WO2014004578A1 - Temperature stable vaccine formulations - Google Patents

Temperature stable vaccine formulations Download PDF

Info

Publication number
WO2014004578A1
WO2014004578A1 PCT/US2013/047712 US2013047712W WO2014004578A1 WO 2014004578 A1 WO2014004578 A1 WO 2014004578A1 US 2013047712 W US2013047712 W US 2013047712W WO 2014004578 A1 WO2014004578 A1 WO 2014004578A1
Authority
WO
WIPO (PCT)
Prior art keywords
composition
vaccine
sugar
rpa
antigen
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2013/047712
Other languages
English (en)
French (fr)
Inventor
Jee Look
Christian Fernando RUIZ
Aaron Paul MILES
Richard William WELCH
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Emergent Product Development Gaithersburg Inc
Original Assignee
Emergent Product Development Gaithersburg Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to SG11201408262XA priority Critical patent/SG11201408262XA/en
Priority to KR20157000755A priority patent/KR20150034170A/ko
Priority to AU2013280480A priority patent/AU2013280480B2/en
Priority to HK15108032.6A priority patent/HK1207312A1/xx
Priority to CA2877130A priority patent/CA2877130A1/en
Priority to CN201380037918.7A priority patent/CN104470506A/zh
Priority to RU2014151424A priority patent/RU2014151424A/ru
Priority to JP2015520412A priority patent/JP2015525748A/ja
Application filed by Emergent Product Development Gaithersburg Inc filed Critical Emergent Product Development Gaithersburg Inc
Priority to IN38MUN2015 priority patent/IN2015MN00038A/en
Priority to EP13809706.8A priority patent/EP2863898A4/en
Priority to US14/410,942 priority patent/US20150335752A1/en
Publication of WO2014004578A1 publication Critical patent/WO2014004578A1/en
Priority to IL236380A priority patent/IL236380A0/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/14Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles
    • A61K9/19Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles lyophilised, i.e. freeze-dried, solutions or dispersions
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/02Bacterial antigens
    • A61K39/07Bacillus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/39Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/02Inorganic compounds
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/16Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing nitrogen, e.g. nitro-, nitroso-, azo-compounds, nitriles, cyanates
    • A61K47/18Amines; Amides; Ureas; Quaternary ammonium compounds; Amino acids; Oligopeptides having up to five amino acids
    • A61K47/183Amino acids, e.g. glycine, EDTA or aspartame
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/24Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing atoms other than carbon, hydrogen, oxygen, halogen, nitrogen or sulfur, e.g. cyclomethicone or phospholipids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/26Carbohydrates, e.g. sugar alcohols, amino sugars, nucleic acids, mono-, di- or oligo-saccharides; Derivatives thereof, e.g. polysorbates, sorbitan fatty acid esters or glycyrrhizin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55505Inorganic adjuvants

