982B2 (en) 1991-09-09 2006-12-19 Third Wave Technologies, Inc. RNA detection assays
US7745416B2 (en) 1995-04-11 2010-06-29 The Regents Of The University Of California Method for in vivo regulation of cardiac muscle contractility
US5985662A (en) 1995-07-13 1999-11-16 Isis Pharmaceuticals Inc. Antisense inhibition of hepatitis B virus replication
US5622856A (en) 1995-08-03 1997-04-22 Avigen High efficiency helper system for AAV vector production
US6251677B1 (en) 1997-08-25 2001-06-26 The Trustees Of The University Of Pennsylvania Hybrid adenovirus-AAV virus and methods of use thereof
GB9720465D0 (en) 1997-09-25 1997-11-26 Oxford Biomedica Ltd Dual-virus vectors
US6534261B1 (en) 1999-01-12 2003-03-18 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
US7033744B2 (en) * 2001-03-16 2006-04-25 Naoya Kobayashi Method for proliferating a liver cell, a liver cell obtained thereby, and use thereof
ES2404689T3 (en) 2001-04-05 2013-05-28 The Johns Hopkins University Chimeric vaccines comprising the lumenal domain of LAMP-1 or LAMP-2
IL159756A0 (en) 2001-07-12 2004-06-20 Univ Massachusetts IN VIVO PRODUCTION OF SMALL INTERFERING RNAs THAT MEDIATE GENE SILENCING
US20040002468A1 (en) 2001-08-08 2004-01-01 Genzyme Corporation Methods of treating diabetes and other blood sugar disorders
WO2003016338A1 (en) 2001-08-15 2003-02-27 Parker Hughes Institute Crystal structure of the btk kinase domain
US7539579B2 (en) 2002-04-09 2009-05-26 Beattie Kenneth L Oligonucleotide probes for genosensor chips
WO2003104414A2 (en) 2002-06-11 2003-12-18 The Scripps Research Institute Artificial transcription factors
CA2499188A1 (en) 2002-09-27 2004-04-08 Cold Spring Harbor Laboratory Cell-based rna interference and related methods and compositions
WO2004046321A2 (en) * 2002-11-15 2004-06-03 Trustees Of Boston University Cis/trans riboregulators
US20060178297A1 (en) 2003-01-28 2006-08-10 Troy Carol M Systems and methods for silencing expression of a gene in a cell and uses thereof
CA2530810A1 (en) 2003-07-03 2005-01-27 The Regents Of The University Of California Genome mapping of functional dna elements and cellular proteins
ES2808687T3 (en) 2003-08-08 2021-03-01 Sangamo Therapeutics Inc Methods and compositions for directed cleavage and recombination
US8409861B2 (en) 2003-08-08 2013-04-02 Sangamo Biosciences, Inc. Targeted deletion of cellular DNA sequences
FR2862659B1 (en) 2003-11-21 2006-02-10 Pasteur Institut GENOME OF LEGIONELLA PNEUMOPHILA SOUCHE PARIS- DIAGNOSTIC AND EPIDEMIOLOGICAL APPLICATIONS
US8053232B2 (en) 2004-01-23 2011-11-08 Virxsys Corporation Correction of alpha-1-antitrypsin genetic defects using spliceosome mediated RNA trans splicing
US20070244031A1 (en) 2004-01-27 2007-10-18 Quan Lu Methods and Compositions for Homozygous Gene Inactivation Using Collections of Pre-Defined Nucleotide Sequences Complementary Chromosomal Transcripts
US20050220796A1 (en) 2004-03-31 2005-10-06 Dynan William S Compositions and methods for modulating DNA repair
FR2872170B1 (en) 2004-06-25 2006-11-10 Centre Nat Rech Scient Cnrse NON-INTERACTIVE AND NON-REPLICATIVE LENTIVIRUS, PREPARATION AND USES
US7404969B2 (en) 2005-02-14 2008-07-29 Sirna Therapeutics, Inc. Lipid nanoparticle based compositions and methods for the delivery of biologically active molecules
US20070081982A1 (en) * 2005-04-28 2007-04-12 Elisabeth Evertsz Multiple RNAi expression cassettes for simultaneous delivery of RNAi agents related to heterozygotic expression patterns
US7892224B2 (en) 2005-06-01 2011-02-22 Brainlab Ag Inverse catheter planning
EP1913149A4 (en) * 2005-07-26 2009-08-05 Sangamo Biosciences Inc Targeted integration and expression of exogenous nucleic acid sequences
CA2619833C (en) 2005-08-26 2017-05-09 Danisco A/S Use of crispr associated genes (cas)
EP1989307B1 (en) 2006-02-08 2012-08-08 Quark Pharmaceuticals, Inc. NOVEL TANDEM siRNAS
EP1994182B1 (en) 2006-03-15 2019-05-29 Siemens Healthcare Diagnostics Inc. Degenerate nucleobase analogs
EP2194128B1 (en) 2006-05-11 2012-08-01 Alnylam Pharmaceuticals Inc. Compositions and methods for inhibiting expression of the PCSK9 gene
WO2008054544A2 (en) 2006-05-22 2008-05-08 Immune Disease Institute, Inc. Method for delivery across the blood brain barrier
WO2008093152A1 (en) 2007-02-01 2008-08-07 Cellectis Obligate heterodimer meganucleases and uses thereof
US8173792B2 (en) 2007-02-09 2012-05-08 The Board Of Trustees Of The Leland Stanford Junior University Method for regulating protein function in cells using synthetic small molecules
ES2719789T3 (en) 2007-03-02 2019-07-16 Dupont Nutrition Biosci Aps Crops with improved phage resistance
PE20090064A1 (en) 2007-03-26 2009-03-02 Novartis Ag DOUBLE-CHAIN RIBONUCLEIC ACID TO INHIBIT THE EXPRESSION OF THE HUMAN E6AP GENE AND THE PHARMACEUTICAL COMPOSITION THAT INCLUDES IT
US20100293703A1 (en) 2007-05-29 2010-11-25 Celine Tezartes-Strauss Garment with built-in protecting pads
US20100081707A1 (en) 2008-02-21 2010-04-01 Ali Robin R Devices and methods for delivering polynucleotides into retinal cells of the macula and fovea
WO2010011961A2 (en) 2008-07-25 2010-01-28 University Of Georgia Research Foundation, Inc. Prokaryotic rnai-like system and methods of use
US20100076057A1 (en) * 2008-09-23 2010-03-25 Northwestern University TARGET DNA INTERFERENCE WITH crRNA
SG10201809460SA (en) 2008-10-20 2018-11-29 Alnylam Pharmaceuticals Inc Compositions and methods for inhibiting expression of transthyretin
US9404098B2 (en) 2008-11-06 2016-08-02 University Of Georgia Research Foundation, Inc. Method for cleaving a target RNA using a Cas6 polypeptide
JP5681114B2 (en) * 2008-12-04 2015-03-04 サンガモ バイオサイエンシーズ, インコーポレイテッド Rat genome editing using zinc finger nuclease
CA2746514C (en) 2008-12-10 2018-11-27 Alnylam Pharmaceuticals, Inc. Gnaq targeted dsrna compositions and methods for inhibiting expression
WO2010075424A2 (en) 2008-12-22 2010-07-01 The Regents Of University Of California Compositions and methods for downregulating prokaryotic genes
US20110239315A1 (en) 2009-01-12 2011-09-29 Ulla Bonas Modular dna-binding domains and methods of use
EP2206723A1 (en) 2009-01-12 2010-07-14 Bonas, Ulla Modular DNA-binding domains
AR076225A1 (en) 2009-04-07 2011-05-26 Dow Agrosciences Llc ADMINISTRATION OF NANOPARTICLES COVERED BY A SEQUENCE OF SPECIFIC NUCLEASE
WO2011036510A1 (en) 2009-09-24 2011-03-31 Cellectis Meganuclease variants cleaving the genome of the herpes simplex virus and uses thereof
US20120149115A1 (en) 2009-06-11 2012-06-14 Snu R&Db Foundation Targeted genomic rearrangements using site-specific nucleases
WO2010147987A1 (en) 2009-06-15 2010-12-23 Agc Automotive Amerlcas R&D, Inc. Diversity antenna system and method
AU2010275432A1 (en) * 2009-07-24 2012-02-02 Sigma-Aldrich Co. Llc. Method for genome editing
US9234016B2 (en) 2009-07-28 2016-01-12 Sangamo Biosciences, Inc. Engineered zinc finger proteins for treating trinucleotide repeat disorders
AU2010325549B2 (en) * 2009-11-27 2017-04-20 Basf Plant Science Company Gmbh Optimized endonucleases and uses thereof
EP3456826B1 (en) 2009-12-10 2023-06-28 Regents of the University of Minnesota Tal effector-mediated dna modification
JP2013515697A (en) 2009-12-23 2013-05-09 マックスプランク−ゲセルシャフト・ツール・フェーデルング・デル・ヴィッセンシャフテン・エー・ファウ Influenza target
EP2534163B1 (en) 2010-02-09 2015-11-04 Sangamo BioSciences, Inc. Targeted genomic modification with partially single-stranded donor molecules
US10087431B2 (en) 2010-03-10 2018-10-02 The Regents Of The University Of California Methods of generating nucleic acid fragments
US8927514B2 (en) 2010-04-30 2015-01-06 City Of Hope Recombinant adeno-associated vectors for targeted treatment
BR112012028805A2 (en) 2010-05-10 2019-09-24 The Regents Of The Univ Of California E Nereus Pharmaceuticals Inc endoribonuclease compositions and methods of use thereof.
JP6208580B2 (en) * 2010-05-17 2017-10-04 サンガモ セラピューティクス, インコーポレイテッド Novel DNA binding protein and use thereof
JP2013537410A (en) 2010-07-23 2013-10-03 シグマ−アルドリッチ・カンパニー・リミテッド・ライアビリティ・カンパニー Genome editing using targeted endonucleases and single-stranded nucleic acids
WO2012018697A1 (en) 2010-08-02 2012-02-09 Integrated Dna Technologies, Inc. Methods for predicting stability and melting temperatures of nucleic acid duplexes
WO2012031205A2 (en) 2010-09-03 2012-03-08 The Brigham And Women's Hospital, Inc. Lipid-polymer hybrid particles
CN103270046B (en) 2010-10-12 2016-05-11 费城儿童医院 The method and composition for the treatment of haemophilia B
US9405700B2 (en) 2010-11-04 2016-08-02 Sonics, Inc. Methods and apparatus for virtualization in an integrated circuit
DK4005603T3 (en) 2011-04-22 2024-11-25 Univ California ADENO-ASSOCIATED VIRUS VIRIOS WITH VARIANT CAPSID AND METHODS OF USING THEREOF
WO2012149470A1 (en) 2011-04-27 2012-11-01 Amyris, Inc. Methods for genomic modification
WO2012164565A1 (en) * 2011-06-01 2012-12-06 Yeda Research And Development Co. Ltd. Compositions and methods for downregulating prokaryotic genes
CA2848417C (en) 2011-09-21 2023-05-02 Sangamo Biosciences, Inc. Methods and compositions for regulation of transgene expression
US20130122096A1 (en) 2011-11-14 2013-05-16 Silenseed Ltd. Compositions for drug delivery and methods of manufacturing and using same
US9708414B2 (en) 2011-11-18 2017-07-18 UNIVERSITé LAVAL Methods and products for increasing frataxin levels and uses thereof
HK1202434A1 (en) 2011-11-22 2015-10-02 The Children's Hospital Of Philadelphia Virus vectors for highly efficient transgene delivery
US20130137173A1 (en) 2011-11-30 2013-05-30 Feng Zhang Nucleotide-specific recognition sequences for designer tal effectors
US8450107B1 (en) 2011-11-30 2013-05-28 The Broad Institute Inc. Nucleotide-specific recognition sequences for designer TAL effectors
GB201122458D0 (en) 2011-12-30 2012-02-08 Univ Wageningen Modified cascade ribonucleoproteins and uses thereof
NZ629427A (en) 2012-02-29 2016-04-29 Sangamo Biosciences Inc Methods and compositions for treating huntington’s disease
WO2013141680A1 (en) 2012-03-20 2013-09-26 Vilnius University RNA-DIRECTED DNA CLEAVAGE BY THE Cas9-crRNA COMPLEX
US9637739B2 (en) 2012-03-20 2017-05-02 Vilnius University RNA-directed DNA cleavage by the Cas9-crRNA complex
EP2834259A4 (en) 2012-04-02 2016-08-24 Moderna Therapeutics Inc Modified polynucleotides
AU2013204327B2 (en) 2012-04-20 2016-09-01 Aviagen Cell transfection method
PL4289948T3 (en) * 2012-05-25 2025-06-02 The Regents Of The University Of California Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription
HK1208823A1 (en) 2012-06-01 2016-03-18 德雷塞尔大学 Modulation of hepatitis b virus cccdna transcription
FR2993379B1 (en) 2012-07-10 2015-09-04 Morpho SECURE COMPARATIVE PROCESSING METHOD
FR2995325B1 (en) 2012-09-11 2015-03-13 Ct Tech De L Ind Des Papiers Cartons Et Celluloses PROCESS FOR PRODUCING A MULTILAYER FIBROUS MEDIUM BY FRACTIONATION AND STRATIFICATION
AU2013329186B2 (en) 2012-10-10 2019-02-14 Sangamo Therapeutics, Inc. T cell modifying compounds and uses thereof
EP2912175B1 (en) 2012-10-23 2018-08-22 Toolgen Incorporated Composition for cleaving a target dna comprising a guide rna specific for the target dna and cas protein-encoding nucleic acid or cas protein, and use thereof
CN105142669B (en) 2012-12-06 2018-07-03 西格马-奥尔德里奇有限责任公司 CRISPR-based genome modification and regulation
WO2014093479A1 (en) 2012-12-11 2014-06-19 Montana State University Crispr (clustered regularly interspaced short palindromic repeats) rna-guided control of gene regulation
PL2784162T3 (en) 2012-12-12 2016-01-29 Broad Inst Inc Engineering of systems, methods and optimized guide compositions for sequence manipulation
WO2014093694A1 (en) * 2012-12-12 2014-06-19 The Broad Institute, Inc. Crispr-cas nickase systems, methods and compositions for sequence manipulation in eukaryotes
US8697359B1 (en) 2012-12-12 2014-04-15 The Broad Institute, Inc. CRISPR-Cas systems and methods for altering expression of gene products
CN105121648B (en) 2012-12-12 2021-05-07 布罗德研究所有限公司 Systems, methods and engineering of guide compositions for sequence manipulation
WO2014093622A2 (en) * 2012-12-12 2014-06-19 The Broad Institute, Inc. Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
WO2014093701A1 (en) 2012-12-12 2014-06-19 The Broad Institute, Inc. Functional genomics using crispr-cas systems, compositions, methods, knock out libraries and applications thereof
PT2898075E (en) * 2012-12-12 2016-06-16 Harvard College Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation
EP3434776A1 (en) 2012-12-12 2019-01-30 The Broad Institute, Inc. Methods, models, systems, and apparatus for identifying target sequences for cas enzymes or crispr-cas systems for target sequences and conveying results thereof
CN105658796B (en) * 2012-12-12 2021-10-26 布罗德研究所有限公司 CRISPR-CAS component systems, methods, and compositions for sequence manipulation
WO2014093655A2 (en) 2012-12-12 2014-06-19 The Broad Institute, Inc. Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains
EP4282970A3 (en) 2012-12-17 2024-01-17 President and Fellows of Harvard College Rna-guided human genome engineering
AU2014207618A1 (en) 2013-01-16 2015-08-06 Emory University Cas9-nucleic acid complexes and uses related thereto
US11135273B2 (en) 2013-02-07 2021-10-05 The Rockefeller University Sequence specific antimicrobials
WO2014124226A1 (en) 2013-02-07 2014-08-14 The Rockefeller University Sequence specific antimicrobials
US9163837B2 (en) 2013-02-27 2015-10-20 Siemens Aktiengesellschaft Flow conditioner in a combustor of a gas turbine engine
KR20170108172A (en) 2013-03-14 2017-09-26 카리부 바이오사이언시스 인코포레이티드 Compositions and methods of nucleic acid-targeting nucleic acids
US9234213B2 (en) 2013-03-15 2016-01-12 System Biosciences, Llc Compositions and methods directed to CRISPR/Cas genomic engineering systems
IL289396B2 (en) 2013-03-15 2023-12-01 The General Hospital Coporation Using tru-grnas to increase the specificity of RNA-guided genome editing
JP6214753B2 (en) 2013-03-27 2017-10-18 ヴィルコ・アーゲー Method for inspecting and / or testing a device in-line and apparatus for performing such a method
WO2014165349A1 (en) 2013-04-04 2014-10-09 Trustees Of Dartmouth College Compositions and methods for in vivo excision of hiv-1 proviral dna
JP2016522679A (en) 2013-04-04 2016-08-04 プレジデント アンド フェローズ オブ ハーバード カレッジ Therapeutic use of genome editing with the CRISPR / Cas system
CN116083487A (en) 2013-05-15 2023-05-09 桑格摩生物治疗股份有限公司 Methods and compositions for treating genetic conditions
JP7065564B2 (en) 2013-05-29 2022-05-12 セレクティス Methods for Providing Accurate DNA Cleavage Using CAS9 Nickase Activity
US20140356956A1 (en) 2013-06-04 2014-12-04 President And Fellows Of Harvard College RNA-Guided Transcriptional Regulation
MY197877A (en) 2013-06-04 2023-07-22 Harvard College Rna-guided transcriptional regulation
KR102307280B1 (en) 2013-06-05 2021-10-01 듀크 유니버시티 Rna-guided gene editing and gene regulation
EP3011033B1 (en) 2013-06-17 2020-02-19 The Broad Institute, Inc. Functional genomics using crispr-cas systems, compositions methods, screens and applications thereof
SG11201510327TA (en) 2013-06-17 2016-01-28 Broad Inst Inc Delivery, engineering and optimization of systems, methods and compositions for targeting and modeling diseases and disorders of post mitotic cells
KR20240172759A (en) 2013-06-17 2024-12-10 더 브로드 인스티튜트, 인코퍼레이티드 Delivery and use of the crispr-cas systems, vectors and compositions for hepatic targeting and therapy
EP3597755A1 (en) 2013-06-17 2020-01-22 The Broad Institute, Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using viral components
EP3674411A1 (en) 2013-06-17 2020-07-01 The Broad Institute, Inc. Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation
CA2915837A1 (en) 2013-06-17 2014-12-24 The Broad Institute, Inc. Optimized crispr-cas double nickase systems, methods and compositions for sequence manipulation
CN103343120B (en) 2013-07-04 2015-03-04 中国科学院遗传与发育生物学研究所 Wheat genome site-specific modification method
DK3019619T3 (en) 2013-07-11 2021-10-11 Modernatx Inc COMPOSITIONS INCLUDING SYNTHETIC POLYNUCLEOTIDES CODING CRISPR-RELATED PROTEINS, SYNTHETIC SGRNAs, AND USES OF USE
CN103388006B (en) 2013-07-26 2015-10-28 华东师范大学 A kind of construction process of site-directed point mutation
EP3038661B1 (en) 2013-08-29 2023-12-27 Temple University Of The Commonwealth System Of Higher Education Methods and compositions for rna-guided treatment of hiv infection
US9526784B2 (en) 2013-09-06 2016-12-27 President And Fellows Of Harvard College Delivery system for functional nucleases
US9322037B2 (en) 2013-09-06 2016-04-26 President And Fellows Of Harvard College Cas9-FokI fusion proteins and uses thereof
US10822606B2 (en) 2013-09-27 2020-11-03 The Regents Of The University Of California Optimized small guide RNAs and methods of use
WO2015048577A2 (en) 2013-09-27 2015-04-02 Editas Medicine, Inc. Crispr-related methods and compositions
WO2015065964A1 (en) 2013-10-28 2015-05-07 The Broad Institute Inc. Functional genomics using crispr-cas systems, compositions, methods, screens and applications thereof
JP2016536021A (en) 2013-11-07 2016-11-24 エディタス・メディシン,インコーポレイテッド CRISPR-related methods and compositions with governing gRNA
WO2015071474A2 (en) 2013-11-18 2015-05-21 Crispr Therapeutics Ag Crispr-cas system materials and methods
WO2015089354A1 (en) 2013-12-12 2015-06-18 The Broad Institute Inc. Compositions and methods of use of crispr-cas systems in nucleotide repeat disorders
EP3080260B1 (en) 2013-12-12 2019-03-06 The Broad Institute, Inc. Crispr-cas systems and methods for altering expression of gene products, structural information and inducible modular cas enzymes
WO2015089364A1 (en) 2013-12-12 2015-06-18 The Broad Institute Inc. Crystal structure of a crispr-cas system, and uses thereof
JP2017501149A (en) 2013-12-12 2017-01-12 ザ・ブロード・インスティテュート・インコーポレイテッド Delivery, use and therapeutic applications of CRISPR-CAS systems and compositions for targeting disorders and diseases using particle delivery components
CN103668472B (en) 2013-12-31 2014-12-24 北京大学 Method for constructing eukaryon gene knockout library by using CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats)/Cas9 system
WO2015113063A1 (en) 2014-01-27 2015-07-30 Georgia Tech Research Corporation Methods and systems for identifying crispr/cas off-target sites
CN103779358A (en) * 2014-01-27 2014-05-07 京东方科技集团股份有限公司 Array substrate, manufacturing method of array substrate and display device
CA2951707A1 (en) 2014-06-10 2015-12-17 Massachusetts Institute Of Technology Method for gene editing
JP6323228B2 (en) 2014-07-18 2018-05-16 富士電機株式会社 Power converter
WO2016022866A1 (en) 2014-08-07 2016-02-11 Agilent Technologies, Inc. Cis-blocked guide rna
EP3686279B1 (en) 2014-08-17 2023-01-04 The Broad Institute, Inc. Genome editing using cas9 nickases
WO2016049024A2 (en) * 2014-09-24 2016-03-31 The Broad Institute Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for modeling competition of multiple cancer mutations in vivo
DE102014221482A1 (en) 2014-10-22 2016-04-28 Ford Global Technologies, Llc Method for controlling a voltage source for charging a battery of a motor vehicle
US12180263B2 (en) 2014-11-06 2024-12-31 President And Fellows Of Harvard College Cells lacking B2M surface expression and methods for allogeneic administration of such cells
WO2016141224A1 (en) 2015-03-03 2016-09-09 The General Hospital Corporation Engineered crispr-cas9 nucleases with altered pam specificity
PL3291679T3 (en) 2015-05-06 2022-04-25 Snipr Technologies Limited CHANGE OF THE MICROBIAL POPULATION AND MODIFYING THE MICROBIOT
WO2016205759A1 (en) 2015-06-18 2016-12-22 The Broad Institute Inc. Engineering and optimization of systems, methods, enzymes and guide scaffolds of cas9 orthologs and variants for sequence manipulation
MX392008B (en) 2015-06-18 2025-03-21 Broad Inst Inc CRISPR ENZYME MUTATIONS THAT REDUCE OFF-TARGET EFFECTS
US9512446B1 (en) 2015-08-28 2016-12-06 The General Hospital Corporation Engineered CRISPR-Cas9 nucleases
US9926546B2 (en) 2015-08-28 2018-03-27 The General Hospital Corporation Engineered CRISPR-Cas9 nucleases
JP6186470B2 (en) 2016-04-20 2017-08-23 パイオニア株式会社 Acoustic device, volume control method, volume control program, and recording medium
WO2018154439A1 (en) 2017-02-22 2018-08-30 Crispr Therapeutics Ag Materials and methods for treatment of spinocerebellar ataxia type 1 (sca1) and other spinocerebellar ataxia type 1 protein (atxn1) gene related conditions or disorders
KR102085165B1 (en) 2017-11-10 2020-03-05 주식회사 엘지화학 Organic metal compound and organic light emitting device comprising the same
KR20210143718A (en) 2019-01-17 2021-11-29 조지아 테크 리서치 코포레이션 Drug Delivery Systems Containing Oxidized Cholesterol
US12569438B2 (en) 2019-07-29 2026-03-10 Georgia Tech Research Corporation Nanomaterials containing constrained lipids and uses thereof

