WO2013192596A2 - Antigen binding proteins that bind ccr2 - Google Patents

Antigen binding proteins that bind ccr2 Download PDF

Info

Publication number
WO2013192596A2
WO2013192596A2 PCT/US2013/047192 US2013047192W WO2013192596A2 WO 2013192596 A2 WO2013192596 A2 WO 2013192596A2 US 2013047192 W US2013047192 W US 2013047192W WO 2013192596 A2 WO2013192596 A2 WO 2013192596A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
called
variable domain
ccr2
antibody
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2013/047192
Other languages
English (en)
French (fr)
Other versions
WO2013192596A3 (en
Inventor
Dingqiu HUANG
Barbara A. Swanson
Heyue Zhou
Guodi LU
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Sorrento Therapeutics Inc
Original Assignee
Sorrento Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Sorrento Therapeutics Inc filed Critical Sorrento Therapeutics Inc
Priority to CA2877814A priority Critical patent/CA2877814A1/en
Priority to HK15108907.8A priority patent/HK1208236A1/xx
Priority to EP13807252.5A priority patent/EP2864358B1/en
Priority to CN201380043633.4A priority patent/CN105051065A/zh
Priority to JP2015518629A priority patent/JP6438391B2/ja
Publication of WO2013192596A2 publication Critical patent/WO2013192596A2/en
Publication of WO2013192596A3 publication Critical patent/WO2013192596A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2866Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • A61P11/02Nasal agents, e.g. decongestants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • A61P11/06Antiasthmatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/08Drugs for disorders of the urinary system of the prostate
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/10Drugs for disorders of the urinary system of the bladder
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/12Drugs for disorders of the urinary system of the kidneys
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P15/00Drugs for genital or sexual disorders; Contraceptives
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/04Antipruritics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/06Antipsoriatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/08Antiseborrheics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • A61P21/04Drugs for disorders of the muscular or neuromuscular system for myasthenia gravis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/04Centrally acting analgesics, e.g. opioids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/06Antihyperlipidemics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/18Antivirals for RNA viruses for HIV
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/08Antiallergic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/02Antithrombotic agents; Anticoagulants; Platelet aggregation inhibitors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/12Antihypertensives
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3015Breast
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3023Lung
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/303Liver or Pancreas
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3038Kidney, bladder
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3069Reproductive system, e.g. ovaria, uterus, testes, prostate
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • compositions and methods relating to or derived from anti-CCR2 antibodies More specifically, the present disclosure provides human antibodies that bind CCR2, CCR2-binding fragments and derivatives of such antibodies, and CCR2-binding polypeptides comprising such fragments.
  • the present disclosure provides nucleic acids encoding such antibodies, antibody fragments and derivatives and polypeptides, cells comprising such polynucleotides, methods of making such antibodies, antibody fragments and derivatives and polypeptides, and methods of using such antibodies, antibody fragments and derivatives and polypeptides, including methods of treating or diagnosing subjects having CCR2 related disorders or conditions, including CCR2 mediated disorder is selected from the group consisting of autoimmune disorders, cardiovascular disorders, inflammatory disorders, immune disorders, proliferative disorders, fibrotic disorders, viral infections, neurological disorders and metabolic disorders.
  • CCR2 CC-Chemokine Receptor 2
  • monocytes CC-Chemokine Receptor 2
  • CCR2a and CCR2P CC-Chemokine Receptor 2
  • CCR2a and CCR2P are slightly different forms due to alternative splicing of the mRNA encoding the carboxy-terminal region (Charo et al., Proc. Natl. Acad. Sci. USA 91 :2752-2756 (1994)).
  • CCR2 is the primary receptor for Chemokine Ligand CCL2 (Monocyte
  • Chemoattractant Protein 1 (MCP-1)) and also binds CCL8 (MCP-2), CCL7 (MCP-3), CCL13 (MCP-4), CCL12 (MCP-5) and HIV.
  • MCP-1 Chemoattractant Protein 1
  • MCP-2 Chemoattractant Protein 2
  • CCL7 MCP-3
  • CCL13 MCP-4
  • CCL12 MCP-5
  • HIV HIV-binds CCL8
  • CCL7 CCL7
  • CCL13 CCL13
  • HIV CCL12
  • CCR2 antagonists CCL2 antagonists or agents which interfere with the binding of CCR2 to its natural ligands represent a class of important therapeutic agents.
  • mammalian chemokine receptors In addition to the mammalian chemokine receptors, mammalian cytomegaloviruses, herpesviruses and pox viruses have been shown to express, in infected cells, proteins with the binding properties of chemokine receptors (Wells et al., Curr. Opin. Biotech. 1997, 8, 741 - 748).
  • Human chemokine receptors such as CXCR4, CCR2, CCR3, CCR5 and CCR8, can act as co-receptors for the infection of mammalian cells by microbes as with, for example, the human immunodeficiency viruses (HIV).
  • chemokines and their cognate receptors have been implicated as being important mediators of inflammatory, infectious, and immunoregulatory disorders and diseases, including asthma and allergic diseases; as well as autoimmune pathologies, such as rheumatoid arthritis and multiple sclerosis; and metabolic diseases, such as atherosclerosis and diabetes (reviewed in: Charo et al., New Eng. J. Med. 2006, 354, 610-621 ; Gao et al., Chem. Rev. 2003, 103, 3733; Carter, Curr. Opin. Chem. Biol. 2002, 6, 510; Trivedi et al., Ann. Reports Med. Chem. 2000, 35, 191 ; Saunders et al., Drug Disc.
  • chemokine monocyte chemoattractant- 1 MCP-1
  • CCR2 Chemokine Receptor 2
  • MCP-1 -/-mice were unable to recruit monocytes into sites of inflammation after several different types of immune challenge (Lu et al., J. Exp. Med. 1998, 187, 601).
  • CCR2- /- mice were unable to recruit monocytes or produce interferon- ⁇ when challenged with various exogenous agents; moreover, the leukocytes of CCR2 null mice did not migrate in response to MCP-1 (Boring et al., J. Clin. Invest. 1997, 100, 2552), thereby demonstrating the specificity of the MCP-l/CCR-2 interaction.
  • Two other groups have independently reported equivalent results with different strains of CCR-2-/- mice (Kuziel et al., Proc. Natl. Acad.
  • ⁇ - ⁇ is elevated in the synovial fluid and blood of patients with rheumatoid arthritis (Koch et al., J. Clin. Invest. 1994, 93, 921-928). Moreover, several studies have demonstrated the potential therapeutic value of antagonism of the ⁇ - ⁇ /CCR1 interaction in treating rheumatoid arthritis (Pease et al., Expert Opin. Invest. Drugs 2005, 14, 785-796). An antibody to ⁇ - ⁇ was shown to ameliorate experimental autoimmune encepahlomytis (EAE), a model of multiple sclerosis, in mice (Karpus et al., J. Immun. 1995, 5003-5010). Likewise, inflammatory disease symptoms could be controlled via direct administration of antibodies for MIP-loc to mice with collagen-induced arthritis (Lukacs et al., 1995, 95, 2868-2876).
  • EAE experimental autoimmune encepahlomytis
  • MCP-1 is upregulated in patients who develop bronchiolitis obliterans syndrome after lung transplantation (Reynaud-Gaubert et al., /. Heart Lung Transplant., 2002, 21 , 721-730; Belperio et al., J. Clin. Invest. 2001 , 108, 547-556).
  • bronchiolitis obliterans syndrome administration of an antibody to MCP-1 led to attenuation of airway obliteration; likewise, CCR2-/-mice were resistant to airway obliteration in this same model (Belperio et al., J. Clin. Invest. 2001, 108, 547-556).
  • CCR-2-/-mice were protected from the effects of dextran sodium sulfate-induced colitis (Andres et al., J. Immunol. 2000, 164, 6303).
  • MCP- l-/-mice showed substantially reduced colonic damage (both macroscopic and histological) in a hapten-induced model of colitis (Khan et al., Am. J. Physiol. Gastrointest. Liver Physiol. 2006, 291. G803).
  • MCP- 1 levels correlate directly with risk for restenosis (Cipollone et al., Arterioscler. Thromb. Vase. Biol. 2001 , 21, 327). Mice deficient in CCR2 or in MCP- 1 showed reductions in the intimal area and in the intima/media ratio (relative to wildtype littermates) after arterial injury (Roque et al.,
  • CCR2-/- mice showed altered responses to inflammatory pain relative to their WT counterparts, including reduced pain behavior after intraplantar formalin injection and slightly reduced mechanical allodynia after intraplantar CFA injection (Abbadie et al., Proc. Natl. Acad. Sci., USA 2003, 100, 7947). In addition, CCR2-/-mice did not display significant mechanical allodynia after sciatic nerve injury. Likewise, a small molecule CCR2 antagonist reduced mechanical allodynia to 80% of pre-injury levels after oral administration (WO 2004/1 10376).
  • MCP-1 has been noted in the lung endothelial cells of patients with idiopathic pulmonary fibrosis (Antoniades et al., Proc. Natl. Acad. Sci. USA 1992, 89, 5371).
  • MCP- 1 has been noted in the skin from patients with psoriasis (Deleuran et al., J. Dermatol. Sci. 1996, 13, 228, and Gillitzer et al., J. Invest. Dermatol. 1993, 101 , 127); correlative findings with predominance of CCR2+ cells have also been reported (Vestergaard et al., Acta Derm. Venerol. 2004, 84, 353). Finally, a recent report has shown that MCP-1 is overexpressed in the brains and cerebrospinal fluid of patients with HIV- 1 -associated dementia (WO 99/46991).
  • CCR2 polymorphism has been shown to be associated with sarcoidosis at least in one subset of patients (Spagnolo et al., Am. J. Respir. Crit. Care Med. 2003, 168, 1 162).
  • CCR2 has been implicated as a co-receptor for some strains of HIV (Doranz et al., Cell 1996, 85, 1149). It has also been determined that the use of CCR2 as an HIV co-receptor can be correlated with disease progression (Connor et al., J. Exp. Med. 1997, 185, 621). This finding is consistent with the recent finding that the presence of a CCR2 mutant, CCR2-64I, is positively correlated with delayed onset of HIV in the human population (Smith et al., Science 1997, 277, 959). Although MCP-1 has not been implicated in these processes, it may be that MCP-1 antagonists that act via binding to CCR2 may have beneficial therapeutic effects in delaying the disease progression to AIDS in HIV-infected patients. Summary
  • the present disclosure provides a fully human antibody of an IgG class that binds to a
  • CCR2 epitope with a binding affinity of at least 10 "6 M which has a heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 1, SEQ ID NO. 3, SEQ ID NO. 4, SEQ ID NO. 5, SEQ ID NO. 6, SEQ ID NO. 7, SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 1 1, SEQ ID NO. 12, SEQ ID NO. 13, SEQ ED NO. 14, SEQ ED NO. 15, SEQ ED NO. 17, SEQ ID NO. 19, SEQ ED NO. 21, SEQ ID NO. 23, SEQ ED NO. 25, SEQ ED NO. 27, SEQ ED NO. 29, SEQ ID NO.
  • SEQ ED NO. 33 SEQ ED NO. 35, SEQ ED NO. 37, SEQ ED NO. 39, SEQ ED NO. 41, SEQ ED NO. 43, and combinations thereof, that has a light chain variable domain sequence that is at least 95% identical to the amino acid sequence consisting of SEQ ID NO. 2, SEQ ED NO. 16, SEQ ID NO. 18, SEQ ED NO. 20, SEQ ED NO. 22, SEQ ID NO. 24, SEQ ID NO. 26, SEQ ID NO. 28, SEQ ED NO. 30, SEQ ED NO. 32, SEQ ID NO. 34, SEQ ID NO. 36, SEQ ID NO. 38, SEQ ID NO. 40, SEQ ID NO. 42, SEQ ED NO. 44, and combinations thereof.
  • the fully human antibody has both a heavy chain and a light chain wherein the antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ED NO. 2 (called Dl herein), SEQ ID NO. 3/SEQ ID NO. 2 (called 1A2 herein), SEQ ID NO. 4/SEQ ID NO. 2 (called 1B 1 1 herein), SEQ ED NO. 5/SEQ ED NO. 2 (called 1G11 herein), SEQ ED NO. 6/SEQ ID NO. 2 (called 1H5 herein), SEQ ID NO. 7/SEQ ID NO. 2 (called 1B2 herein), SEQ ID NO. 8/SEQ ED NO.
  • Dl-1 herein
  • SEQ ED NO. 9/SEQ ID NO. 2 called Dl-2 herein
  • SEQ ED NO. 10/SEQ ED NO. 2 called Dl-3 herein
  • SEQ ID NO. 1 1/SEQ ID NO. 2 called Dl-4 herein
  • SEQ ID NO. 12/SEQ ID NO. 2 called Dl-5 herein
  • SEQ ID NO. 13/SEQ ID NO. 2 called Dl-6 herein
  • SEQ ID NO. 14/SEQ ID NO. 2 called Dl-7 herein
  • SEQ ID NO. 15/SEQ ID NO. 2 called Dl-8 herein
  • SEQ ID NO. 8/SEQ ID NO. 16 called D1-1A herein
  • D1-2B herein SEQ ID NO. 10/SEQ ID NO. 32 (called D1-3B herein), SEQ ID NO. 1 1/SEQ ID NO. 32 (called D1-4B herein), SEQ ED NO. 12/SEQ ED NO. 32 (called D1-5B herein), SEQ ED NO. 13/SEQ ID NO. 32 (called D1-6B herein), SEQ ED NO. 14/SEQ ED NO. 32 (called Dl-7 A herein), SEQ ID NO. 15/SEQ ID NO. 32 (called D1-8B herein), SEQ ID NO. 17/SEQ ID NO. 18 (called 42 AO herein), SEQ ID NO. 19/SEQ ID NO. 20 (called 42D4 herein), SEQ ED NO.
  • the present disclosure provides a Fab fully human antibody fragment, having a variable domain region from a heavy chain and a variable domain region from a light chain, wherein the heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ED NO. 1, SEQ ED NO. 3, SEQ ID NO. 4, SEQ ID NO. 5, SEQ ID NO. 6, SEQ ID NO. 7, SEQ ED NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 1 1, SEQ ED NO. 12, SEQ ED NO. 13, SEQ ED NO. 14, SEQ ED NO. 15, SEQ ID NO. 17, SEQ ED NO. 19, SEQ ID NO. 21, SEQ ED NO. 23, SEQ ID NO.
  • SEQ ID NO. 27 SEQ ID NO. 29, SEQ ED NO. 31 , SEQ ED NO. 33, SEQ ED NO. 35, SEQ ED NO. 37, SEQ ED NO. 39, SEQ ED NO. 41 , SEQ ED NO. 43, and combinations thereof, and that has a light chain variable domain sequence that is at least 95% identical to the amino acid sequence consisting of SEQ ED NO. 2, SEQ ED NO. 16, SEQ ED NO. 18, SEQ ED NO. 20, SEQ ED NO. 22, SEQ ED NO. 24, SEQ ED NO. 26, SEQ ED NO. 28, SEQ ED NO. 30, SEQ ED NO. 32, SEQ ID NO. 34, SEQ ID NO. 36, SEQ ID NO.
  • the fully human antibody Fab fragment has both a heavy chain variable domain region and a light chain variable domain region wherein the antibody has a heavy chain/light chain variable domain sequence selected from the group consisting SEQ ID NO. 1/SEQ ID NO. 2, SEQ ID NO. 3/SEQ ID NO. 2, SEQ ID NO. 4/SEQ ID NO. 2, SEQ ID NO. 5/SEQ ID NO. 2, SEQ ID NO. 6/SEQ ID NO. 2, SEQ ID NO. 7/SEQ ID NO. 2, SEQ ID NO. 8/SEQ ID NO. 2, SEQ ID NO. 9/SEQ ID NO. 2, SEQ ID NO. 10/SEQ ID NO.
  • the present disclosure provides a single chain human antibody, having a variable domain region from a heavy chain and a variable domain region from a light chain and a peptide linker connection the heavy chain and light chain variable domain regions, wherein the heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 1, SEQ ID NO. 3, SEQ ID NO. 4, SEQ ID NO. 5, SEQ ID NO. 6, SEQ ID NO. 7, SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 1 1, SEQ ED NO. 12, SEQ ID NO. 13, SEQ ID NO. 14, SEQ ID NO. 15, SEQ ID NO. 17, SEQ ID NO. 19, SEQ ID NO. 21, SEQ ID NO.
  • SEQ ID NO. 25 SEQ ID NO. 27, SEQ ID NO. 29, SEQ ID NO. 31, SEQ ID NO. 33, SEQ ID NO. 35, SEQ ID NO. 37, SEQ ID NO. 39, SEQ ED NO. 41 , SEQ ED NO. 43, and that has a light chain variable domain sequence that is at least 95% identical to the amino acid sequence consisting of SEQ ED NO. 2, SEQ ID NO. 16, SEQ ED NO. 18, SEQ ED NO. 20, SEQ ED NO. 22, SEQ ED NO. 24, SEQ ID NO. 26, SEQ ID NO. 28, SEQ ED NO. 30, SEQ ED NO. 32, SEQ ID NO. 34, SEQ ED NO. 36, SEQ ID NO. 38, SEQ ID NO.
  • the fully human single chain antibody has both a heavy chain variable domain region and a light chain variable domain region, wherein the single chain fully human antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ID NO. 2, SEQ ID NO. 3/SEQ ID NO. 2, SEQ ID NO. 4/SEQ ID NO. 2, SEQ ID NO. 5/SEQ ID NO. 2, SEQ ID NO. 6/SEQ ID NO. 2, SEQ ID NO. 7/SEQ ID NO. 2, SEQ ID NO. 8/SEQ ID NO. 2, SEQ ID NO. 9/SEQ ED NO. 2, SEQ ED NO.
  • the present disclosure further provides a method for treating a broad spectrum of mammalian cancers or a broad-spectrum of inflammatory diseases and autoimmune diseases, comprising administering an effective amount of an anti-CCR2 polypeptide, wherein the anti- CCR2 polypeptide is selected from the group consisting of a fully human antibody of an IgG class that binds to a CCR2 epitope with a binding affinity of at least lO ⁇ M, a Fab fully human antibody fragment, having a variable domain region from a heavy chain and a variable domain region from a light chain, a single chain human antibody, having a variable domain region from a heavy chain and a variable domain region from a light chain and a peptide linker connection the heavy chain and light chain variable domain regions, and combinations thereof; wherein the fully human antibody has a heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO.
  • SEQ ID NO. 3 SEQ ID NO. 4, SEQ ID NO. 5, SEQ ED NO. 6, SEQ ID NO. 7, SEQ ID NO. 8, SEQ ID NO. 9, SEQ ED NO. 10, SEQ ED NO. 1 1 , SEQ ED NO. 12, SEQ ID NO. 13, SEQ ID NO. 14, SEQ ED NO. 15, SEQ ED NO. 17, SEQ ED NO. 19, SEQ ED NO. 21, SEQ ID NO. 23, SEQ ID NO. 25, SEQ ID NO. 27, SEQ ID NO. 29, SEQ ID NO. 31 , SEQ ID NO. 33, SEQ ID NO. 35, SEQ ID NO. 37, SEQ ID NO. 39, SEQ ID NO. 41 , SEQ ID NO.
  • the Fab fully human antibody fragment has the heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 1 , SEQ ID NO. 3, SEQ ED NO. 4, SEQ ED NO. 5, SEQ ID NO. 6, SEQ ED NO. 7, SEQ ID NO. 8, SEQ ED NO. 9, SEQ ID NO. 10, SEQ ID NO. 1 1 , SEQ ED NO. 12, SEQ ID NO. 13, SEQ ED NO. 14, SEQ ED NO. 15, SEQ ID NO. 17, SEQ ID NO. 19, SEQ ED NO. 21 , SEQ ED NO. 23, SEQ ED NO. 25, SEQ ED NO. 27, SEQ ED NO. 29, SEQ ID NO.
  • SEQ ED NO. 33 SEQ ID NO. 35, SEQ ED NO. 37, SEQ ID NO. 39, SEQ ED NO. 41 , SEQ ID NO. 43, and combinations thereof, and that has the light chain variable domain sequence that is at least 95% identical to the amino acid sequence consisting of SEQ ED NO. 2, SEQ ED NO. 16, SEQ ID NO. 18, SEQ ED NO. 20, SEQ ED NO. 22, SEQ ED NO. 24, SEQ ED NO. 26, SEQ ED NO. 28, SEQ ED NO. 30, SEQ ED NO. 32, SEQ ED NO. 34, SEQ ID NO. 36, SEQ ID NO. 38, SEQ ID NO. 40, SEQ ED NO. 42, SEQ ED NO.
  • the single chain human antibody has the heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ED NO. 1, SEQ ID NO. 3, SEQ ED NO. 4, SEQ ID NO. 5, SEQ ED NO. 6, SEQ ID NO. 7, SEQ ID NO. 8, SEQ ID NO. 9, SEQ ED NO. 10, SEQ ED NO. 1 1, SEQ ID NO. 12, SEQ ID NO. 13, SEQ ID NO. 14, SEQ ED NO. 15, SEQ ED NO. 17, SEQ ED NO. 19, SEQ ID NO. 21 , SEQ ID NO. 23, SEQ ED NO. 25, SEQ ED NO. 27, SEQ ED NO. 29, SEQ ED NO.
  • SEQ ID NO. 33 SEQ ID NO. 35, SEQ ED NO. 37, SEQ ED NO. 39, SEQ ED NO. 41 , SEQ ED NO. 43, and combinations thereof, and that has the light chain variable domain sequence that is at least 95% identical to the amino acid sequence consisting of SEQ ID NO. 2, SEQ ID NO. 16, SEQ ED NO. 18, SEQ ED NO. 20, SEQ ED NO. 22, SEQ ED NO. 24, SEQ ED NO. 26, SEQ ID NO. 28, SEQ ED NO. 30, SEQ ED NO. 32, SEQ ED NO. 34, SEQ ED NO. 36, SEQ ED NO. 38, SEQ ED NO. 40, SEQ ED NO. 42, SEQ ED NO. 44, and combinations thereof.
  • the fully human antibody has both a heavy chain and a light chain wherein the antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ED NO. 1/SEQ ED NO. 2, SEQ ED NO. 3/SEQ ID NO. 2, SEQ ID NO. 4/SEQ ID NO. 2, SEQ ID NO. 5/SEQ ED NO. 2, SEQ ED NO. 6/SEQ ID NO. 2, SEQ ED NO. 7/SEQ ED NO. 2, SEQ ED NO. 8/SEQ ED NO. 2, SEQ ED NO. 9/SEQ ID NO. 2, SEQ ED NO. 10/SEQ ED NO. 2, SEQ ED NO. 1 1/SEQ ED NO. 2, SEQ ID NO.
  • the fully human antibody Fab fragment has both a heavy chain variable domain region and a light chain variable domain region wherein the antibody has a heavy chain light chain variable domain sequence selected from the group consisting of SEQ ED NO. 1/SEQ ID NO.
  • SEQ ED NO. 3/SEQ ED NO. 2 SEQ ID NO. 4/SEQ ID NO. 2, SEQ ED NO. 5/SEQ ED NO. 2, SEQ ED NO. 6/SEQ ED NO. 2, SEQ ID NO. 7/SEQ ID NO. 2, SEQ ID NO. 8/SEQ ID NO. 2, SEQ ED NO. 9/SEQ ED NO. 2, SEQ ED NO. 10/SEQ ED NO. 2, SEQ ED NO. 1 1/SEQ ED NO. 2, SEQ ID NO. 12/SEQ ED NO. 2, SEQ ED NO. 13/SEQ ED NO. 2, SEQ ID NO. 14/SEQ ED NO. 2, SEQ ED NO. 15/SEQ ID NO. 2, SEQ ED NO. 8/SEQ ED NO. 16, SEQ ID NO. 9/SEQ ID NO. 16, SEQ ID NO. 10/SEQ ED NO. 16, SEQ ED NO.
  • the fully human single chain antibody has both a heavy chain variable domain region and a light chain variable domain region, wherein the single chain fully human antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ID NO. 2, SEQ ID NO. 3/SEQ ID NO. 2, SEQ ED NO. 4/SEQ ID NO. 2, SEQ ED NO. 5/SEQ ID NO. 2, SEQ ID NO. 6/SEQ ID NO. 2, SEQ ID NO. 7/SEQ ID NO. 2, SEQ ID NO. 8/SEQ ID NO. 2, SEQ ID NO. 9/SEQ ID NO.
  • SEQ ID NO. 10/SEQ ED NO. 2 SEQ ID NO. 1 1/SEQ ID NO. 2, SEQ ID NO. 12/SEQ D NO. 2, SEQ ED NO. 13/SEQ ID NO. 2, SEQ ED NO. 14/SEQ ED NO. 2, SEQ ED NO. 15/SEQ ID NO. 2, SEQ ED NO. 8/SEQ ID NO. 16, SEQ ID NO. 9/SEQ ID NO. 16, SEQ ID NO. 10/SEQ ID NO. 16, SEQ ID NO.
  • the broad spectrum of mammalian cancers to be treated is selected from the group consisting of the osteosarcoma, rhabdomyosarcoma, neuroblastoma, any pediatric cancer, kidney cancer, leukemia, renal transitional cell cancer, Werner-Morrison syndrome, acromegaly, bladder cancer, Wilm's cancer, ovarian cancer, pancreatic cancer, benign prostatic hyperplasia, breast cancer, prostate cancer, bone cancer, lung cancer, gastric cancer, colorectal cancer, cervical cancer, synovial sarcoma, diarrhea associated with metastatic carcinoid, vasoactive intestinal peptide secreting tumors, gigantism, psoriasis, atherosclerosis, smooth muscle restenosis of blood vessels and inappropriate microvascular proliferation, head and neck cancer, squamous cell carcinoma, multiple myeloma, solitary plasmacytoma, renal cell cancer, retinoblastoma, germ cell tumors, hepatoblastoma, he
  • meningioma pituitary adenoma, vestibular schwannoma, a primitive neuroectodermal tumor, medulloblastoma, astrocytoma, anaplastic astrocytoma, oligodendroglioma, ependymoma and choroid plexus papilloma, a myeloproliferative disorder, polycythemia vera, thrombocythemia, idiopathic myelfibrosis, soft tissue sarcoma, thyroid cancer, endometrial cancer, carcinoid cancer, germ cell tumors, liver cancer, gigantism, psoriasis, atherosclerosis, smooth muscle restenosis of blood vessels, inappropriate microvascular proliferation, acromegaly, gigantism, psoriasis, atherosclerosis, smooth muscle restenosis of blood vessels or inappropriate microvascular proliferation, Grave's disease, multiple sclerosis, systemic lupus
  • the method for treating a CCR2 mediated disorder is selected from the group consisting of inflammatory, immune disorders; cardiovascular disorders; proliferative disorders; graft rejections; fibrotic diseases; viral infections; neurological disorders; and metabolic disorders. More preferably, the method for treating a CCR2 mediated disorder is an inflammatory or immune disorders selected from the group consisting of asthma, allergic rhinitis, hypersensitivity lung diseases, and hypersensitivity pneumonitis; anaphylaxis or hypersensitivity responses; drug allergies, insect sting allergies; allergic contact dermatitis; vasculitis, histamine and IgE-mediated allergic reactionsity pneumonitis, interstitial lung diseases (ILD), idiopathic pulmonary fibrosis, ILD associated with rheumatoid arthritis, systemic lupus erythematosus, ankylosing spondylitis, systemic sclerosis, Sjogren's syndrome, polymyositis, dermatomyositis, inflammatory bowel diseases, Cr
  • the method for treating a CCR2 mediated disorder is a cardiovascular disorder selected from the group consisting of atherogenesis; atherosclerosis; coronary artery disease; myocardial infarction; stroke; acute coronary syndrome; thrombosis; peripheral vascular disease of atherosclerotic origin; hypertension; and dyslipidemia.
  • the method for treating a CCR2 mediated disorder is a proliferative disorder selected from the group consisting of a liquid or solid tumor type, myelomas, leukemias, chronic lymphocytic leukemia, lymphomas, B-cell lymphomas, non-Hodgkins lymphoma, lung cancer, breast cancer, prostate cancer, ovary cancer, colon cancer, kidney cancer, liver cancer, carcinomas, squamous cell carcinoma, basal cell carcinoma, sweat gland carcinoma, sebaceous gland carcinoma, adenocarcinoma, papillary carcinoma, papillary adenocarcinoma, cystadenocarcinoma, medullary carcinoma, undifferentiated carcinoma, bronchogenic carcinoma, melanoma, renal cell carcinoma, hepatoma-liver cell carcinoma, bile duct carcinoma, cholangiocarcinoma, papillary carcinoma, transitional cell carcinoma, choriocarcinoma, semonoma, embryonal carcinoma, mammary carcinoma
  • the method for treating a CCR2 mediated disorder is a graft rejection, such as an allograft rejection or graft-versus-host disease, or is a fibrotic diseases such as scleroderma.
  • the method for treating a CCR2 mediated disorder is a neurological disorder selected from the group consisting of AIDS related dementia and pain, and neuropathic pain.
  • the method for treating a CCR2 mediated disorder is a metabolic diseases such as diabetes.
  • the method for treating a CCR2 mediated disorder is another disease selected from the group consisting of reperfusion injury; certain hematologic malignancies; cytokine-induced toxicity, septic shock, endotoxic shock, polymyositis;
  • Figure 1 shows cellular binding EC50 for the anti-CCR2 Dl antibody.
  • the cellular binding EC50 for the anti-CCR2 Dl antibody was determined to be 168 pM as shown in Figure 1.
  • Figure 2 shows cellular binding EC50 for Dl against murine CCR2 -expressing cells.