Definitions

  • the present invention relates to temperature stable vaccine formulations containing an antigen adsorbed to an aluminum adjuvant and methods of preparing such formulations.
  • the invention includes lyophilized and frozen vaccine formulations.
  • the invention includes temperature stable vaccines, methods of making temperature stable vaccines and methods of use.
  • Anthrax is a well-known infectious disease caused by a Gram-positive bacterium
  • Bacillus anthracis Bacillus anthracis (B. anthracis).
  • Bacillus anthracis Among the three types of anthrax infection (cutaneous, gastrointestinal, and inhalation), cutaneous anthrax is the most common and is relatively easily treatable with various antibiotics. The other two types of anthrax infections are rare, but usually fatal even with aggressive anti-microbial therapy.
  • the major virulence factor, anthrax toxin is composed of three proteins: protective antigen (PA, 83 kilo Dalton, kDa), edema factor (EF, 89 kDa), and lethal factor (LF, 90 kDa).
  • PA protective antigen
  • EF edema toxin
  • LF lethal factor
  • PA is a cell receptor-binding protein and delivers the other two proteins (EF and LF) into the cytosol of infected cells.
  • the most effective known method for preventing anthrax is vaccination.
  • the current and only FDA-approved anthrax vaccine in the United States (produced by Emergent BioSolutions Inc. under the trademark BioThrax® (Anthrax Vaccine Adsorbed)) is produced from a sterile cell- free filtrate from an avirulent B. anthracis V770-NP1-R strain.
  • the licensed anthrax vaccine is also called Anthrax Vaccine Adsorbed (or AVA).
  • the vaccine primarily consists of PA, and aluminum hydroxide is used as an adjuvant.
  • the vaccine was developed during the 1950s and 1960s and is licensed by the FDA to Emergent BioSolutions Inc.
  • the vaccine shows less than 0.06% systemic reactions.
  • the ability of the vaccine to elicit an immune response in humans is well-documented.
  • the AVA vaccine is currently licensed for five doses over 18 months followed by annual boosts.
  • PA vaccines are effective and safe, new immunogenic compositions for preparing a vaccine that protects a subject against a lethal B. anthracis infection using recombinant technologies are under development. Because protective antigen (PA) is the common factor required for both the actions of LF and EF, it is often used to prepare vaccines for anthrax. Examples of PA vaccines in development include those disclosed in US patents 6,316,006 and 6,387,665 and patent applications US 2010/0183675, US201 1/0229507 and WO2010/053610.
  • Vaccines such as an AVA and PA typically contain at least one adjuvant to enhance a subject's immune response.
  • Aluminum salt adjuvants frequently referred to as alum, are currently the most widely used adjuvant for use in humans.
  • Alum is usually aluminum hydroxide (also marketed as ALHYDROGEL® (aluminum hydroxide) or aluminum phosphate).
  • ALHYDROGEL® aluminum hydroxide
  • Anthrax vaccines (such as recombinant PA) are formulated with ALHYDROGEL which binds the antigen.
  • a vaccine that is dependent on a cold chain may also take longer to distribute to those in need in a timely manner.
  • the ability to rapidly deliver vaccines and other medical countermeasures is critical. Eliminating dependence on the cold chain for distribution would lead to more prompt and efficient delivery of medical countermeasures in a variety of climates.
  • lyophilization also referred to as freeze drying, is a process that improves the long term stability of a vaccine. The process involves freezing the liquid vaccine formulation and subliming the frozen formulation under vacuum. Other technologies such as spray drying and foam drying have been developed with the aim of producing a stable, dry powder vaccine. These newer technologies produce dry powder vaccine material without the need for freezing and can be used with an alum containing vaccine. See, for instance, Chen et al, 2010, Vaccine 28:5093-5099. However, these newer technologies are still in their infancy and have yet to be used in the production of a licensed vaccine in the United States.
  • Freezing of vaccine compositions containing alum generally induces aggregation of the aluminum particles and causes degradation of the antigen adsorbed onto the alum adjuvant resulting in potency loss. In addition, freezing causes reduction of the height of the settled aluminum gel (commonly referred to as gel collapse).
  • a vaccine that contains alum that can withstand freezing.
  • Such a vaccine may be subjected to freezing as part of the manufacturing process (e.g., a lyophilized or frozen vaccine), shipping process or during storage.
  • the present invention discloses novel formulations for the production of temperature stable vaccines containing alum.
  • the present invention provides vaccine formulations that contain alum and are capable of being frozen with little to no reduction of potency.
  • the frozen vaccine composition exhibits little to no alum gel collapse as a result of freezing.
  • the vaccine or composition comprises at least 20% sugar which acts as a stabilizer. In one embodiment, the vaccine or composition comprises greater than 15%, greater than 20%, greater than 25%, or greater than 30%) sugar. In some embodiments, the amount of sugar can be reduced without compromising potency if additional stabilizing agents such as amino acids and/or surfactants are added. For frozen and lyophilized vaccine formulations, potency can also be improved by increasing the freezing rate and by freezing suspended particles (as opposed to settled particles).
  • the invention includes frozen vaccine compositions, lyophilized vaccine compositions (which undergo freezing as part of the lyophilization process) and other vaccine formulations that are not susceptible to freeze/thaw conditions during shipping and storage.
  • compositions of the invention include a composition for preparation of a lyophilized vaccine comprising at least one antigen adsorbed to an aluminum adjuvant and at least 20%) (w/v) non-reducing sugar.
  • a temperature stable liquid vaccine composition comprising at least one antigen adsorbed to an aluminum adjuvant and at least 20% (w/v) sugar.
  • a further embodiment includes a composition comprising, prior to lyophilization, at least one antigen absorbed to an aluminum adjuvant and at least 20% (w/v) non-reducing sugar, wherein after reconstitution the non-reducing sugar is at least 6%) (w/v).
  • Compositions of the invention may further comprise a surfactant.
  • composition of the invention comprises at least one antigen adsorbed to an aluminum adjuvant, a surfactant and at least 15% (w/v) sugar can be used for preparation of a lyophilized vaccine.
  • the invention also includes temperature stable liquid vaccine compositions comprising at least one antigen adsorbed to an aluminum adjuvant, a surfactant and at least 15%) (w/v) sugar.
  • a composition further comprises an amino acid.
  • stable liquid vaccine compositions comprising at least one antigen adsorbed to an aluminum adjuvant, a surfactant, an amino acid and at least 10% (w/v) sugar.
  • the invention further provides compositions for preparation of a lyophilized vaccine comprising at least one antigen adsorbed to an aluminum adjuvant, a surfactant, an amino acid and at least 10% (w/v) sugar.
  • the invention can be applied to numerous vaccines that contain an antigen adsorbed to an aluminum adjuvant.
  • the vaccine is an anthrax vaccine such as rPA or Anthrax Vaccine Adsorbed.
  • the source of the protective antigen may vary.
  • the source of the protective antigen may vary.
  • B. anthracis protective antigen protein is produced from an asporogenic B. anthracis bacterium.
  • the asporogenic B. anthracis bacterium is a ASterne- l (pPA102) CR4 strain of bacteria.
  • PA protein is expressed in other organisms such as E. coli.
  • compositions of the invention may further comprise adjuvants (e.g., in addition to aluminum).
  • the present invention includes methods of preventing and treating an anthrax infection comprising administering to a subject a pharmaceutically effective amount of one of the vaccines of the invention.
  • the invention includes methods of inducing an immune response in a subject comprising administering to the subject a vaccine of the invention.
  • the present invention provides method for lyophilizing a vaccine comprising (i) freezing a composition of the invention and (ii) subjecting the frozen composition to sublimation.
  • Figure 1 A photograph of an rPA vaccine without a sugar stabilizer at 2° - 8° C compared to the same composition frozen at -80 ° C and thawed.
  • FIG. 1 A photograph of an rPA vaccine with 20% trehalose and 2% arginine at
  • Figure 3 Photographs of an rPA vaccine with and without sucrose at 2° - 8° C and at -80° C followed by thawing.
  • Figure 4 A graph showing the GeoMean NF50 of a no sugar rPA formulation before and after freezing and photographs showing the collapse of the alum gel.
  • Figure 5. A graph showing the GeoMean NF50 response of lyophilized samples with and without sugar that were not frozen.
  • Figure 6 A graph showing the GeoMean NF50 before and after freeze/thaw for an rPA composition containing 20% trehalose.
  • Figure 7 A graph showing GeoMean NF50 for all lyophilized samples compared to a liquid control.
  • FIG. 8A-B A graph showing NF50 over time for lyophilized rPA at (A) 5°C and 50°C compared to AVA shown in linear NF50 scale and (B) 5°C and 50°C compared to
  • each vaccine was at a 1 :4 dilution.
  • FIG. 9A-B A graph showing NF50 over time for lyophilized rPA at (A) 5°C and 50°C compared to AVA shown in linear NF50 scale and (B) 5°C and 50°C compared to
  • each vaccine was at a 1 : 16 dilution.
  • FIG. 10A-B A graph showing NF50 over time for lyophilized rPA at (A) 5°C and 50°C compared to AVA shown in linear NF50 scale and (B) 5°C and 50°C compared to
  • each vaccine was at a 1 :64 dilution.
  • FIG. 11A-B A graph showing the comparison of NF50 at (A) day 35 and (B) day 42 for lyophilized rPA at 5°C and 50°C and AVA, each vaccine was at a 1 :4 dilution.
  • FIG. 12A-B A graph showing the comparison of NF50 at (A) day 35 and (B) day 42 for lyophilized rPA at 5°C and 50°C and AVA, each vaccine was at a 1 : 16 dilution.
  • FIG. 13A-B A graph showing the comparison of NF50 at day 35 (A) day 35 and (B) day 42 for lyophilized rPA at 5°C and 50°C and AVA, each vaccine was at a 1 :64 dilution.
  • Figure 14 A graph showing a comparison of the %MLA (microphage lysis assay) value for rPA liquid vaccine (Liq rPA Fl) stored at one month versus lyophilized vaccines (LyoA, LyoB, and LyoC) stored at four months as a function of temperature.
  • %MLA microphage lysis assay
  • FIG. 15A-B A graph showing the relative drop in SEC %purity over reference control as a function of storage temperature of three rPA lyophilized formulations (LyoA, LyoB, and LyoC) stored for four months compared to liquid rPA stored for one month.
  • FIG. 16A-B A graph showing the relative drop in %AEX purity as a function of storage temperature of three rPA lyophilized formulations (LyoA, LyoB, and LyoC) stored for four months compared to liquid rPA stored for one month.
  • FIG. 17A-D Graphs showing the comparison of NF50 at dose level 0.25
  • FIG. 18A-D Graphs showing the comparison of NF50 at dose level 0.25
  • FIG. 19A-D Graphs showing the comparison of NF50 at dose level 0.25
  • Figures 20A-D Graphs showing the comparison of NF50 at dose level 0.25
  • Figure 21 A graph showing NF50 values and the standard deviation of mean for
  • alum containing vaccines cannot be frozen. Accordingly, alum containing vaccines are not frozen or lyophilized (requires freezing), and alum-containing liquid vaccines are typically discarded if a break in the cold chain causes freezing.
  • the inventors of the present invention made the exciting discovery that when a sugar such as trehalose or sucrose makes up about 20% (w/v) or more of an anthrax vaccine composition, the alum in the composition does not collapse as a result of freezing or thawing. Alum collapse is easy to identify and is associated with loss of vaccine potency and particle aggregation.
  • the inventors also identified additional stabilizing ingredients and process parameters that help prevent and reduce alum gel collapse.
  • the amount of sugar required to prevent alum gel collapse can be reduced, e.g., to about 10% (w/v).
  • Process changes that have a positive effect on alum gel height include freezing suspended particles (rather than settled particles) and increasing the freeze rate.
  • the section headings used herein are for organizational purposes only and are not to be construed as limiting the subject matter described. All documents, or portions of documents, cited herein, including but not limited to patents, patent applications, articles, books, and treatises, are hereby expressly incorporated by reference in their entirety for any purpose. In the event that one or more of the incorporated documents or portions of documents defines a term that contradicts that term's definition in the application, the definition that appears in this application controls.
  • PA Protective Antigen
  • rPA recombinant Protective Antigen
  • GLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYA VTKENTIINPSENGDTSTNGIKKILIFSKKGYEIG SEQ ID NO: 1.