Patent Citations (114)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US303910A (en) 1884-08-19 Enbaker
US4217344A (en) 1976-06-23 1980-08-12 L'oreal Compositions containing aqueous dispersions of lipid spheres
US4235871A (en) 1978-02-24 1980-11-25 Papahadjopoulos Demetrios P Method of encapsulating biologically active materials in lipid vesicles
US4186183A (en) 1978-03-29 1980-01-29 The United States Of America As Represented By The Secretary Of The Army Liposome carriers in chemotherapy of leishmaniasis
US4261975A (en) 1979-09-19 1981-04-14 Merck & Co., Inc. Viral liposome particle
US4485054A (en) 1982-10-04 1984-11-27 Lipoderm Pharmaceuticals Limited Method of encapsulating biologically active materials in multilamellar lipid vesicles (MLV)
US4501728A (en) 1983-01-06 1985-02-26 Technology Unlimited, Inc. Masking of liposomes from RES recognition
US4897355A (en) 1985-01-07 1990-01-30 Syntex (U.S.A.) Inc. N[ω,(ω-1)-dialkyloxy]- and N-[ω,(ω-1)-dialkenyloxy]-alk-1-yl-N,N,N-tetrasubstituted ammonium lipids and uses therefor
US4946787A (en) 1985-01-07 1990-08-07 Syntex (U.S.A.) Inc. N-(ω,(ω-1)-dialkyloxy)- and N-(ω,(ω-1)-dialkenyloxy)-alk-1-yl-N,N,N-tetrasubstituted ammonium lipids and uses therefor
US5049386A (en) 1985-01-07 1991-09-17 Syntex (U.S.A.) Inc. N-ω,(ω-1)-dialkyloxy)- and N-(ω,(ω-1)-dialkenyloxy)Alk-1-YL-N,N,N-tetrasubstituted ammonium lipids and uses therefor
US4797368A (en) 1985-03-15 1989-01-10 The United States Of America As Represented By The Department Of Health And Human Services Adeno-associated virus as eukaryotic expression vector
US4774085A (en) 1985-07-09 1988-09-27 501 Board of Regents, Univ. of Texas Pharmaceutical administration systems containing a mixture of immunomodulators
EP0264166A1 (en) 1986-04-09 1988-04-20 Genzyme Corporation Transgenic animals secreting desired proteins into milk
US4837028A (en) 1986-12-24 1989-06-06 Liposome Technology, Inc. Liposomes with enhanced circulation time
US4873316A (en) 1987-06-23 1989-10-10 Biogen, Inc. Isolation of exogenous recombinant proteins from the milk of transgenic mammals
US5589466A (en) 1989-03-21 1996-12-31 Vical Incorporated Induction of a protective immune response in a mammal by injecting a DNA sequence
US5580859A (en) 1989-03-21 1996-12-03 Vical Incorporated Delivery of exogenous DNA sequences in a mammal
US5445934A (en) 1989-06-07 1995-08-29 Affymax Technologies N.V. Array of oligonucleotides on a solid substrate
WO1991016024A1 (en) 1990-04-19 1991-10-31 Vical, Inc. Cationic lipids for intracellular delivery of biologically active molecules
WO1991017424A1 (en) 1990-05-03 1991-11-14 Vical, Inc. Intracellular delivery of biologically active substances by means of self-assembling lipid complexes
US5210015A (en) 1990-08-06 1993-05-11 Hoffman-La Roche Inc. Homogeneous assay system using the nuclease activity of a nucleic acid polymerase
US5173414A (en) 1990-10-30 1992-12-22 Applied Immune Sciences, Inc. Production of recombinant adeno-associated virus vectors
WO1993024641A2 (en) 1992-06-02 1993-12-09 The United States Of America, As Represented By The Secretary, Department Of Health & Human Services Adeno-associated virus with inverted terminal repeat sequences as promoter
US5593972A (en) 1993-01-26 1997-01-14 The Wistar Institute Genetic immunization
WO1996039154A1 (en) 1995-06-06 1996-12-12 Isis Pharmaceuticals, Inc. Oligonucleotides having phosphorothioate linkages of high chiral purity
US20040171156A1 (en) 1995-06-07 2004-09-02 Invitrogen Corporation Recombinational cloning using nucleic acids having recombination sites
WO1997000321A1 (en) 1995-06-14 1997-01-03 Commonwealth Scientific And Industrial Research Organisation Immune response modulators and uses therefor
US5846946A (en) 1996-06-14 1998-12-08 Pasteur Merieux Serums Et Vaccins Compositions and methods for administering Borrelia DNA
US6750059B1 (en) 1998-07-16 2004-06-15 Whatman, Inc. Archiving of vectors
US20070054961A1 (en) 1999-03-31 2007-03-08 Malcolm Maden Factor
US20100317109A1 (en) 1999-03-31 2010-12-16 Malcolm Maden Factor
US6479808B1 (en) 1999-07-07 2002-11-12 The United States Of America As Represented By The Administrator Of The National Aeronautics And Space Administration Method and systems for collecting data from multiple fields of view
US7868149B2 (en) 1999-07-20 2011-01-11 Monsanto Technology Llc Plant genome sequence and uses thereof
US6603061B1 (en) 1999-07-29 2003-08-05 Monsanto Company Agrobacterium-mediated plant transformation method
US20040013648A1 (en) 2000-10-06 2004-01-22 Kingsman Alan John Vector system
US7259015B2 (en) 2000-10-06 2007-08-21 Oxford Biomedia (Uk) Limited Vector system
US20090111106A1 (en) 2000-10-06 2009-04-30 Kyri Mitrophanous Vector System
US20070025970A1 (en) 2000-10-06 2007-02-01 Oxford Biomedica (Uk) Limited Vector system
US7776321B2 (en) 2001-09-26 2010-08-17 Mayo Foundation For Medical Education And Research Mutable vaccines
US20050019923A1 (en) 2001-10-19 2005-01-27 Ijeoma Uchegbu Dendrimers for use in targeted delivery
US20090100536A1 (en) 2001-12-04 2009-04-16 Monsanto Company Transgenic plants with enhanced agronomic traits
US20090007284A1 (en) 2001-12-21 2009-01-01 Philippa Radcliffe Transgenic organism
US7206639B2 (en) 2002-03-15 2007-04-17 Sarcos Investments Lc Cochlear drug delivery system and method
US7901708B2 (en) 2002-06-28 2011-03-08 Protiva Biotherapeutics, Inc. Liposomal apparatus and manufacturing methods
EP1519714A1 (en) 2002-06-28 2005-04-06 Protiva Biotherapeutics Inc. Method and apparatus for producing liposomes
US7351585B2 (en) 2002-09-03 2008-04-01 Oxford Biomedica (Uk) Ltd. Retroviral vector
US7982027B2 (en) 2003-07-16 2011-07-19 Protiva Biotherapeutics, Inc. Lipid encapsulated interfering RNA
US7803397B2 (en) 2003-09-15 2010-09-28 Protiva Biotherapeutics, Inc. Polyethyleneglycol-modified lipid compounds and uses thereof
EP1664316A1 (en) 2003-09-15 2006-06-07 Protiva Biotherapeutics Inc. Polyethyleneglycol-modified lipid compounds and uses thereof
US20060281180A1 (en) 2003-10-30 2006-12-14 Philippa Radcliffe Vectors
US20050287127A1 (en) 2003-11-13 2005-12-29 Huawei Li Use of stem cells to generate inner ear cells
US20060030837A1 (en) 2004-01-29 2006-02-09 The Charles Stark Draper Laboratory, Inc. Drug delivery apparatus
US7799565B2 (en) 2004-06-07 2010-09-21 Protiva Biotherapeutics, Inc. Lipid encapsulated interfering RNA
US7745651B2 (en) 2004-06-07 2010-06-29 Protiva Biotherapeutics, Inc. Cationic lipids and methods of use
EP1766035A1 (en) 2004-06-07 2007-03-28 Protiva Biotherapeutics Inc. Lipid encapsulated interfering rna
EP1781593A2 (en) 2004-06-07 2007-05-09 Protiva Biotherapeutics Inc. Cationic lipids and methods of use
US8454972B2 (en) 2004-07-16 2013-06-04 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Method for inducing a multiclade immune response against HIV utilizing a multigene and multiclade immunogen
US20080267903A1 (en) 2004-10-14 2008-10-30 Ijeoma Uchegbu Bioactive Polymers
US20070093878A1 (en) 2005-09-08 2007-04-26 Albert Edge Cochlear implants containing biological cells and uses thereof
US7838658B2 (en) 2005-10-20 2010-11-23 Ian Maclachlan siRNA silencing of filovirus gene expression
US8101741B2 (en) 2005-11-02 2012-01-24 Protiva Biotherapeutics, Inc. Modified siRNA molecules and uses thereof
US8188263B2 (en) 2005-11-02 2012-05-29 Protiva Biotherapeutics, Inc. Modified siRNA molecules and uses thereof
US20090017543A1 (en) 2005-12-22 2009-01-15 Fraser Wilkes Viral Vectors
US20090222937A1 (en) 2006-02-13 2009-09-03 Cellectis Meganuclease variants cleaving a dna target sequence from a xeroderma pigmentosum gene and uses thereof
US7915399B2 (en) 2006-06-09 2011-03-29 Protiva Biotherapeutics, Inc. Modified siRNA molecules and uses thereof
US20090271881A1 (en) 2006-07-18 2009-10-29 Cellectis Meganuclease variants cleaving a dna target sequence from a rag gene and uses thereof
US20100146651A1 (en) 2006-11-14 2010-06-10 Cellectis Meganuclease variants cleaving a dna target sequence from the hprt gene and uses thereof
US20130236946A1 (en) 2007-06-06 2013-09-12 Cellectis Meganuclease variants cleaving a dna target sequence from the mouse rosa26 locus and uses thereof
US20100229252A1 (en) 2007-07-23 2010-09-09 Cellectis Meganuclease variants cleaving a dna target sequence from the human hemoglobin beta gene and uses thereof
US20110091441A1 (en) 2007-08-03 2011-04-21 Cellectis Meganuclease variants cleaving a dna target sequence from the human interleukin-2 receptor gamma chain gene and uses thereof
US20110230839A1 (en) 2007-08-14 2011-09-22 Fred Hutchinson Cancer Research Center Needle Array Assembly and Method for Delivering Therapeutic Agents
US8404658B2 (en) 2007-12-31 2013-03-26 Nanocor Therapeutics, Inc. RNA interference for the treatment of heart failure
US20120328580A1 (en) 2008-02-07 2012-12-27 Albert Edge Compounds that enhance atoh1 expression
US8058069B2 (en) 2008-04-15 2011-11-15 Protiva Biotherapeutics, Inc. Lipid formulations for nucleic acid delivery
US20110253040A1 (en) 2008-05-08 2011-10-20 Chung Yuan Christian University Apparatus For Forming Composite Membrane With Porous Coating Layer
US20110142917A1 (en) 2008-06-06 2011-06-16 Egvenia Alpert Compositions and methods for treatment of ear disorders
US20110195123A1 (en) 2008-06-30 2011-08-11 Silenseed Ltd. Methods, compositions and systems for local delivery of drugs
US20110117189A1 (en) 2008-07-08 2011-05-19 S.I.F.I. Societa' Industria Farmaceutica Italiana S.P.A. Ophthalmic compositions for treating pathologies of the posterior segment of the eye
US20130202678A1 (en) 2008-07-29 2013-08-08 Academia Sinica Puf-a and related compounds for treatment of retinopathies and sight-threatening ophthalmologic disorders
US20110225664A1 (en) 2008-09-08 2011-09-15 Cellectis Meganuclease variants cleaving a dna target sequence from a glutamine synthetase gene and uses thereof
US20110182867A1 (en) 2008-09-15 2011-07-28 Children's Medical Center Corporation Modulation of bcl11a for treatment of hemoglobinopathies
US20100311124A1 (en) 2008-10-29 2010-12-09 Sangamo Biosciences, Inc. Methods and compositions for inactivating glutamine synthetase gene expression
US20110293703A1 (en) 2008-11-07 2011-12-01 Massachusetts Institute Of Technology Aminoalcohol lipidoids and uses thereof
US20110023144A1 (en) 2008-12-04 2011-01-27 Sigma-Aldrich Co. Genomic editing of genes involved in amyotrophyic lateral sclerosis disease
US20110016540A1 (en) 2008-12-04 2011-01-20 Sigma-Aldrich Co. Genome editing of genes associated with trinucleotide repeat expansion disorders in animals
US20110023146A1 (en) 2008-12-04 2011-01-27 Sigma-Aldrich Co. Genomic editing of genes involved in secretase-associated disorders
US20110023145A1 (en) 2008-12-04 2011-01-27 Sigma-Aldrich Co. Genomic editing of genes involved in autism spectrum disorders
US20110023139A1 (en) 2008-12-04 2011-01-27 Sigma-Aldrich Co. Genomic editing of genes involved in cardiovascular disease
US20110023153A1 (en) 2008-12-04 2011-01-27 Sigma-Aldrich Co. Genomic editing of genes involved in alzheimer's disease
US20120159653A1 (en) 2008-12-04 2012-06-21 Sigma-Aldrich Co. Genomic editing of genes involved in macular degeneration
US20100291048A1 (en) 2009-03-20 2010-11-18 Sangamo Biosciences, Inc. Modification of CXCR4 using engineered zinc finger proteins
US20120164118A1 (en) 2009-05-04 2012-06-28 Fred Hutchinson Cancer Research Center Cocal vesiculovirus envelope pseudotyped retroviral vectors
US8236943B2 (en) 2009-07-01 2012-08-07 Protiva Biotherapeutics, Inc. Compositions and methods for silencing apolipoprotein B
US8283333B2 (en) 2009-07-01 2012-10-09 Protiva Biotherapeutics, Inc. Lipid formulations for nucleic acid delivery
WO2011028929A2 (en) 2009-09-03 2011-03-10 The Regents Of The University Of California Nitrate-responsive promoter
US20110059502A1 (en) 2009-09-07 2011-03-10 Chalasani Sreekanth H Multiple domain proteins
US20110158957A1 (en) 2009-11-10 2011-06-30 Sangamo Biosciences, Inc. Targeted disruption of T cell receptor genes using engineered zinc finger protein nucleases
US20110265198A1 (en) 2010-04-26 2011-10-27 Sangamo Biosciences, Inc. Genome editing of a Rosa locus using nucleases
US20120017290A1 (en) 2010-04-26 2012-01-19 Sigma Aldrich Company Genome editing of a Rosa locus using zinc-finger nucleases
US20130145487A1 (en) 2010-05-12 2013-06-06 Cellectis Meganuclease variants cleaving a dna target sequence from the dystrophin gene and uses thereof
US20130183282A1 (en) 2010-05-12 2013-07-18 Cellectis Meganuclease variants cleaving a DNA target sequence from the rhodopsin gene and uses thereof
US20110293571A1 (en) 2010-05-28 2011-12-01 Oxford Biomedica (Uk) Ltd. Method for vector delivery
US20130302401A1 (en) 2010-08-26 2013-11-14 Massachusetts Institute Of Technology Poly(beta-amino alcohols), their preparation, and uses thereof
US20120204282A1 (en) 2011-02-04 2012-08-09 Sangamo Biosciences, Inc. Methods and compositions for treating occular disorders
US20120251618A1 (en) 2011-03-31 2012-10-04 modeRNA Therapeutics Delivery and formulation of engineered nucleic acids
US20120295960A1 (en) 2011-05-20 2012-11-22 Oxford Biomedica (Uk) Ltd. Treatment regimen for parkinson's disease
US20130171732A1 (en) 2011-10-06 2013-07-04 Sangamo Biosciences, Inc. Methods and compositions for regulating hiv infection
US20130122591A1 (en) 2011-10-27 2013-05-16 The Regents Of The University Of California Methods and compositions for modification of the hprt locus
US20130137104A1 (en) 2011-10-27 2013-05-30 The Regents Of The University Of California Methods and compositions for modification of the hprt locus
US20130244279A1 (en) 2011-12-16 2013-09-19 modeRNA Therapeutics Formulation and delivery of plga microspheres
US20130245107A1 (en) 2011-12-16 2013-09-19 modeRNA Therapeutics Dlin-mc3-dma lipid nanoparticle delivery of modified polynucleotides
US20130252281A1 (en) 2011-12-16 2013-09-26 modeRNA Therapeutics Formulation and delivery of plga microspheres
WO2013126794A1 (en) 2012-02-24 2013-08-29 Fred Hutchinson Cancer Research Center Compositions and methods for the treatment of hemoglobinopathies
WO2013163628A2 (en) 2012-04-27 2013-10-31 Duke University Genetic correction of mutated genes

Non-Patent Citations (274)

* Cited by examiner, † Cited by third party
Title
"METHODS IN ENZYMOLOGY", ACADEMIC PRESS, INC.
"REMINGTON'S PHARMACEUTICAL SCIENCES", 1991, MACK PUB. CO.
A.R. GRUBER ET AL., CELL, vol. 106, no. 1, 2008, pages 23 - 24
ADVANCED DRUG DELIVERY REVIEWS, vol. 64, 2012, pages 1730 - 1737
AHMAD ET AL., CANCER RES., vol. 52, 1992, pages 4817 - 4820
AHMAD, S ET AL., J ROYAL SOC INTERFACE, vol. 7, 2010, pages 423 - 33
AIUTI ET AL., NAT. MED., vol. 8, 2002, pages 423 - 425
AKINC ET AL., NAT. BIOTECH., vol. 26, 2010, pages 561 - 569
ALABI ET AL., PROC NATL ACAD SCI U S A, vol. 110, no. 32, 6 August 2013 (2013-08-06), pages 12881 - 6
ALTSCHUL ET AL., J. MOL. BIOL., 1990, pages 403 - 410
ALVAREZ-ERVITI ET AL., NAT BIOTECHNOL, vol. 29, 2011, pages 341
AMRANN ET AL., GENE, vol. 69, 1988, pages 301 - 315
ANDERSON, SCIENCE, vol. 256, 1992, pages 808 - 813
ATSCHUL ET AL., J. MOL. I3IOL., 1990, pages 403 - 410
AUSUBEL ET AL., SHORT PROTOCOLS IN MOLECULAR BIOLOGY, 1999
AUSUBEL ET AL.: "Short Protocols in Molecular Biology, 4th Ed.", 1999, article "Chapter 18"
BAILEV ET AL., J MOL MED (BERL, vol. 77, no. 1, January 1999 (1999-01-01), pages 244 - 9
BALAGAAN: "J Gene Med", vol. 8, 21 November 2005, WILEY INTERSCIENCE, pages: 275 - 285
BALDDRI ET AL., EMBO J, vol. 6, 1987, pages 229 - 234
BANEIJI ET AL., CELL, vol. 33, 1983, pages 729 - 740
BARTLETT ET AL., PNAS, vol. 104, no. 39, 25 September 2007 (2007-09-25)
BAUER ET AL., SCIENCE, vol. 342, no. 6155, 11 October 2013 (2013-10-11), pages 253 - 257
BEHR ET AL., BIOCONJUGATE CHEM., vol. 5, 1994, pages 382 - 389
BINLEY ET AL., HUMAN GENE THERAPY, vol. 23, September 2012 (2012-09-01), pages 980 - 991
BLAESE ET AL., CANCER GENE THER., vol. 2, 1995, pages 291 - 297
BMLEY ET AL., HUMAN GENE THERAPY, vol. 23, September 2012 (2012-09-01), pages 980 - 991
BORTOLANZA ET AL., MOLECULAR THERAPY, vol. 19, no. 11, November 2011 (2011-11-01), pages 2055 - 2064
BOSHART ET AL., CELL, vol. 41, 1985, pages 521 - 530
BOUDREAU ET AL., MOLECULAR THERAPY, vol. 17, no. 6, June 2009 (2009-06-01)
BOUSSO ET AL., PROC. NATL., ACAD. SCI. USA, vol. 97, 2000, pages 274 - 278
BUCAN ET AL., PLOS GENETICS, vol. 5, 2009, pages E1000536
BUCHSCHER ET AL., J. VIROL., vol. 66, 1992, pages 2731 - 2739
BUNTING ET AL., HUM. GENE THER., vol. 11, 2000, pages 2353 - 2364
BUNTING ET AL., NAT. MED., vol. 4, 1998, pages 58 - 64
BYME; RUDDLE, PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 5473 - 5477
CALAME; EATON, ADV. IMMUNOL., vol. 43, 1988, pages 235 - 275
CAMPES; TILGHMAN, GENES DEV, vol. 3, 1989, pages 537 - 546
CAMPOCHIARO ET AL., HUMAN GENE THERAPY, vol. 17, February 2006 (2006-02-01), pages 167 - 176
CANDOTTI ET AL., BLOOD, vol. 87, 1996, pages 3097 - 3102
CAVAZZANA-CALVO ET AL., ANNU REV. MED., vol. 56, 2005, pages 585 - 602
CAVAZZANA-CALVO ET AL., ANNU. REV MED., vol. 56, 2005, pages 585 - 602
CAVAZZANA-CALVO ET AL., ANNU. REV. MED., vol. 56, 2005, pages 585 - 602
CAVAZZANA-CALVO ET AL., BLOOD, vol. 88, 1996, pages 3901 - 3909
CAVAZZANA-CALVO ET AL., SCIENCE, vol. 288, 2000, pages 669 - 672
CHAN-HUI ET AL., CLINICAL IMMUNOLOGY, vol. 111, 2003, pages 162 - 174
CHEN ET AL., GENE THERAPY, vol. 14, 2007, pages 11 - 19
CHO, S.; GOLDBERG, M.; SON, S.; XU, Q.; YANG, F.; MEI, Y.; BOGATYREV, S.; LANGER. R.; ANDERSON. D.: "Lipid-like nanoparticles for small interfering RNA delivery to endothelial cells", ADVANCED FUNCTIONAL MATERIALS, vol. 19, 2010, pages 3112 - 3118, XP001548633, DOI: doi:10.1002/adfm.200900519
CHOI ET AL., PROC NATL ACAD SCI USA, vol. 110, no. 19, 2013, pages 7625 - 7630
CODON USAGE DATABASE, 9 July 2002 (2002-07-09), Retrieved from the Internet <URL:www.kazusa.orjp/codon>
COELHO ET AL., N ENGL J MED, vol. 369, 2013, pages 819 - 29
CRONICAN ET AL., ACS CHEMICAL BIOLOGY, vol. 5, 2010, pages 747 - 752
CRONICAN ET AL., CHEMISTRY & BIOLOGY, vol. 18, 2011, pages 833 - 838
CRYSTAL, SCIENCE, vol. 270, 1995, pages 404 - 410
CSABA RÉVÉSZ; PETER HAMAR: "Gene Therapy Applications", 2011, article "Delivery Methods to Target RNAs in the Kidney"
CUTLER ET AL., J AM CHEM SOC., vol. 134, 2012, pages 1376 - 1391
CUTLER ET AL., J. AM CHEM SOC., vol. 133, 2011, pages 9254 - 9257
DAVIS ET AL., NATURE, vol. 464, 15 April 2010 (2010-04-15)
DEVEREUX ET AL., NUC. ACIDS RESEARCH, vol. 12, 1984, pages 387
DEVEREUX ET AL., NUCLEIC ACIDS RESEARCH, vol. 12, 1984, pages 387
DIFIGLIA ET AL., PNAS, vol. 104, no. 43, 23 October 2007 (2007-10-23), pages 17204 - 17209
DILLON, TIBTECH, vol. 11, pages 167 - 175
DUMITRACHE ET AL., GENETICS, vol. 188, no. 4, August 2011 (2011-08-01), pages 787 - 797
DUMONCEAUX ET AL., MOLECULAR THERAPY, vol. 18, no. 5, May 2010 (2010-05-01), pages 881 - 887
EDLUND ET AL., SCIENCE, vol. 230, 1985, pages 912 - 916
EI-ANDALOUSSI S ET AL.: "Exosome-mediated delivery of siRNA in vitro and in vivo", NAT PROTOC., vol. 7, no. 12, 15 November 2012 (2012-11-15), pages 2112 - 26, XP055129954, DOI: doi:10.1038/nprot.2012.131
EL-ANDALOUSSI ET AL., NATURE PROTOCOLS, vol. 7, 2012, pages 2112 - 2126
ELIAS I. TRABOULSI,: "Genetic Diseases of the Eye, Second Edition,", 2012, OXFORD UNIVERSITY PRESS
EULALIO ET AL., NATURE, vol. 492, 2012, pages 376
F M AUSUBEL, ET AL. EDS ,: "CURRENT PROTOCOLS IN MOLECULAR BIOLOGY", 1987
FEMS MICROBIOL LETT., vol. 174, no. 2, 1999, pages 247 - 50
FEMS MICROBIOL LETT., vol. 177, no. 1, 1999, pages 187 - 8
FISCHER ET AL., IMMUNOL REV, vol. 203, 2005, pages 98 - 109
FISCHER ET AL., IMMUNOL. REV., vol. 203, 2005, pages 98 - 109
FISCHER ET AL., LMMUNOL REV, vol. 203, 2005, pages 98 - 109
FREITAG ET AL., EUR. CHILD. ADOLESC. PSYCHIATRY, vol. 19, 2010, pages 169 - 178
FTSCHER ET AL., IMMUNOL REV, vol. 203, 2005, pages 98 - 109
GAO ET AL., GENE THERAPY, vol. 2, 1995, pages 710 - 722
GARRETT, N L ET AL., J RAMAN SPECT, vol. 43, no. 5, 2012, pages 681 - 688
GARRETT, N.L. ET AL., J BIOPHOTONICS, vol. 5, no. 5-6, 2012, pages 458 - 68
GASIUNAS ET AL., PROC NATL. ACAD SCI. USA, vol. 109, 2012, pages E2579
GASIUNAS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 109, 2012, pages E2579
GASPAR ET AL., LANCET, vol. 364, 2004, pages 2181 - 2187
GEISBERT ET AL., LANCET, vol. 375, 2010, pages 1896 - 905
GIBLETT ET AL., LANCET, vol. 2, 1972, pages 1067 - 1069
GIULIANO AVANZINI, JEFFREY L. NOEBELS.: "Genetics of Epilepsy and Genetic Epilepsies", 2009, MARIANI FOUNDATION PAEDIATRIC NEUROLOGY, pages: 20
GOEDDEL: "GENE EXPRESS tON TECHNOLOGY: METHODS IN ENZYMOLOGY", vol. 185, 1990, ACADEMIC PRESS
GOEDDEL: "GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY", vol. 185, 1990, ACADEMIC PRESS
GRIMM ET AL., NATURE, vol. 441, 26 May 2006 (2006-05-26)
GRIMM, D. ET AL., J. VIROL., vol. 82, 2008, pages 5887 - 5911
GROENEN ET AL., MOL. MICROBIOL., vol. 10, 1993, pages 1057 - 1065
GRUBER ET AL., NUCLEIC ACIDS RESEARCH, vol. 36, 2008, pages W70
GUSCHIN ET AL., METHODS MOL BIOL, vol. 649, 2010, pages 247
HACEIN-BEY ET AL., BLOOD, vol. 92, 1998, pages 4090 - 4097
HADDADA ET AL.: "Current Topics in Microbiology and Immunology", 1995
HAGSTROM ET AL., MOLECULAR THERAPY, vol. 10, no. 2, August 2004 (2004-08-01)
HAO ET AL., SMALL, vol. 7, 2011, pages 3158 - 3162
HARLOW AND LANE,: "ANTIBODIES, A LABORATORY MANUAL", 1988
HERMONAT; MUZYCZKA, PNAS, vol. 81, 1984, pages 6466 - 6470
HICKERSON ET AL., MOLECULAR THERAPY—NUCLEIC ACIDS, vol. 2, 2013, pages E129
HIGGINS DG; SHARP PM, GENE, vol. 73, no. 1, 1988, pages 237 - 244
HIRSCHHORN ET AL., NAT. GENET., vol. 13, 1996, pages 290 - 295
HOE ET AL., EMERG. INFECT DIS., vol. 5, 1999, pages 254 - 263
HORWELL DC, TRENDS BIOTECHNOL, vol. 13, no. 4, 1995, pages 132 - 134
HSU ET AL., NATURE BIOTECH, 2013
ISHMO ET AL., J BACTENOL, vol. 169, 1987, pages 5429 - 5433
JANSEN ET AL., MOL. MICROBIOL, vol. 43, 2002, pages 1565 - 1575
JANSSEN ET AL., OMICS J. INTEG. BIOL., vol. 6, 2002, pages 23 - 33
JAYARAMAN, ANGEW. CHEM. INT. ED., vol. 51, 2012, pages 8529 - 8533
JENSEN ET AL., SCI TRANS MED, vol. 5, 2013, pages 209RA152
JIANG ET AL., NANO LETT, vol. 13, no. 3, 13 March 2013 (2013-03-13), pages 1059 - 64
JINEK ET AL., SCIENCE, vol. 337, 2012, pages 816
JOHANN ET AL., J. VIROL., vol. 66, 1992, pages 1635 - 1640
JONKERS ET AL., AM. J VET RES, vol. 25, 1964, pages 236 - 242
JONKERS ET AL., AM. J. VET. RES., vol. 25, 1964, pages 236 - 242
JUDGE, J CLIN INVEST, vol. 119, 2009, pages 661 - 673
JUNG ET AL., MOLECULAR THERAPY, vol. 21, no. 4, April 2013 (2013-04-01), pages 834 - 841
KARAGIANNIS ET AL., ACS NANO, vol. 6, no. 10, 23 October 2012 (2012-10-23), pages 8484 - 7
KARGINOV; HANNON: "The CRISPR system: small RNA-guided defence in bacteria and archaea", MOLE CELL, vol. 37, no. 1, 15 January 2010 (2010-01-15), pages 7, XP055016972, DOI: doi:10.1016/j.molcel.2009.12.033
KAUFMAN ET AL., EMBO J, vol. 6, 1987, pages 187 - 195
KESSEL; GRUSS, SCIENCE, vol. 249, 1990, pages 374 - 379
KINOUCHI ET AL., GENE THERAPY, vol. 15, 2008, pages 1126 - 1130
KOTIN, HUMAN GENE THERAPY, vol. 5, 1994, pages 793 - 801
KREMER; PERRICAUDET, BRITISH MEDICAL BULLETIN, vol. 51, no. I, 1995, pages 31 - 44
KUIJAN; HERSKOWITZ, CELL, vol. 30, 1982, pages 933 - 943
LALATSA A. ET AL., MOL PHARM, vol. 9, no. 6, 2012, pages 1665 - 80
LALATSA ET AL., J CONTROL RELEASE, vol. 161, no. 2, 20 July 2012 (2012-07-20), pages 523 - 36
LALATSA, A ET AL., J CONTR REL, vol. 161, no. 2, 2012, pages 523 - 36
LALATSA, A ET AL., MOL PHARM, vol. 9, no. 6, 2012, pages 1764 - 7,4
LAWRENCE ET AL., JOURNAL OF THE AMERICAN CHEMICAL SOCIETY, vol. 129, 2007, pages 10110 - 10112
LEACHMAN ET AL., MOLECULAR THERAPY, vol. 18, no. 2, February 2010 (2010-02-01), pages 442 - 446
LEE ET AL., NAT NANOTECHNOL, vol. 7, no. 6, 3 June 2012 (2012-06-03), pages 389 - 93
LEWIS ET AL., NAT. GEN, vol. 32, 2002, pages 107 - 108
LI ET AL., MOLECULAR THERAPY, vol. 17, no. 12, December 2009 (2009-12-01), pages 2067 - 2077
LI, GENE THERAPY, vol. 19, 2012, pages 775 - 780
LIN-YANGA ET AL., PNAS, vol. 106, no. 10, 10 March 2009 (2009-03-10)
LIVINGSTONE C.D.; BARTON G.J.: "Protein sequence alignments: a strategy for the hierarchical analysis of residue conservation", COMPUT. APPL. BIOSCI., vol. 9, 1993, pages 745 - 756
LUCKLOW; SUMMERS, VIROLOGY, vol. 170, 1989, pages 31 - 39
M. J MACPHERSON, B. D. HAMES AND G. R T AVLOR: "PCR 2: A PRACTICAL APPROACH", 1995
MACCHI ET AL., NATURE, vol. 377, 1995, pages 65 - 68
MAKAROVA ET AL., NAT REV MICROBIOL, vol. 9, 2011, pages 467
MASEPOHL ET AL., BIOCHIM BIOPHYS ACTA, 1996, pages 1307 - 26,30
MAZZA ET AL., ACS NANO, vol. 7, no. 2, 26 February 2013 (2013-02-26), pages 1016 - 26
MAZZA, M. ET AL., ACSNANO, vol. 7, no. 2, 2013, pages 1016 - 1026
MCBRIDE ET AL., MOLECULAR THERAPY, vol. 19, no. 12, December 2011 (2011-12-01), pages 2152 - 2162
MCIVOR EI; POLAK U; NAPIERALA M, RNA BIOL., vol. 7, no. 5, September 2010 (2010-09-01), pages 551 - 8
MCNAUGHTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 106, 2009, pages 6111 - 6116
MICHAEL S D KORMANN ET AL.: "Expression of therapeutic proteins after delivery of chemically modified mRNA in mice", NATURE BIOTECHNOLOGY, vol. 29, 9 January 2011 (2011-01-09), pages 154 - 157, XP055040839, DOI: doi:10.1038/nbt.1733
MILLER ET AL., J. VIROL., vol. 65, 1991, pages 2220 - 2224
MILLER, NATURE, vol. 357, 1992, pages 455 - 460
MILLINGTON-WARD ET AL., MOLECULAR THERAPY, vol. 19, no. 4, April 2011 (2011-04-01), pages 642 - 649
MIRKIN ET AL., SMALL
MITANI; CASKEY, TIBTECH, vol. 11, 1993, pages 162 - 166
MOJICA ET AL., MOL MICROBIOL., vol. 17, 1995, pages 85 - 93
MOJICA ET AL., MOL MICROBIOL., vol. 36, 2000, pages 244 - 246
MOL CELL. BIOL., vol. 8, no. 1, 1988, pages 466 - 472
MOLITORIS ET AL., J AM SOC NEPHROL, vol. 20, 2009, pages 1754 - 1764
MORRELL ET AL.: "Crop genomics:advances and applications", NAT REV GENET, vol. 13, no. 2, 29 December 2011 (2011-12-29), pages 85 - 96
MORRISSEY ET AL., NATURE BIOTECHNOLOGY, vol. 23, no. 8, August 2005 (2005-08-01)
MUKHERJEA ET AL., ANTIOXIDANTS & REDOX SIGNALING, vol. 13, no. 5, 2010
MUKIN, NANOMEDICME, vol. 7, 2012, pages 635 - 638
MUZYCZKA, J., CLIN. INVEST., vol. 94, 1994, pages 1351
NABEL; FELGNER, TIBTECH, vol. 11, 1993, pages 211 - 217
NAKAGAWA ET AL., NAT BIOTECHNOL., vol. 26, 2008, pages 101 - 106
NAKAMURA, Y. ET AL.: "Codon usage tabulated from the international DNA sequence databases: status for the year 2000", NUCL. ACIDS RES., vol. 28, 2000, pages 292, XP002941557, DOI: doi:10.1093/nar/28.1.292
NAKATA ET AL., J. BACTENOL., vol. 171, 1989, pages 3553 - 3556
NISHIKOMORI ET AL., BLOOD, vol. 103, 2004, pages 4565 - 4572
NOGUCHI ET AL., CELL, vol. 73, 1993, pages 147 - 157
NOVOBRANTSEVA, MOLECULAR THERAPY-NUCLEIC ACIDS, vol. 1, 2012, pages E4
OAKES; LIEBERMAN, CLIN ORTHOP RELAT RES, vol. 379, October 2000 (2000-10-01), pages 101 - 12
OKITA ET AL., NATURE, vol. 448, 2007, pages 260 - 262
PA CARR; GM CHURCH, NATURE BIOTECHNOLOGY, vol. 27, no. 12, 2009, pages 1151 - 62
PARDRIDGE ET AL., COLD SPRING HARB PROTOC, 2010
PINKERT ET AL., GENES DEV., vol. 1, 1987, pages 268 - 277
PROC NATL. ACAD. SCI. USA, vol. 78, no. 3, 1981, pages 1527 - 31
QI ET AL., GENE THERAPY, 2013, pages 1 - 9
QU, X, BIOMACROMOLECULES, vol. 7, no. 12, 2006, pages 3452 - 9
QUEEN; BALTIMORE, CELL, vol. 33, 1983, pages 741 - 748
R.I. I FRESHNEY,: "ANIMAL CELL CULTURE", 1987
RAN ET AL., CELL, vol. 154, no. 6, 12 September 2013 (2013-09-12), pages 1380 - 9
REICH ET AL., MOL. VISION., vol. 9, 2003, pages 210 - 216
REJALI ET AL., HEAR RES., vol. 228, no. 1-2, June 2007 (2007-06-01), pages 180 - 7
REMY ET AL., BIOCONJUGATE CHEM., vol. 5, 1994, pages 647 - 654
ROBERT D. WELLS; TETSUO ASHIZAWA: "Genetic Instabilities and Neurological Diseases", 13 October 2011, ACADEMIC PRESS
ROELVINKI ET AL., MOLECULAR THERAPY, vol. 20, no. 9, September 2012 (2012-09-01), pages 1737 - 1749
ROSIN ET AL., MOLECULAR FHERAPY, vol. 19, no. 12, December 2011 (2011-12-01), pages 1286 - 2200
ROSIN ET AL., MOLECULAR THERAPY, vol. 19, no. 12, December 2011 (2011-12-01), pages 1286 - 2200
ROZEMA ET AL., PNAS, vol. 104, no. 32, 7 August 2007 (2007-08-07)
SALT; PLONTKE, DRUG DISCOVERY TODAY, vol. 10, 2005, pages 1299 - 1306
SAMBROOK ET AL.: "MOLECULAR CLONING A LABORATORY MANUAL 2nd ed ,", 1989, COLD SPRING HARBOR LABORATORY PRESS
SAMBROOK ET AL.: "Nonradioactive In Situ Hybridization Application Manual", 1989
SAMBROOK; FNTSCH; MANIATIS: "MOLECULAR CLONING; A I LABORATORY MANUAL 2nd edition", 1989
SAMULSKI ET AL., J. VIROL., vol. 63, 1989, pages 03822 - 3828
SAPRANAUSAKS ET AL., NUCLEIC ACIDS RESCH, vol. 39, 2011, pages 9275
SAPRANAUSKAS ET AL., NUCLEIC ACIS RESEARCH, vol. 39, 2011, pages 9275
SATO ET AL., NATURE BIOTECHNOLOGY, vol. 26, no. 4, April 2008 (2008-04-01), pages 431 - 442
SCHIFFELERS ET AL., NUCLEIC ACIDS RESEARCH, vol. 32, no. 19, 2004
SCHROEDER, A.; LEVINS, C.; CORTEZ, C.; LANGER, R.; ANDERSON, D.: "Lipid-based nanotherapeutics for siRNA delivery", JOURNAL OF INTERNAL MEDICINE, vol. 267, 2010, pages 9 - 21
SCHRUM ET AL., DELIVERY AND FORMULATION OF ENGINEERED NUCLEIC ACIDS
SCHULTZ ET AL., GENE, vol. 54, 1987, pages 113 - 123
SCHWANK, CELL STEM CELL, vol. 13, 2013, pages 653 - 58
SEED, NATURE, 1987, pages 329 840
SEMPLE ET AL., NATURE NIOTECHNOLOGY, vol. 28, no. 2, February 2010 (2010-02-01), pages 172 - 177
SHALEK ET AL., NANO LETTERS, 2012
SHEN ET AL., FEBS LET, vol. 539, 2003, pages 111 - 114
SHIMIZU ET AL., J AM SOC NEPHROL, vol. 21, 2010, pages 622 - 633
SIEW, A ET AL., MOL PHARM, vol. 9, no. 1, 2012, pages 14 - 28
SIMEONI ET AL., NAR, vol. 31, no. 11, 2003, pages 2717 - 2724
SIMON RJ ET AL., PNAS, vol. 89, no. 20, 1992, pages 9167 - 9371
SMITH ET AL., MOL CELL BIOL., vol. 3, 1983, pages 2156 - 2165
SMITH; JOHNSON: "Gene", vol. 67, 1988, PHARMACIA BIOTECH INC, pages: 31 - 40
SOMASUNTHARAM ET AL., BIOMATERIALS, vol. 34, 2013, pages 7790
SOMMNERFELT ET AL., VIROL., vol. 176, 1990, pages 58 - 59
SORENSEN ET AL., J MOL. BIOL., vol. 327, 2003, pages 761 - 766
SOUDAIS ET AL., BLOOD, vol. 95, 2000, pages 3071 - 3077
SPUCH; NAVARRO, JOURNAL OF DRUG DELIVERY, vol. 2011, 2011, pages 12
STEPHAN ET AL., N. ENGL. J. MED., vol. 335, 1996, pages 1563 - 1567
STILES ET AL., EXPERIMENTAL NEUROLOGY, vol. 233, 2012, pages 463 - 471
STUDIER ET AL.: "GENE EXPRESSION TECHNOLOGY METHODS IN ENZYMOLOGY", vol. 185, 1990, ACADEMIC PRESS, pages: 60 - 89
SU X; FRICKE J; KAVANAGH DG; IRVINE DJ: "In vitro and in vivo mRNA delivery using lipid-enveloped pH-responsive polymer nanoparticles", MOL I'HARM., vol. 8, no. 3, 1 April 2011 (2011-04-01), pages 774 - 87, XP055127583, DOI: doi:10.1021/mp100390w
TABEMERO ET AL., CANCER DISCOVERY, vol. 3, no. 4, April 2013 (2013-04-01), pages 363 - 470
TAKAHASHI ET AL., CELL, vol. 131, no. 5, 2007, pages 861 - 872
TAKAHASHI; YAMANAKA, CELL, vol. 126, 2006, pages 663 - 76
TANGRI S ET AL.: "Rationally engineered therapeutic proteins with reduced immunogenicity", J IMMUNOL., vol. 174, no. 6, 15 March 2005 (2005-03-15), pages 3187 - 96
TAYLOR ET AL., BLOOD, vol. 87, 1996, pages 3103 - 3107
TAYLOR W.R.: "I'he classification of amino acid conservation", J. THEOR. BIOL., vol. 119, 1986, pages 205 - 218, XP055050432, DOI: doi:10.1016/S0022-5193(86)80075-3
THOMPSON ET AL., METHODS IN ENZYMOLOGY, vol. 503, 2012, pages 293 - 319
THOMPSON ET AL., NUCLEIC ACID THERAPEUTICS, vol. 22, no. 4, 2012
THOMPSON, D.B., CHEMISTRY & BIOLOGY, vol. 19, no. 7, 2012, pages 831 - 843
TIJSSEN: "Laboratory Techniques In Biochemistry And Molecular Biology Hybridization With Nucleic Acid Probes", 1993, ELSEVIER, article "Overview of principles of hybridization and the strategy of nucleic acid probe assay"
TOLENTMO ET AL., RETINA, vol. 24, no. 4, pages 660
TRATSCHIN ET AL., MOL CELL. BIOL., vol. 4, 1984, pages 2072 - 2081
TRATSCHIN ET AL., MOL. CELL. BIOL., vol. 5, 1985, pages 3251 - 3260
TRAVASSOS DA ROSA ET AL., AM. J. TROPICAL MED. & HYGIENE, vol. 33, 1984, pages 999 - 1006
TREMBLAY ET AL.: "Transcription Activator-Like Effector Proteins Induce the Expression of the Frataxin Gene", HUMAN GENE THERAPY, vol. 23, no. 8, August 2012 (2012-08-01), pages 883 - 890, XP055069316, DOI: doi:10.1089/hum.2012.034
TSAI ET AL., BLOOD, vol. 100, 2002, pages 72 - 79
UCHEGBU, I.F. ET AL., INT J PHARM, vol. 224, 2001, pages 185 - 199
UCHEGBU, IF, EXPERT OPM DRUG DELIV, vol. 3, no. 5, 2006, pages 629 - 40
UCHEGBU; SLEW, J PHARM SCI., vol. 102, no. 2, 2013, pages 305 - 10
UNO ET AL., HUMAN GENE THERAPY, vol. 22, June 2011 (2011-06-01), pages 711 - 719
VAN BMNT, BIOTECHNOLOGY, vol. 6, no. 10, 1988, pages 1149 - 1154
VAN EMBDEN ET AL., J BACTERIOL, vol. 182, 2000, pages 2393 - 2401
VIGNE, RESTORATIVE NEUROLOGY AND NEUROSCIENCE, vol. 8, 1995, pages 35 - 36
WADA ET AL., PROC. NATL. ACAD. SCI. USA, vol. 98, 2001, pages 8697 - 8702
WAHLGREN ET AL., NUCLEIC ACIDS RESEARCH, vol. 40, no. 17, 2012, pages EL 30
WAHLGREN ET AL., NUCLEIC ACIDS RESEARCH, vol. 40, no. 17, 2012, pages EL30
WARING ET AL., ARCH. NEUROL., vol. 65, 2008, pages 329 - 334
WEINTRAUB, NATURE, vol. 495, 2013, pages S14 - S16
WEST ET AL., VIROLOGY, vol. 160, 1987, pages 38 - 47
WHITEHEAD ET AL., ACS NANO, vol. 6, no. 8, 28 August 2012 (2012-08-28), pages 6922 - 9
WILSON ET AL., J VIIOL., vol. 63, 1989, pages 2374 - 2378
WMOTO; BALTIMORE, EMBO J, vol. 8, 1989, pages 729 - 733
WOODDELL ET AL., MOLECULAR THERAPY, vol. 21, no. 5, May 2013 (2013-05-01), pages 973 - 985
WU, CELL STEM CELL, vol. 13, 2013, pages 659 - 62
XIA CF; BOADO RJ; PARDRIDGE WM: "Antibody-mediated targeting of siRNA via the human insulin receptor usmg avidin-biotin technology", MOL PHARM, vol. 6, no. 3, May 2009 (2009-05-01), pages 747 - 51, XP055088899, DOI: doi:10.1021/mp800194y
XIA ET AL., NAT.BIOTECH, vol. 20, 2002, pages 1006 - 1010
XIA ET AL., NATURE MEDICINE, vol. 10, no. 8, August 2004 (2004-08-01)
XU ET AL., SCIENCE, vol. 334, no. 6058, 18 November 2011 (2011-11-18), pages 993 - 996
YATES ET AL., BLOOD, vol. 100, 2002, pages 3942 - 3949
YOUNG ET AL., NANO LETT, vol. 12, 2012, pages 3867 - 71
YU ET AL., CELL, vol. 150, 31 August 2012 (2012-08-31), pages 895 - 908
YU ET AL., GENE THERAPY, vol. 1, 1994, pages 13 - 26
YU J. ET AL., SCIENCE, vol. 318, no. 5958, 2007, pages 1917 - 1920
YUAN, AM J PHYSIOL RENAL PHYSIOL, vol. 295, 2008, pages F605 - F617
ZAEHRES; SCHOLER, CELL, vol. 131, no. 5, 2007, pages 834 - 835
ZAMORA ET AL., AM J RESPIR CRIT CARE MED, vol. 183, 2011, pages 531 - 538
ZHANG ET AL., ACS NANO, vol. 5, 2011, pages 6962 - 6970
ZHANG ET AL., ADV MATER, vol. 25, no. 33, 6 September 2013 (2013-09-06), pages 4641 - 5
ZHANG ET AL., J AM CHEM SOC., vol. 134, 2012, pages 16488 - 1691
ZHANG ET AL., MOL THER., vol. 7, no. 1, January 2003 (2003-01-01), pages 11 - 8
ZHENG ET AL., PNAS, vol. 109, no. 30, 24 July 2012 (2012-07-24), pages 11975 - 11980
ZHENG ET AL., PROC NATL ACAD SCI USA, vol. 109, 2012, pages 11975 - 80
ZIMMERMAN ET AL., NATURE LETTERS, vol. 441, 4 May 2006 (2006-05-04)
ZOU ET AL., HUMAN GENE THERAPY, vol. 22, April 2011 (2011-04-01), pages 465 - 475
ZUKER; STIEGLER, NUCLEIC ACIDS RES., vol. 9, 1981, pages 133 - 148