  • the only anti-CCR2 antibody to bind to murine CCR2 was Dl ; all others antibodies showed no cellular staining.
  • the cellular binding EC5 0 for Dl against murine CCR2 -expressing cells is approximately 17 nM ( Figure 2).
  • FIG 3 shows a calcium assay using THP- 1 cells.
  • A EC50 determination of MCP- 1 : THP- 1 cells (0.3 x 10 s cells in 25 ⁇ of the assay buffer) were incubated with 25 ⁇ of Calcium 4 Assay kit including probenecid in a Poly-D-Lysine 384-well plate for 1 h at 37 °C 5% CO2 followed by 15 minutes at room temperature and centrifugation. A 5X dose response of MCP- 1 was added ( 12.5 ⁇ /well) to achieve the final indicated concentrations.
  • B Mean+S.D.
  • IC 50 determination of D l THP- 1 cells (0.3 x 10 5 cells in 25 ⁇ of the assay buffer) were pre-incubated with serial diluted doses of D l for 20 min at room temperature. 25 ⁇ of the pre-incubated cells were added to 25 ⁇ of Calcium 4 Assay kit including probenecid to achieve the final indicated concentrations of D 1. After 1 h incubation at 37 °C, 5% CO2 in a Poly-D-Lysine 384-well plate followed by 15 minutes at room temperature and centrifugation, 10 nM MCP- 1 (final concentration in the 384-well plate) was added as challenge agonist during detection on the FlexStation3.
  • Figure 4 shows a calcium assay using primary human monocytes.
  • MCP- 1 human primary monocytes (0.3 x 10 5 cells in 25 ⁇ of the assay buffer) were incubated with 25 ⁇ of Calcium 4 Assay kit including probenecid in a Poly-D- Lysine 384-well plate for 1 h at 37 °C 5% CO2 followed by 15 minutes at room temperature and centrifugation. A 5X dose response of MCP-1 was added (12.5 ⁇ /well) to achieve the final indicated concentrations.
  • Figure 4A represents one of two independent experiments which had similar results.
  • B IC 50 determination of Dl : THP-1 cells ( 8,000 cells in 25 ⁇ assay buffer) were pre-incubated with serial diluted doses of Dl for 20 min at room temperature.
  • Figure 5 shows a chemotaxis assay using THP- 1 cells.
  • Figure 5A is an EC5 0 determination of MCP-1 : Serial diluted concentrations of MCP- 1 (indicated in Figure 5 A) in 29 ⁇ of HBSS+0.1 % BSA were loaded in the wells of plate in the lower chambers, whereas THP- 1 cells (0.1 x 10 6 cells in 25 ⁇ of HBSS+0.1 % BSA) were loaded on each site on top of 5 ⁇ pore membrane. After 2 hour incubation at 37 °C, 5% CO2, the un-migrated cells on top of membrane were blotted and the membrane was removed.
  • Figure 5B is an IC50 determination of D l : Serial diluted concentrations of Dl (indicated in Figure 5B) were pre- incubated with THP- 1 cells (0.1 x 10 6 cells in 25 ⁇ ) at room temperature for 20 min. MCP- 1 at 3 nM was loaded in the wells of plate in the lower chambers, whereas the pre-incubated cells with D l were loaded on top of membrane. After 2 h incubation at 37 °C, 5% CO2, migrated cells were collected, counted and calculated as the procedures in A.
  • Figure 6 shows a chemotaxis assay using primary human monocyte cells.
  • Figure 6A is an EC5 0 determination of MCP-1 : Different concentrations of MCP-1 (indicated in the figure) in 29 ⁇ of HBSS+0.1 % BSA were loaded in the wells of plate in the lower chambers, whereas primary human monocyte cells (0.1 x 10 6 cells in 25 ⁇ of HBSS+0.1 % BSA) were loaded on each site on top of 5 ⁇ pore membrane. After lhour and 45 min incubation at 37 °C, 5% CO 2 , the un-migrated cells on top of membrane were blotted and the membrane was removed. The migrated cells in wells of plate were counted by Cedex and an EC50 of MCP-1 was calculated by Prism 5.
  • Figure 6B is an IC5 0 determination of Dl : Different
  • FIG. 7 shows a chemotaxis assay using WEHI 274.1 cells.
  • an EC50 was determined for mMCP- 1. Briefly, different concentrations of mMCP- 1 (0.02 -60 nM) in 29 ⁇ of HBSS+0.1 % BSA were loaded in the wells of plate in the lower chambers, whereas WEHI 274.1 cells (0.1 x 10 6 cells in 25 ⁇ of HBSS+0.1% BSA) were loaded on each site on top of a 8 ⁇ pore membrane. After 2 hour incubation at 37 °C, 5% CO2, the non-migrated cells remaining on the upper side of the membrane were blotted and top of the membrane was washed with PBS.
  • the membrane was detached from plate and the fluorescence of the wells was measured from bottom of the membrane in a fluorescent plate reader (FlexStation3, Molecular Device) with excitation at 485 nm and emission at 530 nm.
  • the EC50 value of MCP- 1 was calculated by Prism 5.
  • Figure 7B an IC50 determination for D l is provided. Different concentrations of Dl (4.0 -534 nM) were pre-incubated with WEHI cells (0.1 x 10 6 cells in 25 ⁇ per site) at room temperature for 20 min. mMCP- 1 at 2.5 nM was loaded in the wells of plate in the lower chambers, whereas the pre-incubated cells with Dl were loaded on top of membrane. After 2 h incubation at 37 °C, 5% C0 2 , migrated cells were collected, counted and calculated as the procedures in A.
  • Figure 8 shows A comparison of antibodies Dl and MLN1202 for chemotaxis.
  • Figure 8A is an IC50 determination of D l versus MLN1202 on MCP- 1 induced THP- 1 cell migration.
  • Figure 8B is an IC50 determination of Dl versus MLN1202 on MCP-2 induced THP-1 cell migration.
  • Figure 8C is an IC50 determination of Dl versus MLN1202 on MCP- 3 induced THP-1 cell migration.
  • Figure 8D is an IC50 determination of Dl versus MLN 1202 on MCP-4 induced THP- 1 cell migration.
  • Figure 8E is an IC50 determination of Dl versus MLN1202 on mouse MCP-5 induced THP- 1 cell migration.
  • Figure 9 shows the beneficial effect of anti-CCR2 antibody D l in vivo in a murine EAE model for multiple sclerosis.
  • Figures 10-15 show various IC50 results for antibodies 1G 11 , 1B2, and 1H5.
  • IC 50 of 1G 11 against MCP-1 (3 nM) was 79 pM ( Figure lOA ) and against MCP-5 (6 ng/ml) was 261 pM ( Figure 10B).
  • IC50 of 1B2 against MCP- 1 (3 nM) was 87 pM ( Figure 1 1 A) and against MCP-5 (3 nM) was 197 pM ( Figure 1 IB).
  • These IC 50 values demonstrate that 1G 1 1 and 1B 1 1 are more potent than Dl in MCP- 1 and MCP-5 induced THP- 1 migration.
  • 1G 1 1 and 1 B2 do not have inhibition activities on MCP-2, 3 and 4 induced THP- 1 migration (data not shown).
  • IC50 of 1H5 against MCP- 1 (3 nM) was 109 pM ( Figure 12A) and against MCP-5 (6 ng/ml) was 349 pM ( Figure 12B). These IC 50 values are comparable to D l . 1H5 also demonstrated 1.9 nM IC 50 value against 30 ng/ml of MCP-2 ( Figure 2C), 2.6 nM IC 50 value against 6 ng/ml of MCP-3 ( Figure 12D) and 1.4 nM IC 50 against 200 ng/ml of MCP-4 ( Figure 12E).
  • Figure 13 shows the off -rate of various CCR2 IgG l clones on CHO-huCCR2 cells.
  • the present disclosure provides a fully human antibody of an IgG class that binds to a
  • CCR2 epitope with a binding affinity of lO ⁇ M or less that has a heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 1, SEQ ID NO. 3, SEQ ID NO. 4, SEQ ID NO. 5, SEQ ID NO. 6, SEQ ID NO. 7, SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 1 1 , SEQ ID NO. 12, SEQ ID NO. 13, SEQ ID NO. 14, SEQ ID NO. 15, SEQ ID NO. 17, SEQ ED NO. 19, SEQ ID NO. 21 , SEQ ED NO. 23, SEQ ID NO. 25, SEQ ED NO. 27, SEQ ED NO. 29, SEQ ID NO.
  • SEQ ED NO. 33 SEQ ED NO. 35, SEQ ED NO. 37, SEQ ED NO. 39, SEQ ED NO. 41 , SEQ ED NO. 43, and combinations thereof, and that has a light chain variable domain sequence that is at least 95% identical to the amino acid sequence consisting of SEQ ID NO. 2, SEQ ID NO. 16, SEQ ID NO. 18, SEQ ID NO. 20, SEQ ID NO. 22, SEQ ID NO. 24, SEQ ED NO. 26, SEQ ED NO. 28, SEQ ED NO. 30, SEQ ID NO. 32, SEQ ID NO. 34, SEQ ED NO. 36, SEQ ID NO. 38, SEQ ED NO. 40, SEQ ED NO. 42, SEQ ID NO.
  • the fully human antibody has both a heavy chain and a light chain wherein the antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ID NO. 2 (called D l herein), SEQ ID NO. 3/SEQ ED NO. 2 (called 1 A2 herein), SEQ ID NO. 4/SEQ ID NO. 2 (called 1B 1 1 herein), SEQ ED NO. 5/SEQ ID NO. 2 (called 1G 1 1 herein), SEQ ID NO. 6/SEQ ID NO. 2 (called 1H5 herein), SEQ ID NO. 7/SEQ ID NO. 2 (called 1B2 herein), SEQ ID NO. 8/SEQ ED NO.
  • D l -1 herein
  • SEQ ID NO. 9/SEQ ID NO. 2 called Dl -2 herein
  • SEQ ID NO. 10/SEQ ED NO. 2 called Dl -3 herein
  • SEQ ID NO. 1 1/SEQ ID NO. 2 called Dl -4 herein
  • SEQ ID NO. 12/SEQ ID NO. 2 called D l-5 herein
  • SEQ ED NO. 13/SEQ ID NO. 2 called Dl-6 herein
  • the present disclosure provides a Fab fully human antibody fragment, having a variable domain region from a heavy chain and a variable domain region from a light chain, wherein the heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ED NO. 1, SEQ ED NO. 3, SEQ ED NO. 4, SEQ ID NO. 5, SEQ ED NO. 6, SEQ ID NO. 7, SEQ ED NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ED NO. 12, SEQ ED NO. 13, SEQ ID NO. 14, SEQ ED NO. 15, SEQ ED NO. 17, SEQ ED NO. 19, SEQ ED NO. 21, SEQ ED NO. 23, SEQ ID NO.
  • SEQ ID NO. 27 SEQ ID NO. 29, SEQ ID NO. 31, SEQ ED NO. 33, SEQ ED NO. 35, SEQ ID NO. 37, SEQ ED NO. 39, SEQ ED NO. 41 , SEQ ID NO. 43, and combinations thereof, and that has a light chain variable domain sequence that is at least 95% identical to the amino acid sequence consisting of SEQ ED NO. 2, SEQ ID NO. 16, SEQ ED NO. 18, SEQ ED NO. 20, SEQ ID NO. 22, SEQ ED NO. 24, SEQ ID NO. 26, SEQ ED NO. 28, SEQ ED NO. 30, SEQ ID NO. 32, SEQ ED NO. 34, SEQ ED NO. 36, SEQ ED NO. 38, SEQ ED NO.
  • the fully human antibody Fab fragment has both a heavy chain variable domain region and a light chain variable domain region wherein the antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ED NO. 2, SEQ ED NO. 3/SEQ ID NO. 2, SEQ ED NO.
  • SEQ ED NO. 2 SEQ ED NO. 5/SEQ ED NO. 2, SEQ ID NO. 6/SEQ ID NO. 2, SEQ ED NO. 7/SEQ ED NO. 2, SEQ ID NO. 8/SEQ ED NO. 2, SEQ ED NO. 9/SEQ ID NO. 2, SEQ ID NO. 10/SEQ ID NO. 2, SEQ ID NO. 1 1/SEQ ID NO. 2, SEQ ID NO. 12/SEQ ED NO. 2, SEQ ED NO. 13/SEQ ED NO. 2, SEQ ID NO. 14/SEQ ED NO. 2, SEQ ED NO. 15/SEQ ED NO. 2, SEQ ED NO. 8/SEQ ED NO. 16, SEQ ED NO.
  • SEQ ID NO. 14/SEQ ED NO. 32 SEQ ID NO. 14/SEQ ED NO. 32, SEQ ED NO. 15/SEQ ED NO. 32, SEQ ED NO. 17/SEQ ID NO. 18, SEQ ID NO. 19/SEQ ED NO. 20, SEQ ED NO. 21/SEQ ED NO. 22, SEQ ED NO. 23/SEQ ED NO. 24, SEQ ED NO. 25/SEQ ID NO. 26, SEQ ED NO. 27/SEQ ED NO. 28, SEQ ID NO. 29/SEQ ED NO. 30, SEQ ED NO. 31/SEQ ED NO. 32, SEQ ED NO. 33/SEQ ED NO. 34, SEQ ED NO. 35/SEQ ED NO. 36, SEQ ED NO. 37/SEQ ED NO. 38, SEQ ED NO. 39/SEQ ID NO. 40, SEQ ID NO. 41/SEQ ID NO. 42, SEQ ID NO. 43/SEQ ID NO. 44, and
  • the present disclosure provides a single chain human antibody, having a variable domain region from a heavy chain and a variable domain region from a light chain and a peptide linker connection the heavy chain and light chain variable domain regions, wherein the heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 1, SEQ ⁇ ) NO. 3, SEQ ID NO. 4, SEQ ID NO. 5, SEQ ID NO. 6, SEQ ID NO. 7, SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 1 1 , SEQ ID NO. 12, SEQ ID NO. 13, SEQ ID NO. 14, SEQ ID NO. 15, SEQ ID NO. 17, SEQ ID NO. 19, SEQ ID NO.
  • SEQ ID NO. 21 SEQ ID NO. 23, SEQ ID NO. 25, SEQ ID NO. 27, SEQ ID NO. 29, SEQ ID NO. 31 , SEQ ID NO. 33, SEQ ED NO. 35, SEQ ID NO. 37, SEQ ID NO. 39, SEQ ID NO. 41 , SEQ ID NO. 43, and combinations thereof, and that has a light chain variable domain sequence that is at least 95% identical to the amino acid sequence consisting of SEQ ID NO. 2, SEQ ID NO. 16, SEQ ID NO. 18, SEQ ED NO. 20, SEQ ID NO. 22, SEQ ID NO. 24, SEQ ID NO. 26, SEQ ID NO. 28, SEQ ID NO. 30, SEQ ID NO. 32, SEQ ID NO. 34, SEQ ID NO. 36, SEQ ID NO.
  • the fully human single chain antibody has both a heavy chain variable domain region and a light chain variable domain region, wherein the single chain fully human antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ID NO. 2, SEQ ID NO. 3/SEQ ID NO. 2, SEQ ID NO. 4/SEQ ID NO. 2, SEQ ID NO. 5/SEQ ID NO. 2, SEQ ID NO. 6/SEQ ID NO. 2, SEQ ID NO. 7/SEQ ID NO. 2, SEQ ID NO. 8/SEQ ID NO. 2, SEQ ID NO. 9/SEQ ID NO. 2, SEQ ID NO.
  • SEQ ID NO. 9/SEQ ID NO. 32 SEQ ID NO. 10/SEQ ID NO. 32, SEQ ID NO. 1 1/SEQ ID NO. 32, SEQ ID NO. 12/SEQ ID NO. 32, SEQ ID NO. 13/SEQ ID NO. 32, SEQ ID NO. 14/SEQ ID NO. 32, SEQ ID NO. 15/SEQ ID NO. 32, SEQ ID NO. 17/SEQ ID NO. 18, SEQ ID NO. 19/SEQ ID NO. 20, SEQ ID NO. 21/SEQ ID NO. 22, SEQ ID NO. 23/SEQ ID NO. 24, SEQ ID NO. 25/SEQ ID NO. 26, SEQ ID NO. 27/SEQ ID NO. 28, SEQ ID NO. 29/SEQ ID NO.
  • the present disclosure further provides a method for treating a broad spectrum of mammalian cancers or inflammatory diseases or autoimmune diseases, comprising administering an effective amount of an anti- CCR2 polypeptide, wherein the and- CCR2 polypeptide is selected from the group consisting of a fully human antibody of an IgG class that binds to a CCR2 epitope with a binding affinity of at least 10 "6 M, a Fab fully human antibody fragment, having a variable domain region from a heavy chain and a variable domain region from a light chain, a single chain human antibody, having a variable domain region from a heavy chain and a variable domain region from a light chain and a peptide linker connection the heavy chain and light chain variable domain regions, and combinations thereof; wherein the fully human antibody has a heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of and combinations thereof, and that has a light chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consist
  • the Fab fully human antibody fragment has the heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 1, SEQ ID NO. 3, SEQ ID NO. 4, SEQ ID NO. 5, SEQ ID NO. 6, SEQ ID NO. 7, SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 1 1, SEQ ID NO. 12, SEQ ID NO. 13, SEQ ID NO. 14, SEQ ID NO. 15, SEQ ID NO. 17, SEQ ID NO. 19, SEQ ID NO. 21, SEQ ID NO. 23, SEQ ID NO. 25, SEQ ID NO. 27, SEQ ID NO. 29, SEQ ID NO. 31 , SEQ ID NO. 33, SEQ ID NO. 35, SEQ ID NO.
  • SEQ ID NO. 39 SEQ ID NO. 39, SEQ ED NO. 41, SEQ ID NO. 43, and combinations thereof, and that has the light chain variable domain sequence that is at least 95% identical to the amino acid sequence consisting of SEQ ID NO. 2, SEQ ID NO. 16, SEQ ID NO. 18, SEQ ID NO. 20, SEQ ED NO. 22, SEQ ID NO. 24, SEQ ID NO. 26, SEQ ID NO. 28, SEQ ID NO. 30, SEQ ID NO. 32, SEQ ID NO. 34, SEQ ID NO. 36, SEQ ID NO. 38, SEQ ID NO. 40, SEQ ID NO. 42, SEQ ID NO.
  • the single chain human antibody has the heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ED NO. 1, SEQ ID NO. 3, SEQ ID NO. 4, SEQ ID NO. 5, SEQ ED NO. 6, SEQ ID NO. 7, SEQ ED NO. 8, SEQ ID NO. 9, SEQ ED NO. 10, SEQ ED NO. 11, SEQ ID NO. 12, SEQ ID NO. 13, SEQ ID NO. 14, SEQ ED NO. 15, SEQ ID NO. 17, SEQ ED NO. 19, SEQ ED NO. 21, SEQ ED NO. 23, SEQ ED NO. 25, SEQ ID NO. 27, SEQ ED NO. 29, SEQ ID NO. 31, SEQ ID NO.
  • SEQ ID NO. 35 SEQ ID NO. 37, SEQ ID NO. 39, SEQ ID NO. 41, SEQ ID NO. 43, and combinations thereof, and that has the light chain variable domain sequence that is at least 95% identical to the amino acid sequence consisting of SEQ ID NO. 2, SEQ ID NO. 16, SEQ ID NO. 18, SEQ ED NO. 20, SEQ ID NO. 22, SEQ ID NO. 24, SEQ ID NO. 26, SEQ ID NO. 28, SEQ ID NO. 30, SEQ ID NO. 32, SEQ ID NO. 34, SEQ ID NO. 36, SEQ ID NO. 38, SEQ ID NO. 40, SEQ ID NO. 42, SEQ ID NO. 44, and combinations thereof.
  • the fully human antibody has both a heavy chain and a light chain wherein the antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ID NO. 2, SEQ ID NO. 3/SEQ ID NO. 2, SEQ ID NO. 4/SEQ ID NO. 2, SEQ ID NO. 5/SEQ ID NO. 2, SEQ ID NO. 6/SEQ ID NO. 2, SEQ ED NO. 7/SEQ ED NO. 2, SEQ ED NO. 8/SEQ ED NO. 2, SEQ ID NO. 9/SEQ ID NO. 2, SEQ ID NO. 10/SEQ ED NO. 2, SEQ ED NO. 11/SEQ ED NO. 2, SEQ ED NO. 12/SEQ ED NO.
  • SEQ ED NO. 13/SEQ ED NO. 2 SEQ ED NO. 13/SEQ ED NO. 2
  • SEQ ED NO. 14/SEQ ED NO. 2 SEQ ED NO. 15/SEQ ED NO. 2
  • SEQ ED NO. 8/SEQ ED NO. 16 SEQ ED NO. 9/SEQ ED NO. 16, SEQ ID NO. 10/SEQ ED NO. 16, SEQ ED NO. 1 1/SEQ ED NO. 16, SEQ ED NO. 12/SEQ ED NO. 16, SEQ ID NO. 13/SEQ ID NO. 16, SEQ ED NO. 14/SEQ ED NO. 16, SEQ ED NO. 15/SEQ ED NO. 16, SEQ ED NO. 8/SEQ ED NO. 32, SEQ ED NO.
  • the fully human antibody Fab fragment has both a heavy chain variable domain region and a light chain variable domain region wherein the antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ED NO. 1/SEQ ED NO. 2, SEQ ED NO. 3/SEQ ED NO. 2, SEQ ED NO. 4/SEQ ED NO. 2, SEQ ED NO. 5/SEQ ED NO. 2, SEQ ED NO. 6/SEQ ED NO. 2, SEQ ED NO. 7/SEQ ED NO. 2, SEQ ID NO. 8/SEQ ID NO. 2, SEQ ED NO. 9/SEQ ED NO. 2, SEQ ED NO. 10/SEQ ED NO. 2, SEQ ED NO.
  • SEQ ID NO. 19/SEQ ID NO. 20 SEQ ID NO. 21/SEQ ID NO. 22, SEQ ID NO. 23/SEQ ID NO. 24, SEQ ID NO. 25/SEQ ID NO. 26, SEQ ID NO. 27/SEQ ID NO. 28, SEQ ID NO. 29/SEQ ID NO. 30, SEQ ID NO. 31/SEQ ID NO. 32, SEQ ID NO. 33/SEQ ID NO. 34, SEQ ID NO. 35/SEQ ID NO. 36, SEQ ID NO. 37/SEQ ID NO. 38, SEQ ID NO. 39/SEQ ID NO. 40, SEQ ID NO. 41/SEQ ID NO. 42, SEQ ID NO. 43/SEQ ID NO. 44, and combinations thereof.
  • the fully human single chain antibody has both a heavy chain variable domain region and a light chain variable domain region, wherein the single chain fully human antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ID NO. 2, SEQ ID NO. 3/SEQ ID NO. 2, SEQ ID NO. 4/SEQ ID NO. 2, SEQ ID NO. 5/SEQ ID NO. 2, SEQ ID NO. 6/SEQ ID NO. 2, SEQ ID NO. 7/SEQ ID NO. 2, SEQ ID NO. 8/SEQ ID NO. 2, SEQ ID NO. 9/SEQ ID NO. 2, SEQ ID NO. 10/SEQ ID NO. 2, SEQ ID NO. 11/SEQ ID NO. 2, SEQ ID NO.
  • the broad spectrum of mammalian cancers to be treated is selected from the group consisting of ovarian, colon, breast, lung cancers, myelomas, neuroblastic-derived CNS tumors, monocytic leukemias, B-cell derived leukemias, T-cell derived leukemias, B-cell derived lymphomas, T-cell derived lymphomas, mast cell derived tumors, and combinations thereof.
  • the autoimmune disease or inflammatory disease is selected from the group consisting of intestinal mucosal inflammation, wasting disease associated with colitis, multiple sclerosis, systemic lupus erythematosus, viral infections, rheumatoid arthritis, osteoarthritis, psoriasis, Cohn's disease, and inflammatory bowel disease.
  • an "antigen binding protein” is a protein comprising a portion that binds to an antigen and, optionally, a scaffold or framework portion that allows the antigen binding portion to adopt a conformation that promotes binding of the antigen binding protein to the antigen.
  • antigen binding proteins include antibodies, antibody fragments (e.g., an antigen binding portion of an antibody), antibody derivatives, and antibody analogs.
  • the antigen binding protein can comprise, for example, an alternative protein scaffold or artificial scaffold with grafted CDRs or CDR derivatives.
  • Such scaffolds include, but are not limited to, antibody-derived scaffolds comprising mutations introduced to, for example, stabilize the three-dimensional structure of the antigen binding protein as well as wholly synthetic scaffolds comprising, for example, a biocompatible polymer.
  • PAMs peptide antibody mimetics
  • An antigen binding protein can have, for example, the structure of a naturally occurring immunoglobulin.
  • An "immunoglobulin” is a tetrameric molecule. In a naturally occurring immunoglobulin, each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light” (about 25 kDa) and one "heavy" chain (about 50-70 kDa).
  • the amino- terminal portion of each chain includes a variable region of about 100 to 1 10 or more amino acids primarily responsible for antigen recognition.
  • the carboxy-terminal portion of each chain defines a constant region primarily responsible for effector function. Human light chains are classified as kappa or lambda light chains.
  • Heavy chains are classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively.
  • the variable and constant regions are joined by a "J" region of about 12 or more amino acids, with the heavy chain also including a "D” region of about 10 more amino acids. See generally, Fundamental Immunology Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989)) (incorporated by reference in its entirety for all purposes).
  • the variable regions of each light/heavy chain pair form the antibody binding site such that an intact immunoglobulin has two binding sites.
  • variable regions of naturally occurring immunoglobulin chains exhibit the same general structure of relatively conserved framework regions (FR) joined by three hypervariable regions, also called complementarity determining regions or CDRs. From N-terminus to C- terminus, both light and heavy chains comprise the domains FR1 , CDR1, FR2, CDR2, FR3, CDR3 and FR4.
  • the assignment of amino acids to each domain is in accordance with the definitions of Kabat et al. in Sequences of Proteins of Immunological Interest, 5 lh Ed., US Dept. of Health and Human Services, PHS, NIH, NIH Publication no. 91-3242, 1991.
  • Other numbering systems for the amino acids in immunoglobulin chains include IMGT.RTM.
  • Antibodies can be obtained from sources such as serum or plasma that contain immunoglobulins having varied antigenic specificity. If such antibodies are subjected to affinity purification, they can be enriched for a particular antigenic specificity. Such enriched preparations of antibodies usually are made of less than about 10% antibody having specific binding activity for the particular antigen. Subjecting these preparations to several rounds of affinity purification can increase the proportion of antibody having specific binding activity for the antigen. Antibodies prepared in this manner are often referred to as "monospecific.” Monospecfic antibody preparations can be made up of about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99%, or 99.9% antibody having specific binding activity for the particular antigen.
  • an “antibody” refers to an intact immunoglobulin or to an antigen binding portion thereof that competes with the intact antibody for specific binding, unless otherwise specified.
  • Antigen binding portions may be produced by recombinant DNA techniques or by enzymatic or chemical cleavage of intact antibodies.
  • Antigen binding portions include, inter alia, Fab, Fab', F(ab')2, Fv, domain antibodies (dAbs), and complementarity determining region (CDR) fragments, single-chain antibodies (scFv), chimeric antibodies, diabodies, triabodies, tetrabodies, and polypeptides that contain at least a portion of an immunoglobulin that is sufficient to confer specific antigen binding to the polypeptide.
  • a Fab fragment is a monovalent fragment having the VL, VH, CL and CHI domains; a F(ab') 2 fragment is a bivalent fragment having two Fab fragments linked by a disulfide bridge at the hinge region; a Fd fragment has the V H and CHI domains; an Fv fragment has the VL and VH domains of a single arm of an antibody; and a dAb fragment has a VH domain, a VL domain, or an antigen-binding fragment of a V H or VL domain (U.S. Patents 6,846,634;
  • a single-chain antibody is an antibody in which a V L and a V H region are joined via a linker ⁇ e.g., a synthetic sequence of amino acid residues) to form a continuous protein chain wherein the linker is long enough to allow the protein chain to fold back on itself and form a monovalent antigen binding site (see, e.g., Bird et al., 1988, Science 242:423-26 and Huston et al., 1988, Proc. Natl. Acad. Sci. USA 85:5879-83).
  • a linker ⁇ e.g., a synthetic sequence of amino acid residues
  • Diabodies are bivalent antibodies comprising two polypeptide chains, wherein each polypeptide chain comprises VH and V L domains joined by a linker that is too short to allow for pairing between two domains on the same chain, thus allowing each domain to pair with a complementary domain on another polypeptide chain (see, e.g., Holliger et al., 1993, Proc. Natl. Acad. Sci. USA 90:6444-48, and Poljak et al., 1994, Structure 2: 1 121-23). If the two polypeptide chains of a diabody are identical, then a diabody resulting from their pairing will have two identical antigen binding sites.
  • Polypeptide chains having different sequences can be used to make a diabody with two different antigen binding sites.
  • tribodies and tetrabodies are antibodies comprising three and four polypeptide chains, respectively, and forming three and four antigen binding sites, respectively, which can be the same or different.
  • Complementarity determining regions (CDRs) and framework regions (FR) of a given antibody may be identified using the system described by Kabat et al. supra; Lefranc et al., supra and/or Honegger and Pluckthun, supra.
  • One or more CDRs may be incorporated into a molecule either covalently or noncovalently to make it an antigen binding protein.
  • An antigen binding protein may incorporate the CDR(s) as part of a larger polypeptide chain, may covalently link the CDR(s) to another polypeptide chain, or may incorporate the CDR(s) noncovalently.
  • the CDRs permit the antigen binding protein to specifically bind to a particular antigen of interest.
  • An antigen binding protein may have one or more binding sites. If there is more than one binding site, the binding sites may be identical to one another or may be different. For example, a naturally occurring human immunoglobulin typically has two identical binding sites, while a "bispecific" or "bifunctional” antibody has two different binding sites.
  • human antibody includes all antibodies that have one or more variable and constant regions derived from human immunoglobulin sequences. In one embodiment, all of the variable and constant domains are derived from human immunoglobulin sequences (a fully human antibody). These antibodies may be prepared in a variety of ways, examples of which are described below, including through the immunization with an antigen of interest of a mouse that is genetically modified to express antibodies derived from human heavy and/or light chain-encoding genes.