  • SEQ ID NO: 1 is the amino acid sequence of rPA102 which is expressed from plasmid pPA102. During secretion of rPA102 from B. anthracis ASterne-l (pPA102)CR4 into the extracellular space, the first 29 amino acids (the signal peptide) are removed yielding the mature rPA protein of 735 amino acids (82,674 Da). The mature rPA sequence is underlined (SEQ ID NO: 2).
  • the rPA102 amino acid sequence is but one example of one particular anthrax protein within the scope of the invention. Additional amino acid sequences of PA proteins, including native proteins, from various strains of anthrax are known in the art and include, for example, GenBank Accession Nos: NP_652920.1, ZPJ32937261.1, ZP_02900013.1, ZP_02880951.1 which are incorporated by reference. Various fragments, mutations, and modifications in PA to reduce its toxicity or to improve its expression characteristics are also known, such as those described elsewhere in the specification, as are various fusion proteins. Those fragments, mutants, and fusion proteins are included in the term "PA" unless the context or text clearly indicates that those forms are excluded. Where indicated, PA fragments, mutants, and fusion proteins (whether with full length PA or a PA fragment) are those that elicit an antisera that is active in the toxin neutralization assay (TNA).
  • TAA toxin neutralization assay
  • temperature stable refers to the stability of the alum gel and potency of a vaccine after a freeze/thaw cycle.
  • a stable vaccine as used herein is a vaccine that exhibits no or little decrease in activity and/or potency and/or alum gel collapse and/or particle aggregation after a freeze/thaw cycle as compared to a comparable liquid vaccine that is kept between 2°- 8° C. Stability can be measured using any one or more of the assays described herein, including the working examples, as well as assays known in the art that are used to measure activity, potency and/or peptide degradation.
  • the imrnunogenicity of an antigen or vaccine can be measured by calculating 50% neutralization factor (NF50).
  • NF50 50% neutralization factor
  • the geometric mean of the NF50 (GeoMean or ⁇ NF50>gm) for vaccine formulation can be calculated based on the NF50 values from a given number of data points.
  • the NF50 and/or GeoMean is determined by using serum samples from a standard Toxin Neutralization Assay (TNA) (Hering et al., Biologicals 32 (2004) 17-27; Omland et al., Clinical and Vaccine Immunology (2008) 946-953; and Li et al., Journal of Immunological Methods (2008) 333 :89-106), e.g., serum from immunized mice or rabbits. The dilution of serum resulting in 50% neutralization of toxin is the "ED50".
  • TFA Toxin Neutralization Assay
  • the neutralization capacity of each test serum in relation to that of a reference serum (50% neutralization factor, or NF50, also known as the neutralization ratio) is calculated from the quotient of the ED50 of the reference serum and the ED50 of the test serum, i.e., the neutralization factor, NF50 is calculated as follows:
  • NF50 ED50_samEie
  • a T-test or one-way ANOVA can be used to compare the geometric mean of NF50 from different formulation at the 95% confidence level. In one embodiment, if the p value of the GeoMean NF50 is larger than 0.05, there is no significant difference in NF50 among the formulations. In another embodiment, if the p value is less than 0.05, the geometric mean NF50 among the formulations is significantly different from each other.
  • NF50 Neutralization factor
  • Stability can also be assessed by assaying the composition after freezing for intact protein (e.g., rPA intact with alum) or, conversely, desorbed protein (e.g., rPA desorbed from alum.
  • stability can be determined by assaying and characterizing free rPA102 (release) by ELISA; protein structure by, for instance, differential scanning calorimetry and intrinsic fluorescence; desorbed free protein by A 2 go; purity and backbone degradation by SDS-PAGE, SEC and or RP-HPLC; charge variation by IEX or isoelectric focusing; and biochemical activity by microphage lysis assay (MLA).
  • a temperature stable vaccine is a vaccine that after being exposed to freeze/thaw conditions (e.g., frozen vaccine or lyophilized vaccine), exhibits potency that is the same or at least about 98%, at least about 95%o, at least about 93%, at least about 90%), at least about 88% or at least about 85%o the same as a comparable liquid vaccine stored at about 2° - 8° C.
  • an anthrax mouse potency assay is used to determine whether a frozen or lyophilized vaccine is potent.
  • a composition retains at least 80%, at least 90% or at least
  • the vaccines of the invention are temperature stable vaccines.
  • the temperatures over which a formulation of the invention is stable are generally below about 30° C, but may be above 30° C, 35° C, 40° C, 45° C, or 50° C.
  • the formulation's stability is in reference to a temperature below about 25° C, about 20° C, about 15° C, about 10° C, about 8° C, about 5° C, about 4° C, or about 2° C.
  • the temperature is in the range of about 25° C to about -10° C, about 20° C to about - 10° C, about 15° C to about -10° C, about 10° C to about -10° C, about 8° C to about -10° C, about 5° C to about -10° C, about 15° C to about -5° C, about 10° C to about -5° C, about 8° C to about -5° C, and about 5° C to about -5° C.
  • a vaccine of the invention shows no statistically significant decrease in stability after freeze thaw as compared to the same sample but fresh and/or stored 5 °C. In some embodiments, a vaccine of the invention shows no statistically significant decrease in stability, immunogenicity, potency or any combination thereof after storage at -80° C, -20° C, 25° C, 40° C and/or 50° C for 1 , 2, 3, 4, 5, 6, 9 12, 18, 24, 30, 36, 42, 48, 54 or 60 months as compared to storage at 5° C for the same time period.
  • the stability of a composition is measured by microphage lysis assay (MLA), size exclusion chromatography (SEC-HPLC) and/or anion exchange chromatography (AEX-HPLC).
  • MAA microphage lysis assay
  • SEC-HPLC size exclusion chromatography
  • AEX-HPLC anion exchange chromatography
  • a composition retains at least 80%, at least 90% or at least
  • the vaccine compositions of the invention contain an antigen which is adsorbed to an aluminium adjuvant (alum) and an amount of sugar necessary to stabilize the formulation.
  • alum aluminium adjuvant
  • the vaccine formulations disclosed herein exhibit little to no reduction in potency after exposure to freeze/thaw conditions when compared to a similar liquid vaccine that has been maintained at between 2°- 8°C and /or exhibit little to no collapse of alum gel.
  • the aluminium adjuvant can be, for instance, aluminium hydroxide, aluminium phosphate or aluminium sulphate.
  • the adjuvant is aluminium hydroxide (e.g., ALHYDROGEL).
  • ALHYDROGEL aluminium hydroxide
  • the amount of aluminium can vary quite a bit with apparently no effect on the stability of the alum gel (in other words, increasing the amount of alum in the composition does not appear to increase the likelihood that the alum gel will collapse).
  • the vaccine composition comprises about 1- 10 mg/ml aluminium hydroxide.
  • the composition comprises about 1.5 to 5 mg/ml aluminium hydroxide.
  • the vaccine composition comprises about 1.5, 2, 2.5, 3, 3.5, 4, 4.5 or 5 mg/ml aluminium hydroxide.
  • the stable vaccine compositions of the invention can be used to stabilize any antigen that is formulated with alum.
  • the antigen can be a B. anthracis recombinant Protective Antigen (rPA) or a cell-free filtrate from an avirulent B. anthracis strain such as V770-NP1 -R ⁇ e.g., anthrax vaccine adsorbed).
  • B. anthracis proteins including PA (as well as fragments, mutants, and fusion proteins) are described, for example in U.S. Patent No. 7,201 ,912, to Park and Giri, U.S. Patent No. 6,387,665 to Ivins et al, U.S. Patent No. 6,316,006 to Worsham et al , and U.S. Patent No. 7,261 ,900 to Leppla et al , each of which is incorporated by reference in its entirety.
  • pBP103 is an expression vector for full-length, wild-type rPA.
  • the PA sequence from pBP103 is identical to that of wild-type PA.
  • Some embodiments of the invention include formulations comprising PA expressed in B. anthracis, including expression in either sporulating or non-sporulating strains of B. anthracis or both.
  • the PA can be derived from non-sporulating B. anthracis strain ASterne-l (pPA102)CR4 ⁇ i.e. , rPA102). See, for instance, U.S. Patent No. 6,316,006 and U.S. Patent No. 6,387,665, both to Ivins et al, each of which is herein incorporated by reference in its entirety.
  • Some compositions of the invention comprise a PA from the avirulent B. anthracis strain V770-NP1-R
  • the formulations of the invention may also include B. anthracis PA expressed by a heterologous organism.
  • the invention includes PA expressed in E. coli.
  • PA may be modified to lack a functional binding site, thereby preventing PA from binding to either Antlirax Toxin Receptor (ATR) (see Bradley, K.A., Nature (2001) 414:225-229) to which native PA binds, or to native LF.
  • ATR Antlirax Toxin Receptor
  • a modification made within or near to amino acid residues 315-735 or within or near to residues 596-735 of Domain 4 may render PA incapable of binding to ATR.
  • the PA furin cleavage site "RKKR” (SEQ ID NO: 3), which in most full length PA sequences is found at or around residues 163-168, may be inactivated by deletion, insertion, or substitution within or near to the furin cleavage site.
  • RKKR substitution within or near to the furin cleavage site.
  • all of the farin cleavage site residues of native PA may be deleted.
  • Other mutant PAs include those in which the dipeptide Phe-Phe has been modified to render the PA resistant to chymotrypsin.
  • a PA fragment or PA fusion protein may also be a PA mutant.
  • PA fragments include those in U.S. Patent No. 7,201 ,912, for example, PA64 expressed by pBPl l l, PA47 expressed by pBP1 13, PA27 expressed by pBPl 15. Some of those fragments may also include mutations to, for example, eliminate the furin cleavage site RKK (SEQ ID NO: 3) or the chymotrypsin sensitive site formed by the dipeptide sequence Phe-Phe (FF). In addition, fragments may include one or two additional amino acids at the N-terminus. Examples of fusion proteins involving PA include those in U.S. Patent No.
  • the invention also includes formulations comprising a HIS- tag PA.
  • a fragment, mutant, or fusion protein it is generally desirable that the fragment, mutant, or fusion protein elicit protective immunity to a challenge with, e.g., an LD 5 o, of anthrax spores of the Ames strain in one or more of mice, guinea pigs, or rabbits.
  • PA from a recombinant source and/or a non-recombinant source can be used and the stability of such preparations improved by the formulations of the invention.
  • the vaccine composition comprises about 75 to 750 ⁇ / ⁇ 1,
  • the invention includes a vaccine comprising about 150, 200, 250, 300, 350, 400, 450 and 500 ⁇ g/ml of antigen, e.g., rPA.
  • the vaccine comprises approximately 175 ⁇ g antigen (e.g., rPA) per 1500 ⁇ g aluminum hydroxide.
  • the vaccine comprises approximately 200 g/mL antigen (e.g., rPA) and about 0.5 mg/mL aluminum hydroxide.
  • the vaccine comprises approximately 250 ⁇ g antigen (e.g., rPA) per 100 to 250 ⁇ g aluminum hydroxide.
  • an antigen is an Anthrax antigen such as protective antigen.
  • a protective antigen is at least about 80% identity to the polypeptide of SEQ ID NO: 2.
  • Some compositions of the invention comprise about 150-500 ⁇ protective antigen or about 150, 175, 200, 225, 250, 275, 300, 325, 400, 375, 400, 425, 450, 475 or 500 ⁇ g/ml protective antigen.
  • a composition of the invention contains about 0.5 to 1.5 mg/ml aluminum hydroxide. In some embodiments, a composition contains about 0.5 mg/ml or about 1.5 mg/ml aluminum hydroxide.
  • an aluminum adjuvant is selected from the group consisting of aluminum hydroxide, aluminum phosphate and aluminum sulfate.
  • An anthrax vaccine of the invention whether it be a vaccine comprising rPA or a cell-free filtrate from an avirulent B. anthracis strain, can be administered to a subject preexposure or post-exposure to B. anthracis. When administered post-exposure, the vaccine may be administered in conjunction with antibiotics.
  • the antigen is a protein ⁇ e.g., recombinant) based antigen selected from the group consisting of hepatitis B protective antigens, Clostridium botulinum neurotoxin protein, Herpes Simplex Virus antigens, influenza antigens, Congenital cytomegalovirus antigens, Tuberculosis antigens, HIV antigens, Diphtheria antigens, Tetanus antigens, Pertussis antigens, Staphylococcus enterotoxin B (SEB), and Yersinia pestis protective antigens and Fl-V fusion protein.
  • hepatitis B protective antigens Clostridium botulinum neurotoxin protein
  • Herpes Simplex Virus antigens Herpes Simplex Virus antigens
  • influenza antigens Influen antigens
  • Congenital cytomegalovirus antigens Congenital cytomegalovirus antigens
  • Antigens can be derived, for instance, from papillomavirus ⁇ e.g., HPV), influenza, a herpesvirus, a hepatitis virus ⁇ e.g., a hepatitis A virus, a hepatitis B virus, a hepatitis C virus), Meningococcus A, B and C, Haemophilus influenza type B (HIB), Helicobacter pylori, Vibrio cholerae, Streptococcus sp., Staphylococcus sp., Clostridium botulinum, Bacillus anthracis and Yersinia pestis.
  • papillomavirus ⁇ e.g., HPV