Cited By (1109)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10064398B2 (en) 2009-07-08 2018-09-04 Kymab Limited Animal models and therapeutic molecules
US10165763B2 (en) 2009-07-08 2019-01-01 Kymab Limited Animal models and therapeutic molecules
US9434782B2 (en) 2009-07-08 2016-09-06 Kymab Limited Animal models and therapeutic molecules
US9447177B2 (en) 2009-07-08 2016-09-20 Kymab Limited Transgenic mouse homozygous for chimeric IgH locus
US11606941B2 (en) 2009-07-08 2023-03-21 Kymab Limited Animal models and therapeutic molecules
US9505827B2 (en) 2009-07-08 2016-11-29 Kymab Limited Animal models and therapeutic molecules
US9504236B2 (en) 2009-07-08 2016-11-29 Kymab Limited Animal models and therapeutic molecules
US11564380B2 (en) 2009-07-08 2023-01-31 Kymab Limited Animal models and therapeutic molecules
US11812731B2 (en) 2009-07-08 2023-11-14 Kymab Ltd. Animal models and therapeutic molecules
US12258584B2 (en) 2010-05-06 2025-03-25 Children's Hospital Medical Center Methods and systems for converting precursor cells into intestinal tissues through directed differentiation
US11911474B2 (en) 2011-03-31 2024-02-27 Modernatx, Inc. Delivery and formulation of engineered nucleic acids
US12409226B2 (en) 2011-03-31 2025-09-09 Modernatx, Inc. Delivery and formulation of engineered nucleic acids
US10898574B2 (en) 2011-03-31 2021-01-26 Modernatx, Inc. Delivery and formulation of engineered nucleic acids
US12364763B2 (en) 2011-03-31 2025-07-22 Modernatx, Inc. Delivery and formulation of engineered nucleic acids
US12419957B2 (en) 2011-03-31 2025-09-23 Modernatx, Inc. Delivery and formulation of engineered nucleic acids
US12502431B2 (en) 2011-03-31 2025-12-23 Modernatx, Inc. Delivery and formulation of engineered nucleic acids
US12006520B2 (en) 2011-07-22 2024-06-11 President And Fellows Of Harvard College Evaluation and improvement of nuclease cleavage specificity
US9322006B2 (en) 2011-07-22 2016-04-26 President And Fellows Of Harvard College Evaluation and improvement of nuclease cleavage specificity
US10323236B2 (en) 2011-07-22 2019-06-18 President And Fellows Of Harvard College Evaluation and improvement of nuclease cleavage specificity
US11051497B2 (en) 2011-09-19 2021-07-06 Kymab Limited Manipulation of immunoglobulin gene diversity and multi-antibody therapeutics
US9963716B2 (en) 2011-09-26 2018-05-08 Kymab Limited Chimaeric surrogate light chains (SLC) comprising human VpreB
US11266698B2 (en) 2011-10-07 2022-03-08 4D Pharma Research Limited Bacterium for use as a probiotic for nutritional and medical applications
US12467086B2 (en) 2011-10-14 2025-11-11 President And Fellows Of Harvard College Sequencing by structure assembly
US11976318B2 (en) 2011-12-22 2024-05-07 President And Fellows Of Harvard College Compositions and methods for analyte detection
US11549136B2 (en) 2011-12-22 2023-01-10 President And Fellows Of Harvard College Compositions and methods for analyte detection
US11639518B2 (en) 2011-12-22 2023-05-02 President And Fellows Of Harvard College Compositions and methods for analyte detection
US11293051B2 (en) 2011-12-22 2022-04-05 President And Fellows Of Harvard College Compositions and methods for analyte detection
US11566277B2 (en) 2011-12-22 2023-01-31 President And Fellows Of Harvard College Compositions and methods for analyte detection
US11111521B2 (en) 2011-12-22 2021-09-07 President And Fellows Of Harvard College Compositions and methods for analyte detection
US11566276B2 (en) 2011-12-22 2023-01-31 President And Fellows Of Harvard College Compositions and methods for analyte detection
US11293052B2 (en) 2011-12-22 2022-04-05 President And Fellows Of Harvard College Compositions and methods for analyte detection
US9885026B2 (en) 2011-12-30 2018-02-06 Caribou Biosciences, Inc. Modified cascade ribonucleoproteins and uses thereof
US10711257B2 (en) 2011-12-30 2020-07-14 Caribou Biosciences, Inc. Modified cascade ribonucleoproteins and uses thereof
US10954498B2 (en) 2011-12-30 2021-03-23 Caribou Biosciences, Inc. Modified cascade ribonucleoproteins and uses thereof
US11939604B2 (en) 2011-12-30 2024-03-26 Caribou Biosciences, Inc. Modified cascade ribonucleoproteins and uses thereof
US10435678B2 (en) 2011-12-30 2019-10-08 Caribou Biosciences, Inc. Modified cascade ribonucleoproteins and uses thereof
US10844378B2 (en) 2012-03-20 2020-11-24 Vilnius University RNA-directed DNA cleavage by the Cas9-crRNA complex
EP2828386B1 (en) * 2012-03-20 2019-07-10 Vilnius University RNA-DIRECTED DNA CLEAVAGE BY THE Cas9-crRNA COMPLEX
US11555187B2 (en) 2012-03-20 2023-01-17 Vilnius University RNA-directed DNA cleavage by the Cas9-crRNA complex
US9637739B2 (en) 2012-03-20 2017-05-02 Vilnius University RNA-directed DNA cleavage by the Cas9-crRNA complex
EP2828386A1 (en) 2012-03-20 2015-01-28 Vilnius University RNA-DIRECTED DNA CLEAVAGE BY THE Cas9-crRNA COMPLEX
EP3594341A1 (en) * 2012-03-20 2020-01-15 Vilnius University Rna-directed dna cleavage by the cas9-crrna complex
US9938358B2 (en) 2012-03-28 2018-04-10 Kymab Limited Animal models and therapeutic molecules
US10774155B2 (en) 2012-03-28 2020-09-15 Kymab Limited Animal models and therapeutic molecules
US9938357B2 (en) 2012-03-28 2018-04-10 Kymab Limited Animal models and therapeutic molecules
US10251377B2 (en) 2012-03-28 2019-04-09 Kymab Limited Transgenic non-human vertebrate for the expression of class-switched, fully human, antibodies
US9924705B2 (en) 2012-03-28 2018-03-27 Kymab Limited Animal models and therapeutic molecules
US11297811B2 (en) 2012-03-28 2022-04-12 Kymab Limited Transgenic non-human vertebrate for the expression of class-switched, fully human, antibodies
US9896516B2 (en) 2012-03-28 2018-02-20 Kymab Limited Animal models and therapeutic molecules
US9834786B2 (en) 2012-04-25 2017-12-05 Regeneron Pharmaceuticals, Inc. Nuclease-mediated targeting with large targeting vectors
US10301646B2 (en) 2012-04-25 2019-05-28 Regeneron Pharmaceuticals, Inc. Nuclease-mediated targeting with large targeting vectors
US11976307B2 (en) 2012-04-27 2024-05-07 Duke University Genetic correction of mutated genes
US20210040460A1 (en) 2012-04-27 2021-02-11 Duke University Genetic correction of mutated genes
US10667501B2 (en) 2012-05-17 2020-06-02 Kymab Limited Transgenic non-human vertebrate for the in vivo production of dual specificity immunoglobulins or hypermutated heavy chain only immunoglobulins
US10519467B2 (en) 2012-05-25 2019-12-31 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10351878B2 (en) 2012-05-25 2019-07-16 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10669560B2 (en) 2012-05-25 2020-06-02 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11814645B2 (en) 2012-05-25 2023-11-14 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11293034B2 (en) 2012-05-25 2022-04-05 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10676759B2 (en) 2012-05-25 2020-06-09 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10227611B2 (en) 2012-05-25 2019-03-12 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10113167B2 (en) 2012-05-25 2018-10-30 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
EP3401400B1 (en) 2012-05-25 2019-04-03 The Regents of The University of California Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription
US11274318B2 (en) 2012-05-25 2022-03-15 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
EP3597749B1 (en) 2012-05-25 2023-07-26 The Regents of The University of California Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription
US10640791B2 (en) 2012-05-25 2020-05-05 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10982230B2 (en) 2012-05-25 2021-04-20 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10982231B2 (en) 2012-05-25 2021-04-20 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10626419B2 (en) 2012-05-25 2020-04-21 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10266850B2 (en) 2012-05-25 2019-04-23 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11970711B2 (en) 2012-05-25 2024-04-30 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11332761B2 (en) 2012-05-25 2022-05-17 The Regenis of Wie University of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10988780B2 (en) 2012-05-25 2021-04-27 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10612045B2 (en) 2012-05-25 2020-04-07 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10988782B2 (en) 2012-05-25 2021-04-27 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11001863B2 (en) 2012-05-25 2021-05-11 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10597680B2 (en) 2012-05-25 2020-03-24 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10752920B2 (en) 2012-05-25 2020-08-25 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10301651B2 (en) 2012-05-25 2019-05-28 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10577631B2 (en) 2012-05-25 2020-03-03 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11401532B2 (en) 2012-05-25 2022-08-02 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10570419B2 (en) 2012-05-25 2020-02-25 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10563227B2 (en) 2012-05-25 2020-02-18 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10308961B2 (en) 2012-05-25 2019-06-04 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10550407B2 (en) 2012-05-25 2020-02-04 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10000772B2 (en) 2012-05-25 2018-06-19 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11674159B2 (en) 2012-05-25 2023-06-13 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10337029B2 (en) 2012-05-25 2019-07-02 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10900054B2 (en) 2012-05-25 2021-01-26 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10774344B1 (en) 2012-05-25 2020-09-15 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10533190B2 (en) 2012-05-25 2020-01-14 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10526619B2 (en) 2012-05-25 2020-01-07 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11008590B2 (en) 2012-05-25 2021-05-18 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11473108B2 (en) 2012-05-25 2022-10-18 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11479794B2 (en) 2012-05-25 2022-10-25 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10358658B2 (en) 2012-05-25 2019-07-23 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11008589B2 (en) 2012-05-25 2021-05-18 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
EP2800811B1 (en) 2012-05-25 2017-05-10 The Regents of The University of California Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription
US11242543B2 (en) 2012-05-25 2022-02-08 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10513712B2 (en) 2012-05-25 2019-12-24 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10358659B2 (en) 2012-05-25 2019-07-23 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11028412B2 (en) 2012-05-25 2021-06-08 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US12123015B2 (en) 2012-05-25 2024-10-22 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11186849B2 (en) 2012-05-25 2021-11-30 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11634730B2 (en) 2012-05-25 2023-04-25 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10487341B2 (en) 2012-05-25 2019-11-26 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US12180504B2 (en) 2012-05-25 2024-12-31 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US12180503B2 (en) 2012-05-25 2024-12-31 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10385360B2 (en) 2012-05-25 2019-08-20 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11549127B2 (en) 2012-05-25 2023-01-10 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10793878B1 (en) 2012-05-25 2020-10-06 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10400253B2 (en) 2012-05-25 2019-09-03 The Regents Of The University Of California Methods and compositions or RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10407697B2 (en) 2012-05-25 2019-09-10 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10415061B2 (en) 2012-05-25 2019-09-17 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US12215343B2 (en) 2012-05-25 2025-02-04 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10421980B2 (en) 2012-05-25 2019-09-24 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10428352B2 (en) 2012-05-25 2019-10-01 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US10443076B2 (en) 2012-05-25 2019-10-15 The Regents Of The University Of California Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US11040115B2 (en) 2012-07-11 2021-06-22 Sangamo Therapeutics, Inc. Method for the treatment of lysosomal storage diseases
US9956247B2 (en) 2012-07-11 2018-05-01 Sangamo Therapeutics, Inc. Method of treating lysosomal storage diseases
US11898158B2 (en) 2012-07-11 2024-02-13 Sangamo Therapeutics, Inc. Methods and compositions for the treatment of lysosomal storage diseases
US9877988B2 (en) 2012-07-11 2018-01-30 Sangamo Therapeutics, Inc. Method of treating lysosomal storage diseases using nucleases and a transgene
US10293000B2 (en) 2012-07-11 2019-05-21 Sangamo Therapeutics, Inc. Methods and compositions for the treatment of lysosomal storage diseases
US10851380B2 (en) 2012-10-23 2020-12-01 Toolgen Incorporated Methods for cleaving a target DNA using a guide RNA specific for the target DNA and Cas protein-encoding nucleic acid or Cas protein
US12473559B2 (en) 2012-10-23 2025-11-18 Toolgen Incorporated Cas9/RNA complexes for inducing modifications of target endogenous nucleic acid sequences in nucleuses of eukaryotic cells
EP3363902B1 (en) 2012-12-06 2019-11-27 Sigma Aldrich Co. LLC Crispr-based genome modification and regulation
US10731181B2 (en) 2012-12-06 2020-08-04 Sigma, Aldrich Co. LLC CRISPR-based genome modification and regulation
US10745716B2 (en) 2012-12-06 2020-08-18 Sigma-Aldrich Co. Llc CRISPR-based genome modification and regulation
EP2928496B1 (en) 2012-12-06 2019-10-09 Sigma Aldrich Co. LLC Crispr-based genome modification and regulation
EP3360964B1 (en) 2012-12-06 2019-10-02 Sigma Aldrich Co. LLC Crispr-based genome modification and regulation
EP2931898B1 (en) 2012-12-12 2016-03-09 The Broad Institute, Inc. Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains
EP2825654B1 (en) 2012-12-12 2017-04-26 The Broad Institute, Inc. Crispr-cas component systems, methods and compositions for sequence manipulation
US9840713B2 (en) 2012-12-12 2017-12-12 The Broad Institute Inc. CRISPR-Cas component systems, methods and compositions for sequence manipulation
EP2898075B1 (en) 2012-12-12 2016-03-09 The Broad Institute, Inc. Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation
US9822372B2 (en) 2012-12-12 2017-11-21 The Broad Institute Inc. CRISPR-Cas component systems, methods and compositions for sequence manipulation
EP2764103B1 (en) 2012-12-12 2015-08-19 The Broad Institute, Inc. Crispr-cas systems and methods for altering expression of gene products
EP2896697B1 (en) 2012-12-12 2015-09-02 The Broad Institute, Inc. Engineering of systems, methods and optimized guide compositions for sequence manipulation
US10930367B2 (en) 2012-12-12 2021-02-23 The Broad Institute, Inc. Methods, models, systems, and apparatus for identifying target sequences for Cas enzymes or CRISPR-Cas systems for target sequences and conveying results thereof
EP2840140B1 (en) 2012-12-12 2016-11-16 The Broad Institute, Inc. Crispr-Cas component systems, methods and compositions for sequence manipulation
EP2931897B1 (en) 2012-12-12 2017-11-01 The Broad Institute, Inc. Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
EP2921557B1 (en) 2012-12-12 2016-07-13 The Broad Institute, Inc. Engineering of systems, methods and optimized guide compositions for sequence manipulation
US11041173B2 (en) 2012-12-12 2021-06-22 The Broad Institute, Inc. Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
US12252707B2 (en) 2012-12-12 2025-03-18 The Broad Institute, Inc. Delivery, Engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
US12454687B2 (en) 2012-12-12 2025-10-28 The Broad Institute, Inc. Functional genomics using CRISPR-Cas systems, compositions, methods, knock out libraries and applications thereof
EP3327127B1 (en) 2012-12-12 2021-03-24 The Broad Institute, Inc. Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
EP2931891B1 (en) 2012-12-17 2019-05-15 President and Fellows of Harvard College Rna-guided human genome engineering
US10717990B2 (en) 2012-12-17 2020-07-21 President And Fellows Of Harvard College RNA-guided human genome engineering
US11365429B2 (en) 2012-12-17 2022-06-21 President And Fellows Of Harvard College RNA-guided human genome engineering
US11359211B2 (en) 2012-12-17 2022-06-14 President And Fellows Of Harvard College RNA-guided human genome engineering
US11236359B2 (en) 2012-12-17 2022-02-01 President And Fellows Of Harvard College RNA-guided human genome engineering
EP4481048A3 (en) * 2012-12-17 2025-02-26 President and Fellows of Harvard College Rna-guided human genome engineering
EP4282970A3 (en) * 2012-12-17 2024-01-17 President and Fellows of Harvard College Rna-guided human genome engineering
US10435708B2 (en) 2012-12-17 2019-10-08 President And Fellows Of Harvard College RNA-guided human genome engineering
US11535863B2 (en) 2012-12-17 2022-12-27 President And Fellows Of Harvard College RNA-guided human genome engineering
US12018272B2 (en) 2012-12-17 2024-06-25 President And Fellows Of Harvard College RNA-guided human genome engineering
US11512325B2 (en) 2012-12-17 2022-11-29 President And Fellows Of Harvard College RNA-guided human genome engineering
US11299767B2 (en) 2013-03-12 2022-04-12 President And Fellows Of Harvard College Method for generating a three-dimensional nucleic acid containing matrix
US12264358B2 (en) 2013-03-12 2025-04-01 President And Fellows Of Harvard College Method of selectively sequencing amplicons in a biological sample
US10125361B2 (en) 2013-03-14 2018-11-13 Caribou Biosciences, Inc. Compositions and methods of nucleic acid-targeting nucleic acids
US11312953B2 (en) 2013-03-14 2022-04-26 Caribou Biosciences, Inc. Compositions and methods of nucleic acid-targeting nucleic acids
US9803194B2 (en) 2013-03-14 2017-10-31 Caribou Biosciences, Inc. Compositions and methods of nucleic acid-targeting nucleic acids
US9410198B2 (en) 2013-03-14 2016-08-09 Caribou Biosciences, Inc. Compostions and methods of nucleic acid-targeting nucleic acids
US9809814B1 (en) 2013-03-14 2017-11-07 Caribou Biosciences, Inc. Compositions and methods of nucleic acid-targeting nucleic acids
US9909122B2 (en) 2013-03-14 2018-03-06 Caribou Biosciences, Inc. Compositions and methods of nucleic acid-targeting nucleic acids
US9260752B1 (en) 2013-03-14 2016-02-16 Caribou Biosciences, Inc. Compositions and methods of nucleic acid-targeting nucleic acids
US9725714B2 (en) 2013-03-14 2017-08-08 Caribou Biosciences, Inc. Compositions and methods of nucleic acid-targeting nucleic acids
US10844403B2 (en) 2013-03-15 2020-11-24 The General Hospital Corporation Increasing specificity for RNA-guided genome editing
US9234213B2 (en) 2013-03-15 2016-01-12 System Biosciences, Llc Compositions and methods directed to CRISPR/Cas genomic engineering systems
JP2020031637A (en) * 2013-03-15 2020-03-05 ザ ジェネラル ホスピタル コーポレイション Rna-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci
US10544433B2 (en) 2013-03-15 2020-01-28 The General Hospital Corporation Using RNA-guided FokI nucleases (RFNs) to increase specificity for RNA-guided genome editing
US9738908B2 (en) 2013-03-15 2017-08-22 System Biosciences, Llc CRISPR/Cas systems for genomic modification and gene modulation
US11377470B2 (en) 2013-03-15 2022-07-05 Modernatx, Inc. Ribonucleic acid purification
US11098326B2 (en) 2013-03-15 2021-08-24 The General Hospital Corporation Using RNA-guided FokI nucleases (RFNs) to increase specificity for RNA-guided genome editing
JP2024012446A (en) * 2013-03-15 2024-01-30 ザ ジェネラル ホスピタル コーポレイション Increasing specificity of RNA-guided genome editing using truncated guide RNA (tru-gRNA)
US11845772B2 (en) 2013-03-15 2023-12-19 Modernatx, Inc. Ribonucleic acid purification
US10202619B2 (en) 2013-03-15 2019-02-12 System Biosciences, Llc Compositions and methods directed to CRISPR/Cas genomic engineering systems
US10760064B2 (en) 2013-03-15 2020-09-01 The General Hospital Corporation RNA-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci
US10858647B2 (en) 2013-03-15 2020-12-08 Modernatx, Inc. Removal of DNA fragments in mRNA production process
US11168338B2 (en) 2013-03-15 2021-11-09 The General Hospital Corporation RNA-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci
US11634731B2 (en) 2013-03-15 2023-04-25 The General Hospital Corporation Using truncated guide RNAs (tru-gRNAs) to increase specificity for RNA-guided genome editing
JP2016512264A (en) * 2013-03-15 2016-04-25 ザ ジェネラル ホスピタル コーポレイション RNA-induced targeting of genomic and epigenomic regulatory proteins to specific genomic loci
US11920152B2 (en) 2013-03-15 2024-03-05 The General Hospital Corporation Increasing specificity for RNA-guided genome editing
US12065668B2 (en) 2013-03-15 2024-08-20 The General Hospital Corporation RNA-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci
US11297810B2 (en) 2013-03-18 2022-04-12 Kymab Limited Animal models and therapeutic molecules
US9788534B2 (en) 2013-03-18 2017-10-17 Kymab Limited Animal models and therapeutic molecules
US10226033B2 (en) 2013-03-18 2019-03-12 Kymab Limited Animal models and therapeutic molecules
US12215345B2 (en) 2013-03-19 2025-02-04 Duke University Compositions and methods for the induction and tuning of gene expression
JP2019198329A (en) * 2013-04-04 2019-11-21 トラスティーズ・オブ・ダートマス・カレッジ Compositions and methods for in vivo excision of HIV-1 proviral DNA
US11274305B2 (en) 2013-04-04 2022-03-15 Trustees Of Dartmouth College Compositions and methods for in vivo excision of HIV-1 proviral DNA
JP2016514479A (en) * 2013-04-04 2016-05-23 トラスティーズ・オブ・ダートマス・カレッジ Compositions and methods for in vivo excision of HIV-1 proviral DNA
US9822370B2 (en) 2013-04-04 2017-11-21 President And Fellows Of Harvard College Method of making a deletion in a target sequence in isolated primary cells using Cas9 and two guide RNAs
US11414463B2 (en) 2013-04-10 2022-08-16 4D Pharma Research Limited Polypeptide and immune modulation
US10851137B2 (en) 2013-04-10 2020-12-01 4D Pharma Research Limited Polypeptide and immune modulation
US10975390B2 (en) 2013-04-16 2021-04-13 Regeneron Pharmaceuticals, Inc. Targeted modification of rat genome
US12037596B2 (en) 2013-04-16 2024-07-16 Regeneron Pharmaceuticals, Inc. Targeted modification of rat genome
US10385359B2 (en) 2013-04-16 2019-08-20 Regeneron Pharmaceuticals, Inc. Targeted modification of rat genome
US9783618B2 (en) 2013-05-01 2017-10-10 Kymab Limited Manipulation of immunoglobulin gene diversity and multi-antibody therapeutics
US9783593B2 (en) 2013-05-02 2017-10-10 Kymab Limited Antibodies, variable domains and chains tailored for human use
US10730930B2 (en) 2013-05-02 2020-08-04 Kymab Limited Antibodies, variable domains and chains tailored for human use
US11707056B2 (en) 2013-05-02 2023-07-25 Kymab Limited Animals, repertoires and methods
US11820810B2 (en) 2013-05-02 2023-11-21 Kymab Limited Antibodies, variable domains and chains tailored for human use
JP2016521554A (en) * 2013-06-04 2016-07-25 プレジデント アンド フェローズ オブ ハーバード カレッジ RNA-induced transcriptional regulation
JP2019122384A (en) * 2013-06-04 2019-07-25 プレジデント アンド フェローズ オブ ハーバード カレッジ Rna guided transcriptional regulation
US20140356956A1 (en) * 2013-06-04 2014-12-04 President And Fellows Of Harvard College RNA-Guided Transcriptional Regulation
US11981917B2 (en) 2013-06-04 2024-05-14 President And Fellows Of Harvard College RNA-guided transcriptional regulation
JP2021045153A (en) * 2013-06-04 2021-03-25 プレジデント アンド フェローズ オブ ハーバード カレッジ Rna-guided transcriptional regulation
US10767194B2 (en) 2013-06-04 2020-09-08 President And Fellows Of Harvard College RNA-guided transcriptional regulation
EP3603679A1 (en) * 2013-06-04 2020-02-05 President and Fellows of Harvard College Rna-guideded transcriptional regulation
JP7119055B2 (en) 2013-06-04 2022-08-16 プレジデント アンド フェローズ オブ ハーバード カレッジ RNA-induced transcriptional regulation
JP7036511B2 (en) 2013-06-04 2022-03-15 プレジデント アンド フェローズ オブ ハーバード カレッジ RNA-induced transcriptional regulation
EP3003392A4 (en) * 2013-06-04 2017-05-03 President and Fellows of Harvard College Rna-guideded transcriptional regulation
US10640789B2 (en) 2013-06-04 2020-05-05 President And Fellows Of Harvard College RNA-guided transcriptional regulation
JP7376650B2 (en) 2013-06-04 2023-11-08 プレジデント アンド フェローズ オブ ハーバード カレッジ RNA-induced transcriptional regulation
JP2022166077A (en) * 2013-06-04 2022-11-01 プレジデント アンド フェローズ オブ ハーバード カレッジ RNA-induced transcriptional regulation
US10577630B2 (en) 2013-06-17 2020-03-03 The Broad Institute, Inc. Delivery and use of the CRISPR-Cas systems, vectors and compositions for hepatic targeting and therapy
US12441995B2 (en) 2013-06-17 2025-10-14 The Broad Institute, Inc. Functional genomics using CRISPR-Cas systems, compositions, methods, screens and applications thereof
US11008588B2 (en) 2013-06-17 2021-05-18 The Broad Institute, Inc. Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation
US11597949B2 (en) 2013-06-17 2023-03-07 The Broad Institute, Inc. Optimized CRISPR-Cas double nickase systems, methods and compositions for sequence manipulation
EP3825406A1 (en) * 2013-06-17 2021-05-26 The Broad Institute Inc. Delivery and use of the crispr-cas systems, vectors and compositions for hepatic targeting and therapy
WO2014204726A1 (en) 2013-06-17 2014-12-24 The Broad Institute Inc. Delivery and use of the crispr-cas systems, vectors and compositions for hepatic targeting and therapy
EP3597755A1 (en) * 2013-06-17 2020-01-22 The Broad Institute, Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using viral components
US10946108B2 (en) 2013-06-17 2021-03-16 The Broad Institute, Inc. Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for targeting disorders and diseases using viral components
US12553065B2 (en) 2013-06-17 2026-02-17 The Broad Institute, Inc. Optimized CRISPR-CAS double nickase systems, methods and compositions for sequence manipulation
US10711285B2 (en) 2013-06-17 2020-07-14 The Broad Institute, Inc. Optimized CRISPR-Cas double nickase systems, methods and compositions for sequence manipulation
US10781444B2 (en) 2013-06-17 2020-09-22 The Broad Institute, Inc. Functional genomics using CRISPR-Cas systems, compositions, methods, screens and applications thereof
US12018275B2 (en) 2013-06-17 2024-06-25 The Broad Institute, Inc. Delivery and use of the CRISPR-CAS systems, vectors and compositions for hepatic targeting and therapy
EP3019595A4 (en) * 2013-07-09 2016-11-30 THERAPEUTIC USES OF GENOME EDITING WITH CRISPR / CAS SYSTEMS
US10208319B2 (en) 2013-07-09 2019-02-19 President And Fellows Of Harvard College Therapeutic uses of genome editing with CRISPR/Cas systems
WO2016057835A3 (en) * 2013-07-09 2016-08-25 President And Fellows Of Harvard College THERAPEUTIC USES OF GENOME EDITING WITH CRISPR/Cas SYSTEMS
US11027025B2 (en) 2013-07-11 2021-06-08 Modernatx, Inc. Compositions comprising synthetic polynucleotides encoding CRISPR related proteins and synthetic sgRNAs and methods of use
JP7019233B2 (en) 2013-07-11 2022-02-15 モデルナティエックス インコーポレイテッド Compositions and Methods of Use Containing Synthetic polynucleotides and Synthetic sgRNAs Encoding CRISPR-Related Proteins
JP2016523564A (en) * 2013-07-11 2016-08-12 モデルナ セラピューティクス インコーポレイテッドModerna Therapeutics,Inc. Compositions comprising synthetic polynucleotides encoding CRISPR-related proteins and synthetic sgRNAs and methods of use
JP2016528894A (en) * 2013-07-26 2016-09-23 プレジデント アンド フェローズ オブ ハーバード カレッジ Genome engineering
AU2021202581B2 (en) * 2013-07-26 2023-07-13 President And Fellows Of Harvard College Genome engineering
JP6993063B2 (en) 2013-07-26 2022-01-13 プレジデント アンド フェローズ オブ ハーバード カレッジ Genome engineering
US12473575B2 (en) 2013-07-26 2025-11-18 President And Fellows Of Harvard College Genome engineering
JP2020110152A (en) * 2013-07-26 2020-07-27 プレジデント アンド フェローズ オブ ハーバード カレッジ Genome engineering
US11306328B2 (en) 2013-07-26 2022-04-19 President And Fellows Of Harvard College Genome engineering
US10563225B2 (en) 2013-07-26 2020-02-18 President And Fellows Of Harvard College Genome engineering
US9163284B2 (en) 2013-08-09 2015-10-20 President And Fellows Of Harvard College Methods for identifying a target site of a Cas9 nuclease