  • a humanized antibody has a sequence that differs from the sequence of an antibody derived from a non-human species by one or more amino acid substitutions, deletions, and/or additions, such that the humanized antibody is less likely to induce an immune response, and/or induces a less severe immune response, as compared to the non-human species antibody, when it is administered to a human subject.
  • certain amino acids in the framework and constant domains of the heavy and/or light chains of the non-human species antibody are mutated to produce the humanized antibody.
  • the constant domain(s) from a human antibody are fused to the variable domain(s) of a non-human species.
  • one or more amino acid residues in one or more CDR sequences of a non-human antibody are changed to reduce the likely immunogenicity of the non-human antibody when it is administered to a human subject, wherein the changed amino acid residues either are not critical for immunospecific binding of the antibody to its antigen, or the changes to the amino acid sequence that are made are conservative changes, such that the binding of the humanized antibody to the antigen is not significantly worse than the binding of the non-human antibody to the antigen. Examples of how to make humanized antibodies may be found in U.S. Patents 6,054,297, 5,886, 152 and 5,877,293.
  • chimeric antibody refers to an antibody that contains one or more regions from one antibody and one or more regions from one or more other antibodies.
  • one or more of the CDRs are derived from a human anti-CCR2 antibody.
  • all of the CDRs are derived from a human anti-CCR2 antibody.
  • the CDRs from more than one human anti-CCR2 antibodies are mixed and matched in a chimeric antibody.
  • a chimeric antibody may comprise a CDR1 from the light chain of a first human anti-PAR-2 antibody, a CDR2 and a CDR3 from the light chain of a second human anti-CCR2 antibody, and the CDRs from the heavy chain from a third anti-CCR2 antibody.
  • Other combinations are possible.
  • the framework regions may be derived from one of the same anti-CCR2 antibodies, from one or more different antibodies, such as a human antibody, or from a humanized antibody.
  • a portion of the heavy and/or light chain is identical with, homologous to, or derived from an antibody from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is/are identical with, homologous to, or derived from an antibody (-ies) from another species or belonging to another antibody class or subclass.
  • fragments of such antibodies that exhibit the desired biological activity (i.e., the ability to specifically bind CCR2).
  • a “neutralizing antibody” or an “inhibitory antibody” is an antibody that inhibits the proteolytic activation of CCR2 when an excess of the anti-CCR2 antibody reduces the amount of activation by at least about 20% using an assay such as those described herein in the
  • the antigen binding protein reduces the amount of amount of proteolytic activation of CCR2 by at least 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%,
  • Structural and functional domains can be identified by comparison of the nucleotide and/or amino acid sequence data to public or proprietary sequence databases. Computerized comparison methods can be used to identify sequence motifs or predicted protein conformation domains that occur in other proteins of known structure and/or function.
  • a “CDR grafted antibody” is an antibody comprising one or more CDRs derived from an antibody of a particular species or isotype and the framework of another antibody of the same or different species or isotype.
  • a “multi-specific antibody” is an antibody that recognizes more than one epitope on one or more antigens.
  • a subclass of this type of antibody is a "bi-specific antibody” which recognizes two distinct epitopes on the same or different antigens.
  • An antigen binding protein "specifically binds" to an antigen (e.g., human CCR2) if it binds to the antigen with a dissociation constant of 1 nanomolar or less.
  • an “antigen binding domain,” “antigen binding region,” or “antigen binding site” is a portion of an antigen binding protein that contains amino acid residues (or other moieties) that interact with an antigen and contribute to the antigen binding protein's specificity and affinity for the antigen. For an antibody that specifically binds to its antigen, this will include at least part of at least one of its CDR domains.
  • epitope is the portion of a molecule that is bound by an antigen binding protein
  • An epitope can comprise non-contiguous portions of the molecule (e.g., in a polypeptide, amino acid residues that are not contiguous in the polypeptide's primary sequence but that, in the context of the polypeptide's tertiary and quaternary structure, are near enough to each other to be bound by an antigen binding protein).
  • the "percent identity" of two polynucleotide or two polypeptide sequences is determined by comparing the sequences using the GAP computer program (a part of the GCG
  • nucleic acid molecules e.g., cDNA or genomic DNA
  • RNA molecules e.g., mRNA
  • nucleotide analogs e.g., peptide nucleic acids and non-naturally occurring nucleotide analogs
  • hybrids thereof e.g., peptide nucleic acids and non-naturally occurring nucleotide analogs
  • the nucleic acid molecule can be single-stranded or double-stranded.
  • the nucleic acid molecules of the invention comprise a contiguous open reading frame encoding an antibody, or a fragment, derivative, mutein, or variant thereof.
  • Two single-stranded polynucleotides are "the complement" of each other if their sequences can be aligned in an anti-parallel orientation such that every nucleotide in one polynucleotide is opposite its complementary nucleotide in the other polynucleotide, without the introduction of gaps, and without unpaired nucleotides at the 5' or the 3' end of either sequence.
  • a polynucleotide is "complementary" to another polynucleotide if the two polynucleotides can hybridize to one another under moderately stringent conditions.
  • a polynucleotide can be complementary to another polynucleotide without being its complement.
  • a “vector” is a nucleic acid that can be used to introduce another nucleic acid linked to it into a cell.
  • a vector is a "plasmid,” which refers to a linear or circular double stranded DNA molecule into which additional nucleic acid segments can be ligated.
  • a viral vector e.g., replication defective retroviruses, adenoviruses and adeno- associated viruses
  • certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors comprising a bacterial origin of replication and episomal mammalian vectors).
  • vectors e.g., non-episomal mammalian vectors
  • An "expression vector” is a type of vector that can direct the expression of a chosen polynucleotide.
  • a nucleotide sequence is "operably linked" to a regulatory sequence if the regulatory sequence affects the expression (e.g., the level, timing, or location of expression) of the nucleotide sequence.
  • a "regulatory sequence” is a nucleic acid that affects the expression (e.g., the level, timing, or location of expression) of a nucleic acid to which it is operably linked.
  • the regulatory sequence can, for example, exert its effects directly on the regulated nucleic acid, or through the action of one or more other molecules (e.g., polypeptides that bind to the regulatory sequence and/or the nucleic acid).
  • Examples of regulatory sequences include promoters, enhancers and other expression control elements (e.g., polyadenylation signals).
  • a "host cell” is a cell that can be used to express a nucleic acid, e.g., a nucleic acid of the invention.
  • a host cell can be a prokaryote, for example, E. coli, or it can be a eukaryote, for example, a single-celled eukaryote (e.g., a yeast or other fungus), a plant cell (e.g., a tobacco or tomato plant cell), an animal cell (e.g., a human cell, a monkey cell, a hamster cell, a rat cell, a mouse cell, or an insect cell) or a hybridoma.
  • host cells examples include the COS-7 line of monkey kidney cells (ATCC CRL 1651) (see Gluzman et al., 1981, Cell 23: 175), L cells, C127 cells, 3T3 cells (ATCC CCL 163), Chinese hamster ovary (CHO) cells or their derivatives such as Veggie CHO and related cell lines which grow in serum-free media (see Rasmussen et al., 1998, Cytotechnology 28:31) or CHO strain DX-B 1 1, which is deficient in DHFR (see Urlaub et al., 1980, Proc. Natl. Acad. Sci.
  • COS-7 line of monkey kidney cells ATCC CRL 1651
  • L cells C127 cells
  • 3T3 cells ATCC CCL 163
  • CHO Chinese hamster ovary
  • HeLa cells HeLa cells
  • BHK ATCC CRL 10
  • CV1/EBNA cell line derived from the African green monkey kidney cell line CV 1 (ATCC CCL 70) (see McMahan et al., 1991, EMBO J. 10:2821)
  • human embryonic kidney cells such as 293,293 EBNA or MSR 293, human epidermal A431 cells, human
  • Colo205 cells other transformed primate cell lines, normal diploid cells, cell strains derived from in vitro culture of primary tissue, primary explants, HL-60, U937, HaK or Jurkat cells.
  • a host cell is a cultured cell that can be transformed or transfected with a polypeptide-encoding nucleic acid, which can then be expressed in the host cell.
  • the phrase "recombinant host cell” can be used to denote a host cell that has been transformed or transfected with a nucleic acid to be expressed.
  • a host cell also can be a cell that comprises the nucleic acid but does not express it at a desired level unless a regulatory sequence is introduced into the host cell such that it becomes operably linked with the nucleic acid.
  • host cell refers not only to the particular subject cell but also to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to, e.g., mutation or environmental influence, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term as used herein.
  • the mammalian cancer to be treated is selected from the group consisting of the osteosarcoma, rhabdomyosarcoma, neuroblastoma, any pediatric cancer, kidney cancer, leukemia, renal transitional cell cancer, Werner-Morrison syndrome, acromegaly, bladder cancer, Wilm's cancer, ovarian cancer, pancreatic cancer, benign prostatic hyperplasia, breast cancer, prostate cancer, bone cancer, lung cancer, gastric cancer, colorectal cancer, cervical cancer, synovial sarcoma, diarrhea associated with metastatic carcinoid, vasoactive intestinal peptide secreting tumors, gigantism, psoriasis, atherosclerosis, smooth muscle restenosis of blood vessels and inappropriate microvascular proliferation, head and neck cancer, squamous cell carcinoma, multiple myeloma, solitary plasmacytoma, renal cell cancer, retinoblastoma, germ cell tumors, hepatoblastoma, hepatocellular carcinoma
  • CCR2 mediated disorder refers to a disorder involving the movement, e.g., recruitment from one site to another site, infiltration from one site to another site, proliferation, differentiation, and/or function of cells expressing CCR2.
  • Cells expressing CCR2 include, for example, monocytes, dendritic cells, macrophages, T-cells, lymphocytes, basophils, mast cells, endothelial cells and fibroblasts.
  • CCR2 mediated disorders include, but are not limited to, i) inflammatory or immune disorders; ii) cardiovascular disorders; iii) proliferative disorders; iv) graft rejections; v) fibrotic diseases; vi) viral infections; vii) neurological disorders; and viii) metabolic disorders.
  • Inflammatory disorders and conditions can be chronic or acute.
  • inflammatory or immune disorders include, but are not limited to, respiratory diseases such as asthma, rhinitis, hypersensitivity lung diseases, hypersensitivity pneumonitis, interstitial lung diseases (ELD) (e.g., idiopathic pulmonary fibrosis, or ILD associated with rheumatoid arthritis, systemic lupus erythematosus, ankylosing spondylitis, systemic sclerosis, Sjogren's syndrome, polymyositis or dermatomyositis); inflammatory bowel diseases, such as Crohn's disease and ulcerative colitis; spondyloarthropathies; scleroderma; psoriasis and inflammatory dermatoses such as dermatitis, eczema, atopic dermatitis, urticaria; vasculitis (e.g., necrotizing, cutaneous, and hypersensitivity vasculitis); and inflammatory glomer
  • inflammatory or immune disorders include autoimmune disorders, such as arthritis (e.g., rheumatoid arthritis, psoriatic arthritis); multiple sclerosis; systemic lupus erythematosus; myasthenia gravis; juvenile onset diabetes; nephritides such as glomerulonephritis; autoimmune thyroiditis; acquired immune deficiency syndrome (AIDS) and Behcet's disease.
  • arthritis e.g., rheumatoid arthritis, psoriatic arthritis
  • multiple sclerosis systemic lupus erythematosus
  • myasthenia gravis juvenile onset diabetes
  • nephritides such as glomerulonephritis
  • autoimmune thyroiditis e.g., AIDS
  • Behcet's disease e.g., Behcet's disease.
  • inflammatory or immune disorders include allergic diseases and conditions, such as respiratory allergic diseases such as asthma, allergic rhinitis,
  • hypersensitivity lung diseases and hypersensitivity pneumonitis; anaphylaxis or
  • hypersensitivity responses include drug allergies (e.g., to penicillin, cephalosporins); insect sting allergies; allergic contact dermatitis; vasculitis (e.g., hypersensitivity vasculitis); and histamine and IgE-mediated allergic reactions.
  • Cardiovascular disorders include, but are not limited to atherogenesis; atherosclerosis; coronary artery disease; myocardial infarction; stroke; acute coronary syndrome; thrombosis; peripheral vascular disease of atherosclerotic origin; hypertension; and dyslipidemia.
  • Proliferative disorders include, but are not limited to cancers or tumors.
  • Cancer or “tumor” is intended to include any neoplastic growth in a patient, including an inititial tumor and any metastases.
  • the cancer can be a cancer with leukocyte infiltration of the skin or organs.
  • the cancer can be of the liquid or solid tumor type.
  • Liquid tumors include tumors of hematological origin, including, e.g., myelomas (multiple myeloma), leukemias (e.g.,
  • Solid tumors can originate in organs, and include cancers such as lung, breast, prostate, ovary, colon, kidney, and liver.
  • cancer cells including tumor cells, refer to cells that divide at an abnormal (increased) rate.
  • Cancer cells include, but are not limited to, carcinomas, such as squamous cell carcinoma, basal cell carcinoma, sweat gland carcinoma, sebaceous gland carcinoma, adenocarcinoma, papillary carcinoma, papillary adenocarcinoma, cystadenocarcinoma, medullary carcinoma, undifferentiated carcinoma, bronchogenic carcinoma, melanoma, renal cell carcinoma, hepatoma-liver cell carcinoma, bile duct carcinoma, cholangiocarcinoma, papillary carcinoma, transitional cell carcinoma, choriocarcinoma, semonoma, embryonal carcinoma, mammary carcinomas, gastrointestinal carcinoma, colonic carcinomas, bladder carcinoma, prostate carcinoma, and squamous cell carcinoma of the neck and head region; sarcomas, such as fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteogenic sarcoma,
  • carcinomas such as squamous cell carcinoma
  • chordosarcoma angiosarcoma, endotheliosarcoma, lymphangiosarcoma, synoviosarcoma and mesotheliosarcoma; hematologic cancers, such as myelomas, leukemias (e.g., acute myelogenous leukemia, chronic lymphocytic leukemia, granulocytic leukemia, monocytic leukemia, lymphocytic leukemia), and lymphomas (e.g., follicular lymphoma, mantle cell lymphoma, diffuse large Bcell lymphoma, malignant lymphoma, plasmocytoma, reticulum cell sarcoma, or Hodgkins disease); and tumors of the nervous system including glioma, meningoma, medulloblastoma, schwannoma or epidymoma.
  • leukemias e.g., acute myelogenous leuk
  • Graft rejection (e.g., in transplantation) include but are not limited to allograft rejection or graft- versus-host disease.
  • Fibrotic diseases include, but are not limited to scleroderma.
  • Neurological disorders include, but are not limited to AIDS related dementia and pain (e.g. neuropathic pain).
  • Metabolic disorders include, but are not limited to diabetes.
  • diseases or conditions in which undesirable inflammatory responses are to be inhibited, include, but are not limited to, reperfusion injury; certain hematologic malignancies; cytokine-induced toxicity (e.g., septic shock, endotoxic shock); polymyositis; dermatomyositis; and granulomatous diseases including sarcoidosis.
  • cytokine-induced toxicity e.g., septic shock, endotoxic shock
  • polymyositis e.g., septic shock, endotoxic shock
  • dermatomyositis e.g., granulomatous diseases including sarcoidosis.
  • Polypeptides of the present disclosure can be produced using any standard methods known in the art.
  • the polypeptides are produced by recombinant DNA methods by inserting a nucleic acid sequence (e.g., a cDNA) encoding the polypeptide into a recombinant expression vector and expressing the DNA sequence under conditions promoting expression.
  • a nucleic acid sequence e.g., a cDNA
  • Nucleic acids encoding any of the various polypeptides disclosed herein may be synthesized chemically. Codon usage may be selected so as to improve expression in a cell. Such codon usage will depend on the cell type selected. Specialized codon usage patterns have been developed for E. coli and other bacteria, as well as mammalian cells, plant cells, yeast cells and insect cells. See for example: Mayfield et al., Proc. Natl. Acad. Sci. USA. 2003
  • the DNA encoding the polypeptide is operably linked to suitable transcriptional or translational regulatory elements derived from mammalian, viral, or insect genes.
  • suitable transcriptional or translational regulatory elements include a transcriptional promoter, an optional operator sequence to control transcription, a sequence encoding suitable mRNA ribosomal binding sites, and sequences that control the termination of transcription and translation.
  • the ability to replicate in a host, usually conferred by an origin of replication, and a selection gene to facilitate recognition of transformants is additionally incorporated.
  • the recombinant DNA can also include any type of protein tag sequence that may be useful for purifying the protein.
  • protein tags include but are not limited to a histidine tag, a FLAG tag, a myc tag, an HA tag, or a GST tag.
  • Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts can be found in Cloning Vectors: A Laboratory Manual, (Elsevier, N.Y., 1985).
  • the expression construct is introduced into the host cell using a method appropriate to the host cell.
  • a variety of methods for introducing nucleic acids into host cells are known in the art, including, but not limited to, electroporation; transfection employing calcium chloride, rubidium chloride, calcium phosphate, DEAE-dextran, or other substances; microprojectile bombardment; lipofection; and infection (where the vector is an infectious agent).
  • Suitable host cells include prokaryotes, yeast, mammalian cells, or bacterial cells.
  • Suitable bacteria include gram negative or gram positive organisms, for example, E. coli or Bacillus spp. Yeast, preferably from the Saccharomyces species, such as S. cerevisiae, may also be used for production of polypeptides.
  • Various mammalian or insect cell culture systems can also be employed to express recombinant proteins. Baculovirus systems for production of heterologous proteins in insect cells are reviewed by Luckow and Summers, (Bio/Technology, 6:47, 1988).
  • suitable mammalian host cell lines include endothelial cells, COS-7 monkey kidney cells, CV-1, L cells, CI 27, 3T3, Chinese hamster ovary (CHO), human embryonic kidney cells, HeLa, 293, 293T, and BHK cell lines.
  • Purified polypeptides are prepared by culturing suitable host/vector systems to express the recombinant proteins. For many applications, the small size of many of the polypeptides disclosed herein would make expression in E. coli as the preferred method for expression. The protein is then purified from culture media or cell extracts. Proteins disclosed herein can also be produced using cell-translation systems.
  • nucleic acids encoding the polypeptide must be modified to allow in vitro transcription to produce mRNA and to allow cell-free translation of the mRNA in the particular cell-free system being utilized (eukaryotic such as a mammalian or yeast cell-free translation system or prokaryotic such as a bacterial cell-free translation system.
  • eukaryotic such as a mammalian or yeast cell-free translation system
  • prokaryotic such as a bacterial cell-free translation system.
  • CCR2-binding polypeptides can also be produced by chemical synthesis (e.g., by the methods described in Solid Phase Peptide Synthesis, 2nd ed., 1984, The Pierce Chemical Co., Rockford, 111.). Modifications to the protein can also be produced by chemical synthesis.
  • polypeptides of the present disclosure can be purified by isolation/purification methods for proteins generally known in the field of protein chemistry.
  • Non-limiting examples include extraction, recrystallization, salting out (e.g., with ammonium sulfate or sodium sulfate), centrifugation, dialysis, ultrafiltration, adsorption chromatography, ion exchange chromatography, hydrophobic chromatography, normal phase chromatography, reversed-phase chromatography, gel filtration, gel permeation chromatography, affinity chromatography, electrophoresis, countercurrent distribution or any combinations of these.
  • polypeptides may be exchanged into different buffers and/or concentrated by any of a variety of methods known to the art, including, but not limited to, filtration and dialysis.
  • the purified polypeptide is preferably at least 85% pure, more preferably at least 95% pure, and most preferably at least 98% pure. Regardless of the exact numerical value of the purity, the polypeptide is sufficiently pure for use as a pharmaceutical product.
  • the binding polypeptides of the invention may further comprise post-translational modifications.
  • post-translational protein modifications include phosphorylation, acetylation, methylation, ADP-ribosylation, ubiquitination, glycosylation, carbonylation, sumoylation, biotinylation or addition of a polypeptide side chain or of a hydrophobic group.
  • the modified soluble polypeptides may contain non- amino acid elements, such as lipids, poly- or mono-saccharide, and phosphates.
  • a preferred form of glycosylation is sialylation, which conjugates one or more sialic acid moieties to the polypeptide.
  • Sialic acid moieties improve solubility and serum half-life while also reducing the possible immunogeneticity of the protein. See Raju et al. Biochemistry. 2001 31 ; 40(30):8868- 76. Effects of such non-amino acid elements on the functionality of a polypeptide may be tested for its antagonizing role in CCR2 function.
  • modified forms of the subject soluble polypeptides comprise linking the subject soluble polypeptides to nonproteinaceous polymers.
  • the polymer is polyethylene glycol ("PEG"), polypropylene glycol, or polyoxyalkylenes, in the manner as set forth in U.S. Patents 4,640,835; 4,496,689; 4,301, 144; 4,670,417; 4,791 , 192 or 4,179,337.
  • PEG polyethylene glycol
  • polypropylene glycol polypropylene glycol
  • polyoxyalkylenes examples include PEGylated V -B8.
  • PEG is a water soluble polymer that is commercially available or can be prepared by ring-opening polymerization of ethylene glycol according to methods well known in the art (Sandler and Karo, Polymer Synthesis, Academic Press, New York, Vol. 3, pages 138-161).
  • the term "PEG” is used broadly to encompass any polyethylene glycol molecule, without regard to size or to modification at an end of the PEG, and can be represented by the formula: X-0(CH 2 CH 2 0) n -lCH 2 CH 2 OH (1), where n is 20 to 2300 and X is H or a terminal modification, e.g., a C alkyl.
  • the PEG of the invention terminates on one end with hydroxy or methoxy, i.e., X is H or C3 ⁇ 4 ("methoxy PEG").
  • a PEG can contain further chemical groups which are necessary for binding reactions; which results from the chemical synthesis of the molecule; or which is a spacer for optimal distance of parts of the molecule.
  • such a PEG can consist of one or more PEG side-chains which are linked together. PEGs with more than one PEG chain are called multiarmed or branched PEGs. Branched PEGs can be prepared, for example, by the addition of polyethylene oxide to various polyols, including glycerol, pentaerythriol, and sorbitol.
  • a four-armed branched PEG can be prepared from pentaerythriol and ethylene oxide.
  • Branched PEG are described in, for example, EP-A 0 473 084 and U.S. Patent. 5,932,462.
  • One form of PEGs includes two PEG side-chains (PEG2) linked via the primary amino groups of a lysine (Monfardini et al., Bioconjugate Chem. 6 (1995) 62-69).
  • the pegylated 10F n3 polypeptide is produced by site-directed pegylation, particularly by conjugation of PEG to a cysteine moiety at the N- or C-terminus. Accordingly, the present disclosure provides a target-binding l0F n3 polypeptide with improved
  • the polypeptide comprising: a l0F n3 domain having from about 80 to about 150 amino acids, wherein at least one of the loops of said 10F n3 domain participate in target binding; and a covalently bound PEG moiety, wherein said 10F n3 polypeptide binds to the target with a K D of less than 100 nM and has a clearance rate of less than 30 mlVhr/kg in a mammal.
  • the PEG moiety may be attached to the l0F n3 polypeptide by site directed pegylation, such as by attachment to a Cys residue, where the Cys residue may be positioned at the N-terminus of the 0F n3 polypeptide or between the N-terminus and the most N-terminal beta or beta-like strand or at the C-terminus of the n3 polypeptide or between the C-terminus and the most C-terminal beta or beta-like strand.