  • influenza a herpesvirus
  • a hepatitis virus e.g., a hepatitis A virus, a hepatitis B virus, a hepatitis C virus
  • the vaccines of the present invention can withstand freezing overnight at -80° C with little to no loss of potency or collapse of alum gel.
  • the invention includes frozen liquid vaccines as well as lyophilized vaccines (also referred to herein as freeze dried vaccines).
  • the lyophilization process includes the freezing of a liquid composition.
  • the frozen composition is then subjected to sublimation under freezing.
  • the disclosed vaccine components and amounts refer to the amounts used in the liquid composition that is then subjected to freezing and not necessarily the dried lyophilized cake or reconstituted vaccine.
  • the final lyophilized vaccine cake (a dry composition) may contain different percentages of components due to the drying process.
  • the present invention provides method for lyophilizing a vaccine comprising (i) freezing a composition of the invention and (ii) subjecting the frozen composition to sublimation.
  • the vaccine of the invention comprises about 20% or more of a glass forming agent such as sugar.
  • the glass-forming agent is a reducing sugar
  • the vaccine comprises a non-reducing sugar such as trehalose or sucrose.
  • the glass forming agent is trehalose or sucrose. If the vaccine is iyophilized, it may be preferable to use no more than about 40% sugar, prior to lyophilization, so that the vaccine forms a cake-l ke composition.
  • the vaccine may comprise about 15%, 16%, 17%, 18%, 19%, 20%, 21 %, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 35% or 40% sugar, e.g., prior to lyophilization.
  • the vaccine composition comprises about 10-40%, 10-35%, 10-30%, 10-25%, 10-20%, 35-40%, 30-40%, 25-40%, 20-40%, 15-40%, 20-30%, 20-25%, 25-30%, 25-35%, 21-40%, 23-35%, 21-30% 21 -25% or greater than 10%, 15%, 20%, 21 %, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, or 36% (w/v) sugar, e.g., prior to lyophilization.
  • a composition contains greater than about 15%, 16%, 17%, 18%, 19%, 20%, 21 %, 22%, 23%, 24% and 25% (w/v) sugar, e.g., prior to lyophilization.
  • alum vaccine compositions comprising at least about 20% trehalose or sucrose can withstand freeze/thaw conditions.
  • additional stabilizing agents e.g., a surfactant and/or amino acid
  • the process improvements disclosed herein are incorporated (e.g., increasing freeze rate, freezing of suspended particles)
  • the amount of sugar can be reduced to about 15% (w/v) or even about 10% (w/v) without affecting potency of the vaccine.
  • a vaccine composition comprising an antigen adsorbed to an aluminium adjuvant and a sugar (e.g., 15% w/v or more) also contains a solubilizing agent such as a surfactant, e.g., prior to lyophilization.
  • a surfactant is a nonionic detergent such as polysorbate 80 (TWEEN® 80).
  • the vaccine composition comprises between about 0.001 % and about 0.05% surfactant (such as polysorbate 80).
  • the composition comprises about 0.020%, about 0.025% or about 0.020% to 0.025% (w/v) surfactant (such as polysorbate 80).
  • surfactants that can be used include, but are not limited to, polysorbate 20, pluronic L68, polyoxyethylene 9-10 nonyl phenol (TritonTM N-101 , octoxylnol 9), TritonTM X-100, and sodium dexoycholte.
  • the surfactant is removed during the manufacturing process so that no surfactant is present in the final drug product.
  • a surfactant is present during freezing, e.g., of lyophilization process.
  • a formulation of the invention does not comprise a surfactant.
  • the percentage of sugar may be reduced to as much as about 10% (w/v) with little to no effect on potency and/or little to no alum gel col lapse if amino acids (for instance, alanine, arginine. glycine and proline) are added to the composition, e.g., prior to freezing and/or lyopkilization.
  • amino acids for instance, alanine, arginine. glycine and proline
  • the amount of amino acid added to the vaccine composition can vary, in one embodiment, the vaccine composition comprises 0.5 to about 15% (w/v) of an amino acid or combination of amino acids. In one embodiment, the vaccine composition comprises about 2-10% (w/v) of an amino acid or combination of amino acids. In one embodiment of the invention, the vaccine comprises about 2% arginine or alanine.
  • the vaccine comprises about 10% glycine.
  • a vaccine composition comprises about 2-10%, 2-8%, 2-6%, 2-4%, 2-3%, 3-10%, 5-10%, 7- 10%, 2.5-5%, 3-5%, 3-7%, or 4-6% (w/v) of an amino acid or combination of amino acids, in some embodiments, two, three or more amino acids are present, such as selected from alanine, glycine, proline and/or arginine.
  • a composition contains about 0.5-4%, 1 -4%, 1.5-4%, 2-4%, 2.5-4%, 3-4%, 3.5-4%, 0.5-1%, 0.5-1.5%, 0.5-2%, 0.5-2.5%, 0.5-3%, 0.5-3.5%, 0.5-4%, 1.-3%, 1-2%, 2-3%, or .1.5-2.5% (w/v) alanine or arginine.
  • a composition contains about 2%,, 1.75%, 2.25%, 2.5%, 2.75%, 3%, 3.25%, 3.5%, 3.75% or 4% (w/v) alanine or arginine.
  • a composition contains about 6-12%, 7-12%, 8-12%, 9-12%, 10-12%, 1 1 -12%, 6-1 1 %, 6-10%, 6-9%, 6-8%, 6-7%, 7-11%, 8-10%, 7-10%, 11-9%, 7-8%, 8-9% or 9-10% (w/v) glycine. In some embodiment, a composition contains about 6%, 7%, 8%, 9%, 10%, 1 1% or 12% (w/v) glycine, In some embodiments, the recited concentration of amino acid is prior to freezing and/or lyophilization.
  • a formulation does not comprise an amino acid(s) solution or does not contain an amino acid(s), other than the amino acids that are part of the polypeptide antigen.
  • the formulatio further comprises one or more additional ingredients.
  • the formulation may include one or more salts, such as sodium chloride, sodium phosphate, or a combination thereof.
  • each salt is present in the formulation at about 10 mM to about 200 mM,
  • the vaccine formulations may contain a buffer such as 20 mM TRIS-HCL.
  • the pH of the formulation may also vary. In general, it is betwee about pH 6.2 to about pH 8.0. In one embodiment, the pH of the vaccine is about 7.4.
  • the formulation further comprises a sugar alcohol such as sorbitol. In one embodiment, the formulation comprises 0.25% sorbitol.
  • compositions and vaccine formulations of the invention may contain additional adjuvants, for instance, Immuno Stimulatory Sequences (ISS, CpG), and calcium phosphate.
  • ISS Immuno Stimulatory Sequences
  • CpG calcium phosphate
  • ISS protein samples are generally used at a final protein concentration 50 ⁇ g/ml.
  • adjuvants include, but are not limited to,: CGP7909 (e.g., see US Patent No.
  • CpG1018 see, for instance, US 2010/0183675, which is herein incorporated by reference in its entirety
  • Glucopyranosyl Lipid Adjuvant GLA
  • Polyl PolyC PIPC
  • N-acetyl-muramyl-L-threonyl-D-isoglutamine thr-MDP
  • N-acetyl-nor- muramyl-L-alanyl-D-isoglutamine CGP 1 1637, referred to as nor-MDP
  • RIBI which contains three components extracted from bacteria, monophosphoryl
  • compositions comprising the following formulations:
  • a composition of the invention comprises 5 mM NaPi, pH 7.0 buffer or 20mM Tris, pH 7.4. Other compositions included in the invention are described in the Examples.
  • Vaccines of the invention can be prepared for use as injeciabl.es.
  • the composition can be a liquid formulation that is temperature stable (e.g. , can withstand a freeze/thaw cycle) or a frozen composition.
  • the composition may also be used to produce a lyophilized dry powder vaccine which can be reconstituted, e.g., with a pharmaceutically acceptable carrier prior to administration.
  • Vaccine administration is generally by conventional routes, for instance, intravenous, subcutaneous, intraperitoneal, or mucosal routes.
  • the administration may be by parenteral injection, for example, a subcutaneous or intramuscular injection.
  • a composition of the invention is subjected to freezing and followed by sublimation under vacuum to produce a lyophilized composition.
  • the term "reconstituted” or “reconstitution” refers to the restoration of a lyophilized form to a liquid form, e.g., by rehydration, of a substance previously altered for preservation and/or storage, e.g., the restoration to a liquid state of a lyophilized rPA formulation of the application that has been stored.
  • a lyophilized composition of the present application can be reconstituted in any aqueous solution which produces a stable, aqueous solution suitable for administration.
  • Such an aqueous solution includes, but is not limited to, sterile water, TE (Tris EDTA), phosphate buffered saline (PBS), Tris buffer or normal saline.
  • a lyophilized sample can be reconstituted with a lower, the same or higher volume than was used to lyophilize the sample.
  • a dose of a reconstituted lyophilized vaccine formulation of the application can be determined in light of various relevant factors including the conditions to be treated, the chosen route of administration, the age, sex and body weight of the individual patient, and the severity of the patient's symptom, and can be administrated in a single dose, divided dose or multiple doses.
  • the vaccines are administered in a manner compatible with the dosage formulation, and in such amount as will be prophylactically and/or therapeutically effective.
  • the quantity to be administered which is generally in the range of 5 ⁇ g to 500 ⁇ g of antigen per dose, depends on the subject to be treated, capacity of the subject's immune system to synthesize antibodies, and the degree of protection desired.
  • the vaccine comprises at least about 10 ⁇ g PA, 25 ⁇ g PA, 50 ⁇ g PA, 75 ⁇ g PA, 100 ⁇ g PA, 125 ⁇ g PA, 150 ⁇ g PA, 200 ⁇ ⁇ PA, 225 ⁇ g PA, 250 ⁇ g, 275 ⁇ g, 300 ⁇ g PA.
  • Precise amounts of antigen are dependent on the antigen to be delivered.
  • the vaccine may be given in a single dose schedule, or optionally in a multiple dose schedule.
  • the vaccine composition may be administered, for instance, in a 0.5 mL dose.
  • a multiple dose schedule is one in which a primary course of vaccination may be with 1-6 separate doses, followed by other doses given at subsequent time intervals to maintain and or reinforce the immune response, for example, at 1-4 months for a second dose, and if needed, a subsequent dose(s) after several months.
  • the vaccine may also be administered according to a single dose or multiple dose regimen.
  • the vaccine is administered in 3 doses at times 0, 2 and 4 weeks post exposure.
  • the dosage regimen will also, at least in part, be determined by the need of the individual, upon the judgment of the practitioner and/ or upon results of testing, e.g., measuring levels of immune response to the vaccine/antigen(s) such as antibody levels and/or T-cell activity against the antigen(s).
  • the vaccine containing the immunogenic antigen(s) may be administered in conjunction with other immunoregulatory agents, for example, immunoglobulins, antibiotics, interleukins (e.g., IL-2, IL-12), and/or cytokines (e.g., IFN- beta, IFN-alpha).
  • immunoglobulins for example, antibiotics, interleukins (e.g., IL-2, IL-12), and/or cytokines (e.g., IFN- beta, IFN-alpha).
  • antibiotics e.g., IL-2, IL-12
  • cytokines e.g., IFN- beta, IFN-alpha
  • the vaccine is administered to a subject post-exposure to anthrax.
  • the vaccine may be administered in conjunction with an antibiotic.
  • Antibiotics that may be administered with the vaccine include, but are not limited to, penicillin, doxycycline and ciprofloxacin.
  • the invention includes methods of treating (post-exposure prophylaxis) or preventing (pre-exposure prophylaxis) an anthrax infection comprising administering to a subject a pharmaceutically effective amount of a vaccine of the invention.
  • the anthrax infection is the result of inhaling anthrax (inhalation anthrax).
  • a pharmaceutically effective amount of a vaccine is an amount that induces an immune response.
  • a pharmaceutically effective amount of a vaccine is an amount comprising at least 25 ⁇ g PA.
  • a subject is a mammal such as a human.
  • the invention also provides methods of stimulating an immune response in a subject by administering to the subject an amount of a vaccine of the invention sufficient to stimulate an immune response.
  • immune stimulation is measured by increases in antibody titer that is specific for the antigen in the vaccine.
  • immune stimulation is measured by an increased frequency in cytotoxic T lymphocytes specific for the antigen in the vaccine.
  • the invention further includes methods of producing potent, alum based frozen vaccines comprising suspending a composition comprising at least about 10%, at least about 15%, at least about 20%, at least about 21%, at least about 25% or at least about 30% sugar and an antigen adsorbed to an aluminum adjuvant and freezing said composition at a rate sufficient to freeze the suspended composition before sedimentation occurs, e.g., flash freezing.
  • Some embodiments of the invention provide methods of preparing a stable lyophilized composition, comprising lyophilizing a composition of the invention, wherein the stability of the reconstituted lyophilized composition is measured by microphage lysis assay (MLA), size exclusion chromatography (SEC-HPLC) and/or anion exchange chromatography (AEX-HPLC).
  • MAA microphage lysis assay
  • SEC-HPLC size exclusion chromatography
  • AEX-HPLC anion exchange chromatography
  • mice can be immunized with, for example, 10 ⁇ g, 20 ⁇ g, or more of rPA suspended in an adjuvant emulsion.