US10954548B2 (en) 2013-08-09 2021-03-23 President And Fellows Of Harvard College Nuclease profiling system
US11920181B2 (en) 2013-08-09 2024-03-05 President And Fellows Of Harvard College Nuclease profiling system
US10508298B2 (en) 2013-08-09 2019-12-17 President And Fellows Of Harvard College Methods for identifying a target site of a CAS9 nuclease
US9359599B2 (en) 2013-08-22 2016-06-07 President And Fellows Of Harvard College Engineered transcription activator-like effector (TALE) domains and uses thereof
US11046948B2 (en) 2013-08-22 2021-06-29 President And Fellows Of Harvard College Engineered transcription activator-like effector (TALE) domains and uses thereof
US10227581B2 (en) 2013-08-22 2019-03-12 President And Fellows Of Harvard College Engineered transcription activator-like effector (TALE) domains and uses thereof
US11298411B2 (en) 2013-08-29 2022-04-12 Temple University—Of the Commonwealth System of Higher Education Methods and compositions for RNA-guided treatment of HIV infection
US11285193B2 (en) 2013-08-29 2022-03-29 Temple University—Of the Commonwealth System of Higher Education Methods and compositions for RNA-guided treatment of HIV infection
US11291710B2 (en) 2013-08-29 2022-04-05 Temple University—Of the Commonwealth System of Higher Education Methods and compositions for RNA-guided treatment of HIV infection
US10682410B2 (en) 2013-09-06 2020-06-16 President And Fellows Of Harvard College Delivery system for functional nucleases
US9340799B2 (en) 2013-09-06 2016-05-17 President And Fellows Of Harvard College MRNA-sensing switchable gRNAs
US9737604B2 (en) 2013-09-06 2017-08-22 President And Fellows Of Harvard College Use of cationic lipids to deliver CAS9
US10597679B2 (en) 2013-09-06 2020-03-24 President And Fellows Of Harvard College Switchable Cas9 nucleases and uses thereof
US10858639B2 (en) 2013-09-06 2020-12-08 President And Fellows Of Harvard College CAS9 variants and uses thereof
US11299755B2 (en) 2013-09-06 2022-04-12 President And Fellows Of Harvard College Switchable CAS9 nucleases and uses thereof
US9228207B2 (en) 2013-09-06 2016-01-05 President And Fellows Of Harvard College Switchable gRNAs comprising aptamers
US9526784B2 (en) 2013-09-06 2016-12-27 President And Fellows Of Harvard College Delivery system for functional nucleases
US10912833B2 (en) 2013-09-06 2021-02-09 President And Fellows Of Harvard College Delivery of negatively charged proteins using cationic lipids
US9340800B2 (en) 2013-09-06 2016-05-17 President And Fellows Of Harvard College Extended DNA-sensing GRNAS
US12473573B2 (en) 2013-09-06 2025-11-18 President And Fellows Of Harvard College Switchable Cas9 nucleases and uses thereof
US9999671B2 (en) 2013-09-06 2018-06-19 President And Fellows Of Harvard College Delivery of negatively charged proteins using cationic lipids
US9322037B2 (en) 2013-09-06 2016-04-26 President And Fellows Of Harvard College Cas9-FokI fusion proteins and uses thereof
US9388430B2 (en) 2013-09-06 2016-07-12 President And Fellows Of Harvard College Cas9-recombinase fusion proteins and uses thereof
US12559737B2 (en) 2013-09-06 2026-02-24 President And Fellows Of Harvard College Cas9 variants and uses thereof
US11920128B2 (en) 2013-09-18 2024-03-05 Kymab Limited Methods, cells and organisms
US20170275611A1 (en) * 2013-09-18 2017-09-28 Kymab Limited Methods, cells & organisms
WO2015040402A1 (en) 2013-09-18 2015-03-26 Kymab Limited Methods. cells & organisms
EP2877571B1 (en) * 2013-09-18 2018-05-30 Kymab Limited Methods, cells and organisms
US11399522B2 (en) 2013-10-01 2022-08-02 Kymab Limited Animal models and therapeutic molecules
US10149462B2 (en) 2013-10-01 2018-12-11 Kymab Limited Animal models and therapeutic molecules
US10385088B2 (en) 2013-10-02 2019-08-20 Modernatx, Inc. Polynucleotide molecules and uses thereof
US11149267B2 (en) 2013-10-28 2021-10-19 The Broad Institute, Inc. Functional genomics using CRISPR-Cas systems, compositions, methods, screens and applications thereof
WO2015065964A1 (en) 2013-10-28 2015-05-07 The Broad Institute Inc. Functional genomics using crispr-cas systems, compositions, methods, screens and applications thereof
US11390887B2 (en) 2013-11-07 2022-07-19 Editas Medicine, Inc. CRISPR-related methods and compositions with governing gRNAS
US10640788B2 (en) 2013-11-07 2020-05-05 Editas Medicine, Inc. CRISPR-related methods and compositions with governing gRNAs
US9834791B2 (en) 2013-11-07 2017-12-05 Editas Medicine, Inc. CRISPR-related methods and compositions with governing gRNAS
US10190137B2 (en) 2013-11-07 2019-01-29 Editas Medicine, Inc. CRISPR-related methods and compositions with governing gRNAS
EP3071695A2 (en) * 2013-11-18 2016-09-28 Crispr Therapeutics AG Crispr-cas system materials and methods
EP3375877A1 (en) * 2013-11-18 2018-09-19 Crispr Therapeutics AG Crispr-cas system materials and methods
WO2015088643A1 (en) 2013-12-11 2015-06-18 Regeneron Pharmaceuticals, Inc. Methods and compositions for the targeted modification of a genome
US10208317B2 (en) 2013-12-11 2019-02-19 Regeneron Pharmaceuticals, Inc. Methods and compositions for the targeted modification of a mouse embryonic stem cell genome
EP4349980A2 (en) 2013-12-11 2024-04-10 Regeneron Pharmaceuticals, Inc. Methods and compositions for the targeted modification of a genome
US10711280B2 (en) 2013-12-11 2020-07-14 Regeneron Pharmaceuticals, Inc. Methods and compositions for the targeted modification of a mouse ES cell genome
US11820997B2 (en) 2013-12-11 2023-11-21 Regeneron Pharmaceuticals, Inc. Methods and compositions for the targeted modification of a genome
US9228208B2 (en) 2013-12-11 2016-01-05 Regeneron Pharmaceuticals, Inc. Methods and compositions for the targeted modification of a genome
EP3460063A1 (en) 2013-12-11 2019-03-27 Regeneron Pharmaceuticals, Inc. Methods and compositions for the targeted modification of a genome
EP3540051A1 (en) 2013-12-12 2019-09-18 The Broad Institute, Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for hbv and viral diseases and disorders
JP2017504312A (en) * 2013-12-12 2017-02-09 ザ・ブロード・インスティテュート・インコーポレイテッド Delivery, use and therapeutic application of CRISPR-Cas systems and compositions for genome editing
US10465176B2 (en) 2013-12-12 2019-11-05 President And Fellows Of Harvard College Cas variants for gene editing
EP4183876A1 (en) 2013-12-12 2023-05-24 The Broad Institute, Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for hbv and viral diseases and disorders
US12410435B2 (en) 2013-12-12 2025-09-09 The Broad Institute, Inc. Compositions and methods of use of CRISPR-Cas systems in nucleotide repeat disorders
US11155795B2 (en) 2013-12-12 2021-10-26 The Broad Institute, Inc. CRISPR-Cas systems, crystal structure and uses thereof
US11149259B2 (en) 2013-12-12 2021-10-19 The Broad Institute, Inc. CRISPR-Cas systems and methods for altering expression of gene products, structural information and inducible modular Cas enzymes
US11124782B2 (en) 2013-12-12 2021-09-21 President And Fellows Of Harvard College Cas variants for gene editing
US11053481B2 (en) 2013-12-12 2021-07-06 President And Fellows Of Harvard College Fusions of Cas9 domains and nucleic acid-editing domains
WO2015089465A1 (en) 2013-12-12 2015-06-18 The Broad Institute Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for hbv and viral diseases and disorders
US12421506B2 (en) 2013-12-12 2025-09-23 The Broad Institute, Inc. Engineering of systems, methods and optimized guide compositions with new architectures for sequence manipulation
EP3653229A1 (en) 2013-12-12 2020-05-20 The Broad Institute, Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for genome editing
WO2015089351A1 (en) 2013-12-12 2015-06-18 The Broad Institute Inc. Compositions and methods of use of crispr-cas systems in nucleotide repeat disorders
US10851357B2 (en) 2013-12-12 2020-12-01 The Broad Institute, Inc. Compositions and methods of use of CRISPR-Cas systems in nucleotide repeat disorders
WO2015089419A2 (en) 2013-12-12 2015-06-18 The Broad Institute Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using particle delivery components
EP3653703A1 (en) 2013-12-12 2020-05-20 The Broad Institute, Inc. Compositions and methods of use of crispr-cas systems in nucleotide repeat disorders
WO2015089486A2 (en) 2013-12-12 2015-06-18 The Broad Institute Inc. Systems, methods and compositions for sequence manipulation with optimized functional crispr-cas systems
EP3653704A1 (en) 2013-12-12 2020-05-20 The Broad Institute, Inc. Compositions and methods of use of crispr-cas systems in nucleotide repeat disorders
US10377998B2 (en) 2013-12-12 2019-08-13 The Broad Institute, Inc. CRISPR-CAS systems and methods for altering expression of gene products, structural information and inducible modular CAS enzymes
EP3470089A1 (en) 2013-12-12 2019-04-17 The Broad Institute Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using particle delivery components
US12215365B2 (en) 2013-12-12 2025-02-04 President And Fellows Of Harvard College Cas variants for gene editing
JP2021019622A (en) * 2013-12-12 2021-02-18 ザ・ブロード・インスティテュート・インコーポレイテッド Delivery, use and therapeutic applications of the crispr-cas systems and compositions for genome editing
WO2015089364A1 (en) 2013-12-12 2015-06-18 The Broad Institute Inc. Crystal structure of a crispr-cas system, and uses thereof
US12258595B2 (en) 2013-12-12 2025-03-25 The Broad Institute, Inc. Systems, methods and compositions for sequence manipulation with optimized functional CRISPR-Cas systems
US11597919B2 (en) 2013-12-12 2023-03-07 The Broad Institute Inc. Systems, methods and compositions for sequence manipulation with optimized functional CRISPR-Cas systems
EP3079725B1 (en) * 2013-12-12 2019-10-16 The Broad Institute, Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for genome editing
WO2015089419A3 (en) * 2013-12-12 2015-09-17 The Broad Institute Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using particle delivery components
US9840699B2 (en) 2013-12-12 2017-12-12 President And Fellows Of Harvard College Methods for nucleic acid editing
US10550372B2 (en) 2013-12-12 2020-02-04 The Broad Institute, Inc. Systems, methods and compositions for sequence manipulation with optimized functional CRISPR-Cas systems
US12251450B2 (en) 2013-12-12 2025-03-18 The Broad Institute, Inc. Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for HBV and viral diseases and disorders
JP2017501149A (en) * 2013-12-12 2017-01-12 ザ・ブロード・インスティテュート・インコーポレイテッド Delivery, use and therapeutic applications of CRISPR-CAS systems and compositions for targeting disorders and diseases using particle delivery components
US11591581B2 (en) 2013-12-12 2023-02-28 The Broad Institute, Inc. Compositions and methods of use of CRISPR-Cas systems in nucleotide repeat disorders
WO2015089354A1 (en) 2013-12-12 2015-06-18 The Broad Institute Inc. Compositions and methods of use of crispr-cas systems in nucleotide repeat disorders
EP4219699A1 (en) 2013-12-12 2023-08-02 The Broad Institute, Inc. Engineering of systems, methods and optimized guide compositions with new architectures for sequence manipulation
US11407985B2 (en) 2013-12-12 2022-08-09 The Broad Institute, Inc. Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for genome editing
US9068179B1 (en) 2013-12-12 2015-06-30 President And Fellows Of Harvard College Methods for correcting presenilin point mutations
US11078498B2 (en) 2014-02-11 2021-08-03 The Regents Of The University Of Colorado, A Body Corporate CRISPR enabled multiplexed genome engineering
US10731180B2 (en) 2014-02-11 2020-08-04 The Regents Of The University Of Colorado CRISPR enabled multiplexed genome engineering
US10435715B2 (en) 2014-02-11 2019-10-08 The Regents Of The University Of Colorado, A Body Corporate CRISPR enabled multiplexed genome engineering
JP2017505145A (en) * 2014-02-11 2017-02-16 ザ リージェンツ オブ ザ ユニバーシティ オブ コロラド,ア ボディー コーポレイトTHE REGENTS OF THE UNIVERSITY OF COLORADO,a body corporate Multiple genome engineering enabled by CRISPR
US11639511B2 (en) 2014-02-11 2023-05-02 The Regents Of The University Of Colorado, A Body Corporate CRISPR enabled multiplexed genome engineering
US11795479B2 (en) 2014-02-11 2023-10-24 The Regents Of The University Of Colorado CRISPR enabled multiplexed genome engineering
JP7232540B2 (en) 2014-02-11 2023-03-03 ザ リージェンツ オブ ザ ユニバーシティ オブ コロラド,ア ボディー コーポレイト Multiple genome engineering enabled by CRISPR
US10711284B2 (en) 2014-02-11 2020-07-14 The Regents Of The University Of Colorado CRISPR enabled multiplexed genome engineering
US10669559B2 (en) 2014-02-11 2020-06-02 The Regents Of The University Of Colorado, A Body Corporate CRISPR enabled multiplexed genome engineering
US10364442B2 (en) 2014-02-11 2019-07-30 The Regents Of The University Of Colorado, A Body Corporate CRISPR enabled multiplexed genome engineering
US10351877B2 (en) 2014-02-11 2019-07-16 The Regents Of The University Of Colorado, A Body Corporate CRISPR enabled multiplexed genome engineering
JP2019205478A (en) * 2014-02-11 2019-12-05 ザ リージェンツ オブ ザ ユニバーシティ オブ コロラド,ア ボディー コーポレイトTHE REGENTS OF THE UNIVERSITY OF COLORADO,a body corporate Crispr enabled multiplexed genome engineering
US10240167B2 (en) 2014-02-11 2019-03-26 Inscripta, Inc. CRISPR enabled multiplexed genome engineering
US10465207B2 (en) 2014-02-11 2019-11-05 The Regents Of The University Of Colorado, A Body Corporate CRISPR enabled multiplexed genome engineering
JP2021087454A (en) * 2014-02-11 2021-06-10 ザ リージェンツ オブ ザ ユニバーシティ オブ コロラド,ア ボディー コーポレイトTHE REGENTS OF THE UNIVERSITY OF COLORADO,a body corporate Crispr enabled multiplexed genome engineering
US10266849B2 (en) 2014-02-11 2019-04-23 The Regents Of The University Of Colorado, A Body Corporate CRISPR enabled multiplexed genome engineering
KR20160122197A (en) * 2014-02-11 2016-10-21 더 리전츠 오브 더 유니버시티 오브 콜로라도, 어 바디 코퍼레이트 Crispr enabled multiplexed genome engineering
US11345933B2 (en) 2014-02-11 2022-05-31 The Regents Of The University Of Colorado CRISPR enabled multiplexed genome engineering
US11702677B2 (en) 2014-02-11 2023-07-18 The Regents Of The University Of Colorado CRISPR enabled multiplexed genome engineering
US10286084B2 (en) 2014-02-18 2019-05-14 Duke University Compositions for the inactivation of virus replication and methods of making and using the same
EP3514246A1 (en) 2014-02-27 2019-07-24 The Broad Institute Inc. T cell balance gene expression and methods of use thereof
US11209440B2 (en) 2014-02-27 2021-12-28 The Broad Institute, Inc. T cell balance gene expression, compositions of matters and methods of use thereof
US11028388B2 (en) 2014-03-05 2021-06-08 Editas Medicine, Inc. CRISPR/Cas-related methods and compositions for treating Usher syndrome and retinitis pigmentosa
US11141493B2 (en) 2014-03-10 2021-10-12 Editas Medicine, Inc. Compositions and methods for treating CEP290-associated disease
US9938521B2 (en) 2014-03-10 2018-04-10 Editas Medicine, Inc. CRISPR/CAS-related methods and compositions for treating leber's congenital amaurosis 10 (LCA10)
US12234449B2 (en) 2014-03-10 2025-02-25 Editas Medicine, Inc. CRISPR/Cas-related methods and compositions for treating Leber's congenital amaurosis 10 (LCA10)
US11339437B2 (en) 2014-03-10 2022-05-24 Editas Medicine, Inc. Compositions and methods for treating CEP290-associated disease
US11268086B2 (en) 2014-03-10 2022-03-08 Editas Medicine, Inc. CRISPR/CAS-related methods and compositions for treating Leber's Congenital Amaurosis 10 (LCA10)
US11242525B2 (en) 2014-03-26 2022-02-08 Editas Medicine, Inc. CRISPR/CAS-related methods and compositions for treating sickle cell disease
US12460231B2 (en) 2014-04-02 2025-11-04 Editas Medicine, Inc. Crispr/CAS-related methods and compositions for treating primary open angle glaucoma
US12241090B2 (en) 2014-05-28 2025-03-04 Children's Hospital Medical Center Methods and systems for converting precursor cells into gastric tissues through directed differentiation
EP3708671A1 (en) 2014-06-06 2020-09-16 Regeneron Pharmaceuticals, Inc. Methods and compositions for modifying a targeted locus
WO2015188109A1 (en) 2014-06-06 2015-12-10 Regeneron Pharmaceuticals, Inc. Methods and compositions for modifying a targeted locus
US10286086B2 (en) 2014-06-19 2019-05-14 Modernatx, Inc. Alternative nucleic acid molecules and uses thereof
US10273488B2 (en) 2014-06-23 2019-04-30 Regeneron Pharmaceuticals, Inc. Nuclease-mediated DNA assembly
US9580715B2 (en) 2014-06-23 2017-02-28 Regeneron Pharmaceuticals, Inc. Nuclease-mediated DNA assembly
WO2015200334A1 (en) * 2014-06-23 2015-12-30 Regeneron Pharmaceuticals, Inc. Nuclease-mediated dna assembly
CN106715694A (en) * 2014-06-23 2017-05-24 瑞泽恩制药公司 Nuclease-mediated DNA assembly
EP3708663A1 (en) 2014-06-23 2020-09-16 Regeneron Pharmaceuticals, Inc. Nuclease-mediated dna assembly
US11932859B2 (en) 2014-06-23 2024-03-19 Regeneron Pharmaceuticals, Inc. Nuclease-mediated DNA assembly
US9738897B2 (en) 2014-06-23 2017-08-22 Regeneron Pharmaceuticals, Inc. Nuclease-mediated DNA assembly
EP3354732A1 (en) 2014-06-23 2018-08-01 Regeneron Pharmaceuticals, Inc. Nuclease-mediated dna assembly
US10626402B2 (en) 2014-06-23 2020-04-21 Regeneron Pharmaceuticals, Inc. Nuclease-mediated DNA assembly
WO2015200805A2 (en) 2014-06-26 2015-12-30 Regeneron Pharmaceuticals, Inc. Methods and compositions for targeted genetic modifications and methods of use
EP3461885A1 (en) 2014-06-26 2019-04-03 Regeneron Pharmaceuticals, Inc. Methods and compositions for targeted genetic modifications and methods of use
EP2966170A1 (en) * 2014-07-10 2016-01-13 Heinrich-Pette-Institut Leibniz-Institut für experimentelle Virologie-Stiftung bürgerlichen Rechts - HBV inactivation
US12331347B2 (en) 2014-07-11 2025-06-17 President And Fellows Of Harvard College Methods for high-throughput labelling and detection of biological features in situ using microscopy
US10407683B2 (en) 2014-07-16 2019-09-10 Modernatx, Inc. Circular polynucleotides
US11578343B2 (en) 2014-07-30 2023-02-14 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
US12398406B2 (en) 2014-07-30 2025-08-26 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
US10077453B2 (en) 2014-07-30 2018-09-18 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
US10704062B2 (en) 2014-07-30 2020-07-07 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
JP7197617B2 (en) 2014-08-11 2022-12-27 ザ ボード オブ リージェンツ オブ ザ ユニバーシティー オブ テキサス システム Prevention of muscular dystrophy by CRISPR/CAS9-mediated gene editing
JP2021073304A (en) * 2014-08-11 2021-05-13 ザ ボード オブ リージェンツ オブ ザ ユニバーシティー オブ テキサス システム Prevention of muscular dystrophy by crispr/cas9-mediated gene editing
JP2017525696A (en) * 2014-08-11 2017-09-07 ザ ボード オブ リージェンツ オブ ザ ユニバーシティー オブ テキサス システム Prevention of muscular dystrophy by CRISPR / CAS9-mediated gene editing
EP3686279A1 (en) 2014-08-17 2020-07-29 The Broad Institute, Inc. Genome editing using cas9 nickases
GB2544001A (en) * 2014-08-27 2017-05-03 Caribou Biosciences Inc Methods for increasing Cas9-mediated engineering efficiency
WO2016033246A1 (en) * 2014-08-27 2016-03-03 Caribou Biosciences, Inc. Methods for increasing cas9-mediated engineering efficiency
US9970030B2 (en) 2014-08-27 2018-05-15 Caribou Biosciences, Inc. Methods for increasing CAS9-mediated engineering efficiency
WO2016036754A1 (en) 2014-09-02 2016-03-10 The Regents Of The University Of California Methods and compositions for rna-directed target dna modification
WO2016049024A3 (en) * 2014-09-24 2016-05-12 The Broad Institute Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for modeling competition of multiple cancer mutations in vivo
US11197467B2 (en) 2014-09-24 2021-12-14 The Broad Institute, Inc. Delivery, use and therapeutic applications of the CRISPR-cas systems and compositions for modeling mutations in leukocytes
WO2016049251A1 (en) 2014-09-24 2016-03-31 The Broad Institute Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for modeling mutations in leukocytes
US11124796B2 (en) 2014-09-24 2021-09-21 The Broad Institute, Inc. Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for modeling competition of multiple cancer mutations in vivo
US11459557B2 (en) 2014-09-24 2022-10-04 The Broad Institute, Inc. Use and production of CHD8+/− transgenic animals with behavioral phenotypes characteristic of autism spectrum disorder
WO2016049163A2 (en) 2014-09-24 2016-03-31 The Broad Institute Inc. Use and production of chd8+/- transgenic animals with behavioral phenotypes characteristic of autism spectrum disorder
US11001829B2 (en) 2014-09-25 2021-05-11 The Broad Institute, Inc. Functional screening with optimized functional CRISPR-Cas systems
US12201699B2 (en) 2014-10-10 2025-01-21 Editas Medicine, Inc. Compositions and methods for promoting homology directed repair
EP3561052A1 (en) 2014-10-15 2019-10-30 Regeneron Pharmaceuticals, Inc. Methods and compositions for generating or maintaining pluripotent cells
WO2016061374A1 (en) 2014-10-15 2016-04-21 Regeneron Pharmaceuticals, Inc. Methods and compositions for generating or maintaining pluripotent cells
WO2016069591A2 (en) 2014-10-27 2016-05-06 The Broad Institute Inc. Compositions, methods and use of synthetic lethal screening
EP3708155A1 (en) * 2014-10-31 2020-09-16 Massachusetts Institute Of Technology Massively parallel combinatorial genetics for crispr
US12180263B2 (en) 2014-11-06 2024-12-31 President And Fellows Of Harvard College Cells lacking B2M surface expression and methods for allogeneic administration of such cells
US11680268B2 (en) 2014-11-07 2023-06-20 Editas Medicine, Inc. Methods for improving CRISPR/Cas-mediated genome-editing
US11697828B2 (en) 2014-11-21 2023-07-11 Regeneran Pharmaceuticals, Inc. Methods and compositions for targeted genetic modification using paired guide RNAs
US10457960B2 (en) 2014-11-21 2019-10-29 Regeneron Pharmaceuticals, Inc. Methods and compositions for targeted genetic modification using paired guide RNAs
EP3521437A1 (en) 2014-11-21 2019-08-07 Regeneron Pharmaceuticals, Inc. Methods and compositions for targeted genetic modification using paired guide rnas
WO2016081923A2 (en) 2014-11-21 2016-05-26 Regeneron Pharmaceuticals, Inc. METHODS AND COMPOSITIONS FOR TARGETED GENETIC MODIFICATION USING PAIRED GUIDE RNAs
EP3626832A2 (en) 2014-11-25 2020-03-25 The Brigham and Women's Hospital, Inc. Method of identifying and treating a person having a predisposition to or afflicted with a cardiometabolic disease
WO2016086197A1 (en) 2014-11-25 2016-06-02 The Brigham And Women's Hospital, Inc. Method of identifying and treating a person having a predisposition to or afflicted with a cardiometabolic disease
WO2016086227A2 (en) 2014-11-26 2016-06-02 The Regents Of The University Of California Therapeutic compositions comprising transcription factors and methods of making and using the same
WO2016083811A1 (en) 2014-11-27 2016-06-02 Imperial Innovations Limited Genome editing methods
US10900034B2 (en) 2014-12-03 2021-01-26 Agilent Technologies, Inc. Guide RNA with chemical modifications
US10337001B2 (en) 2014-12-03 2019-07-02 Agilent Technologies, Inc. Guide RNA with chemical modifications
US9888673B2 (en) 2014-12-10 2018-02-13 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
US10993419B2 (en) 2014-12-10 2021-05-04 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
US12465029B2 (en) 2014-12-10 2025-11-11 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
US11234418B2 (en) 2014-12-10 2022-02-01 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
US10278372B2 (en) 2014-12-10 2019-05-07 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
EP3985115A1 (en) 2014-12-12 2022-04-20 The Broad Institute, Inc. Protected guide rnas (pgrnas)
US10954514B2 (en) 2014-12-12 2021-03-23 The Broad Institute, Inc. Escorted and functionalized guides for CRISPR-Cas systems
WO2016094867A1 (en) 2014-12-12 2016-06-16 The Broad Institute Inc. Protected guide rnas (pgrnas)
WO2016094874A1 (en) 2014-12-12 2016-06-16 The Broad Institute Inc. Escorted and functionalized guides for crispr-cas systems
WO2016094880A1 (en) 2014-12-12 2016-06-16 The Broad Institute Inc. Delivery, use and therapeutic applications of crispr systems and compositions for genome editing as to hematopoietic stem cells (hscs)
US11624078B2 (en) 2014-12-12 2023-04-11 The Broad Institute, Inc. Protected guide RNAS (pgRNAS)
US10696986B2 (en) 2014-12-12 2020-06-30 The Board Institute, Inc. Protected guide RNAS (PGRNAS)
US12571005B2 (en) 2014-12-12 2026-03-10 The Broad Institute, Inc. Protected guide RNAs (pgRNAs)
EP3889260A1 (en) 2014-12-12 2021-10-06 The Broad Institute, Inc. Protected guide rnas (pgrnas)
EP3653048A1 (en) 2014-12-19 2020-05-20 Regeneron Pharmaceuticals, Inc. Methods and compositions for targeted genetic modification through single-step multiple targeting
WO2016100974A1 (en) 2014-12-19 2016-06-23 The Broad Institute Inc. Unbiased identification of double-strand breaks and genomic rearrangement by genome-wide insert capture sequencing
WO2016100857A1 (en) 2014-12-19 2016-06-23 Regeneron Pharmaceuticals, Inc. Stem cells for modeling type 2 diabetes
US11723933B2 (en) 2014-12-23 2023-08-15 Cj Bioscience, Inc. Composition of bacteroides thetaiotaomicron for immune modulation
US12215326B2 (en) 2014-12-23 2025-02-04 The Broad Institute, Inc. RNA-targeting system
WO2016106236A1 (en) 2014-12-23 2016-06-30 The Broad Institute Inc. Rna-targeting system
US10973872B2 (en) 2014-12-23 2021-04-13 4D Pharma Research Limited Pirin polypeptide and immune modulation
WO2016106244A1 (en) 2014-12-24 2016-06-30 The Broad Institute Inc. Crispr having or associated with destabilization domains
EP3702456A1 (en) 2014-12-24 2020-09-02 The Broad Institute, Inc. Crispr having or associated with destabilization domains
US12435320B2 (en) 2014-12-24 2025-10-07 The Broad Institute, Inc. CRISPR having or associated with destabilization domains
WO2016108926A1 (en) 2014-12-30 2016-07-07 The Broad Institute Inc. Crispr mediated in vivo modeling and genetic screening of tumor growth and metastasis
US12116619B2 (en) 2014-12-30 2024-10-15 The Broad Institute, Inc. CRISPR mediated in vivo modeling and genetic screening of tumor growth and metastasis
US12215366B2 (en) 2015-02-09 2025-02-04 Duke University Compositions and methods for epigenome editing
US11427869B2 (en) 2015-02-26 2022-08-30 The Broad Institute, Inc. T cell balance gene expression, compositions of matters and methods of use thereof
WO2016138488A2 (en) 2015-02-26 2016-09-01 The Broad Institute Inc. T cell balance gene expression, compositions of matters and methods of use thereof
WO2016138574A1 (en) 2015-03-02 2016-09-09 Sinai Health System Homologous recombination factors
JP2023082036A (en) * 2015-03-03 2023-06-13 ザ ジェネラル ホスピタル コーポレイション Engineered crispr-cas9 nucleases with altered pam specificity
JP7585373B2 (en) 2015-03-03 2024-11-18 ザ ジェネラル ホスピタル コーポレイション Engineered CRISPR-Cas9 nucleases with altered PAM specificity
JP2021058202A (en) * 2015-03-03 2021-04-15 ザ ジェネラル ホスピタル コーポレイション Engineered crispr-cas9 nucleases with altered pam specificity
JP2024123232A (en) * 2015-03-03 2024-09-10 ザ ジェネラル ホスピタル コーポレイション Engineered CRISPR-Cas9 nucleases with altered PAM specificity
JP7291114B2 (en) 2015-03-03 2023-06-14 ザ ジェネラル ホスピタル コーポレイション Engineered CRISPR-Cas9 nuclease with altered PAM specificity
US11851652B2 (en) 2015-04-06 2023-12-26 The Board Of Trustees Of The Leland Stanford Junior Compositions comprising chemically modified guide RNAs for CRISPR/Cas-mediated editing of HBB
US11306309B2 (en) 2015-04-06 2022-04-19 The Board Of Trustees Of The Leland Stanford Junior University Chemically modified guide RNAs for CRISPR/CAS-mediated gene regulation
US11535846B2 (en) 2015-04-06 2022-12-27 The Board Of Trustees Of The Leland Stanford Junior University Chemically modified guide RNAS for CRISPR/Cas-mediated gene regulation
US11760985B2 (en) 2015-04-16 2023-09-19 Wageningen Universiteit CRISPR-Cas complex
EP3283625B1 (en) 2015-04-16 2019-12-11 Wageningen Universiteit Nuclease-mediated genome editing
US11053482B2 (en) 2015-04-16 2021-07-06 Wageningen Universiteit Vector systems for nuclease-mediated genome editing
US11479761B2 (en) 2015-04-16 2022-10-25 Wageningen Universiteit Nuclease-mediated genome editing
US12534715B2 (en) 2015-04-16 2026-01-27 Wageningen Universiteit Nucleic acids for nuclease-mediated genome editing
US11180793B2 (en) 2015-04-24 2021-11-23 Editas Medicine, Inc. Evaluation of Cas9 molecule/guide RNA molecule complexes