  • a Cys residue may be situated at other positions as well, particularly any of the loops that do not participate in target binding.
  • a PEG moiety may also be attached by other chemistry, including by conjugation to amines.
  • PEG conjugation to peptides or proteins generally involves the activation of PEG and coupling of the activated PEG-intermediates directly to target proteins/peptides or to a linker, which is subsequently activated and coupled to target proteins/peptides (see Abuchowski et al., J. Biol. Chem., 252, 3571 (1977) and J. Biol. Chem., 252, 3582 (1977), Zalipsky, et al, and Harris et. al., in: Poly( ethylene glycol) Chemistry: Biotechnical and Biomedical Applications; (J. M. Harris ed.) Plenum Press: New York, 1992; Chap.21 and 22). It is noted that a binding polypeptide containing a PEG molecule is also known as a conjugated protein, whereas the protein lacking an attached PEG molecule can be referred to as unconjugated.
  • a variety of molecular mass forms of PEG can be selected, e.g., from about 1,000 Daltons (Da) to 100,000 Da (n is 20 to 2300), for conjugating to CCR2-binding polypeptides.
  • the number of repeating units "n" in the PEG is approximated for the molecular mass described in Daltons. It is preferred that the combined molecular mass of PEG on an activated linker is suitable for pharmaceutical use. Thus, in one embodiment, the molecular mass of the PEG molecules does not exceed 100,000 Da.
  • each PEG molecule has the same molecular mass of 12,000 Da (each n is about 270)
  • the total molecular mass of PEG on the linker is about 36,000 Da (total n is about 820).
  • the molecular masses of the PEG attached to the linker can also be different, e.g., of three molecules on a linker two PEG molecules can be 5,000 Da each (each n is about 1 10) and one PEG molecule can be 12,000 Da (n is about 270).
  • an CCR2 binding polypeptide is covalently linked to one polyethylene glycol) group of the formula: --CO--(CH 2 ) x ⁇ (OCH 2 CH 2 ) m --OR , with the -CO (i.e. carbonyl) of the poly(ethylene glycol) group forming an amide bond with one of the amino groups of the binding polypeptide; R being lower alkyl; x being 2 or 3; m being from about 450 to about 950; and n and m being chosen so that the molecular weight of the conjugate minus the binding polypeptide is from about 10 to 40 kDa.
  • a binding polypeptide's 6-amino group of a lysine is the available (free) amino group.
  • the above conjugates may be more specifically presented by formula (II): P--NHCO-- (CH 2 )*--(OCH 2 CH 2 ) m --OR (II) , wherein P is the group of a binding polypeptide as described herein, (i.e. without the amino group or amino groups which form an amide linkage with the carbonyl shown in formula (II); and wherein R is lower alkyl; x is 2 or 3; m is from about 450 to about 950 and is chosen so that the molecular weight of the conjugate minus the binding polypeptide is from about 10 to about 40 kDa.
  • the given ranges of "m” have an orientational meaning. The ranges of "m” are determined in any case, and exactly, by the molecular weight of the PEG group.
  • PEG poly(ethylene glycol)
  • a suitable molecular mass for PEG e.g., based on how the pegylated binding polypeptide will be used therapeutically, the desired dosage, circulation time, resistance to proteolysis, immunogenicity, and other considerations.
  • PEG molecules may be activated to react with amino groups on a binding polypeptide, such as with lysines (Bencham et al., Anal. Biochem., 131 , 25 (1983); Veronese et al., Appl. Biochem., 1 1, 141 (1985).; Zalipsky et al., Polymeric Drugs and Drug Delivery Systems, adrs 9-110 ACS Symposium Series 469 (1999); Zalipsky et al., Europ. Polym. J., 19, 1 177-1 183 (1983); Delgado et al., Biotechnology and Applied Biochemistry, 12, 119-128 (1990)).
  • lysines Bosines
  • carbonate esters of PEG are used to form the PEG-binding polypeptide conjugates.
  • ⁇ , ⁇ '-disuccinimidylcarbonate (DSC) may be used in the reaction with PEG to form active mixed PEG-succinimidyl carbonate that may be subsequently reacted with a nucleophilic group of a linker or an amino group of a binding polypeptide (see U.S. Patents 5,281 ,698 and 5,932,462).
  • 1 , 1 '-(dibenzotriazolyl)carbonate and di-(2-pyridyl)carbonate may be reacted with PEG to form PEG-benzotriazolyl and PEG- pyridyl mixed carbonate (U.S. Patent 5,382,657), respectively.
  • Pegylation of a l0F n3 polypeptide can be performed according to the methods of the state of the art, for example by reaction of the binding polypeptide with electrophilically active PEGs (supplier: Shearwater Corp., USA, www.shearwatercorp.com).
  • Preferred PEG reagents of the present invention are, e.g., N-hydroxysuccinimidyl propionates (PEG-SPA), butanoates (PEG-SBA), PEG-succinimidyl propionate or branched N-hydroxysuccinimides such as mPEG2-NHS (Monfardini et al., Bioconjugate Chem. 6 (1995) 62-69).
  • PEG-SPA N-hydroxysuccinimidyl propionates
  • PEG-SBA butanoates
  • PEG-succinimidyl propionate or branched N-hydroxysuccinimides such as mPEG2-NHS (Mon
  • PEG molecules may be coupled to sulfhydryl groups on a binding polypeptide (Sartore et al., Appl. Biochem. BiotechnoL, 27, 45 (1991); Morpurgo et al., Biocon. Chem., 7, 363-368 (1996); Goodson et al., Bio Technology (1990) 8, 343; U.S. Patent 5,766,897).
  • U.S. Patents 6,610,281 and 5,766,897 describes exemplary reactive PEG species that may be coupled to sulfhydryl groups.
  • cysteine residues are native to the binding polypeptide, whereas in other embodiments, one or more cysteine residues are engineered into the binding polypeptide.
  • Mutations may be introduced into a binding polypeptide coding sequence to generate cysteine residues. This might be achieved, for example, by mutating one or more amino acid residues to cysteine.
  • Preferred amino acids for mutating to a cysteine residue include serine, threonine, alanine and other hydrophilic residues.
  • the residue to be mutated to cysteine is a surface-exposed residue.
  • Algorithms are well-known in the art for predicting surface accessibility of residues based on primary sequence or a protein.
  • surface residues may be predicted by comparing the amino acid sequences of binding polypeptides, given that the crystal structure of the framework based on which binding polypeptides are designed and evolved has been solved (see Himanen et al., Nature. (2001) 20-27; 414(6866):933-8) and thus the surface-exposed residues identified.
  • cysteine residues are introduced into binding polypeptides at or near the N- and/or C-terminus, or within loop regions.
  • the pegylated binding polypeptide comprises a PEG molecule covalently attached to the alpha amino group of the N-terminal amino acid.
  • Site specific N- terminal reductive amination is described in Pepinsky et al., (2001) JPET, 297, 1059, and U.S. Patent 5,824,784.
  • the use of a PEG-aldehyde for the reductive amination of a protein utilizing other available nucleophilic amino groups is described in U.S. Patent 4,002,531 , in Wieder et al., ( 1979) . Biol. Chem. 254, 12579, and in Chamow et al., (1994) Bioconjugate Chem. 5, 133.
  • pegylated binding polypeptide comprises one or more PEG molecules covalently attached to a linker, which in turn is attached to the alpha amino group of the amino acid residue at the N-terminus of the binding polypeptide.
  • a binding polypeptide is pegylated at the C-terminus.
  • a protein is pegylated at the C-terminus by the introduction of C-terminal azido- methionine and the subsequent conjugation of a methyl-PEG-triarylphosphine compound via the Staudinger reaction. This C-terminal conjugation method is described in Cazalis et al., Bioconjug. Chem. 2004; 15(5): 1005- 1009.
  • Monopegylation of a binding polypeptide can also be produced according to the general methods described in WO 94/01451.
  • WO 94/01451 describes a method for preparing a recombinant polypeptide with a modified terminal amino acid alpha-carbon reactive group. The steps of the method involve forming the recombinant polypeptide and protecting it with one or more biologically added protecting groups at the N-terminal alpha-amine and C- terminal alpha-carboxyl. The polypeptide can then be reacted with chemical protecting agents to selectively protect reactive side chain groups and thereby prevent side chain groups from being modified.
  • the polypeptide is then cleaved with a cleavage reagent specific for the biological protecting group to form an unprotected terminal amino acid alpha-carbon reactive group.
  • the unprotected terminal amino acid alpha-carbon reactive group is modified with a chemical modifying agent.
  • the side chain protected terminally modified single copy polypeptide is then deprotected at the side chain groups to form a terminally modified recombinant single copy polypeptide.
  • the number and sequence of steps in the method can be varied to achieve selective modification at the N- and/or C-terminal amino acid of the polypeptide.
  • the ratio of a binding polypeptide to activated PEG in the conjugation reaction can be from about 1 :0.5 to 1 :50, between from about 1 : 1 to 1 :30, or from about 1 :5 to 1 : 15.
  • Various aqueous buffers can be used in the present method to catalyze the covalent addition of PEG to the binding polypeptide.
  • the pH of a buffer used is from about 7.0 to 9.0.
  • the pH is in a slightly basic range, e.g., from about 7.5 to 8.5. Buffers having a pKa close to neutral pH range may be used, e.g., phosphate buffer.
  • PEGylated binding polypeptide such as size exclusion (e.g. gel filtration) and ion exchange chromatography. Products may also be separated using SDS-PAGE. Products that may be separated include mono-, di-, tri- poly- and un-pegylated binding polypeptide, as well as free PEG.
  • the percentage of mono-PEG conjugates can be controlled by pooling broader fractions around the elution peak to increase the percentage of mono-PEG in the composition. About ninety percent mono-PEG conjugates represents a good balance of yield and activity.
  • compositions in which, for example, at least ninety-two percent or at least ninety-six percent of the conjugates are mono-PEG species may be desired.
  • the percentage of mono-PEG conjugates is from ninety percent to ninety-six percent.
  • PEGylated binding polypeptide of the invention contain one, two or more PEG moieties.
  • the PEG moiety(ies) are bound to an amino acid residue which is on the surface of the protein and/or away from the surface that contacts the target ligand.
  • the combined or total molecular mass of PEG in PEG- binding polypeptide is from about 3,000 Da to 60,000 Da, optionally from about 10,000 Da to 36,000 Da.
  • the PEG in pegylated binding polypeptide is a substantially linear, straight-chain PEG.
  • the PEG in pegylated binding polypeptide is not hydrolyzed from the pegylated amino acid residue using a hydroxylamine assay, e.g., 450 mM hydroxylamine (pH 6.5) over 8 to 16 hours at room temperature, and is thus stable.
  • a hydroxylamine assay e.g., 450 mM hydroxylamine (pH 6.5) over 8 to 16 hours at room temperature
  • greater than 80% of the composition is stable mono-PEG-binding polypeptide, more preferably at least 90%, and most preferably at least 95%.
  • the pegylated binding polypeptides of the invention will preferably retain at least 25%, 50%, 60%, 70%, 80%, 85%, 90%, 95% or 100% of the biological activity associated with the unmodified protein.
  • biological activity refers to its ability to bind to CCR2, as assessed by KD, kocut or k 0 ff.
  • the pegylated binding polypeptide protein shows an increase in binding to CCR2 relative to unpegylated binding polypeptide.
  • the serum clearance rate of PEG-modified polypeptide may be decreased by about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or even 90%, relative to the clearance rate of the unmodified binding polypeptide.
  • the PEG-modified polypeptide may have a half-life (ti/2) which is enhanced relative to the half-life of the unmodified protein.
  • the half-life of PEG- binding polypeptide may be enhanced by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 125%, 150%, 175%, 200%, 250%, 300%, 400% or 500%, or even by 1000% relative to the half-life of the unmodified binding polypeptide.
  • the protein half-life is determined in vitro, such as in a buffered saline solution or in serum. In other embodiments, the protein half-life is an in vivo half life, such as the half-life of the protein in the serum or other bodily fluid of an animal.
  • the present disclosure features methods for treating conditions or preventing preconditions which respond to an inhibition of CCR2 biological activity.
  • Preferred examples are conditions that are characterized by inflammation or cellular hyperproliferation.
  • Techniques and dosages for administration vary depending on the type of specific polypeptide and the specific condition being treated but can be readily determined by the skilled artisan.
  • regulatory agencies require that a protein reagent to be used as a therapeutic is formulated so as to have acceptably low levels of pyrogens.
  • therapeutic formulations will generally be distinguished from other formulations in that they are substantially pyrogen free, or at least contain no more than acceptable levels of pyrogen as determined by the appropriate regulatory agency (e.g., FDA).
  • compositions of the present disclosure may be administered with a pharmaceutically acceptable diluent, carrier, or excipient, in unit dosage form.
  • Administration may be parenteral (e.g., intravenous, subcutaneous), oral, or topical, as non-limiting examples.
  • any gene therapy technique using nucleic acids encoding the polypeptides of the invention, may be employed, such as naked DNA delivery, recombinant genes and vectors, cell-based delivery, including ex vivo manipulation of patients' cells, and the like.
  • the composition can be in the form of a pill, tablet, capsule, liquid, or sustained release tablet for oral administration; or a liquid for intravenous, subcutaneous or parenteral administration; gel, lotion, ointment, cream, or a polymer or other sustained release vehicle for local administration.
  • Formulations for parenteral administration may, for example, contain excipients, sterile water, saline, polyalkylene glycols such as polyethylene glycol, oils of vegetable origin, or hydrogenated napthalenes.
  • sterile water ed., ed. A. R. Gennaro A R., 2000, Lippincott Williams & Wilkins, Philadelphia, Pa.
  • Formulations for parenteral administration may, for example, contain excipients, sterile water, saline, polyalkylene glycols such as polyethylene glycol, oils of vegetable origin, or hydrogenated napthalenes.
  • Biocompatible, biodegradable lactide polymer, lactide/glycolide copolymer, or polyoxyethylene- polyoxypropylene copolymers may be used to control the release of the compounds.
  • Nanoparticulate formulations may be used to control the biodistribution of the compounds.
  • Other potentially useful parenteral delivery systems include ethylene-vinyl acetate copolymer particles, osmotic pumps, implantable infusion systems, and liposomes.
  • concentration of the compound in the formulation varies depending upon a number of factors, including the dosage of the drug to be administered, and the route of administration.
  • the polypeptide may be optionally administered as a pharmaceutically acceptable salt, such as non-toxic acid addition salts or metal complexes that are commonly used in the pharmaceutical industry.
  • acid addition salts include organic acids such as acetic, lactic, pamoic, maleic, citric, malic, ascorbic, succinic, benzoic, palmitic, suberic, salicylic, tartaric, methanesulfonic, toluenesulfonic, or trifluoroacetic acids or the like; polymeric acids such as tannic acid, carboxymethyl cellulose, or the like; and inorganic acid such as hydrochloric acid, hydrobromic acid, sulfuric acid phosphoric acid, or the like.
  • Metal complexes include zinc, iron, and the like.
  • the polypeptide is formulated in the presence of sodium acetate to increase thermal stability.
  • Formulations for oral use include tablets containing the active ingredient(s) in a mixture with non-toxic pharmaceutically acceptable excipients.
  • excipients may be, for example, inert diluents or fillers (e.g., sucrose and sorbitol), lubricating agents, glidants, and anti- adhesives (e.g., magnesium stearate, zinc stearate, stearic acid, silicas, hydrogenated vegetable oils, or talc).
  • Formulations for oral use may also be provided as chewable tablets, or as hard gelatin capsules wherein the active ingredient is mixed with an inert solid diluent, or as soft gelatin capsules wherein the active ingredient is mixed with water or an oil medium.
  • a therapeutically effective dose refers to a dose that produces the therapeutic effects for which it is administered.
  • the exact dose will depend on the disorder to be treated, and may be ascertained by one skilled in the art using known techniques.
  • the polypeptide is administered at about 0.01 g/kg to about 50 mg/kg per day, preferably 0.01 mg/kg to about 30 mg/kg per day, most preferably 0.1 mg/kg to about 20 mg kg per day.
  • the polypeptide may be given daily (e.g., once, twice, three times, or four times daily) or preferably less frequently (e.g., weekly, every two weeks, every three weeks, monthly, or quarterly).
  • adjustments for age as well as the body weight, general health, sex, diet, time of administration, drug interaction, and the severity of the disease may be necessary, and will be ascertainable with routine experimentation by those skilled in the art.
  • the CCR2 binding proteins described herein and their related variants are useful in a number of therapeutic and diagnostic applications. These include the inhibition of the biological activity of CCR2 by competing for or blocking the binding to a CCR2 as well as the delivery of cytotoxic or imaging moieties to cells, preferably cells expressing CCR2.
  • the small size and stable structure of these molecules can be particularly valuable with respect to manufacturing of the drug, rapid clearance from the body for certain applications where rapid clearance is desired or formulation into novel delivery systems that are suitable or improved using a molecule with such characteristics.
  • the polypeptides of this disclosure are effective against a number of cancer conditions as well as complications arising from cancer, such as pleural effusion and ascites.
  • the CCR2-binding polypeptides of the disclosure can be used for the treatment of prevention of hyperproliferative diseases or cancer and the metastatic spread of cancers.
  • Preferred indications for the disclosed anti- CCR2antibodies include colorectal cancers, head and neck cancers, small cell lung cancer, non-small cell lung cancer (NSCLC) and pancreatic cancer.
  • Non-limiting examples of cancers include bladder, blood, bone, brain, breast, cartilage, colon kidney, liver, lung, lymph node, nervous tissue, ovary, pancreatic, prostate, skeletal muscle, skin, spinal cord, spleen, stomach, testes, thymus, thyroid, trachea, urogenital tract, ureter, urethra, uterus, or vaginal cancer.
  • inflammatory disorders can be treated with the disclosed anti- CCR2 binding polypeptides disclosed herein.
  • Such inflammatory disorders include, for example, intestinal mucosa inflammation wasting diseases associated with colitis, multiple sclerosis, systemic lupus erythematosus, viral infections, rheumatoid arthritis, osteoarthritis, psoriasis, and Crohn's disease.
  • a CCR2 binding polypeptide can be administered alone or in combination with one or more additional therapies such as chemotherapy radiotherapy, immunotherapy, surgical intervention, or any combination of these. Long-term therapy is equally possible as is adjuvant therapy in the context of other treatment strategies, as described above.
  • polypeptide therapeutic agents can be administered, together (simultaneously) or at different times (sequentially).
  • polypeptide therapeutic agents can be administered with another type of compounds for treating cancer or for inhibiting angiogenesis.
  • the subject anti- CCR2antibodies agents of the invention can be used alone.
  • the subject agents may be used in combination with other conventional anti-cancer therapeutic approaches directed to treatment or prevention of proliferative disorders (e.g., tumor).
  • proliferative disorders e.g., tumor
  • methods can be used in prophylactic cancer prevention, prevention of cancer recurrence and metastases after surgery, and as an adjuvant of other conventional cancer therapy.
  • conventional cancer therapies e.g., chemotherapy, radiation therapy, phototherapy, immunotherapy, and surgery
  • a wide array of conventional compounds have been shown to have anti-neoplastic activities. These compounds have been used as pharmaceutical agents in chemotherapy to shrink solid tumors, prevent metastases and further growth, or decrease the number of malignant cells in leukemic or bone marrow malignancies.
  • chemotherapy has been effective in treating various types of malignancies, many anti-neoplastic compounds induce undesirable side effects. It has been shown that when two or more different treatments are combined, the treatments may work synergistically and allow reduction of dosage of each of the treatments, thereby reducing the detrimental side effects exerted by each compound at higher dosages. In other instances, malignancies that are refractory to a treatment may respond to a combination therapy of two or more different treatments.
  • a polypeptide therapeutic agent of the present invention When a polypeptide therapeutic agent of the present invention is administered in combination with another conventional anti-neoplastic agent, either concomitantly or sequentially, such therapeutic agent may be found to enhance the therapeutic effect of the antineoplastic agent or overcome cellular resistance to such anti-neoplastic agent. This allows decrease of dosage of an anti-neoplastic agent, thereby reducing the undesirable side effects, or restores the effectiveness of an anti-neoplastic agent in resistant cells.
  • Pharmaceutical compounds that may be used for combinatory anti-tumor therapy include, merely to illustrate: aminoglutethimide, amsacrine, anastrozole, asparaginase, beg, bicalutamide, bleomycin, buserelin, busulfan, campothecin, capecitabine, carboplatin, carmustine, chlorambucil, cisplatin, cladribine, clodronate, colchicine, cyclophosphamide, cyproterone, cytarabine, dacarbazine, dactinomycin, daunorubicin, dienestrol,
  • diethylstilbestrol docetaxel, doxorubicin, epirubicin, estradiol, estramustine, etoposide, exemestane, filgrastim, fludarabine, fludrocortisone, fluorouracil, fluoxymesterone, flutamide, gemcitabine, genistein, goserelin, hydroxyurea, idarubicin, ifosfamide, imatinib, interferon, irinotecan, ironotecan, letrozole, leucovorin, leuprolide, levamisole, lomustine,
  • chemotherapeutic anti-tumor compounds may be categorized by their mechanism of action into, for example, following groups: anti-metabolites/anti-cancer agents, such as pyrimidine analogs (5-fluorouracil, floxuridine, capecitabine, gemcitabine and cytarabine) and purine analogs, folate antagonists and related inhibitors (mercaptopurine, thioguanine, pentostatin and 2-chlorodeoxyadenosine (cladribine)); antiproliferative/antimitotic agents including natural products such as vinca alkaloids (vinblastine, vincristine, and vinorelbine), microtubule disruptors such as taxane (paclitaxel, docetaxel), vincristin, vinblastin, nocodazole, epothilones and navelbine, epidipodophyllotoxins (etoposide, teniposide), DNA damaging agents (actinomycin, amsacrine, anthra
  • doxorubicin (adriamycin), amsacrine, camptothecin, daunorubicin, dactinomycin, eniposide, epirubicin, etoposide, idarubicin and mitoxantrone, topotecan, irinotecan), corticosteroids (cortisone, dexamethasone, hydrocortisone, methylpednisolone, prednisone, and prenisolone); growth factor signal transduction kinase inhibitors; mitochondrial dysfunction inducers and caspase activators; and chromatin disruptors.
  • administration of the polypeptide therapeutic agents may be continued while the other therapy is being administered and or thereafter.
  • Administration of the polypeptide therapeutic agents may be made in a single dose, or in multiple doses.
  • administration of the polypeptide therapeutic agents is commenced at least several days prior to the conventional therapy, while in other instances, administration is begun either immediately before or at the time of the administration of the conventional therapy.
  • a biological sample such as serum or a tissue biopsy, from a patient suspected of having a condition characterized by inappropriate angiogenesis is contacted with a detectably labeled polypeptide of the disclosure to detect levels of CCR2.
  • the levels of CCR2 detected are then compared to levels of CCR2 detected in a normal sample also contacted with the labeled polypeptide.
  • An increase of at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% in the levels of the CCR2 may be considered a diagnostic indicator.
  • the CCR2 binding polypeptides are further attached to a label that is able to be detected (e.g., the label can be a radioisotope, fluorescent compound, enzyme or enzyme co-factor).
  • the active moiety may be a radioactive agent, such as: radioactive heavy metals such as iron chelates, radioactive chelates of gadolinium or manganese, positron emitters of oxygen, nitrogen, iron, carbon, or gallium, 43 K, 52 Fe, 57 Co, 67 Cu, 67 Ga, 68 Ga, l23 I, 125 I, 131 I, 132 I, or "TC.