  • Control mice are immunized with saline emulsified in adjuvant for use as negative controls.
  • the mice are generally immunized, then bled at various intervals, e.g., day 0, day 21 and day 28 post- immunization.
  • the serum is then analyzed for the presence of specific antibody, e.g., by ELISA, which can also be used to determine the titer of the antisera.
  • a mouse toxin-neutralizing antibody assay can also be used to determine if the anthrax vaccine formulations elicit protective antibodies.
  • mice immunized with rPA are then challenged i.p. with 2 lethal doses of lethal toxin (PA and lethal factor (LF)). Four days after challenge, the mice are scored for survivors.
  • PA and LF lethal factor
  • the rPA formulations can also be used to prepare compositions comprising neutralizing antibodies that immunoreact with the anthrax toxin.
  • the resulting antisera can be used for the manufacture of a medicament for treating exposure to anthrax.
  • the antibody composition comprises a purified anti-PA antibody.
  • purified it is meant that the antibody is substantially free of other biological material with which it is naturally associated.
  • Purified antibodies of the invention are at least 60% weight pure, at least 70% weight pure, at least 80% weight pure, at least 90% weight pure or at least 95% weight pure.
  • the antisera, or antibodies purified from the antisera can also be used as diagnostic agents to detect either PA fragments or native protein.
  • the frozen and lyophilized formulations of the invention can be manufactured with increased potency by increasing the freeze rate.
  • the formulation is flash frozen.
  • Potency can also be increased by freezing suspended rather than settled compositions, Compositions can be suspended by gentle shaking and immediately frozen.
  • the invention will be further clarified by the following examples, which intended to be purely exemplary of the invention and in no way limiting.
  • Example 1 Freeze/Thaw of Liquid rPA and AVA Vaccines with and without
  • rPA102 vaccine formulations with and without trehalose were prepared outlined in Table 1 below.
  • each sample was divided into two 8 ml aliquots in 10 ml glass tubes. For each sample, after gentle mixing overnight, one tube was placed at -80° C and the other tube was placed at 2-8° C after gentle mixing overnight.
  • FIG. 1 is a photograph comparing rPA Control 1 sample at 2-8° C (labeled 5° C) to the -80° C sample after thaw. The photograph shows significant collapse of the alum gel in the rPA Control 1 sample subjected to freeze/thaw conditions.
  • FIG. 1 The level of sugar in a regular formulation that protected rPA102 from freeze/thaw stress was tested.
  • freezing damaged rPA102 vaccine, and the potency (MRPT) data correlated with physio-chemical and gel height (collapsed).
  • Figure 2 is a photograph comparing rPA Test 1 sample at 2-8° C (labeled 5° C) to the -80° C sample after thaw. There is no noticeable collapse of the alum in the thawed rPA Test 1 sample. Table 2 provides an overview of the relative % alum height.
  • a vial of BioThrax® (Anthrax Vaccine Adsorbed), AVA, and a vial AVA + 25% trehalose were placed in -80° C after gentle mixing.
  • the aluminum gel height appeared to be about the same for the BioThrax stored at 2°- 8° C and the two AVA samples containing 25 % trehalose.
  • rPA102 vaccine formulations with and without sucrose were prepared as outlined in Table 3 below.
  • each sample was divided in to two 10 ml aliquots in 10 ml glass tubes. For each sample, one tube was placed at -80° C after gentle mixing overnight and the other tube was placed at 2-8° C after gentle mixing overnight.
  • Figure 3 contains a photograph of each formulation from 2-8° C (labeled 5° C) and -80° C after both being brought to room temperature. As shown, gel collapse occurred in both -80° C samples (rPA Control 2 and rPA Test 2) after thaw as compared to the samples that remained refrigerated at 2-8° C. However, the amount of gel collapse was visibly greater in the rPA Control 2 sample that did not include sucrose.
  • Lyophilized vaccines were prepared as outlined in Table 4. Dried vaccines were reconstituted with water for injection to a final rPA concentration of 0.15 mg/ml (75 ⁇ g/0.5 ml dose) and then diluted in normal saline by 10-fold to yield a dose level of 0.1 (DL).
  • mice Female CD-I mice at 5-8 weeks of age and weighing 20-25 grams each were used for this study.
  • the 0.1 DL of the vaccine was injected (0.5 ml) IP into groups of 20 female CD-I mice and sera were collected on day 28 for the assessment of their ability to neutralize anthrax LT cytotoxicity in the toxin neutralization assay (TNA) in mice.
  • TAA toxin neutralization assay
  • NF50 Neutralization factor
  • the geometric mean (GeoMean) of the NF50 of each vaccine formulation was calculated based on 20 NF50 values from 20 mice. T-test or one-way ANOVA were used to compare the geometric mean of NF50 of each formulation at the 95% confidence level. If the p value of the geometric mean NF50 was larger than 0.05, there was no significant difference in NF50 (potency) among the formulations. If the p value was less than 0.05, the geometric mean NF50 of the formulations was significantly different from each other.
  • the control (lyophilized #2) was an rPA102 formulation without stabilizer (0.15 mg/ml rPA, 1.5 mg/ml aluminum, 20 mM Tris-HCL, pH 7.4).
  • the effect of freezing on the GeoMean NF50 values from the relative mouse potency assay for the regular rPA102 formulation is shown in Figure 4.
  • the control formulation was susceptible to freeze/thaw damage with immunogenicity dropping significantly after the freezing process ( Figure 4). The drop in immunogenicity corresponded to the decrease in the height of the aluminum gel in the solution.
  • Lyophilized Samples #1 and 2 showed significantly lower immunogenic potency relative to Lyophilized Samples #3 and 4 (which contained 30% and 20% trehalose, respectively).
  • the effect of sugar in the formulation on lyophilization of rPA102 vaccine was shown by GeoMean NF50 results in Figure 7. Lyophilized Sample #1 (10% sugar) was not able to protect rPA102 from freeze-dry stress (see Figure 7). These results showed that 20% and 30%) sugar was able to protect rPA102 from lyophilization stress. The appearance of gel collapse correlated with potency loss.
  • NF50 responses were determined from two more formulations that differ only by the absence or presence of trehalose: #1) 0.15mg/mL rPA, 1.5mg/mL alum, 2% arginine, 0.025% TWEEN 80 (polysorbate 80), 20mM Tris-HCL, pH 7.4 and #2 & #3) 0.15mg/mL rPA, 1.5mg/mL alum, 20% trehalose, 2% arginine, 0.025% TWEEN 80 (polysorbate 80), 20mM Tris-HCL, pH 7.4 and the effect of sugar before freezing on the GeoMean values for rPA102 is shown in Figure 5.
  • Table 5 The ingredients of the final formulation were blended prior to lyophilization and after reconstitution as shown in Table 5. Briefly, 2 mL of the suspension was filled in a 10 mL glass vial. The lyophilization was performed using a VirTis Advantage lyophilizer. After lyophilization, the vaccines were stored at 5 and 50 °C.
  • Vials were stored as described in Table 6. On the day of immunization, 6.1 1 niL sterile water for injection was added to each vial to reconstitute the lyophilized samples. The vials were mixed end over end until all formulation components were completely dissolved. Dilutions (1 :4, 1 : 16 and 1 :64) of each test and control article were prepared in sterile normal saline.
  • NZW rabbits were used for the present study. NZW rabbits are commonly used as an animal model for Bacillus anthracis disease to test for toxicity, immunogenicity and efficacy studies, and NZW rabbits are considered to be a well-characterized model since they have similar pathogenesis and clinical presentation as seen in humans (EK Leffel et al., Clin Vaccine Immunol. 19(18): 1 158-1164, 2012; AJ Phipps et al., Microbiol Mol Biol Rev. 68(4):617-29, 2004).
  • AVA BioThrax®
  • AVA is a liquid anthrax vaccine that includes the 83kDa protective antigen protein and is formulated with 1.2 mg/mL aluminum (added as aluminum hydroxide in 0.85% sodium chloride), 25 mg/mL benzethonium chloride and 100 mg/mL formaldehyde (added as preservatives).
  • Serum samples were collected at days -1 or 0, 14, 21, 28, 35, 42, 56 and prior to termination on day 70.
  • the TNA assay was performed by using serum collected on day -1 or 0, 14, 35 and 42. Table 6 summarizes the study design. Table 6. Rabbit Immunogemcity Study Design
  • the TNA assay is a functional test that evaluates the amount of antibody needed to inactivate the lethal B. anthracis toxin complex of LF and PA (lethal toxin, LT).
  • the ability of test serum samples to neutralize lethal toxin in vitro was compared with that of a standard serum sample by using cytotoxicity as the endpoint of the assay (PR Pittman et al., Vaccine 24(17):3654-60, 2006).
  • J774A.1 cells were cultured in flasks for 48 to 72 h in Dulbecco's modified Eagle media (DMEM) containing 4.5 g/liter d-glucose and supplemented with 10% heat-inactivated bovine serum, 2 mM L-glutamine, ImM sodium pyruvate, penicillin (50 U/ml), streptomycin (50 ⁇ g/rnl), and 0.1 ImM sodium bicarbonate. Cells were harvested and seeded in 96-well tissue culture plates at 30,000 cells/well, followed by 16 to 24 hour incubation.
  • DMEM Dulbecco's modified Eagle media
  • Serum samples were prepared in a separate 96-well microtiter plate at 2-fold dilutions for a total of seven dilutions per sample.
  • the serum samples were then incubated with a constant concentration of LT (100 ng/ml PA and 80 ng/ml LF) for 1 hour.
  • LT 100 ng/ml PA and 80 ng/ml LF
  • the serum sample with LT was added to the corresponding wells of the tissue culture plate containing the cells and incubated for four hours, after which 25 ⁇ /well of 5 mg/ml of a tetrazolium salt, 3-(4,5-dimethylthiazolyl-2)-2,5-diphenyltetrazolium bromide (MTT), was added.
  • LT 100 ng/ml PA and 80 ng/ml LF
  • the cells were lysed by using 100 ⁇ /well of acidified isopropanol (50% N, N-Dimethylformamide (with deionized water) and 20% SDS (200g in 1 liter of 50% dimethylformamide)) with the pH adjusted to 4.7 using HC1. Assay plates were incubated for an additional 16-24 hour, absorbance was measured at 570 and 690 nm in which 690 optical density values were subtracted from 570 values using a calibrated Molecular Devices VersaMax Plate Reader. The ED50, which is the dose that produces a quantal effect in 50% of the population in optical density measurement, was determined using SoffMax Pro software (version 5.4.1, Sunnyvale, CA).
  • the mouse reference standard was prepared by immunizing 300 mice with AVA vaccine containing CPG 7909 adjuvant. The serum from the 300 mice was collected, pooled and stored frozen at -80 °C as the reference standard. Tables 7A-C show a comparison of the average kinetic data (NF50) for lyophilized rPA stored at 5 °C, lyophilized rPA stored at 50 °C, and AVA control stored at 5 °C from serum samples at 14, 35 and 42 da s, respectively.
  • the ⁇ NF50>gm of the combined data was found to be 3.06; and the combined ⁇ NF50>gm was statistical higher than that of the AVA reference (1.61), p ::: 0.034 (t.test).
  • the combined ⁇ NF50>gm was found to be 2.10.
  • the ⁇ NF50>gm for the lyophilized rPA vaccine stored at 50 °C was found to be 2.98, 0.94 and 0.1 for doses 1 :4, 1 : 16 and 1 :64, respectively.
  • the ⁇ NF50>gm of the lyophilized rPA vaccine stored at 5 °C were similar at day 35 (3.14, 1.7 and 0.16, respectively) with no statistically significant difference compared to 50 °C (alph-0.05). Similar results were found at day 42. These data demonstrated that the immunogenicity of the lyophilized rPA vaccine stored at 50 °C for 4 months was not significantly different from the lyophilized rPA vaccine stored at 5 °C.
  • the combined ⁇ NF50>gm was found to be non- inferior (statistical higher or no difference) to that of the AVA. Similar results are shown for day 42.
  • These immunogenicity data show that the rPA lyophilized vaccine stored at 5 °C and 50 °C for 4 months was at least as immunogenic as the AVA vaccine.
  • rPA vaccine formulations were tested for immunogenicity and physiochemical stability compared to liquid rPA vaccine.
  • the content and purity of rPA vaccines were measured by macrophage lysis assay (MLA), size exclusion chromatography (SEC-HPLC), and anion exchange chromatography (AEX-HPLC).
  • the immunogenicity of the rPA vaccines was evaluated by vaccinating CD-I mice with four dose levels and testing the ability of the mice serum to neutralize anthrax toxin (NF50).
  • Liquid rPA formulation (Fl) was prepared under aseptic condition at 0.15 mg/mL rPA, 1.5 mg/mL alum, 2% Alanine, 0.01% TWEEN 80, 25 mM NaPi, pH 7.0.
  • the samples for the stability assays contained 5 mL liquid suspension filled in 10 mL glass vial (10 doses per vial).
  • the intended human dose is 75 ⁇ g rP A/750 ⁇ g alum per 0.5 mL with intramuscular injection. Lyophilization rPA Vaccine Formulations
  • lyophilized rPA formulations were prepared. The final formulations, prior to lyophilization, are shown in Table 9.
  • the first lot (lyoA) was formulated with 0.15 mg/mL rPA, 1.5 mg/mL alum, 20% Trehalose, 2% Ala, 0.025% Tw80 and 5 mM NaPi at pH 7.0.