US11685917B2 (en) 2015-05-08 2023-06-27 The Broad Institute, Inc. Functional genomics using CRISPR-Cas systems for saturating mutagenesis of non-coding elements, compositions, methods, libraries and applications thereof
WO2016182893A1 (en) 2015-05-08 2016-11-17 Teh Broad Institute Inc. Functional genomics using crispr-cas systems for saturating mutagenesis of non-coding elements, compositions, methods, libraries and applications thereof
US12031154B2 (en) 2015-05-08 2024-07-09 President And Fellows Of Harvard College Universal donor stem cells and related methods
US12497590B2 (en) 2015-05-08 2025-12-16 President And Fellows Of Harvard College Universal donor stem cells and related methods
US12497610B2 (en) 2015-05-08 2025-12-16 The Broad Institute, Inc. Functional genomics using CRISPR-CAS systems for saturating mutagenesis of non-coding elements, compositions, methods, libraries and applications thereof
US12421493B2 (en) 2015-05-08 2025-09-23 President And Fellows Of Harvard College Universal donor stem cells and related methods
US12031155B2 (en) 2015-05-08 2024-07-09 President And Fellows Of Harvard College Universal donor stem cells and related methods
US12110500B2 (en) 2015-05-08 2024-10-08 President And Fellows Of Harvard College Universal donor stem cells and related methods
US11390884B2 (en) 2015-05-11 2022-07-19 Editas Medicine, Inc. Optimized CRISPR/cas9 systems and methods for gene editing in stem cells
WO2016187717A1 (en) * 2015-05-26 2016-12-01 Exerkine Corporation Exosomes useful for genome editing
US10883103B2 (en) 2015-06-02 2021-01-05 Monsanto Technology Llc Compositions and methods for delivery of a polynucleotide into a plant
US11911415B2 (en) 2015-06-09 2024-02-27 Editas Medicine, Inc. CRISPR/Cas-related methods and compositions for improving transplantation
US11433106B2 (en) 2015-06-15 2022-09-06 4D Pharma Research Limited Compositions comprising bacterial strains
US11331352B2 (en) 2015-06-15 2022-05-17 4D Pharma Research Limited Compositions comprising bacterial strains
US10500237B2 (en) 2015-06-15 2019-12-10 4D Pharma Research Limited Compositions comprising bacterial strains
US11040075B2 (en) 2015-06-15 2021-06-22 4D Pharma Research Limited Compositions comprising bacterial strains
US10864236B2 (en) 2015-06-15 2020-12-15 4D Pharma Research Limited Compositions comprising bacterial strains
US10493112B2 (en) 2015-06-15 2019-12-03 4D Pharma Research Limited Compositions comprising bacterial strains
US11273185B2 (en) 2015-06-15 2022-03-15 4D Pharma Research Limited Compositions comprising bacterial strains
US10780134B2 (en) 2015-06-15 2020-09-22 4D Pharma Research Limited Compositions comprising bacterial strains
US10736926B2 (en) 2015-06-15 2020-08-11 4D Pharma Research Limited Compositions comprising bacterial strains
US10744167B2 (en) 2015-06-15 2020-08-18 4D Pharma Research Limited Compositions comprising bacterial strains
US11389493B2 (en) 2015-06-15 2022-07-19 4D Pharma Research Limited Compositions comprising bacterial strains
US11643669B2 (en) 2015-06-17 2023-05-09 Massachusetts Institute Of Technology CRISPR mediated recording of cellular events
WO2016205728A1 (en) 2015-06-17 2016-12-22 Massachusetts Institute Of Technology Crispr mediated recording of cellular events
US11180751B2 (en) 2015-06-18 2021-11-23 The Broad Institute, Inc. CRISPR enzymes and systems
US10669540B2 (en) 2015-06-18 2020-06-02 The Board Institute, Inc. CRISPR enzymes and systems
WO2016205613A1 (en) 2015-06-18 2016-12-22 The Broad Institute Inc. Crispr enzyme mutations reducing off-target effects
EP3310917B1 (en) 2015-06-18 2020-02-12 The Broad Institute, Inc. Novel crispr enzymes and systems
US11421250B2 (en) 2015-06-18 2022-08-23 The Broad Institute, Inc. CRISPR enzymes and systems
EP3470519B1 (en) 2015-06-18 2020-02-12 The Broad Institute, Inc. Novel crispr enzymes and systems
US10494621B2 (en) 2015-06-18 2019-12-03 The Broad Institute, Inc. Crispr enzyme mutations reducing off-target effects
US12410468B2 (en) 2015-06-18 2025-09-09 The Broad Institute, Inc. CRISPR enzymes and systems
US11578312B2 (en) 2015-06-18 2023-02-14 The Broad Institute Inc. Engineering and optimization of systems, methods, enzymes and guide scaffolds of CAS9 orthologs and variants for sequence manipulation
EP4159856A1 (en) 2015-06-18 2023-04-05 The Broad Institute, Inc. Novel crispr enzymes and systems
EP3009511B1 (en) 2015-06-18 2017-05-31 The Broad Institute, Inc. Novel crispr enzymes and systems
US11060115B2 (en) 2015-06-18 2021-07-13 The Broad Institute, Inc. CRISPR enzymes and systems
US12371737B2 (en) 2015-06-18 2025-07-29 The Broad Institute, Inc. CRISPR enzymes and systems
US11634755B2 (en) 2015-06-18 2023-04-25 The Broad Institute, Inc. Crispr enzymes and systems
US10648020B2 (en) 2015-06-18 2020-05-12 The Broad Institute, Inc. CRISPR enzymes and systems
EP3502253B1 (en) 2015-06-18 2020-05-27 The Broad Institute, Inc. Novel crispr enzymes and systems
US11773432B2 (en) 2015-06-18 2023-10-03 The Broad Institute Inc. CRISPR enzymes and systems
EP3666895A1 (en) 2015-06-18 2020-06-17 The Broad Institute, Inc. Novel crispr enzymes and systems
US12123032B2 (en) 2015-06-18 2024-10-22 The Broad Institute, Inc. CRISPR enzyme mutations reducing off-target effects
EP3502253A1 (en) 2015-06-18 2019-06-26 The Broad Institute Inc. Novel crispr enzymes and systems
US10876100B2 (en) 2015-06-18 2020-12-29 The Broad Institute, Inc. Crispr enzyme mutations reducing off-target effects
EP3009511A2 (en) 2015-06-18 2016-04-20 The Broad Institute, Inc. Novel crispr enzymes and systems
WO2016205745A2 (en) 2015-06-18 2016-12-22 The Broad Institute Inc. Cell sorting
US11781172B2 (en) 2015-06-18 2023-10-10 The Broad Institute, Inc. Crispr enzymes and systems
US11091798B2 (en) 2015-06-18 2021-08-17 The Broad Institute, Inc. CRISPR enzymes and systems
US12264359B2 (en) 2015-06-18 2025-04-01 The Broad Institute, Inc. CRISPR enzymes and systems
US11236327B2 (en) 2015-06-18 2022-02-01 The Broad Institute, Inc. Cell sorting
WO2016205749A1 (en) 2015-06-18 2016-12-22 The Broad Institute Inc. Novel crispr enzymes and systems
US12168789B2 (en) 2015-06-18 2024-12-17 The Broad Institute, Inc. Engineering and optimization of systems, methods, enzymes and guide scaffolds of CAS9 orthologs and variants for sequence manipulation
EP3929287A2 (en) 2015-06-18 2021-12-29 The Broad Institute, Inc. Crispr enzyme mutations reducing off-target effects
WO2016205764A1 (en) 2015-06-18 2016-12-22 The Broad Institute Inc. Novel crispr enzymes and systems
IL256369A (en) * 2015-06-18 2018-02-28 Harvard College New enzymes and systems of crispr
US11773412B2 (en) 2015-06-18 2023-10-03 The Broad Institute, Inc. Crispr enzymes and systems
WO2016205711A1 (en) 2015-06-18 2016-12-22 The Broad Institute Inc. Novel crispr enzymes and systems
US20180127745A1 (en) * 2015-06-18 2018-05-10 The Broad Institute Inc. Cell sorting
EP4403638A2 (en) 2015-06-18 2024-07-24 The Broad Institute Inc. Novel crispr enzymes and systems
US12091709B2 (en) 2015-06-18 2024-09-17 The Broad Institute, Inc. Crispr enzymes and systems
US11244760B2 (en) 2015-06-25 2022-02-08 Karydo Therapeutix, Inc. Prediction device based on inter-organ cross talk system
US11414657B2 (en) 2015-06-29 2022-08-16 Ionis Pharmaceuticals, Inc. Modified CRISPR RNA and modified single CRISPR RNA and uses thereof
US10987409B2 (en) 2015-07-02 2021-04-27 Poseida Therapeutics, Inc. Compositions and methods for improved encapsulation of functional proteins in polymeric vesicles
JP2018532408A (en) * 2015-07-02 2018-11-08 ポセイダ セラピューティクス, インコーポレイテッド Compositions and methods for delivering genetic editing tools using polymer vesicles
JP6993966B2 (en) 2015-07-02 2022-02-04 ポセイダ セラピューティクス, インコーポレイテッド Compositions and Methods for Delivering Gene Editing Tools Using Polymer Vesicles
JP2018525983A (en) * 2015-07-28 2018-09-13 ダニスコ・ユーエス・インク Genome editing system and method of use
JP2018522072A (en) * 2015-07-31 2018-08-09 リージェンツ オブ ザ ユニバーシティ オブ ミネソタ Modified cells and methods of treatment
US11642375B2 (en) 2015-07-31 2023-05-09 Intima Bioscience, Inc. Intracellular genomic transplant and methods of therapy
US11925664B2 (en) 2015-07-31 2024-03-12 Intima Bioscience, Inc. Intracellular genomic transplant and methods of therapy
US11903966B2 (en) 2015-07-31 2024-02-20 Regents Of The University Of Minnesota Intracellular genomic transplant and methods of therapy
US10166255B2 (en) 2015-07-31 2019-01-01 Regents Of The University Of Minnesota Intracellular genomic transplant and methods of therapy
US11266692B2 (en) 2015-07-31 2022-03-08 Regents Of The University Of Minnesota Intracellular genomic transplant and methods of therapy
US11583556B2 (en) 2015-07-31 2023-02-21 Regents Of The University Of Minnesota Modified cells and methods of therapy
US10406177B2 (en) 2015-07-31 2019-09-10 Regents Of The University Of Minnesota Modified cells and methods of therapy
WO2017023801A1 (en) * 2015-07-31 2017-02-09 Regents Of The University Of Minnesota Intracellular genomic transplant and methods of therapy
US11147837B2 (en) 2015-07-31 2021-10-19 Regents Of The University Of Minnesota Modified cells and methods of therapy
US11642374B2 (en) 2015-07-31 2023-05-09 Intima Bioscience, Inc. Intracellular genomic transplant and methods of therapy
EP4512819A2 (en) 2015-08-12 2025-02-26 The General Hospital Corporation Compositions and methods that promote hypoxia or the hypoxia response for treatment and prevention of mitochondrial dysfunction and oxidative stress disorders
WO2017027910A1 (en) 2015-08-14 2017-02-23 The University Of Sydney Connexin 45 inhibition for therapy
EP4043074A1 (en) 2015-08-14 2022-08-17 The University of Sydney Connexin 45 inhibition for therapy
US11214800B2 (en) 2015-08-18 2022-01-04 The Broad Institute, Inc. Methods and compositions for altering function and structure of chromatin loops and/or domains
CN114634930A (en) * 2015-08-25 2022-06-17 杜克大学 Compositions and methods for improving genome engineering specificity using RNA-guided endonucleases
CN114634930B (en) * 2015-08-25 2025-10-21 杜克大学 Compositions and methods for improving specificity of genome engineering using RNA-guided endonucleases
US10633642B2 (en) 2015-08-28 2020-04-28 The General Hospital Corporation Engineered CRISPR-Cas9 nucleases
US11060078B2 (en) 2015-08-28 2021-07-13 The General Hospital Corporation Engineered CRISPR-Cas9 nucleases
US10526591B2 (en) 2015-08-28 2020-01-07 The General Hospital Corporation Engineered CRISPR-Cas9 nucleases
US12109274B2 (en) 2015-09-17 2024-10-08 Modernatx, Inc. Polynucleotides containing a stabilizing tail region
US11667911B2 (en) 2015-09-24 2023-06-06 Editas Medicine, Inc. Use of exonucleases to improve CRISPR/CAS-mediated genome editing
WO2017069958A2 (en) 2015-10-09 2017-04-27 The Brigham And Women's Hospital, Inc. Modulation of novel immune checkpoint targets
US11970710B2 (en) 2015-10-13 2024-04-30 Duke University Genome engineering with Type I CRISPR systems in eukaryotic cells
US12234454B2 (en) 2015-10-22 2025-02-25 The Broad Institute, Inc. Crispr enzymes and systems
US12215318B2 (en) 2015-10-22 2025-02-04 The Broad Institute, Inc. Crispr enzymes and systems
WO2017070605A1 (en) 2015-10-22 2017-04-27 The Broad Institute Inc. Type vi-b crispr enzymes and systems
US12043852B2 (en) 2015-10-23 2024-07-23 President And Fellows Of Harvard College Evolved Cas9 proteins for gene editing
US12344869B2 (en) 2015-10-23 2025-07-01 President And Fellows Of Harvard College Nucleobase editors and uses thereof
US10167457B2 (en) 2015-10-23 2019-01-01 President And Fellows Of Harvard College Nucleobase editors and uses thereof
US11214780B2 (en) 2015-10-23 2022-01-04 President And Fellows Of Harvard College Nucleobase editors and uses thereof
WO2017074788A1 (en) 2015-10-27 2017-05-04 The Broad Institute Inc. Compositions and methods for targeting cancer-specific sequence variations
US11186825B2 (en) 2015-10-28 2021-11-30 The Broad Institute, Inc. Compositions and methods for evaluating and modulating immune responses by detecting and targeting POU2AF1
WO2017075451A1 (en) 2015-10-28 2017-05-04 The Broad Institute Inc. Compositions and methods for evaluating and modulating immune responses by detecting and targeting pou2af1
US11180730B2 (en) 2015-10-28 2021-11-23 The Broad Institute, Inc. Compositions and methods for evaluating and modulating immune responses by detecting and targeting GATA3
US11092607B2 (en) 2015-10-28 2021-08-17 The Board Institute, Inc. Multiplex analysis of single cell constituents
WO2017075465A1 (en) 2015-10-28 2017-05-04 The Broad Institute Inc. Compositions and methods for evaluating and modulating immune responses by detecting and targeting gata3
WO2017075478A2 (en) 2015-10-28 2017-05-04 The Broad Institute Inc. Compositions and methods for evaluating and modulating immune responses by use of immune cell gene signatures
WO2017075294A1 (en) 2015-10-28 2017-05-04 The Board Institute Inc. Assays for massively combinatorial perturbation profiling and cellular circuit reconstruction
US11542554B2 (en) 2015-11-03 2023-01-03 President And Fellows Of Harvard College Method and apparatus for volumetric imaging
US11617783B2 (en) 2015-11-16 2023-04-04 Research Institute At Nationwide Children's Hospital Repairing a mutant human titin gene using CRISPR technology
US12472239B2 (en) 2015-11-16 2025-11-18 Research Institute At Nationwide Children's Hospital Guide RNA for repairing a mutant human titin gene using CRISPR technology
US11001622B2 (en) 2015-11-19 2021-05-11 The Brigham And Women's Hospital, Inc. Method of treating autoimmune disease with lymphocyte antigen CD5-like (CD5L) protein
US11884717B2 (en) 2015-11-19 2024-01-30 The Brigham And Women's Hospital, Inc. Method of treating autoimmune disease with lymphocyte antigen CD5-like (CD5L) protein
WO2017087708A1 (en) 2015-11-19 2017-05-26 The Brigham And Women's Hospital, Inc. Lymphocyte antigen cd5-like (cd5l)-interleukin 12b (p40) heterodimers in immunity
US10471108B2 (en) 2015-11-20 2019-11-12 4D Pharma Research Limited Compositions comprising bacterial strains
US11058732B2 (en) 2015-11-20 2021-07-13 4D Pharma Research Limited Compositions comprising bacterial strains
US10610550B2 (en) 2015-11-20 2020-04-07 4D Pharma Research Limited Compositions comprising bacterial strains
US11667903B2 (en) 2015-11-23 2023-06-06 The Regents Of The University Of California Tracking and manipulating cellular RNA via nuclear delivery of CRISPR/CAS9
US20170253925A1 (en) * 2015-11-25 2017-09-07 Integrated Dna Technologies Methods for variant detection
US20210395799A1 (en) * 2015-11-25 2021-12-23 Integrated Dna Technologies, Inc. Methods for variant detection
US20170260583A1 (en) * 2015-11-25 2017-09-14 Integrated Dna Technologies, Inc. Methods for variant detection
US11926866B2 (en) 2015-11-25 2024-03-12 Integrated Dna Technologies, Inc. Method for detecting on-target and predicted off-target genome editing events
US10886006B2 (en) * 2015-11-25 2021-01-05 Integrated Dna Technologies, Inc. Methods for variant detection
US12214054B2 (en) 2015-11-30 2025-02-04 Duke University Therapeutic targets for the correction of the human dystrophin gene by gene editing and methods of use
US12110490B2 (en) 2015-12-18 2024-10-08 The Broad Institute, Inc. CRISPR enzymes and systems
WO2017106657A1 (en) 2015-12-18 2017-06-22 The Broad Institute Inc. Novel crispr enzymes and systems
WO2017114497A1 (en) 2015-12-30 2017-07-06 Novartis Ag Immune effector cell therapies with enhanced efficacy
EP4219689A2 (en) 2015-12-30 2023-08-02 Novartis AG Immune effector cell therapies with enhanced efficacy
WO2017127807A1 (en) 2016-01-22 2017-07-27 The Broad Institute Inc. Crystal structure of crispr cpf1
WO2017147196A1 (en) 2016-02-22 2017-08-31 Massachusetts Institute Of Technology Methods for identifying and modulating immune phenotypes
US10583158B2 (en) 2016-03-04 2020-03-10 4D Pharma Plc Compositions comprising bacterial strains
EP3219799A1 (en) 2016-03-17 2017-09-20 IMBA-Institut für Molekulare Biotechnologie GmbH Conditional crispr sgrna expression
WO2017161325A1 (en) 2016-03-17 2017-09-21 Massachusetts Institute Of Technology Methods for identifying and modulating co-occurant cellular phenotypes
US11427861B2 (en) 2016-03-17 2022-08-30 Massachusetts Institute Of Technology Methods for identifying and modulating co-occurant cellular phenotypes
WO2017158153A1 (en) 2016-03-17 2017-09-21 Imba - Institut Für Molekulare Biotechnologie Gmbh Conditional crispr sgrna expression
US11597924B2 (en) 2016-03-25 2023-03-07 Editas Medicine, Inc. Genome editing systems comprising repair-modulating enzyme molecules and methods of their use
US11512311B2 (en) 2016-03-25 2022-11-29 Editas Medicine, Inc. Systems and methods for treating alpha 1-antitrypsin (A1AT) deficiency
US11180539B2 (en) 2016-03-29 2021-11-23 Karydo Therapeutix, Inc. Pharmaceutical composition or food composition, and method for assessing effect of active ingredient in vivo
WO2017170803A1 (en) * 2016-03-29 2017-10-05 株式会社国際電気通信基礎技術研究所 Pharmaceutical composition or food composition, and method for assessing effect of active ingredient in vivo
JPWO2017170803A1 (en) * 2016-03-29 2018-04-05 株式会社国際電気通信基礎技術研究所 Pharmaceutical composition or food composition, and method for evaluating the effect of active ingredients in the body
US12091701B2 (en) 2016-03-29 2024-09-17 Karydo Therapeutix, Inc. Screening method for candidate substances for active component to prevent or treat at least one disease selected from the group consisting of renal hypofunction, chronic kidney disease and kidney failure
US12428631B2 (en) 2016-04-13 2025-09-30 Duke University CRISPR/Cas9-based repressors for silencing gene targets in vivo and methods of use
US12049651B2 (en) 2016-04-13 2024-07-30 Editas Medicine, Inc. Cas9 fusion molecules, gene editing systems, and methods of use thereof
US11236313B2 (en) 2016-04-13 2022-02-01 Editas Medicine, Inc. Cas9 fusion molecules, gene editing systems, and methods of use thereof
WO2017184768A1 (en) 2016-04-19 2017-10-26 The Broad Institute Inc. Novel crispr enzymes and systems
WO2017189308A1 (en) 2016-04-19 2017-11-02 The Broad Institute Inc. Novel crispr enzymes and systems
US12344838B2 (en) 2016-04-19 2025-07-01 The Broad Institute, Inc. CPF1 complexes with reduced indel activity
US12410416B2 (en) 2016-04-19 2025-09-09 The Broad Institute, Inc. CRISPR enzymes and systems with modified pam specificity
WO2017184786A1 (en) 2016-04-19 2017-10-26 The Broad Institute Inc. Cpf1 complexes with reduced indel activity
US11286478B2 (en) 2016-04-19 2022-03-29 The Broad Institute, Inc. Cpf1 complexes with reduced indel activity
US11713485B2 (en) 2016-04-25 2023-08-01 President And Fellows Of Harvard College Hybridization chain reaction methods for in situ molecular detection
WO2017189542A1 (en) * 2016-04-26 2017-11-02 University Of Georgia Research Foundation, Inc. Plants having reduced methylation of cytosine nucleotides and methods of use
US11213594B2 (en) 2016-04-29 2022-01-04 Poseida Therapeutics, Inc. Poly(histidine)-based micelles for complexation and delivery of proteins and nucleic acids
KR20190019931A (en) * 2016-05-20 2019-02-27 리제너론 파마슈티칼스 인코포레이티드 Immunological resistance destruction method using multiple guide RNAs
KR102628909B1 (en) 2016-05-20 2024-01-25 리제너론 파마슈티칼스 인코포레이티드 Methods for breaking immunological tolerance using multiple guide rnas
RU2745563C2 (en) * 2016-05-20 2021-03-29 Регенерон Фармасьютикалс, Инк. Ways to overcome immunological tolerance using multiple guide rnas
EP4368637A2 (en) 2016-05-20 2024-05-15 Regeneron Pharmaceuticals, Inc. Methods for breaking immunological tolerance using multiple guide rnas
US12342801B2 (en) 2016-05-20 2025-07-01 Regeneron Pharmaceuticals, Inc. Methods for producing antigen-binding proteins against foreign antigens
KR102356542B1 (en) 2016-05-20 2022-01-28 리제너론 파마슈티칼스 인코포레이티드 A method for disrupting immunological resistance using multiple guide RNAs
EP4368637A3 (en) * 2016-05-20 2024-07-10 Regeneron Pharmaceuticals, Inc. Methods for breaking immunological tolerance using multiple guide rnas
WO2017201476A1 (en) 2016-05-20 2017-11-23 Regeneron Pharmaceuticals, Inc. Methods for breaking immunological tolerance using multiple guide rnas
KR102661748B1 (en) * 2016-05-20 2024-05-31 리제너론 파마슈티칼스 인코포레이티드 Methods for breaking immunological tolerance using multiple guide rnas
RU2842438C1 (en) * 2016-05-20 2025-06-26 Регенерон Фармасьютикалс, Инк. Methods of overcoming immunological tolerance using plurality of guide rna
IL262888B2 (en) * 2016-05-20 2026-02-01 Regeneron Pharma Methods for breaking immunological tolerance using multiple guide rnas
KR20220018613A (en) * 2016-05-20 2022-02-15 리제너론 파마슈티칼스 인코포레이티드 Methods for breaking immunological tolerance using multiple guide rnas
RU2829155C2 (en) * 2016-05-20 2024-10-24 Регенерон Фармасьютикалс, Инк. Methods of overcoming immunological tolerance using multiple targeting rnas
IL262888B1 (en) * 2016-05-20 2025-10-01 Regeneron Pharma Methods for breaking immunological tolerance using multiple guide rnas
US10767175B2 (en) 2016-06-08 2020-09-08 Agilent Technologies, Inc. High specificity genome editing using chemically modified guide RNAs
WO2017219027A1 (en) 2016-06-17 2017-12-21 The Broad Institute Inc. Type vi crispr orthologs and systems
US11788083B2 (en) 2016-06-17 2023-10-17 The Broad Institute, Inc. Type VI CRISPR orthologs and systems
US10294473B2 (en) 2016-06-24 2019-05-21 The Regents Of The University Of Colorado, A Body Corporate Methods for generating barcoded combinatorial libraries
US11584928B2 (en) 2016-06-24 2023-02-21 The Regents Of The University Of Colorado, A Body Corporate Methods for generating barcoded combinatorial libraries
US10287575B2 (en) 2016-06-24 2019-05-14 The Regents Of The University Of Colorado, A Body Corporate Methods for generating barcoded combinatorial libraries
WO2018005873A1 (en) 2016-06-29 2018-01-04 The Broad Institute Inc. Crispr-cas systems having destabilization domain
US10610548B2 (en) 2016-07-13 2020-04-07 4D Pharma Plc Compositions comprising bacterial strains
US10610549B2 (en) 2016-07-13 2020-04-07 4D Pharma Plc Composition comprising bacterial strains
US12031150B2 (en) 2016-07-13 2024-07-09 Vertex Pharmaceuticals Incorporated Methods, compositions and kits for increasing genome editing efficiency
US10960031B2 (en) 2016-07-13 2021-03-30 4D Pharma Plc Compositions comprising bacterial strains
EP4219462A1 (en) 2016-07-13 2023-08-02 Vertex Pharmaceuticals Incorporated Methods, compositions and kits for increasing genome editing efficiency
WO2018013840A1 (en) 2016-07-13 2018-01-18 Vertex Pharmaceuticals Incorporated Methods, compositions and kits for increasing genome editing efficiency
US11224620B2 (en) 2016-07-13 2022-01-18 4D Pharma Plc Compositions comprising bacterial strains
US10967010B2 (en) 2016-07-13 2021-04-06 4D Pharma Plc Compositions comprising bacterial strains
US12214056B2 (en) 2016-07-19 2025-02-04 Duke University Therapeutic applications of CPF1-based genome editing
WO2018023014A1 (en) 2016-07-29 2018-02-01 Regeneron Pharmaceuticals, Inc. Mice comprising mutations resulting in expression of c-truncated fibrillin-1
US11566263B2 (en) 2016-08-02 2023-01-31 Editas Medicine, Inc. Compositions and methods for treating CEP290 associated disease
US11702651B2 (en) 2016-08-03 2023-07-18 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
US10947530B2 (en) 2016-08-03 2021-03-16 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
US11999947B2 (en) 2016-08-03 2024-06-04 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
US10113163B2 (en) 2016-08-03 2018-10-30 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
US11661590B2 (en) 2016-08-09 2023-05-30 President And Fellows Of Harvard College Programmable CAS9-recombinase fusion proteins and uses thereof
US12305204B2 (en) 2016-08-17 2025-05-20 The Broad Institute, Inc. CRISPR enzymes and systems
WO2018035250A1 (en) 2016-08-17 2018-02-22 The Broad Institute, Inc. Methods for identifying class 2 crispr-cas systems
WO2018035364A1 (en) 2016-08-17 2018-02-22 The Broad Institute Inc. Product and methods useful for modulating and evaluating immune responses
WO2018035387A1 (en) 2016-08-17 2018-02-22 The Broad Institute, Inc. Novel crispr enzymes and systems
EP4485466A2 (en) 2016-08-17 2025-01-01 The Broad Institute Inc. Novel crispr enzymes and systems
US12559774B2 (en) 2016-08-17 2026-02-24 The Broad Institute, Inc. CRISPR enzymes and systems
WO2018035388A1 (en) 2016-08-17 2018-02-22 The Broad Institute, Inc. Novel crispr enzymes and systems
US11352647B2 (en) 2016-08-17 2022-06-07 The Broad Institute, Inc. Crispr enzymes and systems
US11630103B2 (en) 2016-08-17 2023-04-18 The Broad Institute, Inc. Product and methods useful for modulating and evaluating immune responses
US12431216B2 (en) 2016-08-17 2025-09-30 Broad Institute, Inc. Methods for identifying class 2 crispr-cas systems
US12084663B2 (en) 2016-08-24 2024-09-10 President And Fellows Of Harvard College Incorporation of unnatural amino acids into proteins using base editing
US11542509B2 (en) 2016-08-24 2023-01-03 President And Fellows Of Harvard College Incorporation of unnatural amino acids into proteins using base editing
US12565671B2 (en) 2016-08-31 2026-03-03 President And Fellows Of Harvard College Methods of combining the detection of biomolecules into a single assay using fluorescent in situ sequencing
WO2018049025A2 (en) 2016-09-07 2018-03-15 The Broad Institute Inc. Compositions and methods for evaluating and modulating immune responses
US12188059B2 (en) 2016-09-13 2025-01-07 The Broad Institute, Inc. Proximity-dependent biotinylation and uses thereof
WO2017216392A1 (en) * 2016-09-23 2017-12-21 Dsm Ip Assets B.V. A guide-rna expression system for a host cell
WO2018054911A1 (en) 2016-09-23 2018-03-29 Bayer Cropscience Nv Targeted genome optimization in plants
US12499971B2 (en) 2016-09-28 2025-12-16 The Broad Institute, Inc. Systematic screening and mapping of regulatory elements in non-coding genomic regions, methods, compositions, and applications thereof
US11427818B2 (en) 2016-10-07 2022-08-30 Integrated Dna Technologies, Inc. S. pyogenes CAS9 mutant genes and polypeptides encoded by same
WO2018067991A1 (en) 2016-10-07 2018-04-12 The Brigham And Women's Hospital, Inc. Modulation of novel immune checkpoint targets
US12447213B2 (en) 2016-10-07 2025-10-21 The Broad Institute, Inc. Modulation of novel immune checkpoint targets
US12168765B2 (en) 2016-10-07 2024-12-17 Integrated Dna Technologies, Inc. S. pyogenes CAS9 mutant genes and polypeptides encoded by same
US12351799B2 (en) 2016-10-07 2025-07-08 Integrated Dna Technologies, Inc. S. pyogenes CAS9 mutant genes and polypeptides encoded by same
US20180100148A1 (en) * 2016-10-07 2018-04-12 Integrated Dna Technologies, Inc. S. pyogenes cas9 mutant genes and polypeptides encoded by same
US10717978B2 (en) * 2016-10-07 2020-07-21 Integrated Dna Technologies, Inc. S. pyogenes CAS9 mutant genes and polypeptides encoded by same
US11306324B2 (en) 2016-10-14 2022-04-19 President And Fellows Of Harvard College AAV delivery of nucleobase editors
US10912797B2 (en) 2016-10-18 2021-02-09 Intima Bioscience, Inc. Tumor infiltrating lymphocytes and methods of therapy
US11154574B2 (en) 2016-10-18 2021-10-26 Regents Of The University Of Minnesota Tumor infiltrating lymphocytes and methods of therapy
WO2018083606A1 (en) 2016-11-01 2018-05-11 Novartis Ag Methods and compositions for enhancing gene editing
US12414967B2 (en) 2016-11-04 2025-09-16 Children's Hospital Medical Center Compositions and methods of treating liver disease
US12227578B2 (en) 2016-11-11 2025-02-18 The Broad Institute, Inc. Modulation of intestinal epithelial cell differentiation, maintenance and/or function through T cell action
WO2018107129A1 (en) 2016-12-09 2018-06-14 The Broad Institute, Inc. Crispr effector system based diagnostics
EP4119663A1 (en) 2016-12-09 2023-01-18 The Broad Institute, Inc. Crispr effector system based diagnostics
US12404514B2 (en) 2016-12-09 2025-09-02 The Broad Institute, Inc. CRISPR-systems for modifying a trait of interest in a plant
US10485830B2 (en) 2016-12-12 2019-11-26 4D Pharma Plc Compositions comprising bacterial strains
US12286727B2 (en) 2016-12-19 2025-04-29 Editas Medicine, Inc. Assessing nuclease cleavage
US10745677B2 (en) 2016-12-23 2020-08-18 President And Fellows Of Harvard College Editing of CCR5 receptor gene to protect against HIV infection
US11820969B2 (en) 2016-12-23 2023-11-21 President And Fellows Of Harvard College Editing of CCR2 receptor gene to protect against HIV infection