  • a binding agent affixed to such a moiety may be used as an imaging agent and is administered in an amount effective for diagnostic use in a mammal such as a human and the localization and accumulation of the imaging agent is then detected.
  • the localization and accumulation of the imaging agent may be detected by radioscintigraphy, nuclear magnetic resonance imaging, computed tomography or positron emission tomography.
  • Immunoscintigraphy using CCR2 binding polypeptides directed at CCR2 may be used to detect and/or diagnose cancers and vasculature. For example, any of the binding polypeptide against a CCR2 marker labeled with "Technetium, 1 1 'indium, or 1 5 Iodine may be effectively used for such imaging.
  • compositions according to the present invention useful as imaging agents comprising a targeting moiety conjugated to a radioactive moiety comprise 0.1 - 100 millicuries, in some embodiments preferably 1-10 millicuries, in some embodiments preferably 2-5 millicuries, in some embodiments more preferably 1-5 millicuries.
  • the CCR2 binding polypeptides can also be used to deliver additional therapeutic agents (including but not limited to drug compounds, chemotherapeutic compounds, and radiotherapeutic compounds) to a cell or tissue expressing CCR2.
  • additional therapeutic agents including but not limited to drug compounds, chemotherapeutic compounds, and radiotherapeutic compounds
  • the CCR2 binding polypeptide is fused to a chemotherapeutic agent for targeted delivery of the chemotherapeutic agent to a tumor cell or tissue expressing CCR2.
  • the CCR2 binding polypeptides are useful in a variety of applications, including research, diagnostic and therapeutic applications. For instance, they can be used to isolate and/or purify receptor or portions thereof, and to study receptor structure (e.g., conformation) and function.
  • the various binding polypeptides can be used to detect or measure the expression of CCR2, for example, on endothelial cells (e.g., venous endothelial cells), or on cells transfected with a CCR2 gene.
  • endothelial cells e.g., venous endothelial cells
  • cells transfected with a CCR2 gene e.g., VEnous endothelial cells
  • they also have utility in applications such as cell sorting and imaging (e.g., flow cytometry, and fluorescence activated cell sorting), for diagnostic or research purposes.
  • the binding polypeptides of fragments thereof can be labeled or unlabeled for diagnostic purposes.
  • diagnostic assays entail detecting the formation of a complex resulting from the binding of a binding polypeptide to CCR2.
  • the binding polypeptides or fragments can be directly labeled, similar to antibodies.
  • labels can be employed, including, but not limited to, radionuclides, fluorescers, enzymes, enzyme substrates, enzyme cofactors, enzyme inhibitors and ligands (e.g., biotin, haptens). Numerous appropriate immunoassays are known to the skilled artisan (see, for example, U.S. Patents.
  • the binding polypeptides can be used in assays, such as agglutination assays. Unlabeled binding polypeptides can also be used in combination with another (one or more) suitable reagent which can be used to detect the binding polypeptide, such as a labeled antibody reactive with the binding polypeptide or other suitable reagent (e.g., labeled protein A).
  • a suitable reagent which can be used to detect the binding polypeptide, such as a labeled antibody reactive with the binding polypeptide or other suitable reagent (e.g., labeled protein A).
  • the binding polypeptides of the present invention can be utilized in enzyme immunoassays, wherein the subject polypeptides are conjugated to an enzyme.
  • a biological sample comprising a CCR2 protein is combined with the subject binding polypeptides, binding occurs between the binding polypeptides and the CCR2 protein.
  • a sample containing cells expressing a CCR2 protein e.g., endothelial cells
  • binding occurs between the binding polypeptides and cells bearing a CCR2 protein recognized by the binding polypeptide.
  • binding polypeptide-enzyme conjugate specifically bound to the cells can be determined, for example, by contacting the sample with a substrate of the enzyme which produces a color or other detectable change when acted on by the enzyme.
  • the subject binding polypeptides can be unlabeled, and a second, labeled polypeptide (e.g., an antibody) can be added which recognizes the subject binding polypeptide.
  • kits for use in detecting the presence of a CCR2 protein in a biological sample can also be prepared.
  • Such kits will include a CCR2 binding polypeptide which binds to a CCR2 protein or portion of said receptor, as well as one or more ancillary reagents suitable for detecting the presence of a complex between the binding polypeptide and the receptor protein or portions thereof.
  • the polypeptide compositions of the present invention can be provided in lyophilized form, either alone or in combination with additional antibodies specific for other epitopes.
  • the binding polypeptides and/or antibodies which can be labeled or unlabeled, can be included in the kits with adjunct ingredients (e.g., buffers, such as Tris, phosphate and carbonate, stabilizers, excipients, biocides and/or inert proteins, e.g., bovine serum albumin).
  • adjunct ingredients e.g., buffers, such as Tris, phosphate and carbonate, stabilizers, excipients, biocides and/or inert proteins, e.g., bovine serum albumin.
  • the binding polypeptides and/or antibodies can be provided as a lyophilized mixture with the adjunct ingredients, or the adjunct ingredients can be separately provided for combination by the user.
  • these adjunct materials will be present in less than about 5% weight based on the amount of active binding polypeptide or antibody, and usually will be present in a total amount of at least about 0.001 % weight based on polypeptide or antibody concentration.
  • a second antibody capable of binding to the binding polypeptide can be provided in the kit, for instance in a separate vial or container.
  • the second antibody if present, is typically labeled, and can be formulated in an analogous manner with the antibody formulations described above.
  • the present disclosure also provides a method of detecting and/or quantitating expression of CCR2, wherein a composition comprising a cell or fraction thereof ⁇ e.g., membrane fraction) is contacted with a binding polypeptide which binds to a CCR2 or portion of the receptor under conditions appropriate for binding thereto, and the binding is monitored. Detection of the binding polypeptide, indicative of the formation of a complex between binding polypeptide and CCR2 or a portion thereof, indicates the presence of the receptor. Binding of a polypeptide to the cell can be determined by standard methods, such as those described in the working examples. The method can be used to detect expression of CCR2 on cells from an individual. Optionally, a quantitative expression of CCR2 on the surface of endothelial cells can be evaluated, for instance, by flow cytometry, and the staining intensity can be correlated with disease susceptibility, progression or risk.
  • the present disclosure also provides a method of detecting the susceptibility of a mammal to certain diseases.
  • the method can be used to detect the susceptibility of a mammal to diseases which progress based on the amount of CCR2 present on cells and/or the number of CCR2-positive cells in a mammal.
  • Polypeptide sequences are indicated using standard one- or three-letter abbreviations. Unless otherwise indicated, each polypeptide sequence has amino termini at the left and a carboxy termini at the right; each single-stranded nucleic acid sequence, and the top strand of each double-stranded nucleic acid sequence, has a 5' termini at the left and a 3' termini at the right. A particular polypeptide sequence also can be described by explaining how it differs from a reference sequence.
  • CCR2 inhibitor and " CCR2 antagonist” are used interchangeably. Each is a molecule that detectably inhibits at least one function of CCR2. Conversely, a “CCR2 agonist” is a molecule that detectably increases at least one function of CCR2. The inhibition caused by a CCR2 inhibitor need not be complete so long as it is detectable using an assay. Any assay of a function of CCR2 can be used, examples of which are provided herein.
  • CCR2 Examples of functions of CCR2 that can be inhibited by a CCR2 inhibitor, or increased by a CCR2agonist, include cancer cell growth or apoptosis (programmed cell death), and so on.
  • types of CCR2 inhibitors and CCR2 agonists include, but are not limited to, CCR2 binding polypeptides such as antigen binding proteins (e.g., CCR2 inhibiting antigen binding proteins), antibodies, antibody fragments, and antibody derivatives.
  • peptide each refers to a molecule comprising two or more amino acid residues joined to each other by peptide bonds. These terms encompass, e.g., native and artificial proteins, protein fragments and polypeptide analogs (such as muteins, variants, and fusion proteins) of a protein sequence as well as post-translationally, or otherwise covalently or non-covalently, modified proteins.
  • a peptide, polypeptide, or protein may be monomelic or polymeric.
  • a "variant" of a polypeptide comprises an amino acid sequence wherein one or more amino acid residues are inserted into, deleted from and/or substituted into the amino acid sequence relative to another polypeptide sequence.
  • Disclosed variants include, for example, fusion proteins.
  • a “derivative" of a polypeptide is a polypeptide (e.g., an antibody) that has been chemically modified, e.g., via conjugation to another chemical moiety (such as, for example, polyethylene glycol or albumin, e.g., human serum albumin), phosphorylation, and glycosylation.
  • another chemical moiety such as, for example, polyethylene glycol or albumin, e.g., human serum albumin
  • phosphorylation phosphorylation
  • glycosylation e.g., glycosylation
  • the term “antibody” includes, in addition to antibodies comprising two full-length heavy chains and two full-length light chains, derivatives, variants, fragments, and muteins thereof, examples of which are described below.
  • an "antigen binding protein” is a protein comprising a portion that binds to an antigen and, optionally, a scaffold or framework portion that allows the antigen binding portion to adopt a conformation that promotes binding of the antigen binding protein to the antigen.
  • antigen binding proteins include antibodies, antibody fragments (e.g., an antigen binding portion of an antibody), antibody derivatives, and antibody analogs.
  • the antigen binding protein can comprise, for example, an alternative protein scaffold or artificial scaffold with grafted CDRs or CDR derivatives.
  • Such scaffolds include, but are not limited to, antibody-derived scaffolds comprising mutations introduced to, for example, stabilize the three-dimensional structure of the antigen binding protein as well as wholly synthetic scaffolds comprising, for example, a biocompatible polymer.
  • PAMs peptide antibody mimetics
  • An antigen binding protein can have, for example, the structure of a naturally occurring immunoglobulin.
  • An "immunoglobulin” is a tetrameric molecule. In a naturally occurring immunoglobulin, each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light” (about 25 kDa) and one "heavy" chain (about 50-70 kDa).
  • the amino- terminal portion of each chain includes a variable region of about 100 to 1 10 or more amino acids primarily responsible for antigen recognition.
  • the carboxy-terminal portion of each chain defines a constant region primarily responsible for effector function. Human light chains are classified as kappa or lambda light chains.
  • Heavy chains are classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively.
  • the anti-CCR2 antibodies disclosed herein are characterized by their variable domain region sequences in the heavy VH and light VL amino acid sequences.
  • the preferred antibody is A6 which is a kappa IgG antibody.
  • the variable and constant regions are joined by a "J" region of about 12 or more amino acids, with the heavy chain also including a "D" region of about 10 more amino acids. See generally, Fundamental Immunology Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989)).
  • the variable regions of each light/heavy chain pair form the antibody binding site such that an intact immunoglobulin has two binding sites.
  • a “multi-specific antibody” is an antibody that recognizes more than one epitope on one or more antigens.
  • a subclass of this type of antibody is a "bi-specific antibody” which recognizes two distinct epitopes on the same or different antigens.
  • An antigen binding protein "specifically binds" to an antigen (e.g., human CCR2) if it binds to the antigen with a dissociation constant of 1 nanomolar or less.
  • An "antigen binding domain, "antigen binding region,” or “antigen binding site” is a portion of an antigen binding protein that contains amino acid residues (or other moieties) that interact with an antigen and contribute to the antigen binding protein's specificity and affinity for the antigen. For an antibody that specifically binds to its antigen, this will include at least part of at least one of its CDR domains.
  • An “epitope” is the portion of a molecule that is bound by an antigen binding protein (e.g., by an antibody).
  • An epitope can comprise non-contiguous portions of the molecule (e.g., in a polypeptide, amino acid residues that are not contiguous in the polypeptide's primary sequence but that, in the context of the polypeptide's tertiary and quaternary structure, are near enough to each other to be bound by an antigen binding protein).
  • the "percent homology" of two polynucleotide or two polypeptide sequences is determined by comparing the sequences using the GAP computer program (a part of the GCG Wisconsin Package, version 10.3 (Accelrys, San Diego, Calif.)) using its default parameters.
  • a "host cell” is a cell that can be used to express a nucleic acid.
  • a host cell can be a prokaryote, for example, E. coli, or it can be a eukaryote, for example, a single-celled eukaryote (e.g., a yeast or other fungus), a plant cell (e.g., a tobacco or tomato plant cell), an animal cell (e.g., a human cell, a monkey cell, a hamster cell, a rat cell, a mouse cell, or an insect cell) or a hybridoma.
  • a prokaryote for example, E. coli
  • a eukaryote for example, a single-celled eukaryote (e.g., a yeast or other fungus)
  • a plant cell e.g., a tobacco or tomato plant cell
  • an animal cell e.g., a human cell,
  • host cells examples include the COS-7 line of monkey kidney cells (ATCC CRL 1651) (Gluzman et al., 1981, Cell 23: 175), L cells, C127 cells, 3T3 cells (ATCC CCL 163), Chinese hamster ovary (CHO) cells or their derivatives such as Veggie CHO and related cell lines which grow in serum-free media (Rasmussen et al., 1998, Cytotechnology 28:31) or CHO strain DX-B 11, which is deficient in DHFR (Urlaub et al., 1980, Proc. Natl. Acad. Sci.
  • COS-7 line of monkey kidney cells ATCC CRL 1651
  • L cells C127 cells
  • 3T3 cells ATCC CCL 163
  • CHO Chinese hamster ovary
  • HeLa cells derived from the African green monkey kidney cell line CV1 (ATCC CCL 70) (McMahan et al., 1991, EMBO J. 10:2821), human embryonic kidney cells such as 293,293 EBNA or MSR 293, human epidermal A431 cells, human Colo205 cells, other transformed primate cell lines, normal diploid cells, cell strains derived from in vitro culture of primary tissue, primary explants, HL-60, U937, HaK or Jurkat cells.
  • CV1/EBNA cell line derived from the African green monkey kidney cell line CV1 (ATCC CCL 70) (McMahan et al., 1991, EMBO J. 10:2821)
  • human embryonic kidney cells such as 293,293 EBNA or MSR 293, human epidermal A431 cells
  • human Colo205 cells other transformed primate cell lines, normal diploid cells, cell strains derived from in vitro culture of primary tissue, primary explants, HL-60, U937, HaK
  • a host cell is a cultured cell that can be transformed or transfected with a polypeptide-encoding nucleic acid, which can then be expressed in the host cell.
  • the phrase "recombinant host cell” can be used to denote a host cell that has been transformed or transfected with a nucleic acid to be expressed.
  • a host cell also can be a cell that comprises the nucleic acid but does not express it at a desired level unless a regulatory sequence is introduced into the host cell such that it becomes operably linked with the nucleic acid. It is understood that the term host cell refers not only to the particular subject cell but also to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to, e.g., mutation or environmental influence, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term as used herein.
  • Antigen binding proteins ⁇ e.g., antibodies, antibody fragments, antibody derivatives, antibody muteins, and antibody variants) are polypeptides that bind to CCR2, (preferably, human CCR2). Antigen binding proteins include antigen binding proteins that inhibit a biological activity of CCR2.
  • Oligomers that contain one or more antigen binding proteins may be employed as oligomers.
  • Oligomers may be in the form of covalently-linked or non-covalently- linked dimers, trimers, or higher oligomers. Oligomers comprising two or more antigen binding protein are contemplated for use, with one example being a homodimer. Other oligomers include heterodimers, homotrimers, heterotrimers, homotetramers, heterotetramers, etc.
  • One embodiment is directed to oligomers comprising multiple antigen binding proteins joined via covalent or non-covalent interactions between peptide moieties fused to the antigen binding proteins.
  • Such peptides may be peptide linkers (spacers), or peptides that have the property of promoting oligomerization.
  • Leucine zippers and certain polypeptides derived from antibodies are among the peptides that can promote oligomerization of antigen binding proteins attached thereto, as described in more detail below.
  • the oligomers comprise from two to four antigen binding proteins.
  • the antigen binding proteins of the oligomer may be in any form, such as any of the forms described above, e.g., variants or fragments.
  • the oligomers comprise antigen binding proteins that have CCR2 binding activity.
  • an oligomer is prepared using polypeptides derived from immunoglobulins. Preparation of Fusion Proteins Comprising Certain Heterologous
  • One embodiment is directed to a dimer comprising two fusion proteins created by fusing a CCR2 binding fragment of an anti- CCR2 antibody to the Fc region of an antibody.
  • the dimer can be made by, for example, inserting a gene fusion encoding the fusion protein into an appropriate expression vector, expressing the gene fusion in host cells transformed with the recombinant expression vector, and allowing the expressed fusion protein to assemble much like antibody molecules, whereupon interchain disulfide bonds form between the Fc moieties to yield the dimer.
  • Fc polypeptide includes native and mutein forms of polypeptides derived from the Fc region of an antibody. Truncated forms of such polypeptides containing the hinge region that promotes dimerization also are included. Fusion proteins comprising Fc moieties (and oligomers formed therefrom) offer the advantage of facile purification by affinity chromatography over Protein A or Protein G columns.
  • Leucine zipper domains are peptides that promote oligomerization of the proteins in which they are found.
  • Leucine zippers were originally identified in several DNA- binding proteins (Landschulz et al., 1988, Science 240: 1759), and have since been found in a variety of different proteins.
  • leucine zippers are naturally occurring peptides and derivatives thereof that dimerize or trimerize.
  • leucine zipper domains suitable for producing soluble oligomeric proteins are described in WO 94/10308, and the leucine zipper derived from lung surfactant protein D (SPD) described in Hoppe et al., 1994, FEBS Letters 344: 191.
  • SPD lung surfactant protein D
  • the use of a modified leucine zipper that allows for stable trimerization of a heterologous protein fused thereto is described in Fanslow et al., 1994, Semin. Immunol. 6:267- 78.
  • recombinant fusion proteins comprising an anti- CCR2 antibody fragment or derivative fused to a leucine zipper peptide are expressed in suitable host cells, and the soluble oligomeric anti- CCR2 antibody fragments or derivatives that form are recovered from the culture supernatant.
  • Antigen-binding fragments of antigen binding proteins of the invention may be produced by conventional techniques. Examples of such fragments include, but are not limited to, Fab and F(ab')2 fragments.
  • Monoclonal antibodies may be produced using any technique known in the art, e.g., by immortalizing spleen cells harvested from the transgenic animal after completion of the immunization schedule.
  • the spleen cells can be immortalized using any technique known in the art, e.g., by fusing them with myeloma cells to produce hybridomas.
  • Myeloma cells for use in hybridoma- producing fusion procedures preferably are non-antibody-producing, have high fusion efficiency, and enzyme deficiencies that render them incapable of growing in certain selective media which support the growth of only the desired fused cells (hybridomas).
  • Examples of suitable cell lines for use in mouse fusions include Sp-20, P3-X63/Ag8, P3-X63-Ag8.653, NS l/l .Ag 4 1, Sp210-Agl4, FO, NSO/U, MPC- 1 1 , MPC1 1 -X45-GTG 1.7 and S 194/5XX0 Bui; examples of cell lines used in rat fusions include R210.RCY3, Y3-Ag 1.2.3, IR983F and 48210.
  • Other cell lines useful for cell fusions are U-266, GM1500-GRG2, LICR-LON-HMy2 and UC729-6.
  • Antigen binding proteins directed against CCR2 can be used, for example, in assays to detect the presence of CCR2 polypeptides, either in vitro or in vivo.
  • the antigen binding proteins also may be employed in purifying CCR2 proteins by immunoaffinity
  • Blocking antigen binding proteins can be used in the methods disclosed herein. Such antigen binding proteins that function as CCR2 antagonists may be employed in treating any CCR2-induced condition, including but not limited to various cancers.
  • Antigen binding proteins may be employed in an in vitro procedure, or administered in vivo to inhibit CCR2-induced biological activity. Disorders caused or exacerbated (directly or indirectly) by the proteolytic activation of CCR2, examples of which are provided herein, thus may be treated.
  • the present invention provides a therapeutic method comprising in vivo administration of a CCR2 blocking antigen binding protein to a mammal in need thereof in an amount effective for reducing an CCR2-induced biological activity.
  • Antigen binding proteins include fully human monoclonal antibodies that inhibit a biological activity of CCR2.
  • Antigen binding proteins may be prepared by any of a number of conventional techniques. For example, they may be purified from cells that naturally express them (e.g., an antibody can be purified from a hybridoma that produces it), or produced in recombinant expression systems, using any technique known in the art. See, for example, Monoclonal Antibodies, Hybridomas: A New Dimension in Biological Analyses, Kennet et al. (eds.), Plenum Press, New York (1980); and Antibodies: A Laboratory Manual, Harlow and Land (eds.), Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., ( 1988).
  • any expression system known in the art can be used to make the recombinant polypeptides of the invention.
  • host cells are transformed with a recombinant expression vector that comprises DNA encoding a desired polypeptide.
  • the host cells that may be employed are prokaryotes, yeast or higher eukaryotic cells.
  • Prokaryotes include gram negative or gram positive organisms, for example E. coli or bacilli.
  • Higher eukaryotic cells include insect cells and established cell lines of mammalian origin.
  • suitable mammalian host cell lines include the COS-7 line of monkey kidney cells (ATCC CRL 1651) (Gluzman et al., 1981, Cell 23: 175), L cells, 293 cells, C127 cells, 3T3 cells (ATCC CCL 163), Chinese hamster ovary (CHO) cells, HeLa cells, BH (ATCC CRL 10) cell lines, and the CVl/EBNA cell line derived from the African green monkey kidney cell line CV l (ATCC CCL 70) as described by McMahan et al., 1991 , EMBO J. 10: 2821.
  • the transformed cells can be cultured under conditions that promote expression of the polypeptide, and the polypeptide recovered by conventional protein purification procedures.
  • One such purification procedure includes the use of affinity chromatography, e.g., over a matrix having all or a portion (e.g., the extracellular domain) of CCR2 bound thereto.
  • Polypeptides contemplated for use herein include substantially homogeneous recombinant mammalian anti- CCR2 antibody polypeptides substantially free of contaminating endogenous materials.
  • Antigen binding proteins may be prepared, and screened for desired properties, by any of a number of known techniques. Certain of the techniques involve isolating a nucleic acid encoding a polypeptide chain (or portion thereof) of an antigen binding protein of interest (e.g., an anti- CCR2 antibody), and manipulating the nucleic acid through recombinant DNA technology.
  • the nucleic acid may be fused to another nucleic acid of interest, or altered (e.g., by mutagenesis or other conventional techniques) to add, delete, or substitute one or more amino acid residues, for example.