  • the second and third lots (lyoB and lyoC, respectively) contained 3.3x higher rPA and alum concentrations (0.5 mg/mL and 5.0 mg/mL, respectively) with slight variations in sugar, amino acid and buffer as indicated in Table 9.
  • the lyophilized samples were reconstituted with water for injection (WFI) to produce a final concentration of 0.15 mg/mL rPA and 1.5 mg/mL alum for all three formulations.
  • the final concentration was accomplished by adding 1.55, 6.2 and 6.18 mL of WFI to vials of the first lot (LyoA), second lot (LyoB) and third lot (LyoC), respectively.
  • the final suspension volume per vial for LyoA was 2.0 mL and for both lots LyoB and LyoC were 6.7 mL.
  • the concentration of rPA vaccines after reconstitution are shown in Table 10.
  • the rPA liquid formulation (Fl) was placed in a long term stability program at storage temperatures of 5, 25 and 40 °C.
  • the three rPA lyophilized lots (LyoA, LyoB, and LyoC) were placed in a long term stability program at storage temperatures of 5, 25, 40, and 50 °C.
  • the physiochemical tests were performed for both the liquid (Fl) and lyophilized rPA vaccine formulations. Four (4) months of stability data for the samples were collected.
  • the physiochemical properties of the rPA test vaccines were evaluated by a series of assays, i.e., MLA, SEC-HPLC and AEX-HPLC. All of these assays were performed using rPA proteins extracted from the alum. The extraction procedure utilized 200 niM potassium phosphate/0.01% Tw80/0.9% NaCl.
  • a rPA bulk drug substance (BDS) stored at -80 °C was used as a reference control.
  • the BDS control was purified from a ASterne-l(pPA102)CR4 strain of B. anthracis, which was developed by the U.S. Army Medical Research Institute of Infectious Diseases (USAMRIID) as an asporogenic, non-toxigenic expression system for the production of rPA.
  • the rPA BDS was purified and stored in 20 mM Tris, 0.9% NaCl, pH 7 under -80 °C frozen condition.
  • the in vitro macrophage lysis assay was used to determine the cytotoxicity of rP A on the murine macrophage cell line J7774 A.1.
  • the MLA measures the activity of rPA and rLF toxin.
  • the assay involves adding rPA protein to lethal factor protein (rLF) to form a lethal toxin complex, which caused pore formation with the cell membranes of the macrophages, leading to cell lysis.
  • rLF lethal factor protein
  • the activity of the rPA lyophilized vaccines was measured relative to a BDS reference standard and reported as a percentage of the reference standard. The percentage of cells surviving toxin challenge was determined. For example, 100% MLA activity of rPA vaccine would indicate there was no loss in the cytotoxicity activity of rPA adsorbed to alum and after lyophilized.
  • microphage cells were seeded in a 96 well plate at 5xl0 4 cells/well and the plate was placed in a C0 2 incubator overnight.
  • l OOul of soluble solution (20% SDS in 50% dimethylformamide solution) was added to the wells and the plate was incubated at 37°C overnight. The next day, the plate was read by a plate reader at 570nm and OD readings were graphed with 4-parameter model using software (SoftMax). The ED50 value of the test sample rPA was then compared to that of the rPA reference standard, and their ratio was used to report relative activity of the rPA test sample. The accuracy of the assay was determined to be +/-30%.
  • SEC-HPLC is a chromatographic technique used to separate proteins based on their molecular weight and size and it is commonly used to assess the stability of a protein in a formulation.
  • a larger protein typically has a shorter retention time (elute out sooner) in a SEC-column than a smaller protein. Protein that is degraded (or fragmented) will become smaller in size and elute out of the chromatography later. Vice versa, aggregated protein will elute sooner. For example, an aggregated rPA protein that has increased in size would have a shorter retention time than the native rPA protein, and a degraded rPA protein (breakdown in size) would have a longer retention time.
  • SEC-HPLC is a common assay used to assess the physiochemical stability of a protein in a formulation. Compared to MLA, the SEC-HPLC is, in general, relatively more sensitive and quantitative with precision of less than 5% in %peak area and less than 0.1% in retention time within the same run.
  • UV detector at 215 nm or fluorescence detector at 280 nm (excitation) and 335 nm (emission) were used for the detection.
  • AEX-HPLC separates proteins based on their net electrostatic charge.
  • the assay involved injecting rPA protein solution into an HPLC equipped with an anion exchange column.
  • the rPA protein was retained by the anion exchange (AEX) column (stationary phase) due to electrostatic interaction.
  • the rPA protein was then eluted out by using mobile phase with gradually increased ionic strength (NaCl concentration).
  • the ionic strength (or elution time) at which the rPA molecules eluted is related to its net charges.
  • the rPA molecule is known to be susceptible to degradation by deamidation mechanism (D'Souza, Journal of Pharmaceutical Sciences, 102(2):454-461, 2013) resulting in a change in net change. Deamidation increases the negative charge of the rPA protein due to the conversion of asparagine residues to aspartate (more negative).
  • the deamidated rPA typically referred to as the acidic species
  • the purity of the rPA was characterized by the %main peak.
  • Immunogenicity was evaluated using toxin neutralizing assay (TNA) (Hering et al., Biologicals 32 (2004) 17-27; Omland et al., Clinical and Vaccine Immunology (2008) 946-953; and Li et al, Journal of Immunological Methods (2008) 333 :89-106.
  • ED50 values for the mouse reference serum were used to determine the NF50 values of the test serum sample and the positive control. The first month stability data are reported herein.
  • Table 11 summarizes the MLA, SEC-HPLC & AEX-HPLC results of the three lyophilized formulations stored at 4 months at 5, 25, 40 and 50 °C and the BDS reference control. Table 11. Summary of physiochemical stability data at 4 months
  • FIG 15B The percent peak area was calculated for each sample peak.
  • the native rPA protein (monomer) eluted at 17.1 minutes with a % main peak area of 85%.
  • the second peak eluted at 18.2 minutes and corresponds to the aggregated rPA molecule main peak area of -15%.
  • the %>purity of the BDS reference control were found to be 84.0% and 98.6%> for the lyophilized and the liquid assays, respectively. The two tests were performed at different times. The difference in % purity of the reference control was not unusual. The difference could be due to varying SEC-column condition and sample preparation procedure. The relative % purity (over reference control) is typically used to compare the stability samples at different times and across different laboratories.
  • Figure 15A shows the relative decrease of rPA SEC % purity (over BDS reference control) as a function of storage temperature for the three lyophilized formulation compared to the liquid formulation.
  • FIG 16B The purity of rPA was characterized by the %main peak area.
  • the native rPA protein eluted at 21.0 minutes with a main peak of -81.4%.
  • the deamidated rPA typically referred to acidic species
  • the purity of rPA was the same as %main peak area.
  • the accuracy of the AEX assay was about 10-15%.
  • the AEX %purity of the first lyophilized lot (lyoA) stored for 4 months was found to be 87.1 , 86.6, 84.7 at 5, 25 and 40°C, respectively.
  • the AEX purity for the second lyophilized lot (lyoB) was 87.8%, 86.2% and 85.3% at 5, 25 and 50°C, respectively.
  • the AEX %purity for the third lyophilized lot (lyoC) was 87.5%, 84.5% and 70.5% at 5, 25 and 50°C, respectively.
  • NF50 results in mice at dose levels 0.25, 0.125, 0.0625 and 0.03125 for the three lyophilized formulations stored for 1 month each were determined.
  • Figures 17A-D, 18A-D, and 19A-D compares the NF50 data (n :s: 20) across various temperatures (5, 25 and 40 °C) at their corresponding formulation and dose level.
  • liquid rPA formulation (Fl) showed a significant drop in immunogenicity at the 25 and 40 °C storage temperatures at 1 month.
  • Table 13 shows the ⁇ NF50>gm results for the rPA liquid formulation stored at 1 month at 5, 25 and 40 °C.
  • the ⁇ NF50>gm significantly dropped as the storage temperature increases (see Figure 20A-D).
  • the NF50 was found to decease significantly when the liquid vaccine was stored at 25 °C as compare to 5 °C at all four dose levels, ' and progressively more at 40 °C.
  • the immunogenicity data demonstrated the superiority of the lyophilized rPA formulations over the liquid rPA formulation.
  • the lyophilized formulations maintain their immunogenicity at 25 and 40 °C for at least 1 month, while the immunogenicity of the liquid formulation decreases significantly over similar storage conditions.
  • liquid rPA vaccines were found to be unstable at accelerated storage temperatures (e.g., 25 and 40 °C). Liquid rPA vaccine lost its immunogenicity and key physiochemical properties when stored at 40 °C for 1 month. Similarly, the key physiochemical properties of the vaccine were also significantly degraded. The content and purity of vaccine as measured by macrophage lysis assay (MLA), size exclusion chromatography (SEC-HPLC) and anion exchange chromatography (AEX-HPLC) were found to significantly decrease at 25 °C and be undetectable at 40 °C for 1 month. Liquid rPA vaccine was known to be susceptible to deamidation reaction especially when it was adsorbed on aluminum and stored at accelerated temperature.
  • MFA macrophage lysis assay
  • SEC-HPLC size exclusion chromatography
  • AEX-HPLC anion exchange chromatography
  • the results herein show that the lyophilized rPA formulations had superior physiochemical and immunological stability profiles over the liquid rPA formulation.
  • the lyophilized formulations maintained all the key physiochemical properties tested by MLA, SEC and AEX at storage temperatures up to 50 °C and over the 4 month storage time period.
  • the lyophilized formulations also maintained immunogenicity at storage temperatures up to 40 °C for at least 1 month.
  • the liquid rPA formulation showed a complete loss of the physiochemical properties (MLA, SEC, and AEX) and a significant drop in immunogenicity after storage for 1 month at 40 °C.
  • CPG 7909 Bulk Drug Substance is packaged as a lyophilized powder in high density polyethylene (HDPE) bottles, heat sealed in multi-layer (mylar, foil) pouches, and stored at -20°C ⁇ 5°C.
  • HDPE high density polyethylene
  • Glucopyranosyl Lipid Adjuvant was obtained from Avanti Polar Lipids,
  • GLA is described in Arias et al. (2012) PLoS ONE 7(7):e41 144.
  • BDS Bulk Drug Substance
  • PIPC Polyl PolyC
  • NaPi buffers separately, and were sterile filtered.
  • a 10% (v/v) solution of Polysorbate80 was prepared in DI water and then sterile filtered.
  • Two 12%> (w/v) solutions of alanine were prepared in 20mM Tris and 5mM NaPi buffers, separately, and were sterile filtered.
  • One aluminum hydroxide stock solution was buffered by adding 7 mL of 1M Tris buffer, pH 7.4, to 343 mL of 2%> AIOH (or 10 mg/mL aluminum) and was titrated to pH 7.4.
  • a second aluminum hydroxide stock solution was buffered by adding 1.75 mL of 1M NaPi buffer, pH 7.0, to 348.25 mL of 2% AIOH and was titrated to pH 7.0. The dilution effect from the buffer addition and subsequent titration was not accounted for in either preparation.
  • GLA adjuvant was prepared in 20mM Tris-HCl buffer, pH 7.4 by adding 31.2 mg of powder into a 50 mL conical tube and adding 15.6 mL of buffer. The mixture was sonicated for a total of 60 seconds in 10 second intervals with 10 second rests in between to a maximum power of 15 W. A turbid mixture was obtained of 2 mg/mL GLA.
  • CPG 7909 stocks were prepared in 20mM Tris, pH 7.4 or 5mM NaPi, pH 7.0 buffers. In each preparation, about 200 mg of CPG 7909 powder were fully dissolved in a final volume of 10 mL. A clear solution was obtained for both preparations.
  • a 2 mg/mL stock solution of PIPC was prepared by dissolving a 50 mg lyophilized cake of PIPC in 25 mL of 5 mM NaPi buffer, pH 7.0. The mixture was sonicated for a total of 60 seconds in 10 second intervals with 10 second rests in between to a maximum power of 15 W. A clear solution with no visible particles was obtained.
  • Table 16 shows the chemical composition of the prepared formulations:
  • a final volume of 20 mL was prepared for samples 14-20, 40-45 and 76-81 for lyophilization. Blends were split into 10 mL glass vials in 2 mL aliquots and set aside for lyophilization.
  • a 10% (v/v) solution of Polysorbate80 was prepared by mixing 10 niL of concentrated Tween80 in 90 niL of DI water. Three 12% (w/v) solutions of alanine were prepared, one in 20mM Tris (pH 7.4), a second in 5mM NaPi buffers (pH 7.0), and a third in 20mM Na- Citrate (pH 5.5) and all were sterile filtered.
  • Figure 21 shows the NF50 and the standard deviation of mean of the 12 formulations.
  • Table 21 shows the numerical values of each mouse of the 12 formulations.
  • Example 9 Formulations with Influenza Antigen(s)
  • Formulations containing influenza antigen(s) are formulated using methods similar to the disclosed herein for rPA formulations, except for the presence of influenza antigen(s) and the absence of rPA antigens.
  • the influenza antigen is an influenza hemagglutinin.
  • Formulations may also contain another adjuvant such as CPG at 0.5 mg/rnL, PIPC at 0.5 mg/mL, GLA at