US11733235B2 (en) 2016-12-27 2023-08-22 Chugai Seiyaku Kabushiki Kaisha Method for evaluating immunogenicity of test substance
US12110545B2 (en) 2017-01-06 2024-10-08 Editas Medicine, Inc. Methods of assessing nuclease cleavage
WO2018136758A1 (en) 2017-01-23 2018-07-26 Regeneron Pharmaceuticals, Inc. Hsd17b13 variants and uses thereof
US12559748B2 (en) 2017-02-06 2026-02-24 Novartis Ag Compositions and methods for the treatment of hemoglobinopathies
US11466271B2 (en) 2017-02-06 2022-10-11 Novartis Ag Compositions and methods for the treatment of hemoglobinopathies
WO2018147343A1 (en) * 2017-02-07 2018-08-16 Edigene Corporation Method of treating diseases associated with elevated kras expression using crispr-gndm system
US11591621B2 (en) 2017-02-07 2023-02-28 Modalis Therapeutics Corporation Method of treating diseases associated with elevated KRAS expression using CRISPR-GNDM system
US11898179B2 (en) 2017-03-09 2024-02-13 President And Fellows Of Harvard College Suppression of pain by gene editing
US12516308B2 (en) 2017-03-09 2026-01-06 President And Fellows Of Harvard College Suppression of pain by gene editing
US12390514B2 (en) 2017-03-09 2025-08-19 President And Fellows Of Harvard College Cancer vaccine
US12435331B2 (en) 2017-03-10 2025-10-07 President And Fellows Of Harvard College Cytosine to guanine base editor
US11542496B2 (en) 2017-03-10 2023-01-03 President And Fellows Of Harvard College Cytosine to guanine base editor
WO2018170333A1 (en) 2017-03-15 2018-09-20 The Broad Institute, Inc. Novel cas13b orthologues crispr enzymes and systems
EP4361261A2 (en) 2017-03-15 2024-05-01 The Broad Institute Inc. Novel cas13b orthologues crispr enzymes and systems
US11174515B2 (en) 2017-03-15 2021-11-16 The Broad Institute, Inc. CRISPR effector system based diagnostics
US11739308B2 (en) 2017-03-15 2023-08-29 The Broad Institute, Inc. Cas13b orthologues CRISPR enzymes and systems
US12203145B2 (en) 2017-03-15 2025-01-21 The Broad Institute, Inc. CRISPR effector system based diagnostics for virus detection
WO2018170340A1 (en) 2017-03-15 2018-09-20 The Broad Institute, Inc. Crispr effector system based diagnostics for virus detection
US11104937B2 (en) 2017-03-15 2021-08-31 The Broad Institute, Inc. CRISPR effector system based diagnostics
WO2018170515A1 (en) 2017-03-17 2018-09-20 The Broad Institute, Inc. Methods for identifying and modulating co-occurant cellular phenotypes
US12180546B2 (en) 2017-03-17 2024-12-31 Massachusetts Institute Of Technology Methods for identifying and modulating co-occurant cellular phenotypes
US11268082B2 (en) 2017-03-23 2022-03-08 President And Fellows Of Harvard College Nucleobase editors comprising nucleic acid programmable DNA binding proteins
US12161694B2 (en) 2017-03-24 2024-12-10 The Broad Institute, Inc. Methods and compositions for regulating innate lymphoid cell inflammatory responses
US11963966B2 (en) 2017-03-31 2024-04-23 Dana-Farber Cancer Institute, Inc. Compositions and methods for treating ovarian tumors
US11913075B2 (en) 2017-04-01 2024-02-27 The Broad Institute, Inc. Methods and compositions for detecting and modulating an immunotherapy resistance gene signature in cancer
US11840711B2 (en) 2017-04-12 2023-12-12 The Broad Institute, Inc. Type VI CRISPR orthologs and systems
WO2018191520A1 (en) 2017-04-12 2018-10-18 The Broad Institute, Inc. Respiratory and sweat gland ionocytes
WO2018191553A1 (en) 2017-04-12 2018-10-18 Massachusetts Eye And Ear Infirmary Tumor signature for metastasis, compositions of matter methods of use thereof
US11618928B2 (en) 2017-04-12 2023-04-04 The Broad Institute, Inc. CRISPR effector system based diagnostics for malaria detection
WO2018191388A1 (en) 2017-04-12 2018-10-18 The Broad Institute, Inc. Novel type vi crispr orthologs and systems
US12331319B2 (en) 2017-04-12 2025-06-17 The Broad Institute, Inc. Respiratory and sweat gland ionocytes
US12281334B2 (en) 2017-04-14 2025-04-22 Children's Hospital Medical Center Multi donor stem cell compositions and methods of making same
WO2018191750A2 (en) 2017-04-14 2018-10-18 The Broad Institute Inc. Novel delivery of large payloads
US12350368B2 (en) 2017-04-14 2025-07-08 The Broad Institute, Inc. Delivery of large payloads
US11913015B2 (en) 2017-04-17 2024-02-27 University Of Maryland, College Park Embryonic cell cultures and methods of using the same
WO2018195019A1 (en) 2017-04-18 2018-10-25 The Broad Institute Inc. Compositions for detecting secretion and methods of use
US12058986B2 (en) 2017-04-20 2024-08-13 Egenesis, Inc. Method for generating a genetically modified pig with inactivated porcine endogenous retrovirus (PERV) elements
WO2018195486A1 (en) 2017-04-21 2018-10-25 The Broad Institute, Inc. Targeted delivery to beta cells
US11499151B2 (en) 2017-04-28 2022-11-15 Editas Medicine, Inc. Methods and systems for analyzing guide RNA molecules
US11072816B2 (en) 2017-05-03 2021-07-27 The Broad Institute, Inc. Single-cell proteomic assay using aptamers
US11591601B2 (en) 2017-05-05 2023-02-28 The Broad Institute, Inc. Methods for identification and modification of lncRNA associated with target genotypes and phenotypes
WO2018208910A1 (en) 2017-05-09 2018-11-15 The Broad Institute Inc. Gut microbiome function predicts response to anti-integrin biologic therapy in inflammatory bowel diseases
US12163148B2 (en) 2017-05-10 2024-12-10 The Regents Of The University Of California Directed editing of cellular RNA via nuclear delivery of CRISPR/Cas9
US11963982B2 (en) 2017-05-10 2024-04-23 Editas Medicine, Inc. CRISPR/RNA-guided nuclease systems and methods
US11453891B2 (en) 2017-05-10 2022-09-27 The Regents Of The University Of California Directed editing of cellular RNA via nuclear delivery of CRISPR/CAS9
US12226479B2 (en) 2017-05-11 2025-02-18 The General Hospital Corporation Methods and compositions of use of CD8+ tumor infiltrating lymphocyte subtypes and gene signatures thereof
US11560566B2 (en) 2017-05-12 2023-01-24 President And Fellows Of Harvard College Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation
US12297436B2 (en) 2017-05-18 2025-05-13 The Broad Institute, Inc. Systems, methods, and compositions for targeted nucleic acid editing
US11866697B2 (en) 2017-05-18 2024-01-09 The Broad Institute, Inc. Systems, methods, and compositions for targeted nucleic acid editing
US11376284B2 (en) 2017-05-22 2022-07-05 4D Pharma Research Limited Compositions comprising bacterial strains
US11382936B2 (en) 2017-05-22 2022-07-12 4D Pharma Research Limited Compositions comprising bacterial strains
US11123378B2 (en) 2017-05-22 2021-09-21 4D Pharma Research Limited Compositions comprising bacterial strains
US10987387B2 (en) 2017-05-24 2021-04-27 4D Pharma Research Limited Compositions comprising bacterial strain
US12442021B2 (en) 2017-06-05 2025-10-14 Fred Hutchinson Cancer Center Genomic safe harbors for genetic therapies in human stem cells and engineered nanoparticles to provide targeted genetic therapies
US11603544B2 (en) 2017-06-05 2023-03-14 Fred Hutchinson Cancer Center Genomic safe harbors for genetic therapies in human stem cells and engineered nanoparticles to provide targeted genetic therapies
US10428319B2 (en) 2017-06-09 2019-10-01 Editas Medicine, Inc. Engineered Cas9 nucleases
US12297466B2 (en) 2017-06-09 2025-05-13 Editas Medicine, Inc. Engineered Cas9 nucleases
US11098297B2 (en) 2017-06-09 2021-08-24 Editas Medicine, Inc. Engineered Cas9 nucleases
US11007233B2 (en) 2017-06-14 2021-05-18 4D Pharma Research Limited Compositions comprising a bacterial strain of the genus Megasphera and uses thereof
US12048720B2 (en) 2017-06-14 2024-07-30 Cj Bioscience, Inc. Compositions comprising bacterial strains
US11123379B2 (en) 2017-06-14 2021-09-21 4D Pharma Research Limited Compositions comprising bacterial strains
US11660319B2 (en) 2017-06-14 2023-05-30 4D Pharma Research Limited Compositions comprising bacterial strains
US11897953B2 (en) 2017-06-14 2024-02-13 The Broad Institute, Inc. Compositions and methods targeting complement component 3 for inhibiting tumor growth
US11779613B2 (en) 2017-06-14 2023-10-10 Cj Bioscience, Inc. Compositions comprising a bacterial strain of the genus Megasphera and uses thereof
US10337028B2 (en) 2017-06-23 2019-07-02 Inscripta, Inc. Nucleic acid-guided nucleases
US12195749B2 (en) 2017-06-23 2025-01-14 Inscripta, Inc. Nucleic acid-guided nucleases
US11697826B2 (en) 2017-06-23 2023-07-11 Inscripta, Inc. Nucleic acid-guided nucleases
US12139718B2 (en) 2017-06-23 2024-11-12 University Of Kentucky Research Foundation Methods of decreasing total alkaloid content in tobacco
US12180502B2 (en) 2017-06-23 2024-12-31 Inscripta, Inc. Nucleic acid-guided nucleases
US10626416B2 (en) 2017-06-23 2020-04-21 Inscripta, Inc. Nucleic acid-guided nucleases
WO2018237107A1 (en) 2017-06-23 2018-12-27 University Of Kentucky Research Foundation Method
US10435714B2 (en) 2017-06-23 2019-10-08 Inscripta, Inc. Nucleic acid-guided nucleases
WO2019005884A1 (en) 2017-06-26 2019-01-03 The Broad Institute, Inc. Crispr/cas-adenine deaminase based compositions, systems, and methods for targeted nucleic acid editing
US11098325B2 (en) 2017-06-30 2021-08-24 Intima Bioscience, Inc. Adeno-associated viral vectors for gene therapy
WO2019006471A2 (en) 2017-06-30 2019-01-03 Arbor Biotechnologies, Inc. Novel crispr rna targeting enzymes and systems and uses thereof
WO2019003193A1 (en) 2017-06-30 2019-01-03 Novartis Ag Methods for the treatment of disease with gene editing systems
US12415000B2 (en) 2017-07-07 2025-09-16 The Broad Institute, Inc. CRISPR system based antiviral therapy
US12548638B2 (en) 2017-07-07 2026-02-10 The Broad Institute, Inc. Methods for designing guide sequences for guided nucleases
US11866726B2 (en) 2017-07-14 2024-01-09 Editas Medicine, Inc. Systems and methods for targeted integration and genome editing and detection thereof using integrated priming sites
US12049643B2 (en) 2017-07-14 2024-07-30 The Broad Institute, Inc. Methods and compositions for modulating cytotoxic lymphocyte activity
WO2019018440A1 (en) 2017-07-17 2019-01-24 The Broad Institute, Inc. Cell atlas of the healthy and ulcerative colitis human colon
US12105089B2 (en) 2017-07-17 2024-10-01 The Broad Institute, Inc. Cell atlas of the healthy and ulcerative colitis human colon
US12239646B2 (en) 2017-07-19 2025-03-04 Dana-Farber Cancer Institute, Inc. Cancer diagnostic and treatment
US11732274B2 (en) 2017-07-28 2023-08-22 President And Fellows Of Harvard College Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE)
US12359218B2 (en) 2017-07-28 2025-07-15 President And Fellows Of Harvard College Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE)
WO2019028029A1 (en) 2017-07-31 2019-02-07 Regeneron Pharmaceuticals, Inc. Assessment of crispr/cas-induced recombination with an exogenous donor nucleic acid in vivo
WO2019028023A2 (en) 2017-07-31 2019-02-07 Regeneron Pharmaceuticals, Inc. Methods and compositions for assessing crispr/cas-mediated disruption or excision and crispr/cas-induced recombination with an exogenous donor nucleic acid in vivo
WO2019028032A1 (en) 2017-07-31 2019-02-07 Regeneron Pharmaceuticals, Inc. Cas-transgenic mouse embryonic stem cells and mice and uses thereof
US11866794B2 (en) 2017-07-31 2024-01-09 Regeneron Pharmaceuticals, Inc. Cas-ready mouse embryonic stem cells and mice and uses thereof
WO2019023770A1 (en) 2017-07-31 2019-02-07 Universidade Federal Do Rio Grande Do Sul Composition for gene therapy of the central nervous system, process of production and use thereof
US11932884B2 (en) 2017-08-30 2024-03-19 President And Fellows Of Harvard College High efficiency base editors comprising Gam
US11319532B2 (en) 2017-08-30 2022-05-03 President And Fellows Of Harvard College High efficiency base editors comprising Gam
US11618896B2 (en) 2017-09-21 2023-04-04 The Broad Institute, Inc. Systems, methods, and compositions for targeted nucleic acid editing
US11685916B2 (en) 2017-09-21 2023-06-27 The Broad Institute, Inc. Systems, methods, and compositions for targeted nucleic acid editing
WO2019060746A1 (en) 2017-09-21 2019-03-28 The Broad Institute, Inc. Systems, methods, and compositions for targeted nucleic acid editing
WO2019067872A1 (en) * 2017-09-29 2019-04-04 Intellia Therapeutics, Inc. Compositions and methods for ttr gene editing and treating attr amyloidosis
WO2019067875A1 (en) 2017-09-29 2019-04-04 Regeneron Pharmaceuticals, Inc. Non-human animals comprising a humanized ttr locus and methods of use
US11965165B2 (en) 2017-09-29 2024-04-23 Intellia Therapeutics, Inc. Compositions and methods for TTR gene editing and treating ATTR amyloidosis
US11795460B2 (en) 2017-09-29 2023-10-24 Intellia Therapeutics, Inc. Compositions and methods for TTR gene editing and treating ATTR amyloidosis
EP4276185A2 (en) 2017-09-29 2023-11-15 Regeneron Pharmaceuticals, Inc. Rodents comprising a humanized ttr locus and methods of use
WO2019070755A1 (en) 2017-10-02 2019-04-11 The Broad Institute, Inc. Methods and compositions for detecting and modulating an immunotherapy resistance gene signature in cancer
US12043870B2 (en) 2017-10-02 2024-07-23 The Broad Institute, Inc. Methods and compositions for detecting and modulating an immunotherapy resistance gene signature in cancer
WO2019071054A1 (en) 2017-10-04 2019-04-11 The Broad Institute, Inc. Methods and compositions for altering function and structure of chromatin loops and/or domains
US12221636B2 (en) 2017-10-04 2025-02-11 The Broad Institute, Inc. Systems methods, and compositions for targeted nucleic acid editing
US11633732B2 (en) 2017-10-04 2023-04-25 The Broad Institute, Inc. CRISPR effector system based diagnostics
US12297457B2 (en) 2017-10-10 2025-05-13 Children's Hospital Medical Center Esophageal tissue and/or organoid compositions and methods of making same
US11680296B2 (en) 2017-10-16 2023-06-20 Massachusetts Institute Of Technology Mycobacterium tuberculosis host-pathogen interaction
US11795443B2 (en) 2017-10-16 2023-10-24 The Broad Institute, Inc. Uses of adenosine base editors
US11578118B2 (en) 2017-10-20 2023-02-14 Fred Hutchinson Cancer Center Systems and methods to produce B cells genetically modified to express selected antibodies
US12227742B2 (en) 2017-10-23 2025-02-18 The Broad Institute, Inc. Nucleic acid modifiers
US12433803B2 (en) 2017-10-31 2025-10-07 The Broad Institute, Inc. Methods and compositions for studying cell evolution
US11547614B2 (en) 2017-10-31 2023-01-10 The Broad Institute, Inc. Methods and compositions for studying cell evolution
WO2019087113A1 (en) 2017-11-01 2019-05-09 Novartis Ag Synthetic rnas and methods of use
US12054754B2 (en) 2017-11-02 2024-08-06 Arbor Biotechnologies, Inc. CRISPR-associated transposon systems and components
US12221720B2 (en) 2017-11-13 2025-02-11 The Broad Institute, Inc. Methods for determining spatial and temporal gene expression dynamics during adult neurogenesis in single cells
WO2019094983A1 (en) 2017-11-13 2019-05-16 The Broad Institute, Inc. Methods and compositions for treating cancer by targeting the clec2d-klrb1 pathway
US12171783B2 (en) 2017-11-13 2024-12-24 The Broad Institute, Inc. Methods and compositions for targeting developmental and oncogenic programs in H3K27M gliomas
WO2019099943A1 (en) 2017-11-16 2019-05-23 Astrazeneca Ab Compositions and methods for improving the efficacy of cas9-based knock-in strategies
US11332736B2 (en) 2017-12-07 2022-05-17 The Broad Institute, Inc. Methods and compositions for multiplexing single cell and single nuclei sequencing
US12406749B2 (en) 2017-12-15 2025-09-02 The Broad Institute, Inc. Systems and methods for predicting repair outcomes in genetic engineering
US12379372B2 (en) 2017-12-21 2025-08-05 Children's Hospital Medical Center Digitalized human organoids and methods of using same
WO2019126709A1 (en) 2017-12-22 2019-06-27 The Broad Institute, Inc. Cas12b systems, methods, and compositions for targeted dna base editing
US11994512B2 (en) 2018-01-04 2024-05-28 Massachusetts Institute Of Technology Single-cell genomic methods to generate ex vivo cell systems that recapitulate in vivo biology with improved fidelity
WO2019138083A1 (en) 2018-01-12 2019-07-18 Basf Se Gene underlying the number of spikelets per spike qtl in wheat on chromosome 7a
US12121524B2 (en) 2018-01-17 2024-10-22 Vertex Pharmaceuticals Incorporated DNA-PK inhibitors
US12005127B2 (en) 2018-01-17 2024-06-11 Vertex Pharmaceuticals Incorporated DNA-PK inhibitors
WO2019143675A1 (en) 2018-01-17 2019-07-25 Vertex Pharmaceuticals Incorporated Dna-pk inhibitors
WO2019143678A1 (en) 2018-01-17 2019-07-25 Vertex Pharmaceuticals Incorporated Dna-pk inhibitors
US12269804B2 (en) 2018-01-17 2025-04-08 Vertex Pharmaceuticals Incorporated Quinoxalinone compounds, compositions, methods, and kits for increasing genome editing efficiency
US12509492B2 (en) 2018-01-19 2025-12-30 Duke University Genome engineering with CRISPR-Cas systems in eukaryotes
WO2019148206A1 (en) 2018-01-29 2019-08-01 The Broad Institute, Inc. Crispr effector system based diagnostics
US12263230B2 (en) 2018-01-31 2025-04-01 Research Institute At Nationwide Children's Hospital Gene therapy for limb-girdle muscular dystrophy type 2C
WO2019168950A1 (en) * 2018-02-27 2019-09-06 The University Of North Carolina At Chapel Hill Methods and compositions for treating angelman syndrome
CN111770758A (en) * 2018-02-27 2020-10-13 北卡罗来纳-查佩尔山大学 Methods and compositions for treating Angelman syndrome
WO2019178428A1 (en) 2018-03-14 2019-09-19 Arbor Biotechnologies, Inc. Novel crispr dna and rna targeting enzymes and systems
EP4253551A2 (en) 2018-03-14 2023-10-04 Arbor Biotechnologies, Inc. Novel crispr dna and rna targeting enzymes and systems
EP4257696A2 (en) 2018-03-14 2023-10-11 Arbor Biotechnologies, Inc. Novel crispr dna targeting enzymes and systems
US12031132B2 (en) 2018-03-14 2024-07-09 Editas Medicine, Inc. Systems and methods for the treatment of hemoglobinopathies
WO2019178427A1 (en) 2018-03-14 2019-09-19 Arbor Biotechnologies, Inc. Novel crispr dna targeting enzymes and systems
WO2019183123A1 (en) 2018-03-19 2019-09-26 Regeneron Pharmaceuticals, Inc. Transcription modulation in animals using crispr/cas systems
US12529072B2 (en) 2018-03-19 2026-01-20 Regeneron Pharmaceuticals, Inc. Transcription modulation in animals using CRISPR/CAS systems
US11519004B2 (en) 2018-03-19 2022-12-06 Regeneran Pharmaceuticals, Inc. Transcription modulation in animals using CRISPR/Cas systems
WO2019204585A1 (en) 2018-04-19 2019-10-24 Massachusetts Institute Of Technology Single-stranded break detection in double-stranded dna
EP3560330A1 (en) 2018-04-24 2019-10-30 KWS SAAT SE & Co. KGaA Plants with improved digestibility and marker haplotypes
US12180490B2 (en) 2018-04-24 2024-12-31 KWS SAAT SE & Co. KGaA Plants with improved digestibility and marker haplotypes
WO2019206927A1 (en) 2018-04-24 2019-10-31 KWS SAAT SE & Co. KGaA Plants with improved digestibility and marker haplotypes
US11957695B2 (en) 2018-04-26 2024-04-16 The Broad Institute, Inc. Methods and compositions targeting glucocorticoid signaling for modulating immune responses
WO2019210268A2 (en) 2018-04-27 2019-10-31 The Broad Institute, Inc. Sequencing-based proteomics
WO2019222555A1 (en) 2018-05-16 2019-11-21 Arbor Biotechnologies, Inc. Novel crispr-associated systems and components
US12522812B2 (en) 2018-05-16 2026-01-13 Arbor Biotechnologies, Inc. CRISPR-associated systems and components
US11667904B2 (en) 2018-05-16 2023-06-06 Arbor Biotechnologies, Inc. CRISPR-associated systems and components
US12157760B2 (en) 2018-05-23 2024-12-03 The Broad Institute, Inc. Base editors and uses thereof
WO2019232542A2 (en) 2018-06-01 2019-12-05 Massachusetts Institute Of Technology Methods and compositions for detecting and modulating microenvironment gene signatures from the csf of metastasis patients
US12036240B2 (en) 2018-06-14 2024-07-16 The Broad Institute, Inc. Compositions and methods targeting complement component 3 for inhibiting tumor growth
WO2020006036A1 (en) 2018-06-26 2020-01-02 Massachusetts Institute Of Technology Crispr effector system based amplification methods, systems, and diagnostics
WO2020006067A1 (en) 2018-06-26 2020-01-02 The Broad Institute, Inc. Crispr double nickase based amplification compositions, systems, and methods
WO2020006049A1 (en) 2018-06-26 2020-01-02 The Broad Institute, Inc. Crispr/cas and transposase based amplification compositions, systems and methods
US12559786B2 (en) 2018-06-26 2026-02-24 The Broad Institute, Inc. CRISPR/Cas and transposase based amplification compositions, systems and methods
WO2020002592A1 (en) 2018-06-29 2020-01-02 Stichting Het Nederlands Kanker Instituut - Antoni Van Leeuwenhoek Ziekenhuis Traf2 inhibitors for use in the treatment of a cancer
US12338436B2 (en) 2018-06-29 2025-06-24 Editas Medicine, Inc. Synthetic guide molecules, compositions and methods relating thereto
US12391928B2 (en) 2018-06-29 2025-08-19 Research Institute At Nationwide Children's Hospital Recombinant adeno-associated virus products and methods for treating limb girdle muscular dystrophy 2A
US12522807B2 (en) 2018-07-09 2026-01-13 The Broad Institute, Inc. RNA programmable epigenetic RNA modifiers and uses thereof
US12421500B2 (en) 2018-07-26 2025-09-23 Children's Hospital Medical Center Hepato-biliary-pancreatic tissues and methods of making same
WO2020028555A2 (en) 2018-07-31 2020-02-06 The Broad Institute, Inc. Novel crispr enzymes and systems
WO2020025963A2 (en) 2018-08-02 2020-02-06 British American Tobacco (Investments) Limited Method
WO2020033601A1 (en) 2018-08-07 2020-02-13 The Broad Institute, Inc. Novel cas12b enzymes and systems
AU2019275586B2 (en) * 2018-08-16 2021-06-17 Lart Bio Co., Ltd. Transgenic animals and transgenic embryos producing an engineered nuclease
US12029204B2 (en) 2018-08-16 2024-07-09 Lart Bio Co., Ltd. Transgenic animals and transgenic embryos producing an engineered nuclease
US12391685B2 (en) 2018-08-20 2025-08-19 The Broad Institute, Inc. Inhibitors of RNA-guided nuclease target binding and uses thereof
WO2020041380A1 (en) 2018-08-20 2020-02-27 The Broad Institute, Inc. Methods and compositions for optochemical control of crispr-cas9
US12421507B2 (en) 2018-08-20 2025-09-23 The Broad Institute, Inc. Methods and compositions for optochemical control of CRISPR-CAS9
US12460244B2 (en) 2018-08-20 2025-11-04 The Broad Institute, Inc. Inhibitors of RNA-guided nuclease activity and uses thereof
WO2020041384A1 (en) 2018-08-20 2020-02-27 The Broad Institute, Inc. 3-phenyl-2-cyano-azetidine derivatives, inhibitors of rna-guided nuclease activity
WO2020041387A1 (en) 2018-08-20 2020-02-27 The Brigham And Women's Hospital, Inc. Degradation domain modifications for spatio-temporal control of rna-guided nucleases
WO2020068304A2 (en) 2018-08-20 2020-04-02 The Broad Institute, Inc. Inhibitors of rna-guided nuclease target binding and uses thereof
WO2020051507A1 (en) 2018-09-06 2020-03-12 The Broad Institute, Inc. Nucleic acid assemblies for use in targeted delivery
EP4268831A2 (en) 2018-09-12 2023-11-01 Fred Hutchinson Cancer Center Reducing cd33 expression to selectively protect therapeutic cells
US12428622B2 (en) 2018-09-12 2025-09-30 Children's Hospital Medical Center Organoid compositions for the production of hematopoietic stem cells and derivatives thereof
US11505578B2 (en) 2018-09-18 2022-11-22 Vnv Newco Inc. Endogenous Gag-based capsids and uses thereof
US11447527B2 (en) 2018-09-18 2022-09-20 Vnv Newco Inc. Endogenous Gag-based capsids and uses thereof
WO2020072816A1 (en) 2018-10-03 2020-04-09 The Broad Institute, Inc. Crispr effector system based diagnostics for hemorrhagic fever detection
US12098425B2 (en) 2018-10-10 2024-09-24 Readcoor, Llc Three-dimensional spatial molecular indexing
WO2020077135A1 (en) 2018-10-10 2020-04-16 Dana-Farber Cancer Institute, Inc. Modulating resistance to bcl-2 inhibitors
WO2020077236A1 (en) 2018-10-12 2020-04-16 The Broad Institute, Inc. Method for extracting nuclei or whole cells from formalin-fixed paraffin-embedded tissues
WO2020081730A2 (en) 2018-10-16 2020-04-23 Massachusetts Institute Of Technology Methods and compositions for modulating microenvironment
US12281338B2 (en) 2018-10-29 2025-04-22 The Broad Institute, Inc. Nucleobase editors comprising GeoCas9 and uses thereof
WO2020092057A1 (en) 2018-10-30 2020-05-07 Yale University Compositions and methods for rapid and modular generation of chimeric antigen receptor t cells
WO2020089645A1 (en) 2018-11-02 2020-05-07 British American Tobacco (Investments) Limited Method of modulating the alkaloid content of a plant
US12402610B2 (en) 2018-11-09 2025-09-02 The Broad Institute, Inc. Methods and compositions for modulating innate lymphoid cell pathogenic effectors
US12165743B2 (en) 2018-11-09 2024-12-10 The Broad Institute, Inc. Compressed sensing for screening and tissue imaging
WO2020102610A1 (en) 2018-11-14 2020-05-22 The Broad Institute, Inc. Crispr system based droplet diagnostic systems and methods
WO2020102608A2 (en) 2018-11-14 2020-05-22 President And Fellows Of Harvard College Multiplexing highly evolving viral variants with sherlock
WO2020099875A1 (en) 2018-11-16 2020-05-22 British American Tobacco (Investments) Limited Methods and means for modifying the alkaloid content of plants
US12077483B2 (en) 2018-12-05 2024-09-03 Intellia Therapeutics, Inc. Modified amine lipids
EP3891276A4 (en) * 2018-12-05 2022-07-27 Fred Hutchinson Cancer Center PRODUCTION WITH REDUCED AND MINIMAL HANDLING OF GENETICALLY MODIFIED CELLS
US12258594B2 (en) 2018-12-05 2025-03-25 The Broad Institute, Inc. Cas proteins with reduced immunogenicity and methods of screening thereof
WO2020123377A1 (en) 2018-12-10 2020-06-18 Neoimmunetech, Inc. Nrf-2 deficient cells and uses thereof
WO2020124050A1 (en) 2018-12-13 2020-06-18 The Broad Institute, Inc. Tiled assays using crispr-cas based detection
US11384344B2 (en) 2018-12-17 2022-07-12 The Broad Institute, Inc. CRISPR-associated transposase systems and methods of use thereof
US12264323B2 (en) 2018-12-17 2025-04-01 The Broad Institute, Inc. CRISPR CPF1 direct repeat variants
WO2020131586A2 (en) 2018-12-17 2020-06-25 The Broad Institute, Inc. Methods for identifying neoantigens
WO2020131862A1 (en) 2018-12-17 2020-06-25 The Broad Institute, Inc. Crispr-associated transposase systems and methods of use thereof
WO2020131632A1 (en) 2018-12-20 2020-06-25 Regeneron Pharmaceuticals, Inc. Nuclease-mediated repeat expansion
US11739156B2 (en) 2019-01-06 2023-08-29 The Broad Institute, Inc. Massachusetts Institute of Technology Methods and compositions for overcoming immunosuppression
US12351837B2 (en) 2019-01-23 2025-07-08 The Broad Institute, Inc. Supernegatively charged proteins and uses thereof
WO2020152466A1 (en) 2019-01-23 2020-07-30 British American Tobacco (Investments) Limited Method for decreasing the alkaloid content of a tobacco plant
US12529092B2 (en) 2019-01-28 2026-01-20 The Broad Institute, Inc. In-situ spatial transcriptomics
WO2020160044A1 (en) 2019-01-28 2020-08-06 The Broad Institute, Inc. In-situ spatial transcriptomics
US11965159B2 (en) 2019-01-29 2024-04-23 The Broad Institute, Inc. Compositions and methods for regulating proteins and nucleic acids activities
WO2020172343A2 (en) 2019-02-19 2020-08-27 Massachusetts Institute Of Technology Methods for treating injuries
US12377170B2 (en) 2019-02-26 2025-08-05 Research Institute At Nationwide Children's Hospital Adeno-associated virus vector delivery of β-sarcoglycan and the treatment of muscular dystrophy
US12215382B2 (en) 2019-03-01 2025-02-04 The General Hospital Corporation Liver protective MARC variants and uses thereof
WO2020182941A1 (en) 2019-03-12 2020-09-17 MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. Cas9 variants with enhanced specificity
WO2020186101A1 (en) 2019-03-12 2020-09-17 The Broad Institute, Inc. Detection means, compositions and methods for modulating synovial sarcoma cells
WO2020186237A1 (en) 2019-03-13 2020-09-17 The Broad Institute, Inc. Microglial progenitors for regeneration of functional microglia in the central nervous system and therapeutics uses thereof
US12419915B2 (en) 2019-03-13 2025-09-23 The Broad Institute, Inc. Microglial progenitors for regeneration of functional microglia in the central nervous system and therapeutics uses thereof
WO2020186223A1 (en) 2019-03-14 2020-09-17 The Broad Institute, Inc. Sherlock assays for tick-borne diseases
WO2020186235A1 (en) 2019-03-14 2020-09-17 The Broad Institute, Inc. Compositions and methods for modulating cgrp signaling to regulate intestinal innate lymphoid cells