  • Single chain antibodies may be formed by linking heavy and light chain variable domain (Fv region) fragments via an amino acid bridge (short peptide linker), resulting in a single polypeptide chain.
  • Fv region heavy and light chain variable domain
  • short peptide linker short peptide linker
  • Such single-chain Fvs have been prepared by fusing DNA encoding a peptide linker between DNAs encoding the two variable domain polypeptides (VL and VH).
  • the resulting polypeptides can fold back on themselves to form antigen-binding monomers, or they can form multimers (e.g., dimers, trimers, or tetramers), depending on the length of a flexible linker between the two variable domains (Kortt et al., 1997, Prot. Eng.
  • IgG antibodies may be derived from an IgM antibody, for example, and vice versa.
  • Such techniques allow the preparation of new antibodies that possess the antigen-binding properties of a given antibody (the parent antibody), but also exhibit biological properties associated with an antibody isotype or subclass different from that of the parent antibody.
  • Recombinant DNA techniques may be employed. Cloned DNA encoding particular antibody polypeptides may be employed in such procedures, e.g., DNA encoding the constant domain of an antibody of the desired isotype (Lantto et al., 2002, Methods Mol. Biol.
  • IgG4 it may also be desired to introduce a point mutation (CPSCP->CPPCP) in the hinge region (Bloom et al., 1997, Protein Science 6:407) to alleviate a tendency to form intra-H chain disulfide bonds that can lead to heterogeneity in the IgG4 antibodies.
  • CPSCP->CPPCP point mutation
  • antigen binding proteins of the present invention have a binding affinity (K a ) for CCR2 of at least 10 6 .
  • the antigen binding proteins exhibit a K a of at least 10 7 , at least 10 8 , at least 10 9 , or at least 10 !0 .
  • the antigen binding protein exhibits a a substantially the same as that of an antibody described herein in the Examples.
  • the present disclosure provides an antigen binding protein that has a low dissociation rate from CCR2.
  • the antigen binding protein has a Koff of 1 X 10"* to " ' or lower.
  • the Koff is 5 X 10 "5 to " ' or lower.
  • the Koff is substantially the same as an antibody described herein.
  • the antigen binding protein binds to CCR2 with substantially the same Koff as an antibody described herein.
  • the present disclosure provides an antigen binding protein that inhibits an activity of CCR2.
  • the antigen binding protein has an IC 5 o of 1000 nM or lower.
  • the IC50 is 100 nM or lower; in another embodiment, the IC50 is 10 nM or lower.
  • the IC5 is substantially the same as that of an antibody described herein in the Examples.
  • the antigen binding protein inhibits an activity of CCR2 with substantially the same IC50 as an antibody described herein.
  • the present disclosure provides an antigen binding protein that binds to human CCR2 expressed on the surface of a cell and, when so bound, inhibits CCR2 signaling activity in the cell without causing a significant reduction in the amount of CCR2 on the surface of the cell. Any method for determining or estimating the amount of CCR2 on the surface and/or in the interior of the cell can be used. In other embodiments, binding of the antigen binding protein to the CCR2-expressing cell causes less than about 75%, 50%, 40%, 30%, 20%, 15%, 10%, 5%, 1%, or 0.1 % of the cell-surface CCR2 to be internalized.
  • the present disclosure provides an antigen binding protein having a half-life of at least one day in vitro or in vivo (e.g., when administered to a human subject).
  • the antigen binding protein has a half-life of at least three days.
  • the antigen binding protein has a half-life of four days or longer.
  • the antigen binding protein has a half-life of eight days or longer.
  • the antigen binding protein is derivatized or modified such that it has a longer half-life as compared to the underivatized or unmodified antigen binding protein.
  • the antigen binding protein contains one or more point mutations to increase serum half life, such as described in WO00/09560, incorporated by reference herein.
  • bispecific antigen binding protein e.g., antigen binding protein that bind to two different epitopes of CCR2, or to an epitope of CCR2 and an epitope of another molecule, via two different antigen binding sites or regions.
  • bispecific antigen binding protein as disclosed herein can comprise a CCR2 binding site from one of the herein-described antibodies and a second CCR2 binding region from another of the herein-described antibodies, including those described herein by reference to other publications.
  • a bispecific antigen binding protein may comprise an antigen binding site from one of the herein described antibodies and a second antigen binding site from another CCR2 antibody that is known in the art, or from an antibody that is prepared by known methods or the methods described herein.
  • bispecific antibodies Numerous methods of preparing bispecific antibodies are known in the art. Such methods include the use of hybrid-hybridomas as described by Milstein et al., 1983, Nature 305:537, and chemical coupling of antibody fragments (Brennan et al., 1985, Science 229:81 ; Glennie et al., 1987, J. Immunol. 139:2367; U.S. Patent 6,010,902).
  • bispecific antibodies can be produced via recombinant means, for example by using leucine zipper moieties (i.e., from the Fos and Jun proteins, which preferentially form heterodimers; Kostelny et al., 1992, J. Immunol. 148: 1547) or other lock and key interactive domain structures as described in U.S. Patent 5,582,996. Additional useful techniques include those described in U.S. Patents 5,959,083; and 5,807,706.
  • the antigen binding protein comprises a derivative of an antibody.
  • the derivatized antibody can comprise any molecule or substance that imparts a desired property to the antibody, such as increased half-life in a particular use.
  • the derivatized antibody can comprise, for example, a detectable (or labeling) moiety (e.g., a radioactive, colorimetric, antigenic or enzymatic molecule, a detectable bead (such as a magnetic or electrodense (e.g., gold) bead), or a molecule that binds to another molecule (e.g., biotin or streptavidin), a therapeutic or diagnostic moiety (e.g., a radioactive, cytotoxic, or
  • an antibody e.g., a pharmaceutically active moiety
  • a molecule that increases the suitability of the antibody for a particular use e.g., administration to a subject, such as a human subject, or other in vivo or in vitro uses.
  • molecules that can be used to derivatize an antibody include albumin (e.g., human serum albumin) and polyethylene glycol (PEG).
  • Albumin-linked and PEGylated derivatives of antibodies can be prepared using techniques well known in the art.
  • the antibody is conjugated or otherwise linked to transthyretin (TTR) or a TTR variant.
  • TTR transthyretin
  • the TTR or TTR variant can be chemically modified with, for example, a chemical selected from the group consisting of dextran, poly(n-vinyl pyurrolidone), polyethylene glycols, propropylene glycol homopolymers, polypropylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols and polyvinyl alcohols.
  • the present disclosure provides methods of treating a subject.
  • the method can, for example, have a generally salubrious effect on the subject, e.g., it can increase the subject's expected longevity.
  • the method can, for example, treat, prevent, cure, relieve, or ameliorate ("treat") a disease, disorder, condition, or illness ("a condition").
  • a condition a disease, disorder, condition, or illness
  • the conditions to be treated are conditions characterized by inappropriate expression or activity of CCR2.
  • the expression or activity level is too high, and the treatment comprises administering a CCR2 antagonist as described herein.
  • the disorders or conditions are cancer-related.
  • those cancers include, but are not limited to, lung, ovarian and colon carcinoma and various myelomas.
  • Specific medical conditions and diseases that are treatable or preventable with the antigen binding proteins of this disclosure include various cancers.
  • Certain methods provided herein comprise administering a CCR2 binding antigen binding protein to a subject, thereby reducing a CCR2-induced biological response that plays a role in a particular condition.
  • methods of the invention involve contacting endogenous CCR2 with a CCR2 binding antigen binding protein, e.g., via administration to a subject or in an ex vivo procedure.
  • treatment encompasses alleviation or prevention of at least one symptom or other aspect of a disorder, or reduction of disease severity, and the like.
  • An antigen binding protein need not effect a complete cure, or eradicate every symptom or manifestation of a disease, to constitute a viable therapeutic agent.
  • drugs employed as therapeutic agents may reduce the severity of a given disease state, but need not abolish every manifestation of the disease to be regarded as useful therapeutic agents.
  • a prophylactically administered treatment need not be completely effective in preventing the onset of a condition in order to constitute a viable prophylactic agent.
  • Simply reducing the impact of a disease for example, by reducing the number or severity of its symptoms, or by increasing the effectiveness of another treatment, or by producing another beneficial effect), or reducing the likelihood that the disease will occur or worsen in a subject, is sufficient.
  • One embodiment of the invention is directed to a method comprising
  • a CCR2 antagonist in an amount and for a time sufficient to induce a sustained improvement over baseline of an indicator that reflects the severity of the particular disorder.
  • compositions comprising the antibodies and fragments thereof of the disclosure are administered to a subject in a manner appropriate to the indication.
  • Pharmaceutical compositions may be administered by any suitable technique, including but not limited to, parenterally, topically, or by inhalation. If injected, the pharmaceutical composition can be administered, for example, via intra-articular, intravenous, intramuscular, intralesional, intraperitoneal or subcutaneous routes, by bolus injection, or continuous infusion. Localized administration, e.g. at a site of disease or injury is contemplated, as are transdermal delivery and sustained release from implants.
  • Delivery by inhalation includes, for example, nasal or oral inhalation, use of a nebulizer, inhalation of the antagonist in aerosol form, and the like.
  • Other alternatives include eyedrops; oral preparations including pills, syrups, lozenges or chewing gum; and topical preparations such as lotions, gels, sprays, and ointments.
  • antigen binding proteins in ex vivo procedures also is contemplated.
  • a patient's blood or other bodily fluid may be contacted with an antigen binding protein that binds CCR2 ex vivo.
  • the antigen binding protein may be bound to a suitable insoluble matrix or solid support material.
  • antigen binding proteins are administered in the form of a composition comprising one or more additional components such as a physiologically acceptable carrier, excipient or diluent.
  • the composition additionally comprises one or more physiologically active agents, for example, a second inflammation- or immune- inhibiting substance, an anti-angiogenic substance, an analgesic substance, etc., non-exclusive examples of which are provided herein.
  • the composition comprises one, two, three, four, five, or six physiologically active agents in addition to a CCR2 binding antigen binding protein
  • the present disclosure provides a method of treating a subject with a CCR2 inhibiting antigen binding protein and one or more other treatments.
  • such a combination therapy achieves synergy or an additive effect by, for example, attacking multiple sites or molecular targets in a tumor.
  • Types of combination therapies that can be used in connection with the present invention include inhibiting or activating (as appropriate) multiple nodes in a single disease-related pathway, multiple pathways in a target cell, and multiple cell types within a target tissue.
  • a combination therapy method comprises administering to the subject two, three, four, five, six, or more of the CCR2 agonists or antagonists described herein.
  • the method comprises administering to the subject two or more treatments that together inhibit or activate (directly or indirectly) CCR2-mediated signal transduction. Examples of such methods include using combinations of two or more CCR2 inhibiting antigen binding proteins, of a CCR2 inhibiting antigen binding protein and one or more other therapeutic moiety having anti-cancer properties (for example, cytotoxic agents, and/or immunomodulators), or of a CCR2 inhibiting antigen binding protein and one or more other treatments (e.g., surgery, or radiation).
  • one or more anti- CCR2 antibodies or antibody derivatives can be used in combination with one or more molecules or other treatments, wherein the other molecule(s) and/or treatment(s) do not directly bind to or affect CCR2, but which combination is effective for treating or preventing the condition being treated.
  • one or more of the molecule(s) and/or treatment(s) treats or prevents a condition that is caused by one or more of the other molecule(s) or treatment(s) in the course of therapy, e.g., nausea, fatigue, alopecia, cachexia, insomnia, etc.
  • the individual molecule(s) and/or treatment(s) can be administered in any order, over any length of time, which is effective, e.g., simultaneously, consecutively, or alternately.
  • the method of treatment comprises completing a first course of treatment with one molecule or other treatment before beginning a second course of treatment.
  • the length of time between the end of the first course of treatment and beginning of the second course of treatment can be any length of time that allows the total course of therapy to be effective, e.g., seconds, minutes, hours, days, weeks, months, or even years.
  • the method comprises administering one or more of the CCR2 antagonists described herein and one or more other treatments (e.g., a therapeutic or palliative treatment).
  • a method comprises administering more than one treatment to a subject, it is to be understood that the order, timing, number, concentration, and volume of the
  • administrations is limited only by the medical requirements and limitations of the treatment, i.e., two treatments can be administered to the subject, e.g., simultaneously, consecutively, alternately, or according to any other regimen.
  • This example shows a cellular binding assay to determine the EC5 0 for anti-CCR2 antibodies.
  • the data in Figure 1 illustrates in vitro data for cellular binding EC 50
  • This example shows the binding characteristics for these antibodies in terms of the maximal cell binding and the concentration at which 50% binding saturation (EC5 0 ) is reached.
  • CHO -CCR2 cells were lifted from culture flasks using non- enzymatic Cell Dissociation Buffer - PBS based (Life Technologies #13151-014). Cells were resuspended in FACS Buffer (2% Fetal Bovine Serum in PBS) at 1 x 10 6 cells/ml and 100 ⁇ (1 x 10 5 cells) were aliquoted into the wells of a 96-well plate. Plated cells were spun down and the supernatant discarded.
  • FACS Buffer 2% Fetal Bovine Serum in PBS
  • Example 2 shows in vitro data for cellular binding ECs 0 measurements of anti-CCR2 antibodies against murine CCR2. This example shows whether these antibodies directed against human CCR2 can cross react with murine CCR2 as well as demonstrating the binding characteristic for these antibodies in terms of the maximal cell binding and the concentration at which 50% binding saturation (EC5 0 ) is reached.
  • WEHI 274.1 cells were resuspended in FACS Buffer (2% Fetal Bovine Serum in PBS) at 1 x 10 6 cells and 50 ⁇ (1 x 10 s cells) of cell suspension was aliquoted into the wells of a 96-well plate. Plated cells were spun down and the supernatant discarded.
  • This example shows a calcium influx assay on THP-1 cells (human monocyte cell line).
  • THP-1 cells human monocyte cell line.
  • MCP-1 induced THP-1 calcium flux assay To measure IC50 of Dl on MCP-1 induced THP-1 calcium mobilization, we first set up a MCP-1 induced THP-1 calcium flux assay to determine EC50 of MCP-1. Under the assay conditions used for measuring EC50 of MCP- 1 described in the methods (calcium influx assay), EC50 value 3.3 nM on MCP- l -induced calcium flux was obtained. We then used 10 nM of human MCP- 1 (PROSPEC # CHM-271 ) (about EC 80 ) to conducted a calcium flux assay for determination of Dl IC50 on MCP- 1 induced THP-1 calcium mobilization.
  • This example provides primary human monocytes to measure IC50 of Dl on MCP- 1 induced primary human monocyte calcium mobilization.
  • MCP- 1 induced primary human monocyte calcium flux assay was set up using a FLIPR calcium 4 assay kit and changes in intracellular Ca 2+ were measured with a FlexStation3 scanning fluorometer (Molecular Devices, Sunnyvale, CA).
  • THP-1 cells or primary human monocytes in 25 of assay buffer (HBSS + 20 mM HEPES) were loaded into a Poly-D-Lysine coated 384-well black wall, clear-bottom assay plate (Greiner) together with 25 ⁇ of FLIPR calcium 4 assay kit (R8142, Molecular Devices) containing probenecid 3 mM ( final in- well working
  • This example shows a chemotaxis assay using THP-1 (human monocyte cell line) to measure the IC50 of Dl on MCP-1 induced THP-1 cell migration.
  • THP-1 human monocyte cell line
  • Chemotaxis assays were set up using 96-well chemotaxis chamber (ChemoTX;
  • Membrane was aligned with wells and snapped into place. THP-1 or primary human monocyte cells resuspended in 25 ⁇ of the assay buffer were added to the upper chamber wells. The lid was replaced and the plate is incubated at 37 °C 5% CO 2 . After the incubation, the non- migrated cells remaining on the upper side of the membrane were blotted by filter paper and the membrane was detached from microplate and cell number in each well of the lower chamber was counted with Cedex. MCP-1 induced dose dependent curve and EC50 value of MCP-1 was calculated by Prism5.
  • This example provides an IC50 assay of Dl on MCP-1 induced primary human monocyte migration.
  • a MCP- 1 induced primary human monocyte migration assay to determine EC50 of MCP- 1.
  • chemotaxis assay Under the assay condition used for measuring EC50 of MCP-1 described in the methods (chemotaxis assay).
  • EC50 value 0.389 nM on MCP-l-induced chemotaxis.
  • This example provides an IC50 determination of Dl on mMCP- 1 (mouse MCP-1 ) induced WEHI 274.1 (mouse monocyte cell line) cell migration assay.
  • mMCP- 1 mouse MCP-1
  • WEHI 274.1 mouse monocyte cell line
  • MLN1202 (Millennium) is a humanized monoclonal antibody with high specificity to CCR2, which interrupts MCP-1 binding to CCR2. MLN1202 is being evaluated in clinical trials.
  • CCR2 chemokines MCP-1, MCP-2, MCP-3, MCP-4 and MCP-5) on induced THP-1 cell migration.
  • Chemotaxis assays were set up using 96-well chemotaxis chamber (ChemoTX;
  • the cells were incubated with different doses of Dl in the assay buffer for 20 min at room temperature prior to adding cells in 25 ⁇ of the assay buffer to the upper chamber wells and one concentration of MCP- 1 (around the ECso) was added to the lower compartment.
  • Other procedures were the same as the ones in the above EC50
  • IC 50 values of Dl and MLN1202 are indicated in Figures 8 A, 8B, 8C, 8D and 8E.
  • a comparison of the IC50 values is shown in Table 3 below.
  • EAE autoimmune encephalomyelitis
  • This example provides cellular binding IC50 for antibodies 1G11, 1B2 and 1H5.
  • the chemotaxis assay methods used for these antibodies were the same as the ones used for Dl.
  • To measure the IC50 of the antibodies on MCPs induced THP-1 cell migration we first set up the THP-1 cell migration assay to determine EC 50 of the MCP ligands. Under the assay condition used for measuring the EC5 0 of MCP-1 described above (chemotaxis assay), an EC5 0 value was determined (data not showed).
  • IC 50 of 1G1 lagainst MCP-1 (3 nM) was 79 pM ( FigurelOA) and against MCP- 5 (6 ng/ml) was 261 pM ( Figure 10B).
  • IC 50 of 1B2 against MCP-1 (3 nM) was 87 pM ( Figure 11A) and against MCP-5 (3 nM) was 197 pM ( Figure 1 IB).
  • the IC 50 of 1H5 against MCP-1 (3 nM) was 109 pM ( Figure 12A) and against MCP-5 (6 ng/ml) was 349 pM ( Figure 12B).
  • 1H5 also demonstrated 1.9 nM IC 50 value against 30 ng/ml of MCP-2 ( Figure 2C), 2.6 nM IC 50 value against 6 ng/ml of MCP-3 ( Figure 12D) and 1.4 nM IC50 against 200 ng/ml of MCP-4 ( Figure 12E).
  • This example shows a chemotaxis assay using THP-1 (ATCC #TIB-202) cells, a human monocyte cell line.
  • the chemotaxis assays were set up using 96-well chemotaxis chamber (ChemoTX; NeuroProbe, Gaithersburg, MD) with 2 compartments separated by a 5- ⁇ polycarbonate membrane.
  • Serial diluted concentrations of mAbs were pre-incubated with THP-1 cells (O. lxlO 6 cells in 25 ⁇ of HBSS with 0.1% BSA) at room temperature for 20 min.
  • Ligands in HBSS with 0.1% BSA were loaded in the wells of plate in the lower chambers, whereas the pre-incubated cells with mAbs were loaded on top of the membrane.
  • the final concentration of ligands was 3 nM MCP-1 (PROSPEC # CHM-271), 6.7 nM of MCP-2 (PeproTech #300-15), 1.1 nM of MCP-3 (PeproTech #300-17), 35 nM of MCP-4 (PeproTech #300-24) and 0.65 nM of MCP-5 (PeproTech #250-04).
  • MCP-1 PROSPEC # CHM-271
  • 6.7 nM of MCP-2 PeproTech #300-15
  • 1.1 nM of MCP-3 PeproTech #300-17
  • 35 nM of MCP-4 PeproTech #300-24
  • 0.65 nM of MCP-5 PeproTech #250-04.
  • Migrated cells in each well of the plate in lower chamber were counted with Cedex XS cell counter (Innovatis, Roche) or transferred to an opaque white 96 well plate and treated with CellTiter GLo (Cat#G7571, Promega) for 10 min at room temperature.
  • Luminescent signals generated by CellTiter Glo were detected by a fluorescent plate reader (FlexStation3, Molecular Device). The IC50 value of each mAb indicated in the table was calculated by Prism5.
  • Results of the IC50 of the each mAb against corresponding ligand are indicated in Table 4.
  • MLN1202 (Takeda) was used as a control; it is a humanized monoclonal antibody with high specificity to CCR2 and interrupts MCP-1 binding to CCR2.
  • Disclosed mAbs (Dl, 1B2, 1G1 1 , Dl- 1 and D1H1/45H8L1) are human IgGl .
  • THP-1 cells 0.3xl0 5 cells in 25 ⁇ of the assay buffer HBSS plus 20 mM HEPES
  • 25 ⁇ of the pre-incubated cells were added to 25 ⁇ of Calcium 4 Assay kit (Molecular Device #R8142) including 5 mM probenecid (Sigma #P8761-25G) in a Poly-D-Lysine 384- well plate (Greiner #781946).
  • Table 5 show the IC50 of the each mAb against the corresponding ligand.
  • This example illustrates a chemotaxis assay with mouse WEHI cells.
  • WEHI- 274.1 (ATCC, CRL-1679), a mouse monocyte cell line was used in the chemotaxis assays.
  • the chemotaxis assays were set up using 96-well chemotaxis chamber (ChemoTX; NeuroProbe, Gaithersburg, MD) with 2 compartments separated by 8- ⁇ polycarbonate membrane.
  • Assay buffer used for chemotaxis was RPMI and HBSS at 1 : 1 ratio in volume plus 0.1 % BSA.
  • Serial diluted mAbs were pre-incubated with WEHI at O. lxlO 6 cells in 25 ⁇ of the assay buffer for 20 min at room temperature.
  • mice MCP- 1 (R&D, 479- JE) was loaded in the wells of plate in the lower chamber, whereas the pre-incubated cells with mAbs were loaded on top of membrane. After 2 h incubation at 37 °C, 5% CO2, migrated cells in the lower chamber were transferred to an opaque white 96 well plate and incubated with CellTiter GLo (Cat#G7571 , Promega) for 10 min at room temperature. Luminescent signals generated from the cells in each well were detected by a fluorescent plate reader (FlexStation3, Molecular Device). The IC50 value of each mAb indicated in Table 6 was calculated by Prism5.
  • Example 14 In this example, CHO-CCR2 cells were lifted from culture flasks using non-enzymatic Cell Dissociation Buffer - PBS based (Life Technologies #13151-014). Cells were resuspended in FACS Buffer (2% Fetal Bovine Serum in PBS) with sodium azide at 1 x 10 6 cells/ml and 800 ⁇ were aliquoted into a tube for each antibody. Antibody was added to a final concentration of 5 ⁇ and incubated at room temperature for lh. The samples were then placed on ice and a 105 ⁇ aliquot at various time points was added to 1 0 ⁇ FACS buffer in a 96-well plate and centnfuged for 3 min.
  • FACS Buffer 2% Fetal Bovine Serum in PBS
  • CHO-CCR2 cells were lifted from culture flasks using non-enzymatic Cell Dissociation Buffer - PBS based (Life Technologies #13151-014).
  • Cells were resuspended in FACS Buffer (2% Fetal Bovine Serum in PBS) at 1 x 10 6 cells/ml and 50 ⁇ (1 x 10 5 cells) were aliquoted into the wells of a 96-well plate.
  • Antibody was added at one or more concentrations (typically 5, 10 and/or 20 ⁇ g/ml). Plates were incubated for 1 hr at 4 °C, and then washed lx with FACS Buffer.
  • D1-2A CATGGFGYWGEGTLVTVSS SEQ ID NO. 9 VL SEQ ID NO. 16 QVQLVQSGAEVKKPGASVKVSCKASGYTFTGY QAGLTQPPSVSKGLRQTATLTCTGNSN H M HWVRQAPGQG LEWM G Wl N PNSGVTKYA NVGNQGAAWLQQHQGHPPKLLSYRN QKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVY HNRPSGISERFSASRSGNTASLTITGLQP YCATGSGGGTMDVWGEGTLVTVSS SEQ ID EDEADYYCLAWDSSLRAFVFGGGTQLT
  • E4 NO. 41 SEQ ID NO. 42 EVQLVQSGAEVKKPGASVKVSCKASGYTFTSYY DWMTQSPLSSPVTLGQPASISCKSSQT MHWVRQAPGRGLEWMGII NPSSGSTSYAQKF LVHNDGNSYLSWLHQRPGQPPRLLIYK QGRVTMTRDTSTSTVY ELSSLRSEDTAVYYCA VSNRFSGVPDRFSGSGAGTDFTLRIGRV RGQGTAIRAFDIWGQGTMVTVSS SEQ ID EAEDVGVYYCMQATQFPYTFGQGTKLE NO. 43 IK SEQ ID NO. 44