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Engineering & Computer Science (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • Molecular Biology (AREA)
  • Immunology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Inorganic Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Organic Chemistry (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicinal Preparation (AREA)
  • Peptides Or Proteins (AREA)
PCT/US2013/047712 2012-06-25 2013-06-25 Temperature stable vaccine formulations Ceased WO2014004578A1 (en)

Priority Applications (12)

Application Number Priority Date Filing Date Title
RU2014151424A RU2014151424A (ru) 2012-06-25 2013-06-25 Термостабильные составы вакцины
AU2013280480A AU2013280480B2 (en) 2012-06-25 2013-06-25 Temperature stable vaccine formulations
HK15108032.6A HK1207312A1 (en) 2012-06-25 2013-06-25 Temperature stable vaccine formulations
CA2877130A CA2877130A1 (en) 2012-06-25 2013-06-25 Temperature stable vaccine formulations
CN201380037918.7A CN104470506A (zh) 2012-06-25 2013-06-25 温度稳定性疫苗制剂
JP2015520412A JP2015525748A (ja) 2012-06-25 2013-06-25 温度に安定なワクチン製剤
IN38MUN2015 IN2015MN00038A (https=) 2012-06-25 2013-06-25
SG11201408262XA SG11201408262XA (en) 2012-06-25 2013-06-25 Temperature stable vaccine formulations
KR20157000755A KR20150034170A (ko) 2012-06-25 2013-06-25 온도 안정성 백신 제형
EP13809706.8A EP2863898A4 (en) 2012-06-25 2013-06-25 STABLE TEMPERATURE VACCINE FORMULATIONS
US14/410,942 US20150335752A1 (en) 2012-06-25 2013-06-25 Temperature Stable Vaccine Formulations
IL236380A IL236380A0 (en) 2012-06-25 2014-12-21 Temperature stable vaccine formulations