WO2020186231A2 (en) 2019-03-14 2020-09-17 The Broad Institute, Inc. Crispr effector system based multiplex diagnostics
WO2020186213A1 (en) 2019-03-14 2020-09-17 The Broad Institute, Inc. Novel nucleic acid modifiers
WO2020191069A1 (en) 2019-03-18 2020-09-24 The Broad Institute, Inc. Modulation of type 2 immunity by targeting clec-2 signaling
US12534714B2 (en) 2019-03-18 2026-01-27 The Broad Institute, Inc. Type VII CRISPR proteins and systems
WO2020191102A1 (en) 2019-03-18 2020-09-24 The Broad Institute, Inc. Type vii crispr proteins and systems
WO2020190927A1 (en) 2019-03-18 2020-09-24 Regeneron Pharmaceuticals, Inc. Crispr/cas dropout screening platform to reveal genetic vulnerabilities associated with tau aggregation
WO2020191079A1 (en) 2019-03-18 2020-09-24 The Broad Institute, Inc. Compositions and methods for modulating metabolic regulators of t cell pathogenicity
WO2020190932A1 (en) 2019-03-18 2020-09-24 Regeneron Pharmaceuticals, Inc. Crispr/cas screening platform to identify genetic modifiers of tau seeding or aggregation
EP4317950A2 (en) 2019-03-18 2024-02-07 Regeneron Pharmaceuticals, Inc. Crispr/cas screening platform to identify genetic modifiers of tau seeding or aggregation
US11643652B2 (en) 2019-03-19 2023-05-09 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US12281303B2 (en) 2019-03-19 2025-04-22 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US12570972B2 (en) 2019-03-19 2026-03-10 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US11447770B1 (en) 2019-03-19 2022-09-20 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US12509680B2 (en) 2019-03-19 2025-12-30 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US11795452B2 (en) 2019-03-19 2023-10-24 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
WO2020205681A1 (en) 2019-03-29 2020-10-08 Massachusetts Institute Of Technology Constructs for continuous monitoring of live cells
WO2020206036A1 (en) 2019-04-01 2020-10-08 The Broad Institute, Inc. Novel nucleic acid modifier
WO2020206046A1 (en) 2019-04-01 2020-10-08 The Broad Institute, Inc. Methods and compositions for cell therapy
WO2020206162A1 (en) 2019-04-03 2020-10-08 Regeneron Pharmaceuticals, Inc. Methods and compositions for insertion of antibody coding sequences into a safe harbor locus
US11111504B2 (en) 2019-04-04 2021-09-07 Regeneron Pharmaceuticals, Inc. Methods for scarless introduction of targeted modifications into targeting vectors
WO2020206134A1 (en) 2019-04-04 2020-10-08 Regeneron Pharmaceuticals, Inc. Methods for scarless introduction of targeted modifications into targeting vectors
US11499164B2 (en) 2019-04-04 2022-11-15 Regeneran Pharmaceuticals, Inc. Methods for scarless introduction of targeted modifications into targeting vectors
WO2020206139A1 (en) 2019-04-04 2020-10-08 Regeneron Pharmaceuticals, Inc. Non-human animals comprising a humanized coagulation factor 12 locus
US12473543B2 (en) 2019-04-17 2025-11-18 The Broad Institute, Inc. Adenine base editors with reduced off-target effects
WO2020223539A1 (en) 2019-04-30 2020-11-05 The Broad Institute, Inc. Methods and compositions for barcoding nucleic acid libraries and cell populations
GB2600568A (en) * 2019-05-03 2022-05-04 Specific Biologics Inc Lipid-encapsulated dual-cleaving endonuclease for DNA and gene editing
US12312615B2 (en) 2019-05-03 2025-05-27 Specific Biologics Inc. Lipid-encapsulated dual-cleaving endonuclease for DNA and gene editing
US11814658B2 (en) 2019-05-03 2023-11-14 Specific Biologics Inc. Lipid-encapsulated dual-cleaving endonuclease for DNA and gene editing
GB2600568B (en) * 2019-05-03 2024-07-31 Specific Biologics Inc Lipid-encapsulated dual-cleaving endonuclease for DNA and gene editing
US12297467B2 (en) 2019-05-03 2025-05-13 Specific Biologics Inc. Lipid-encapsulated dual-cleaving endonuclease for DNA and gene editing
WO2020225719A1 (en) * 2019-05-03 2020-11-12 Specific Biologics Inc. Lipid-encapsulated dual-cleaving endonuclease for dna and gene editing
US12460192B2 (en) 2019-05-03 2025-11-04 Specific Biologics Inc. Lipid-encapsulated dual-cleaving endonuclease for DNA and gene editing
WO2020229533A1 (en) 2019-05-13 2020-11-19 KWS SAAT SE & Co. KGaA Drought tolerance in corn
WO2020229830A1 (en) 2019-05-14 2020-11-19 British American Tobacco (Investments) Limited Method
WO2020232271A1 (en) 2019-05-14 2020-11-19 The Broad Institute, Inc. Compositions and methods for targeting multinucleated cells
WO2020236967A1 (en) 2019-05-20 2020-11-26 The Broad Institute, Inc. Random crispr-cas deletion mutant
WO2020236972A2 (en) 2019-05-20 2020-11-26 The Broad Institute, Inc. Non-class i multi-component nucleic acid targeting systems
WO2020239680A2 (en) 2019-05-25 2020-12-03 KWS SAAT SE & Co. KGaA Haploid induction enhancer
WO2020243371A1 (en) 2019-05-28 2020-12-03 Massachusetts Institute Of Technology Methods and compositions for modulating immune responses
WO2020243661A1 (en) 2019-05-31 2020-12-03 The Broad Institute, Inc. Methods for treating metabolic disorders by targeting adcy5
US12497597B2 (en) 2019-05-31 2025-12-16 Children's Hospital Medical Center Methods of generating and expanding hematopoietic stem cells
US12534709B2 (en) 2019-05-31 2026-01-27 Children's Hospital Medical Center Shaped organoid compositions and methods of making same
WO2020247452A1 (en) 2019-06-04 2020-12-10 Regeneron Pharmaceuticals, Inc. Non-human animals comprising a humanized ttr locus with a beta-slip mutation and methods of use
WO2020247812A1 (en) 2019-06-07 2020-12-10 Regeneron Pharmaceuticals, Inc. Non-human animals comprising a humanized albumin locus
WO2020252340A1 (en) 2019-06-14 2020-12-17 Regeneron Pharmaceuticals, Inc. Models of tauopathy
WO2021003432A1 (en) 2019-07-02 2021-01-07 Fred Hutchinson Cancer Research Center Recombinant ad35 vectors and related gene therapy improvements
WO2021001658A1 (en) 2019-07-03 2021-01-07 British American Tobacco (Investments) Limited Method for modulating the alkaloid content of a tobacco plant
WO2021001659A1 (en) 2019-07-03 2021-01-07 British American Tobacco (Investments) Limited Method for modifying alkaloid content in plants
EP3772542A1 (en) 2019-08-07 2021-02-10 KWS SAAT SE & Co. KGaA Modifying genetic variation in crops by modulating the pachytene checkpoint protein 2
WO2021030627A1 (en) 2019-08-13 2021-02-18 The General Hospital Corporation Methods for predicting outcomes of checkpoint inhibition and treatment thereof
US12421557B2 (en) 2019-08-16 2025-09-23 The Broad Institute, Inc. Methods for predicting outcomes and treating colorectal cancer using a cell atlas
US12258573B2 (en) 2019-08-21 2025-03-25 Research Institute At Nationwide Children's Hospital Adeno-associated virus vector delivery of alpha-sarcoglycan and the treatment of muscular dystrophy
WO2021041922A1 (en) 2019-08-30 2021-03-04 The Broad Institute, Inc. Crispr-associated mu transposase systems
WO2021046257A1 (en) 2019-09-03 2021-03-11 The Broad Institute, Inc. Crispr effector system based multiplex cancer diagnostics
WO2021050974A1 (en) 2019-09-12 2021-03-18 The Broad Institute, Inc. Engineered adeno-associated virus capsids
WO2021050940A1 (en) 2019-09-13 2021-03-18 Regeneron Pharmaceuticals, Inc. Transcription modulation in animals using crispr/cas systems delivered by lipid nanoparticles
US12264367B2 (en) 2019-09-19 2025-04-01 The Broad Institute, Inc. Methods of in vivo evaluation of gene function
WO2021055855A1 (en) 2019-09-20 2021-03-25 The Broad Institute, Inc. Compositions and methods for delivering cargo to a target cell
WO2021055874A1 (en) 2019-09-20 2021-03-25 The Broad Institute, Inc. Novel type vi crispr enzymes and systems
US12297426B2 (en) 2019-10-01 2025-05-13 The Broad Institute, Inc. DNA damage response signature guided rational design of CRISPR-based systems and therapies
US12195725B2 (en) 2019-10-03 2025-01-14 Dana-Farber Cancer Institute, Inc. Compositions and methods for modulating and detecting tissue specific TH17 cell pathogenicity
US11981922B2 (en) 2019-10-03 2024-05-14 Dana-Farber Cancer Institute, Inc. Methods and compositions for the modulation of cell interactions and signaling in the tumor microenvironment
US11793787B2 (en) 2019-10-07 2023-10-24 The Broad Institute, Inc. Methods and compositions for enhancing anti-tumor immunity by targeting steroidogenesis
US12435330B2 (en) 2019-10-10 2025-10-07 The Broad Institute, Inc. Methods and compositions for prime editing RNA
US12410447B2 (en) 2019-10-16 2025-09-09 The Broad Institute, Inc. Engineered muscle targeting compositions
WO2021074367A1 (en) 2019-10-17 2021-04-22 KWS SAAT SE & Co. KGaA Enhanced disease resistance of crops by downregulation of repressor genes
US11844800B2 (en) 2019-10-30 2023-12-19 Massachusetts Institute Of Technology Methods and compositions for predicting and preventing relapse of acute lymphoblastic leukemia
WO2021092513A1 (en) 2019-11-08 2021-05-14 Regeneron Pharmaceuticals, Inc. Crispr and aav strategies for x-linked juvenile retinoschisis therapy
US12195723B2 (en) 2019-11-08 2025-01-14 The Broad Institute, Inc. Engineered antigen presenting cells and uses thereof
WO2021108363A1 (en) 2019-11-25 2021-06-03 Regeneron Pharmaceuticals, Inc. Crispr/cas-mediated upregulation of humanized ttr allele
US12241830B2 (en) 2019-12-06 2025-03-04 Broad Institute, Inc. Living biosensors
WO2021116448A1 (en) 2019-12-13 2021-06-17 KWS SAAT SE & Co. KGaA Method for increasing cold or frost tolerance in a plant
EP3835309A1 (en) 2019-12-13 2021-06-16 KWS SAAT SE & Co. KGaA Method for increasing cold or frost tolerance in a plant
US12139719B2 (en) 2019-12-13 2024-11-12 KWS SAAT SE & Co. KGaA Method for increasing cold or frost tolerance in a plant
JP2023508362A (en) * 2019-12-23 2023-03-02 ザ リージェンツ オブ ザ ユニバーシティ オブ カリフォルニア CRISPR-CAS EFFECTOR POLYPEPTIDES AND METHODS OF USE THEREOF
WO2021133829A1 (en) * 2019-12-23 2021-07-01 The Regents Of The University Of California Crispr-cas effector polypeptides and methods of use thereof
US12252705B2 (en) 2020-01-17 2025-03-18 The Broad Institute, Inc. Small type II-D Cas proteins and methods of use thereof
US12165747B2 (en) 2020-01-23 2024-12-10 The Broad Institute, Inc. Molecular spatial mapping of metastatic tumor microenvironment
US12559790B2 (en) 2020-01-29 2026-02-24 10X Genomics, Inc. Compositions and methods for analyte detection
EP3872190A1 (en) 2020-02-26 2021-09-01 Antibodies-Online GmbH A method of using cut&run or cut&tag to validate crispr-cas targeting
WO2021178556A1 (en) 2020-03-04 2021-09-10 Regeneron Pharmaceuticals, Inc. Methods and compositions for sensitization of tumor cells to immune therapy
WO2021188734A1 (en) 2020-03-17 2021-09-23 The Broad Institute, Inc. Crispr system high throughput diagnostic systems and methods
US11639523B2 (en) 2020-03-23 2023-05-02 The Broad Institute, Inc. Type V CRISPR-Cas systems and use thereof
WO2021195079A1 (en) 2020-03-23 2021-09-30 Regeneron Pharmaceuticals, Inc. Non-human animals comprising a humanized ttr locus comprising a v30m mutation and methods of use
US11453907B2 (en) 2020-03-23 2022-09-27 The Broad Institute, Inc. Crispr effector system based coronavirus diagnostics
US12522863B2 (en) 2020-03-23 2026-01-13 The Broad Institute, Inc. Crispr effector system based coronavirus diagnostics
US11851702B2 (en) 2020-03-23 2023-12-26 The Broad Institute, Inc. Rapid diagnostics
WO2021202800A1 (en) 2020-03-31 2021-10-07 Arbor Biotechnologies, Inc. Compositions comprising a cas12i2 variant polypeptide and uses thereof
US12057197B2 (en) 2020-04-03 2024-08-06 Creyon Bio, Inc. Oligonucleotide-based machine learning
US12400739B2 (en) 2020-04-03 2025-08-26 Creyon Bio, Inc. Oligonucleotide-based machine learning
WO2021202938A1 (en) 2020-04-03 2021-10-07 Creyon Bio, Inc. Oligonucleotide-based machine learning
WO2021205000A2 (en) 2020-04-09 2021-10-14 R.J. Reynolds Tobacco Company Method
US12031126B2 (en) 2020-05-08 2024-07-09 The Broad Institute, Inc. Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence
US11912985B2 (en) 2020-05-08 2024-02-27 The Broad Institute, Inc. Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence
US20230175015A1 (en) * 2020-05-12 2023-06-08 Myogene Bio Llc Immunosuppressive agents and viral delivery re-dosing methods for gene therapy
WO2021239986A1 (en) 2020-05-29 2021-12-02 KWS SAAT SE & Co. KGaA Plant haploid induction
WO2022010286A1 (en) * 2020-07-08 2022-01-13 경상국립대학교산학협력단 Donor nucleic acid used for gene correction through microhomology-mediated end joining and uses thereof
WO2022018667A1 (en) 2020-07-24 2022-01-27 Pfizer Inc. Combination therapies using cdk2 and cdc25a inhibitors
WO2022032228A1 (en) 2020-08-07 2022-02-10 The Broad Institute, Inc. Therapeutic targeting of phosphate dysregulation in cancer via the xpr1:kidins220 protein complex
US12203136B2 (en) 2020-08-17 2025-01-21 Readcoor, Llc Methods and systems for spatial mapping of genetic variants
US12545920B2 (en) 2020-09-10 2026-02-10 Monsanto Technology Llc Increasing gene editing and site-directed integration events utilizing meiotic and germline promoters
US11981900B2 (en) 2020-09-10 2024-05-14 Monsanto Technology Llc Increasing gene editing and site-directed integration events utilizing meiotic and germline promoters
WO2022068912A1 (en) 2020-09-30 2022-04-07 Huigene Therapeutics Co., Ltd. Engineered crispr/cas13 system and uses thereof
EP4001429A1 (en) 2020-11-16 2022-05-25 Antibodies-Online GmbH Analysis of crispr-cas binding and cleavage sites followed by high-throughput sequencing (abc-seq)
WO2022120022A1 (en) 2020-12-02 2022-06-09 Regeneron Pharmaceuticals, Inc. Crispr sam biosensor cell lines and methods of use thereof
WO2022174099A2 (en) 2021-02-11 2022-08-18 Arbor Biotechnologies, Inc. Compositions comprising a variant cas12i4 polypeptide and uses thereof
CN112997966A (en) * 2021-03-08 2021-06-22 国家卫生健康委科学技术研究所 Mouse model knocking-in miRNA-125a based on CRISPR/Cas9 technology and construction method
WO2022188039A1 (en) 2021-03-09 2022-09-15 Huigene Therapeutics Co., Ltd. Engineered crispr/cas13 system and uses thereof
WO2022188797A1 (en) 2021-03-09 2022-09-15 Huigene Therapeutics Co., Ltd. Engineered crispr/cas13 system and uses thereof
WO2022240846A1 (en) 2021-05-10 2022-11-17 Sqz Biotechnologies Company Methods for delivering genome editing molecules to the nucleus or cytosol of a cell and uses thereof
WO2022247873A1 (en) 2021-05-27 2022-12-01 中国科学院动物研究所 Engineered cas12i nuclease, effector protein and use thereof
WO2022251644A1 (en) 2021-05-28 2022-12-01 Lyell Immunopharma, Inc. Nr4a3-deficient immune cells and uses thereof
WO2022256437A1 (en) 2021-06-02 2022-12-08 Lyell Immunopharma, Inc. Nr4a3-deficient immune cells and uses thereof
WO2023004367A2 (en) 2021-07-20 2023-01-26 The Broad Institute, Inc. Engineered targeting compositions for endothelial cells of the central nervous system vasculature and methods of use thereof
WO2023004422A2 (en) 2021-07-22 2023-01-26 Arbor Biotechnologies, Inc. Crispr-associated transposon systems and methods of using same
WO2023006933A1 (en) 2021-07-30 2023-02-02 KWS SAAT SE & Co. KGaA Plants with improved digestibility and marker haplotypes
WO2023019243A1 (en) 2021-08-12 2023-02-16 Arbor Biotechnologies, Inc. Compositions comprising a variant cas12i3 polypeptide and uses thereof
US11884915B2 (en) 2021-09-10 2024-01-30 Agilent Technologies, Inc. Guide RNAs with chemical modification for prime editing
WO2023064924A1 (en) 2021-10-14 2023-04-20 Codiak Biosciences, Inc. Modified producer cells for extracellular vesicle production
US12285497B2 (en) 2021-10-15 2025-04-29 Research Institute At Nationwide Children's Hospital Self-complementary adeno-associated virus vector and its use in treatment of muscular dystrophy
WO2023077053A2 (en) 2021-10-28 2023-05-04 Regeneron Pharmaceuticals, Inc. Crispr/cas-related methods and compositions for knocking out c5
US11649444B1 (en) 2021-11-02 2023-05-16 Huidagene Therapeutics Co., Ltd. CRISPR-CAS12i systems
WO2023093862A1 (en) 2021-11-26 2023-06-01 Epigenic Therapeutics Inc. Method of modulating pcsk9 and uses thereof
WO2023108047A1 (en) 2021-12-08 2023-06-15 Regeneron Pharmaceuticals, Inc. Mutant myocilin disease model and uses thereof
US12359213B2 (en) * 2021-12-14 2025-07-15 Institute Of Medicinal Plant Development, Chinese Academy Of Medical Science Method and use for identifying plant species based on whole genome analysis and genome editing
US20230193301A1 (en) * 2021-12-14 2023-06-22 Institute of Medicinal Plant Development (IMPLAD), CAMS & PUMC Method and use for identifying plant species based on whole genome analysis and genome editing
WO2023129974A1 (en) 2021-12-29 2023-07-06 Bristol-Myers Squibb Company Generation of landing pad cell lines
WO2023150181A1 (en) 2022-02-01 2023-08-10 President And Fellows Of Harvard College Methods and compositions for treating cancer
WO2023150637A1 (en) 2022-02-02 2023-08-10 Inscripta, Inc. Nucleic acid-guided nickase fusion proteins
WO2023150620A1 (en) 2022-02-02 2023-08-10 Regeneron Pharmaceuticals, Inc. Crispr-mediated transgene insertion in neonatal cells
WO2023148476A1 (en) 2022-02-03 2023-08-10 Nicoventures Trading Limited Method of modulating alkaloid content in tobacco plants
WO2023148478A1 (en) 2022-02-03 2023-08-10 Nicoventures Trading Limited Method of modulating alkaloid content in tobacco plants
WO2023148475A1 (en) 2022-02-04 2023-08-10 Nicoventures Trading Limited Method of modulating alkaloid content in tobacco plants
WO2023163131A1 (en) 2022-02-28 2023-08-31 国立大学法人東海国立大学機構 Medicine for disease caused by frame-shift mutation
WO2023196818A1 (en) 2022-04-04 2023-10-12 The Regents Of The University Of California Genetic complementation compositions and methods
WO2023194747A1 (en) 2022-04-07 2023-10-12 Nicoventures Trading Limited Method of modulating the alkaloid content of tobacco
WO2023194746A1 (en) 2022-04-07 2023-10-12 Nicoventures Trading Limited Method for modulating the alkaloid content of tobacco
WO2023199065A1 (en) 2022-04-14 2023-10-19 Nicoventures Trading Limited Method of modulating the alkaloid content of tobacco
WO2023199064A1 (en) 2022-04-14 2023-10-19 Nicoventures Trading Limited Method of modulating the alkaloid content of tobacco
WO2023209373A1 (en) 2022-04-27 2023-11-02 Nicoventures Trading Limited Method of modulating the alkaloid content of tobacco
WO2023209372A1 (en) 2022-04-27 2023-11-02 Nicoventures Trading Limited Method of modulating the alkaloid content of tobacco
WO2023212677A2 (en) 2022-04-29 2023-11-02 Regeneron Pharmaceuticals, Inc. Identification of tissue-specific extragenic safe harbors for gene therapy approaches
WO2023220603A1 (en) 2022-05-09 2023-11-16 Regeneron Pharmaceuticals, Inc. Vectors and methods for in vivo antibody production
WO2023225564A1 (en) 2022-05-18 2023-11-23 The Broad Institute, Inc. Engineered viral capsids with increased stability and methods of use thereof
WO2023225665A1 (en) 2022-05-19 2023-11-23 Lyell Immunopharma, Inc. Polynucleotides targeting nr4a3 and uses thereof
WO2023235726A2 (en) 2022-05-31 2023-12-07 Regeneron Pharmaceuticals, Inc. Crispr interference therapeutics for c9orf72 repeat expansion disease
WO2023235725A2 (en) 2022-05-31 2023-12-07 Regeneron Pharmaceuticals, Inc. Crispr-based therapeutics for c9orf72 repeat expansion disease
US12098399B2 (en) 2022-06-24 2024-09-24 Tune Therapeutics, Inc. Compositions, systems, and methods for epigenetic regulation of proprotein convertase subtilisin/kexin type 9 (PCSK9) gene expression
WO2024016003A2 (en) 2022-07-14 2024-01-18 The Broad Institute, Inc. Aav capsids that enable cns-wide gene delivery through interactions with the transferrin receptor
WO2024020557A1 (en) 2022-07-22 2024-01-25 Arbor Biotechnologies, Inc. Compositions comprising a variant nuclease and uses thereof
WO2024020567A1 (en) 2022-07-22 2024-01-25 Arbor Biotechnologies, Inc. Compositions comprising a variant polypeptide and uses thereof
WO2024026474A1 (en) 2022-07-29 2024-02-01 Regeneron Pharmaceuticals, Inc. Compositions and methods for transferrin receptor (tfr)-mediated delivery to the brain and muscle
WO2024031053A1 (en) 2022-08-05 2024-02-08 Regeneron Pharmaceuticals, Inc. Aggregation-resistant variants of tdp-43
WO2024042199A1 (en) 2022-08-26 2024-02-29 KWS SAAT SE & Co. KGaA Use of paired genes in hybrid breeding
WO2024064952A1 (en) 2022-09-23 2024-03-28 Lyell Immunopharma, Inc. Methods for culturing nr4a-deficient cells overexpressing c-jun
WO2024064958A1 (en) 2022-09-23 2024-03-28 Lyell Immunopharma, Inc. Methods for culturing nr4a-deficient cells
WO2024073606A1 (en) 2022-09-28 2024-04-04 Regeneron Pharmaceuticals, Inc. Antibody resistant modified receptors to enhance cell-based therapies
US12584118B2 (en) 2022-09-30 2026-03-24 President And Fellows Of Harvard College Cas9 variants and uses thereof
WO2024077174A1 (en) 2022-10-05 2024-04-11 Lyell Immunopharma, Inc. Methods for culturing nr4a-deficient cells
WO2024098002A1 (en) 2022-11-04 2024-05-10 Regeneron Pharmaceuticals, Inc. Calcium voltage-gated channel auxiliary subunit gamma 1 (cacng1) binding proteins and cacng1-mediated delivery to skeletal muscle
WO2024107765A2 (en) 2022-11-14 2024-05-23 Regeneron Pharmaceuticals, Inc. Compositions and methods for fibroblast growth factor receptor 3-mediated delivery to astrocytes
WO2024124044A1 (en) 2022-12-07 2024-06-13 The Brigham And Women’S Hospital, Inc. Compositions and methods targeting sat1 for enhancing anti¬ tumor immunity during tumor progression
US12582104B2 (en) 2022-12-08 2026-03-24 Regeneron Pharmaceuticals, Inc. Mutant myocilin disease model and uses thereof
WO2024133600A1 (en) 2022-12-20 2024-06-27 Nanocell Therapeutics B.V. Integrating and self-inactivating viral vectors and constructs and uses thereof
WO2024155597A1 (en) 2023-01-17 2024-07-25 Inscripta, Inc. Methods and compositions of co-expression of t7rna polymerase and inhibitory rna aptamers
WO2024153938A1 (en) 2023-01-20 2024-07-25 Nicoventures Trading Limited Method
WO2024159071A1 (en) 2023-01-27 2024-08-02 Regeneron Pharmaceuticals, Inc. Modified rhabdovirus glycoproteins and uses thereof
WO2024163842A2 (en) 2023-02-03 2024-08-08 The Broad Institute, Inc. Delivering genes to the brain endothelium to treat lysosomal storage disorder-derived neuropathology
WO2024168265A1 (en) 2023-02-10 2024-08-15 Possible Medicines Llc Aav delivery of rna guided recombination system
WO2024168253A1 (en) 2023-02-10 2024-08-15 Possible Medicines Llc Delivery of an rna guided recombination system
WO2024180236A1 (en) 2023-03-02 2024-09-06 Universitetet I Oslo Brassica plants with improved seed retention
WO2024192141A1 (en) 2023-03-13 2024-09-19 Dana-Farber Cancer Institute, Inc. Treatment of cancers having a drug-resistant mesenchymal cell state
WO2024197185A1 (en) 2023-03-21 2024-09-26 The Broad Institute, Inc. Methods and compositions for dissecting organelle physiology
WO2024206911A2 (en) 2023-03-30 2024-10-03 Children's Hospital Medical Center Clinical-grade organoids
WO2024220741A1 (en) 2023-04-19 2024-10-24 Flagship Pioneering Innovations Vii, Llc Compositions and methods for the production of libraries
WO2024226838A2 (en) 2023-04-25 2024-10-31 The Brigham And Women's Hospital, Inc. Treatment of autoimmune diseases having a pathogenic t cell state
WO2024236547A1 (en) 2023-05-18 2024-11-21 Inceptor Bio, Llc Modified phagocytic cells expressing chimeric antigen receptors comprising a herpes virus entry mediator (hvem) co-stimulatory domain and uses thereof
WO2024238977A2 (en) 2023-05-18 2024-11-21 Children's Hospital Medical Center Liver organoids with intrahepatic sympathetic nerves, and methods of use thereof
WO2024259309A1 (en) 2023-06-15 2024-12-19 Regeneron Pharmaceuticals, Inc. Gene therapy for hearing disorders
WO2024255823A1 (en) 2023-06-16 2024-12-19 益杰立科(上海)生物科技有限公司 Epigenetic editing tool for targeting hepatitis b virus gene
WO2024263961A2 (en) 2023-06-23 2024-12-26 Children's Hospital Medical Center Methods of matrix-free suspension culture
WO2025006419A1 (en) 2023-06-26 2025-01-02 Flagship Pioneering Innovations Vii, Llc Engineered plasmodia and related methods
WO2025006963A1 (en) 2023-06-30 2025-01-02 Regeneron Pharmaceuticals, Inc. Methods and compositions for increasing homology-directed repair
WO2025029654A2 (en) 2023-07-28 2025-02-06 Regeneron Pharmaceuticals, Inc. Use of bgh-sv40l tandem polya to enhance transgene expression during unidirectional gene insertion
WO2025029657A2 (en) 2023-07-28 2025-02-06 Regeneron Pharmaceuticals, Inc. Anti-tfr:gaa and anti-cd63:gaa insertion for treatment of pompe disease
WO2025029662A1 (en) 2023-07-28 2025-02-06 Regeneron Pharmaceuticals, Inc. Anti-tfr: acid sphingomyelinase for treatment of acid sphingomyelinase deficiency
WO2025038750A2 (en) 2023-08-14 2025-02-20 President And Fellows Of Harvard College Methods and compositions for treating cancer
WO2025049524A1 (en) 2023-08-28 2025-03-06 Regeneron Pharmaceuticals, Inc. Cxcr4 antibody-resistant modified receptors
WO2025046513A1 (en) 2023-08-29 2025-03-06 Inceptor Bio, Llc Methods of manufacturing myeloid-derived cells from hematopoietic stem cells and compositions and uses thereof
WO2025049788A1 (en) 2023-08-29 2025-03-06 The Broad Institute, Inc. Optical genetic screens of intracellular and intercellular transcriptional circuits with perturb-fish
WO2025059533A1 (en) 2023-09-13 2025-03-20 The Broad Institute, Inc. Crispr enzymes and systems
WO2025072383A1 (en) 2023-09-25 2025-04-03 The Broad Institute, Inc. Viral open reading frames, uses thereof, and methods of detecting the same
WO2025072803A1 (en) 2023-09-29 2025-04-03 Children's Hospital Medical Center Ntrk2 signaling-mediated alveolar capillary injury and repair
WO2025075911A1 (en) 2023-10-02 2025-04-10 Inscripta, Inc. Engineered gpp synthases
WO2025085423A1 (en) 2023-10-19 2025-04-24 The Broad Institute, Inc. Method of multi-locus crispri targeting with a single truncated guide
WO2025097055A2 (en) 2023-11-02 2025-05-08 The Broad Institute, Inc. Compositions and methods of use of t cells in immunotherapy
WO2025096916A1 (en) 2023-11-03 2025-05-08 The Broad Institute, Inc. Multi-site editing in living cells
WO2025117544A1 (en) 2023-11-29 2025-06-05 The Broad Institute, Inc. Engineered omega guide molecule and iscb compositions, systems, and methods of use thereof
WO2025129158A1 (en) 2023-12-15 2025-06-19 The Broad Institute, Inc. Engineered arc delivery vesicles and uses thereof
WO2025155923A1 (en) 2024-01-17 2025-07-24 The Broad Institute, Inc. Aav capsid modifications that enable improved cns-wide gene delivery through interactions with the transferrin receptor
WO2025160155A1 (en) 2024-01-22 2025-07-31 The Broad Institute, Inc. Epigenetic targeting of prion diseases
WO2025166152A1 (en) 2024-02-02 2025-08-07 The Broad Institute, Inc. Multiplexed perturbation and decoding in pooled genetic screens
WO2025184567A1 (en) 2024-03-01 2025-09-04 Regeneron Pharmaceuticals, Inc. Methods and compositions for re-dosing aav using anti-cd40 antagonistic antibody to suppress host anti-aav antibody response
WO2025212920A1 (en) 2024-04-03 2025-10-09 Children's Hospital Medical Center Multi-zonal liver organoids
WO2025217163A2 (en) 2024-04-08 2025-10-16 The Broad Institute, Inc. Novel aav capsids binding to human cd59
WO2025217202A1 (en) 2024-04-08 2025-10-16 Children's Hospital Medical Center Bile duct organoid
WO2025217174A1 (en) 2024-04-08 2025-10-16 The Broad Institute, Inc. Aav capsid modifications that enable improved cns-wide gene delivery through interactions with carbonic anhydrase iv
WO2025217398A1 (en) 2024-04-10 2025-10-16 Lyell Immunopharma, Inc. Methods for culturing cells with improved culture medium
WO2025235388A1 (en) 2024-05-06 2025-11-13 Regeneron Pharmaceuticals, Inc. Transgene genomic identification by nuclease-mediated long read sequencing
WO2025244671A1 (en) 2024-05-22 2025-11-27 The Scripps Research Institute Compositions for use in treating haploinsufficiency diseases
WO2025250808A1 (en) 2024-05-29 2025-12-04 The Brigham And Women’S Hospital, Inc. Anti-crispr delivery compositions and methods
WO2025259669A1 (en) 2024-06-10 2025-12-18 Regeneron Pharmaceuticals, Inc. Methods and systems for characterizing modified oligonucleotides
WO2025265017A1 (en) 2024-06-20 2025-12-26 Regeneron Pharmaceuticals, Inc. Ass1 gene insertion for the treatment of citrullinemia type i
WO2026047626A1 (en) 2024-08-30 2026-03-05 Inceptor Bio, Llc Compositions and methods involving immune cells engineered for binding bispecific antibodies for use in cell therapy