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Urology & Nephrology (AREA)
  • Cell Biology (AREA)
  • Diabetes (AREA)
  • Neurology (AREA)
  • Pulmonology (AREA)
  • Hematology (AREA)
  • Dermatology (AREA)
  • Neurosurgery (AREA)
  • Biomedical Technology (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Virology (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Obesity (AREA)
  • Oncology (AREA)
  • Cardiology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Reproductive Health (AREA)
  • Pain & Pain Management (AREA)
PCT/US2013/047192 2012-06-22 2013-06-21 Antigen binding proteins that bind ccr2 Ceased WO2013192596A2 (en)

Priority Applications (5)

Application Number Priority Date Filing Date Title
CA2877814A CA2877814A1 (en) 2012-06-22 2013-06-21 Antigen binding proteins that bind ccr2
HK15108907.8A HK1208236A1 (en) 2012-06-22 2013-06-21 Antigen binding proteins that bind ccr2
EP13807252.5A EP2864358B1 (en) 2012-06-22 2013-06-21 Antigen binding proteins that bind ccr2
CN201380043633.4A CN105051065A (zh) 2012-06-22 2013-06-21 与ccr2结合的抗原结合蛋白
JP2015518629A JP6438391B2 (ja) 2012-06-22 2013-06-21 Ccr2に結合する抗原結合タンパク質

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201261663496P 2012-06-22 2012-06-22
US61/663,496 2012-06-22

Publications (2)

Publication Number Publication Date
WO2013192596A2 true WO2013192596A2 (en) 2013-12-27
WO2013192596A3 WO2013192596A3 (en) 2014-04-03

Family

ID=49769736

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2013/047192 Ceased WO2013192596A2 (en) 2012-06-22 2013-06-21 Antigen binding proteins that bind ccr2

Country Status (7)

Country Link
US (3) US9315579B2 (https=)
EP (1) EP2864358B1 (https=)
JP (2) JP6438391B2 (https=)
CN (1) CN105051065A (https=)
CA (1) CA2877814A1 (https=)
HK (1) HK1208236A1 (https=)
WO (1) WO2013192596A2 (https=)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018195283A1 (en) 2017-04-19 2018-10-25 Elstar Therapeutics, Inc. Multispecific molecules and uses thereof
WO2019113464A1 (en) 2017-12-08 2019-06-13 Elstar Therapeutics, Inc. Multispecific molecules and uses thereof
WO2020069372A1 (en) 2018-09-27 2020-04-02 Elstar Therapeutics, Inc. Csf1r/ccr2 multispecific antibodies
WO2023072916A1 (en) 2021-10-27 2023-05-04 Granite Bio Ag Antibodies targeting ccr2
WO2024245988A1 (en) 2023-05-29 2024-12-05 Granite Bio Ag Antibodies targeting ccr2

Families Citing this family (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
BR112014013138B1 (pt) 2011-12-01 2022-06-28 Chemocentryx, Inc Compostos de anilinas substituídas como antagonistas de ccr(4) e composição farmacêutica compreendendo os mesmos
CN105050618B (zh) * 2012-06-21 2018-11-16 索伦托治疗有限公司 与c-Met结合的抗原结合蛋白
WO2013192596A2 (en) * 2012-06-22 2013-12-27 Sorrento Therapeutics Inc. Antigen binding proteins that bind ccr2
DK3297438T3 (da) 2015-05-21 2022-01-17 Chemocentryx Inc Ccr2-modulatorer
WO2017165125A1 (en) * 2016-03-24 2017-09-28 Millennium Pharmaceuticals, Inc. Use of a pd-1 antagonist and an anti-ccr2 antibody in the treatment of cancer
US20170348442A1 (en) 2016-06-02 2017-12-07 Washington University Compositions and methods for detecting ccr2 receptors
WO2018106945A1 (en) 2016-12-07 2018-06-14 Progenity Inc. Gastrointestinal tract detection methods, devices and systems
EP3554541B1 (en) 2016-12-14 2023-06-07 Biora Therapeutics, Inc. Treatment of a disease of the gastrointestinal tract with a chemokine/chemokine receptor inhibitor
CA3293051A1 (en) 2017-09-25 2026-03-02 Chemocentryx, Inc. Combination therapy using a chemokine receptor 2 (ccr2) antagonist and a pd-1/pd-l1 inhibitor
CN112105353B (zh) * 2018-01-08 2024-04-19 凯莫森特里克斯股份有限公司 Ccr2拮抗剂治疗实体瘤的方法
US20190269664A1 (en) 2018-01-08 2019-09-05 Chemocentryx, Inc. Methods of treating solid tumors with ccr2 antagonists
EP3833762A4 (en) 2018-08-09 2022-09-28 Verseau Therapeutics, Inc. Oligonucleotide compositions for targeting ccr2 and csf1r and uses thereof
EP3883635A1 (en) 2018-11-19 2021-09-29 Progenity, Inc. Methods and devices for treating a disease with biotherapeutics
CN115666704B (zh) 2019-12-13 2025-09-26 比特比德科有限责任公司 用于将治疗剂递送至胃肠道的可摄取装置
WO2024220548A2 (en) * 2023-04-17 2024-10-24 University Of Southern California Molecular-mri using ccr2-targeted micelles for detection of lymph node metastases
WO2025231346A1 (en) * 2024-05-03 2025-11-06 The Wistar Institute Of Anatomy And Biology Anti-interferon-alpha and anti-interferon-beta antibodies, and methods of use thereof

Citations (37)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3817827A (en) 1972-03-30 1974-06-18 Scott Paper Co Soft absorbent fibrous webs containing elastomeric bonding material and formed by creping and embossing
US3850752A (en) 1970-11-10 1974-11-26 Akzona Inc Process for the demonstration and determination of low molecular compounds and of proteins capable of binding these compounds specifically
US3901654A (en) 1971-06-21 1975-08-26 Biological Developments Receptor assays of biologically active compounds employing biologically specific receptors
US4002531A (en) 1976-01-22 1977-01-11 Pierce Chemical Company Modifying enzymes with polyethylene glycol and product produced thereby
US4098876A (en) 1976-10-26 1978-07-04 Corning Glass Works Reverse sandwich immunoassay
US4179337A (en) 1973-07-20 1979-12-18 Davis Frank F Non-immunogenic polypeptides
US4301144A (en) 1979-07-11 1981-11-17 Ajinomoto Company, Incorporated Blood substitute containing modified hemoglobin
US4496689A (en) 1983-12-27 1985-01-29 Miles Laboratories, Inc. Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer
US4640835A (en) 1981-10-30 1987-02-03 Nippon Chemiphar Company, Ltd. Plasminogen activator derivatives
US4670417A (en) 1985-06-19 1987-06-02 Ajinomoto Co., Inc. Hemoglobin combined with a poly(alkylene oxide)
US4791192A (en) 1986-06-26 1988-12-13 Takeda Chemical Industries, Ltd. Chemically modified protein with polyethyleneglycol
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
EP0473084A2 (en) 1990-08-28 1992-03-04 Sumitomo Pharmaceuticals Company, Limited Polyethylene glycol derivatives, their modified peptides, methods for producing them and use of the modified peptides
WO1994001451A2 (en) 1992-07-13 1994-01-20 Bionebraska, Inc. Method for modification of recombinant polypeptides
US5281698A (en) 1991-07-23 1994-01-25 Cetus Oncology Corporation Preparation of an activated polymer ester for protein conjugation
WO1994010308A1 (en) 1992-10-23 1994-05-11 Immunex Corporation Methods of preparing soluble, oligomeric proteins
US5382657A (en) 1992-08-26 1995-01-17 Hoffmann-La Roche Inc. Peg-interferon conjugates
US5582996A (en) 1990-12-04 1996-12-10 The Wistar Institute Of Anatomy & Biology Bifunctional antibodies and method of preparing same
US5766897A (en) 1990-06-21 1998-06-16 Incyte Pharmaceuticals, Inc. Cysteine-pegylated proteins
US5807706A (en) 1995-03-01 1998-09-15 Genentech, Inc. Method for making heteromultimeric polypeptides
US5824784A (en) 1994-10-12 1998-10-20 Amgen Inc. N-terminally chemically modified protein compositions and methods
US5877293A (en) 1990-07-05 1999-03-02 Celltech Therapeutics Limited CDR grafted anti-CEA antibodies and their production
US5886152A (en) 1991-12-06 1999-03-23 Sumitomo Pharmaceuticals Company, Limited Humanized B-B10
US5932462A (en) 1995-01-10 1999-08-03 Shearwater Polymers, Inc. Multiarmed, monofunctional, polymer for coupling to molecules and surfaces
WO1999046991A1 (en) 1998-03-17 1999-09-23 University Of Maryland Biotechnology Institute Methods for treating hiv-associated dementia
US5959083A (en) 1991-06-03 1999-09-28 Behringwerke Aktiengellschaft Tetravalent bispecific receptors, the preparation and use thereof
US6010902A (en) 1988-04-04 2000-01-04 Bristol-Meyers Squibb Company Antibody heteroconjugates and bispecific antibodies for use in regulation of lymphocyte activity
WO2000009560A2 (en) 1998-08-17 2000-02-24 Abgenix, Inc. Generation of modified molecules with increased serum half-lives
US6054297A (en) 1991-06-14 2000-04-25 Genentech, Inc. Humanized antibodies and methods for making them
US20020044921A1 (en) 2000-09-29 2002-04-18 Seoju Lee Pegylated interleukin-10
US20030039958A1 (en) 1999-12-03 2003-02-27 Domantis Limited Direct screening method
US6610281B2 (en) 1993-11-12 2003-08-26 Shearwater Corporation Water soluble activated polymers containing an active ethyl sulfone moiety for modification of surfaces and molecules
US20040009507A1 (en) 2000-10-13 2004-01-15 Domantis, Ltd. Concatenated nucleic acid sequence
US6696245B2 (en) 1997-10-20 2004-02-24 Domantis Limited Methods for selecting functional polypeptides
US20040202995A1 (en) 2003-04-09 2004-10-14 Domantis Nucleic acids, proteins, and screening methods
WO2004110376A2 (en) 2003-06-06 2004-12-23 Merck & Co., Inc. Ccr-2 antagonists for treatment of neuropathic pain
WO2010021697A2 (en) 2008-08-18 2010-02-25 Pfizer Inc. Antibodies to ccr2