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201261664062P 2012-06-25 2012-06-25
US61/664,062 2012-06-25
US201361801385P 2013-03-15 2013-03-15
US61/801,385 2013-03-15

Publications (1)

Publication Number Publication Date
WO2014004578A1 true WO2014004578A1 (en) 2014-01-03

Family

ID=49783811

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2013/047712 Ceased WO2014004578A1 (en) 2012-06-25 2013-06-25 Temperature stable vaccine formulations

Country Status (13)

Country Link
US (1) US20150335752A1 (https=)
EP (1) EP2863898A4 (https=)
JP (1) JP2015525748A (https=)
KR (1) KR20150034170A (https=)
CN (1) CN104470506A (https=)
AU (1) AU2013280480B2 (https=)
CA (1) CA2877130A1 (https=)
HK (1) HK1207312A1 (https=)
IL (1) IL236380A0 (https=)
IN (1) IN2015MN00038A (https=)
RU (1) RU2014151424A (https=)
SG (1) SG11201408262XA (https=)
WO (1) WO2014004578A1 (https=)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2015100344A1 (en) * 2013-12-27 2015-07-02 Emergent Product Development Gaithersburg Inc. Temperature stable vaccine formulations
JP2018521129A (ja) * 2015-07-07 2018-08-02 ナノビオ コーポレイションNanobio Corporation タンパク質の安定化のための方法および組成物
US11185503B2 (en) 2017-01-20 2021-11-30 Daewoong Co., Ltd. Stable liquid composition comprising botulinum toxin
US11510871B2 (en) 2016-09-16 2022-11-29 Leukocare Ag Method for producing low viscous and highly concentrated biopharmaceutical drug products in liquid formulation
US12350375B2 (en) 2016-09-16 2025-07-08 Leukocare Ag Method for obtaining efficient viral vector-based compositions for vaccination or gene therapy

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
IL310015B2 (en) 2013-12-31 2026-02-01 Access To Advanced Health Inst Single vial formulation
US11173197B2 (en) 2015-07-07 2021-11-16 Bluewillow Biologics, Inc. Methods and compositions for nanoemulsion vaccine formulations
US20170007690A1 (en) * 2015-07-07 2017-01-12 Nanobio Corporation Methods and compositions for the stabilization of anthrax recombinant protective antigen
KR20190053908A (ko) * 2016-09-16 2019-05-20 로이코케어 아게 가공 동안 바이오 의약품의 안정화를 위한 신규한 방법

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20100158951A1 (en) * 2007-03-22 2010-06-24 The Regents Of The University Of Colorado Method of Preparing an Immunologically-Active Adjuvant-Bound Dried Vaccine Composition
WO2010084298A1 (en) * 2009-01-22 2010-07-29 Pharmathene Uk Limited Stable vaccine compositions and methods of use
US20110229507A1 (en) * 2008-07-30 2011-09-22 Elizabet Kaisheva Stable anthrax vaccine formulations

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE69530196T2 (de) * 1994-06-02 2003-11-20 Elan Drug Delivery Ltd Methode zum verhindern der aggregation von proteinen/peptiden bei rehydratation oder auftauen
US7201912B2 (en) * 2002-04-12 2007-04-10 Emergent Biodefense Operation Lansing Inc. Recombinant immunogenic compositions and methods for protecting against lethal infections from Bacillus anthracis
US9283260B2 (en) * 2006-04-21 2016-03-15 Amgen Inc. Lyophilized therapeutic peptibody formulations
CN100556400C (zh) * 2006-07-20 2009-11-04 上海交通大学 载有活性疫苗或抗体的多糖玻璃体微粒的制备方法
US20080226729A1 (en) * 2006-09-08 2008-09-18 Becton, Dickinson And Company Stable powder formulations of alum-adsorbed vaccines
US20110212127A1 (en) * 2008-09-24 2011-09-01 Stabilitech Ltd. Method for Preserving Polypeptides Using a Sugar and Polyethyleneimine

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20100158951A1 (en) * 2007-03-22 2010-06-24 The Regents Of The University Of Colorado Method of Preparing an Immunologically-Active Adjuvant-Bound Dried Vaccine Composition
US20110229507A1 (en) * 2008-07-30 2011-09-22 Elizabet Kaisheva Stable anthrax vaccine formulations
WO2010084298A1 (en) * 2009-01-22 2010-07-29 Pharmathene Uk Limited Stable vaccine compositions and methods of use

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
See also references of EP2863898A4 *
WANG ET AL.: "Selection of Adjuvants for Enhanced Vaccine Potency", WORLD JOURNAL OF VACCINES, vol. 1, 12 October 2011 (2011-10-12), pages 33 - 78, XP055177437 *

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2015100344A1 (en) * 2013-12-27 2015-07-02 Emergent Product Development Gaithersburg Inc. Temperature stable vaccine formulations
US10357559B2 (en) 2013-12-27 2019-07-23 Emergent Product Development Gaithersburg Inc. Temperature stable vaccine formulations
JP2018521129A (ja) * 2015-07-07 2018-08-02 ナノビオ コーポレイションNanobio Corporation タンパク質の安定化のための方法および組成物
US11510871B2 (en) 2016-09-16 2022-11-29 Leukocare Ag Method for producing low viscous and highly concentrated biopharmaceutical drug products in liquid formulation
US12350375B2 (en) 2016-09-16 2025-07-08 Leukocare Ag Method for obtaining efficient viral vector-based compositions for vaccination or gene therapy
US11185503B2 (en) 2017-01-20 2021-11-30 Daewoong Co., Ltd. Stable liquid composition comprising botulinum toxin

Also Published As

Publication number Publication date
US20150335752A1 (en) 2015-11-26
CA2877130A1 (en) 2014-01-03
AU2013280480A1 (en) 2015-01-22
JP2015525748A (ja) 2015-09-07
EP2863898A1 (en) 2015-04-29
IL236380A0 (en) 2015-02-26
CN104470506A (zh) 2015-03-25
IN2015MN00038A (https=) 2015-10-16
RU2014151424A (ru) 2016-08-20
HK1207312A1 (en) 2016-01-29
EP2863898A4 (en) 2016-04-27
KR20150034170A (ko) 2015-04-02
AU2013280480B2 (en) 2018-03-15
SG11201408262XA (en) 2015-01-29

Similar Documents

Publication Publication Date Title
AU2013280480B2 (en) Temperature stable vaccine formulations
JP7109412B2 (ja) Staphylococcus aureusに対して免疫化するための組成物
JP6435261B2 (ja) Staphylococcusaureusに対する免疫化のための安定化されたタンパク質
RU2623174C2 (ru) Вакцины и композиции против streptococcus pneumoniae
US20150023998A1 (en) Stable Anthrax Vaccine Formulations
US20230066762A1 (en) Immunogenic composition
US10357559B2 (en) Temperature stable vaccine formulations
JP2018135388A (ja) シュードモナス抗原および抗原の組み合わせ
US20100183675A1 (en) Stable vaccine compositions and methods of use
JP2012515752A (ja) 安定なワクチン組成物とその使用方法
US10293041B2 (en) Multivalent stable vaccine composition and methods of making same
WO2025149609A1 (en) Formulations for staphylococcus aureus vaccine
JP2015528456A (ja) Staphylococcusaureusに対する免疫化のための安定化されたタンパク質
JP2015532594A (ja) Staphylococcusaureusに対する免疫化のための安定化されたタンパク質
JP2013510188A (ja) 黄色ブドウ球菌に由来する菌血症関連抗原
WO2016007797A1 (en) Multivalent stable vaccine composition and methods of making same
NZ614460B2 (en) Vaccines and compositions against streptococcus pneumoniae

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13809706

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2013809706

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2877130

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 14410942

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2015520412

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 20157000755

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2013280480

Country of ref document: AU

Date of ref document: 20130625

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2014151424

Country of ref document: RU

Kind code of ref document: A