Also Published As

Publication number Publication date
CN105164264B (en) 2021-05-07
EP2931897A2 (en) 2015-10-21
JP2023073245A (en) 2023-05-25
IL239317A0 (en) 2015-07-30
JP2022040308A (en) 2022-03-10
US20210269831A1 (en) 2021-09-02
WO2014093622A3 (en) 2014-08-07
JP7013406B2 (en) 2022-02-15
US20140242699A1 (en) 2014-08-28
EP4549566A3 (en) 2025-07-09
EP3031921A1 (en) 2016-06-15
US11041173B2 (en) 2021-06-22
US20170152528A1 (en) 2017-06-01
AU2013359199C1 (en) 2021-06-17
AU2025203782A1 (en) 2025-06-12
US12252707B2 (en) 2025-03-18
CN110872583A (en) 2020-03-10
DK2931897T3 (en) 2018-02-05
US20250382642A1 (en) 2025-12-18
US20140179770A1 (en) 2014-06-26
IL293526A (en) 2022-08-01
IL239317B (en) 2022-07-01
EP3327127A1 (en) 2018-05-30
US20170107536A1 (en) 2017-04-20
AU2013359199B2 (en) 2019-10-31
EP3327127B1 (en) 2021-03-24
SG10201912328UA (en) 2020-02-27
EP4299741A3 (en) 2024-02-28
MX2015007550A (en) 2017-02-02
JP2016501531A (en) 2016-01-21
WO2014093622A8 (en) 2014-12-04
KR20150105956A (en) 2015-09-18
EP2931897B1 (en) 2017-11-01
CA2894681A1 (en) 2014-06-19
MX2022001378A (en) 2022-06-23
SG10201707569YA (en) 2017-10-30
ES2658401T3 (en) 2018-03-09
EP3031921B1 (en) 2025-03-12
AU2013359199A1 (en) 2015-07-30
HK1252619A1 (en) 2019-05-31
SG11201504523UA (en) 2015-07-30
AU2025203782A9 (en) 2026-03-19
AU2019283878A1 (en) 2020-01-23
HK1220725A1 (en) 2017-05-12
CN105164264A (en) 2015-12-16
HK1215048A1 (en) 2016-08-12
DK3327127T3 (en) 2021-06-28
US20250250589A1 (en) 2025-08-07
JP7228059B2 (en) 2023-02-22
JP2025181841A (en) 2025-12-11
JP2019103513A (en) 2019-06-27
AU2022203759B2 (en) 2025-02-27
JP7736729B2 (en) 2025-09-09
MX389793B (en) 2025-03-20
ES2883590T3 (en) 2021-12-09
BR112015013784A2 (en) 2017-07-11
ZA201504132B (en) 2022-03-30
WO2014093622A9 (en) 2014-11-06
RU2015128057A (en) 2019-03-27
AU2022203759A1 (en) 2022-06-23
EP4549566A2 (en) 2025-05-07
AU2019283878B2 (en) 2022-06-09
RU2721275C2 (en) 2020-05-18
US20150020223A1 (en) 2015-01-15
US20230399662A1 (en) 2023-12-14
US20240035048A1 (en) 2024-02-01
EP4299741A2 (en) 2024-01-03

Similar Documents

Publication Publication Date Title
US12252707B2 (en) Delivery, Engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
US20210361779A1 (en) Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using viral components
EP3011032B1 (en) Delivery, engineering and optimization of systems, methods and compositions for targeting and modeling diseases and disorders of post mitotic cells
WO2015089419A9 (en) Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using particle delivery components
HK1252619B (en) Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
HK1220725B (en) Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
HK1215048B (en) Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
BR122024006902A2 (en) APPLICATION, MANIPULATION AND OPTIMIZATION OF SYSTEMS, METHODS AND COMPOSITIONS FOR SEQUENCE MANIPULATION AND THERAPEUTIC APPLICATIONS

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 201380072752.2

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13814362

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2894681

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 239317

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2015547543

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: MX/A/2015/007550

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 20157018653

Country of ref document: KR

Kind code of ref document: A

REEP Request for entry into the european phase

Ref document number: 2013814362

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2013814362

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2015128057

Country of ref document: RU

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2013359199

Country of ref document: AU

Date of ref document: 20131212

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112015013784

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112015013784

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20150611