Family Cites Families (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6312689B1 (en) 1998-07-23 2001-11-06 Millennium Pharmaceuticals, Inc. Anti-CCR2 antibodies and methods of use therefor
GB0016138D0 (en) 2000-06-30 2000-08-23 Novartis Ag Organic compounds
US20070021466A1 (en) 2002-11-18 2007-01-25 Solomon Ungashe CCR2 inhibitors and methods of use thereof
MXPA06000176A (es) * 2003-12-10 2006-06-27 Millennium Pharm Inc Anticuerpos anti-ccr2 humanizados y sus metodos de uso.
US20050260139A1 (en) * 2004-03-30 2005-11-24 Boehringer Ingelheim International Gmbh Pharmaceutical compositions based on anticholinergics and CCR2 receptor antagonists
CA2665808A1 (en) * 2006-10-05 2008-05-22 Centocor Ortho Biotech Inc. Ccr2 antagonists for treatment of fibrosis
WO2013192596A2 (en) * 2012-06-22 2013-12-27 Sorrento Therapeutics Inc. Antigen binding proteins that bind ccr2

Patent Citations (39)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3850752A (en) 1970-11-10 1974-11-26 Akzona Inc Process for the demonstration and determination of low molecular compounds and of proteins capable of binding these compounds specifically
US3901654A (en) 1971-06-21 1975-08-26 Biological Developments Receptor assays of biologically active compounds employing biologically specific receptors
US3817827A (en) 1972-03-30 1974-06-18 Scott Paper Co Soft absorbent fibrous webs containing elastomeric bonding material and formed by creping and embossing
US4179337A (en) 1973-07-20 1979-12-18 Davis Frank F Non-immunogenic polypeptides
US4002531A (en) 1976-01-22 1977-01-11 Pierce Chemical Company Modifying enzymes with polyethylene glycol and product produced thereby
US4098876A (en) 1976-10-26 1978-07-04 Corning Glass Works Reverse sandwich immunoassay
US4301144A (en) 1979-07-11 1981-11-17 Ajinomoto Company, Incorporated Blood substitute containing modified hemoglobin
US4640835A (en) 1981-10-30 1987-02-03 Nippon Chemiphar Company, Ltd. Plasminogen activator derivatives
US4496689A (en) 1983-12-27 1985-01-29 Miles Laboratories, Inc. Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer
US4670417A (en) 1985-06-19 1987-06-02 Ajinomoto Co., Inc. Hemoglobin combined with a poly(alkylene oxide)
US4791192A (en) 1986-06-26 1988-12-13 Takeda Chemical Industries, Ltd. Chemically modified protein with polyethyleneglycol
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
US6010902A (en) 1988-04-04 2000-01-04 Bristol-Meyers Squibb Company Antibody heteroconjugates and bispecific antibodies for use in regulation of lymphocyte activity
US5766897A (en) 1990-06-21 1998-06-16 Incyte Pharmaceuticals, Inc. Cysteine-pegylated proteins
US5877293A (en) 1990-07-05 1999-03-02 Celltech Therapeutics Limited CDR grafted anti-CEA antibodies and their production
EP0473084A2 (en) 1990-08-28 1992-03-04 Sumitomo Pharmaceuticals Company, Limited Polyethylene glycol derivatives, their modified peptides, methods for producing them and use of the modified peptides
US5582996A (en) 1990-12-04 1996-12-10 The Wistar Institute Of Anatomy & Biology Bifunctional antibodies and method of preparing same
US5959083A (en) 1991-06-03 1999-09-28 Behringwerke Aktiengellschaft Tetravalent bispecific receptors, the preparation and use thereof
US6054297A (en) 1991-06-14 2000-04-25 Genentech, Inc. Humanized antibodies and methods for making them
US5281698A (en) 1991-07-23 1994-01-25 Cetus Oncology Corporation Preparation of an activated polymer ester for protein conjugation
US5886152A (en) 1991-12-06 1999-03-23 Sumitomo Pharmaceuticals Company, Limited Humanized B-B10
WO1994001451A2 (en) 1992-07-13 1994-01-20 Bionebraska, Inc. Method for modification of recombinant polypeptides
US5382657A (en) 1992-08-26 1995-01-17 Hoffmann-La Roche Inc. Peg-interferon conjugates
WO1994010308A1 (en) 1992-10-23 1994-05-11 Immunex Corporation Methods of preparing soluble, oligomeric proteins
US6610281B2 (en) 1993-11-12 2003-08-26 Shearwater Corporation Water soluble activated polymers containing an active ethyl sulfone moiety for modification of surfaces and molecules
US5824784A (en) 1994-10-12 1998-10-20 Amgen Inc. N-terminally chemically modified protein compositions and methods
US5932462A (en) 1995-01-10 1999-08-03 Shearwater Polymers, Inc. Multiarmed, monofunctional, polymer for coupling to molecules and surfaces
US5807706A (en) 1995-03-01 1998-09-15 Genentech, Inc. Method for making heteromultimeric polypeptides
US6846634B1 (en) 1997-10-20 2005-01-25 Domantis Limited Method to screen phage display libraries with different ligands
US6696245B2 (en) 1997-10-20 2004-02-24 Domantis Limited Methods for selecting functional polypeptides
US20040038291A2 (en) 1997-10-20 2004-02-26 Domantis Limited Method to screen phage display libraries with different ligands
WO1999046991A1 (en) 1998-03-17 1999-09-23 University Of Maryland Biotechnology Institute Methods for treating hiv-associated dementia
WO2000009560A2 (en) 1998-08-17 2000-02-24 Abgenix, Inc. Generation of modified molecules with increased serum half-lives
US20030039958A1 (en) 1999-12-03 2003-02-27 Domantis Limited Direct screening method
US20020044921A1 (en) 2000-09-29 2002-04-18 Seoju Lee Pegylated interleukin-10
US20040009507A1 (en) 2000-10-13 2004-01-15 Domantis, Ltd. Concatenated nucleic acid sequence
US20040202995A1 (en) 2003-04-09 2004-10-14 Domantis Nucleic acids, proteins, and screening methods
WO2004110376A2 (en) 2003-06-06 2004-12-23 Merck & Co., Inc. Ccr-2 antagonists for treatment of neuropathic pain
WO2010021697A2 (en) 2008-08-18 2010-02-25 Pfizer Inc. Antibodies to ccr2

Non-Patent Citations (159)

* Cited by examiner, † Cited by third party
Title
"Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY PRESS
"Cloning Vectors: A Laboratory Manual", 1985, ELSEVIER
"Fundamental Immunology", 1989, RAVEN PRESS
"Monoclonal Antibodies, Hybridomas: A New Dimension in Biological Analyses", 1980, PLENUM PRESS
"Remington: The Science and Practice of Pharmacy", 2000, LIPPINCOTT WILLIAMS & WILKINS
"Solid Phase Peptide Synthesis", 1984, THE PIERCE CHEMICAL CO., pages: 111
ABBADIE ET AL., PROC. NATL. ACAD. SCI., USA, vol. 100, 2003, pages 7947
ABDI ET AL., J. IMMUNOL., vol. 172, 2004, pages 767
ABUCHOWSKI ET AL., J. BIOL. CHEM., vol. 252, 1977, pages 3571
AIELLO ET AL., ARTERIOSCLER. THROMB. VASE. BIOL., vol. 19, no. 6, 1999, pages 1518 - 25
ANDRES ET AL., J. IMMUNOL., vol. 164, 2000, pages 6303
ANTONIADES ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 5371
ASHKENAZI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 88, 1991, pages 10535
BARON ET AL., NUCLEIC ACIDS RES., vol. 23, 1995, pages 3605 - 06
BELPERIO ET AL., J. CLIN. INVEST., vol. 108, 2001, pages 547 - 556
BENCHAM ET AL., ANAL. BIOCHEM., vol. 131, 1983, pages 25
BERMAN ET AL., J. IMMUNOL., vol. 156, 1996, pages 3017
BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 26
BIRD, SCIENCE, vol. 242, 1988, pages 423
BLOOM ET AL., PROTEIN SCIENCE, vol. 6, 1997, pages 407
BORING ET AL., J. CLIN. INVEST., vol. 100, 1997, pages 2552
BORING ET AL., NATURE, vol. 394, no. 6696, 1998, pages 894 - 7
BOWIE ET AL., SCIENCE, vol. 253, 1991, pages 164
BRENNAN ET AL., SCIENCE, vol. 229, 1985, pages 81
BYRN ET AL., NATURE, vol. 344, 1990, pages 677
CARTER, CURR. OPIN. CHEM. BIOL, vol. 6, 2002, pages 510
CAZALIS ET AL., BIOCONJUG. CHEM., vol. 15, no. 5, 2004, pages 1005 - 1009
CHAMOW ET AL., BIOCONJUGATE CHEM., vol. 5, 1994, pages 133
CHARO ET AL., NEW ENG. J. MED., vol. 354, 2006, pages 610 - 621
CHARO ET AL., PROC. NATL. ACAD. SCI. USA, vol. 91, 1994, pages 2752 - 2756
CIPOLLONE ET AL., ARTERIOSCLER. THROMB. VASE. BIOL., vol. 21, 2001, pages 327
CONNELL N D., CURR. OPIN. BIOTECHNOL., vol. 12, no. 5, 2001, pages 446 - 9
CONNOR ET AL., GUT, vol. 53, 2004, pages 1287
CONNOR ET AL., J. EXP. MED., vol. 185, 1997, pages 621
CONTI, SEMINARS IN CANCER BIOLOGY, vol. 14, 2004, pages 149
CRAIG ET AL., CANCER METASTASIS REV., vol. 25, 2006, pages 611
DAWSON ET AL., ATHEROSCLEROSIS, vol. 143, no. 1, 1999, pages 205 - 11
DAWSON ET AL., EXP. OPIN. THER. TARGETS, vol. 7, 2003, pages 35
DE GRAAF ET AL., METHODS MOL. BIOL., vol. 178, 2002, pages 379 - 87
DELEURAN ET AL., J. DERMATOL. SCI., vol. 13, 1996, pages 228
DELGADO ET AL., BIOTECHNOLOGY AND APPLIED BIOCHEMISTRY, vol. 12, 1990, pages 119 - 128
DIMITRIJEVIC ET AL., STROKE, vol. 38, 2007, pages 1345
DORANZ ET AL., CELL, vol. 85, 1996, pages 1149
EGASHIRA ET AL., CIRC. RES., vol. 90, 2002, pages 1167
F. AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1987, GREEN PUBLISHING AND WILEY-INTERSCIENCE
FANSLOW ET AL., SEMIN. IMMUNOL., vol. 6, 1994, pages 267 - 78
FERIA ET AL., EXP. OPIN. THER. PATENTS, vol. 16, 2006, pages 49
FERREIRA ET AL., J. INVEST. DERMATOL., vol. 126, 2006, pages 1900
FRANGOGIANNIS ET AL., CIRCULATION, vol. 115, 2007, pages 584
GAO ET AL., CHEM. REV., vol. 103, 2003, pages 3733
GHARAEE-KERMANI ET AL., CYTOKINE, vol. 24, 2003, pages 266
GILES, CURR. CANCER DRUG TARGETS, vol. 6, 2006, pages 659
GILLITZER ET AL., J. INVEST. DERMATOL., vol. 101, 1993, pages 127
GLENNIE ET AL., J. IMMUNOL., vol. 139, 1987, pages 2367
GLUZMAN ET AL., CELL, vol. 23, 1981, pages 175
GOEDDEL: "Gene Expression Technology: Methods in Enzymology", vol. 185, 1990, ACADEMIC PRESS
GONZALO ET AL., J. EXP. MED., vol. 188, 1998, pages 157
GOODSON ET AL., BIOLTECHNOLOGY, vol. 8, 1990, pages 343
GOSLING ET AL., J. CLIN. INVEST., vol. 103, no. 6, 1999, pages 773 - 778
GRIMM ET AL., J. LEUKOC. BIOL., vol. 59, 1996, pages 804
GU L. ET AL., MOL. CELL, vol. 2, no. 2, 1998, pages 275 - 81
HARRIS: "Poly(ethylene glycol) Chemistry: Biotechnical and Biomedical Applications", 1992, PLENUM PRESS
HASEGAWA ET AL., ARTHRITIS & RHEUMATISM, vol. 48, 2003, pages 2555
HAYASHIDANI ET AL., CIRCULATION, vol. 108, 2003, pages 2134
HIMANEN ET AL., NATURE, vol. 414, no. 6866, 2001, pages 933 - 8
HOLLENBAUGH ET AL.: "Construction of Immunoglobulin Fusion Proteins", CURRENT PROTOCOLS IN IMMUNOLOGY, 1992, pages 10.19.1 - 10.19.11
HOLLIGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 48
HONEGGER; PLUCKTHUN, J. MOL. BIOL., vol. 309, no. 3, 2001, pages 657 - 670
HOPPE ET AL., FEBS LETTERS, vol. 344, 1994, pages 191
HORIGUCHI ET AL., J. HEART LUNG TRANSPLANT., vol. 21, 2002, pages 1090
HORVATH ET AL., CIRC. RES., vol. 90, 2002, pages 488
HUGHES ET AL., J. CEREB. BLOOD FLOW METAB., vol. 22, 2002, pages 308
HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879
HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 83
INOUE ET AL., CIRCULATION, vol. 106, no. 21, 2002, pages 2700 - 6
J. BIOL. CHEM., vol. 252, 1977, pages 3582
JONES ET AL., J. IMMUNOL., vol. 149, 1992, pages 2147
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, US DEPT. OF HEALTH AND HUMAN SERVICES, PHS, NIH
KARPUS ET AL., J. IMMUN., 1995, pages 5003 - 5010
KARRER ET AL., J. INVEST. DERMATOL., vol. 124, 2005, pages 92
KATRE, ADVANCED DRUG DELIVERY REVIEWS, vol. 10, 1993, pages 91 - 114
KHAN ET AL., AM. J. PHYSIOL. GASTROINTEST. LIVER PHYSIOL., vol. 291, 2006, pages G803
KIM ET AL., BIOCHEM BIOPHYS. RES. COMMUN., vol. 310, 2003, pages 936
KING ET AL., J. NEUROIMMUNOL., vol. 56, 1994, pages 127
KITAGAWA ET AL., AM. J. PATHOL., vol. 165, 2004, pages 237
KOCH ET AL., J. CLIN. INVEST., vol. 93, 1994, pages 921 - 928
KORNDORFER ET AL., PROTEINS: STRUCTURE, FUNCTION, AND BIOINFORMATICS, vol. 53, no. 1, 2003, pages 121 - 129
KORTT ET AL., BIOMOL. ENG., vol. 18, 2001, pages 95 - 108
KORTT ET AL., PROT. ENG., vol. 10, 1997, pages 423
KOSTELNY ET AL., J. IMMUNOL., vol. 148, 1992, pages 1547
KRIANGKUM ET AL., BIOMOL. ENG., vol. 18, 2001, pages 31 - 40
KURIHARA ET AL., J. EXP. MED., vol. 186, 1997, pages 1757
KUZIEL ET AL., PROC. NATL. ACAD. SCI. USA, vol. 94, 1997, pages 12053
LANDSCHULZ ET AL., SCIENCE, vol. 240, 1988, pages 1759
LANTTO ET AL., METHODS MOL. BIOL., vol. 178, 2002, pages 303 - 16
LEE ET AL., J. IMMUNOL., vol. 171, 2003, pages 6929
LEFRANC ET AL., DEV. COMP. IMMUNOL., vol. 29, 2005, pages 185 - 203
LIU ET AL., PAIN, vol. 86, 2000, pages 25
LLOYD ET AL., J. EXP. MED., vol. 185, 1997, pages 1371
LU ET AL., CANCER RES., vol. 67, 2007, pages 3646
LU ET AL., J. CELL. BIOCHEM., vol. 101, 2007, pages 676
LU ET AL., J. EXP. MED., vol. 187, 1998, pages 601
LU ET AL., PROSTATE, vol. 66, 2006, pages 1311
LUCKOW; SUMMERS, BIOLTECHNOLOGY, vol. 6, 1988, pages 47
LUKACS ET AL., J. IMMUNOL., vol. 158, 1997, pages 4398
MAKRIDES ET AL., MICROBIOL. REV., vol. 60, no. 3, 1996, pages 512 - 38
MAYFIELD ET AL., PROC. NATL. ACAD. SCI. USA., vol. 100, no. 2, 2003, pages 438 - 42
MCMAHAN ET AL., EMBO J., vol. 10, 1991, pages 2821
MILSTEIN ET AL., NATURE, vol. 305, 1983, pages 537
MONFARDINI ET AL., BIOCONJUGATE CHEM., vol. 6, 1995, pages 62 - 69
MORPURGO ET AL., BIOCON. CHEM., vol. 7, 1996, pages 363 - 368
NAMIKI ET AL., ARTERIOSCLER. THROMB. VASE. BIOL., vol. 22, no. 1, 2002, pages 115 - 20
NELKEN ET AL., J. CLIN. INVEST., vol. 88, no. 4, 1991, pages 1121 - 7
NI ET AL., CIRCULATION, vol. 103, no. 16, 2001, pages 2096 - 2101
OKUMA ET AL., J. PATHOL., vol. 204, 2004, pages 594
PEASE ET AL., EXPERT OPIN. INVEST. DRUGS, vol. 14, 2005, pages 785 - 796
PEPINSKY ET AL., JPET, vol. 297, 2001, pages 1059
PEREZ DE LEMA ET AL., J. AM. SOC. NEPH., vol. 16, 2005, pages 3592
POLJAK ET AL., STRUCTURE, vol. 2, 1994, pages 1121 - 23
POUWELS ET AL.: "Cloning Vectors: A Laboratory Manual", 1985, ELSEVIER
PREMACK ET AL., NATURE MEDICINE, vol. 2, 1996, pages 1174
RAJU ET AL., BIOCHEMISTRY, vol. 40, no. 30, 2001, pages 8868 - 76
RASMUSSEN ET AL., CYTOTECHNOLOGY, vol. 28, 1998, pages 31
REINECKER ET AL., GASTROENTEROLOGY, vol. 108, 1995, pages 40
REYNAUD-GAUBERT ET AL., J. HEART LUNG TRANSPLANT., vol. 21, 2002, pages 721 - 730
ROQUE ET AL., ARTERIOSCLER. THROMB. VASE. BIOL., vol. 22, 2002, pages 554
ROQUE ET AL., BIOTECHNOL. PROG., vol. 20, 2004, pages 639 - 654
RUSSELL ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6086
SAIURA ET AL., ARTERIOSCLER. THROMB. VASE. BIOL., vol. 24, 2004, pages 1886
SALCEDO ET AL., BLOOD, vol. 96, 2000, pages 34 - 40
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", vol. 1-3, 1989, COLD SPRING HARBOR LABORATORY PRESS
SANDLER; KARO: "Polymer Synthesis", vol. 3, ACADEMIC PRESS, pages: 138 - 161
SARTORE ET AL., APPL. BIOCHEM. BIOTECHNOL., vol. 27, 1991, pages 45
SAUNDERS ET AL., DRUG DISC. TODAY, vol. 4, 1999, pages 80
SCHOBER ET AL., CIRC. RES., vol. 95, 2004, pages 1125
SEINO ET AL., CYTOKINE, vol. 7, no. 6, 1995, pages 575 - 9
SHARP ET AL., YEAST, vol. 7, no. 7, 1991, pages 657 - 78
SHIMIZU, S. ET AL., RHEUMATOLOGY (OXFORD, vol. 43, 2004, pages 1121
SINCLAIR ET AL., PROTEIN EXPR. PURIF., vol. 1, 2002, pages 96 - 105
SMITH ET AL., SCIENCE, vol. 277, 1997, pages 959
SPAGNOLO ET AL., AM. J. RESPIR. CRIT. CARE MED., vol. 168, 2003, pages 1162
TATEWAKI ET AL., J. VASE. SURG., vol. 45, 2007, pages 1236
TESCH ET AL., J. EXP. MED., vol. 190, 1999, pages 1813
TESCH, G. H. ET AL., J. CLIN. INVEST., vol. 103, 1999, pages 73
TOKUYAMA ET AL., INT. IMMUNOL., vol. 17, 2005, pages 1023
TRIVEDI ET AL., ANN. REPORTS MED. CHEM., vol. 35, 2000, pages 191
TSURUTA ET AL., INT. J. MOL. MED., vol. 14, 2004, pages 837
URLAUB ET AL., PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4216 - 20
VERONESE ET AL., APPL. BIOCHEM., vol. 11, 1985, pages 141
VESTERGAARD ET AL., ACTA DERM. VENEROL., vol. 84, 2004, pages 353
WADA ET AL., J. AM. SOC. NEPHROL., vol. 15, 2004, pages 940
WARD ET AL., NATURE, vol. 334, 1989, pages 544
WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546
WELLS ET AL., CURR. OPIN. BIOTECH., vol. 8, 1997, pages 741 - 748
WIEDER ET AL., J. BIOL. CHEM., vol. 254, 1979, pages 12579
YAMAMOTO ET AL., J. INVEST. DERMATOL., vol. 121, 2003, pages 510
YLA-HERTUALA ET AL., PROC. NATL. ACAD. SCI USA, vol. 88, no. 12, 1991, pages 5252 - 6
ZALIPSKY ET AL., EUROP. POLYM. J., vol. 19, 1983, pages 1177 - 1183
ZALIPSKY ET AL.: "Polymeric Drugs and Drug Delivery Systems", ADRS 9-110 ACS SYMPOSIUM SERIES, 1999, pages 469

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018195283A1 (en) 2017-04-19 2018-10-25 Elstar Therapeutics, Inc. Multispecific molecules and uses thereof
CN110709422A (zh) * 2017-04-19 2020-01-17 埃尔斯塔治疗公司 多特异性分子及其用途
CN110709422B (zh) * 2017-04-19 2023-12-26 马伦戈治疗公司 多特异性分子及其用途
US12134654B2 (en) 2017-04-19 2024-11-05 Marengo Therapeutics, Inc. Multispecific molecules and uses thereof
WO2019113464A1 (en) 2017-12-08 2019-06-13 Elstar Therapeutics, Inc. Multispecific molecules and uses thereof
WO2020069372A1 (en) 2018-09-27 2020-04-02 Elstar Therapeutics, Inc. Csf1r/ccr2 multispecific antibodies
WO2023072916A1 (en) 2021-10-27 2023-05-04 Granite Bio Ag Antibodies targeting ccr2
US12168692B1 (en) 2021-10-27 2024-12-17 Granite Bio Ag Antibodies targeting CCR2
WO2024245988A1 (en) 2023-05-29 2024-12-05 Granite Bio Ag Antibodies targeting ccr2

Also Published As

Publication number Publication date
WO2013192596A3 (en) 2014-04-03
US9951138B2 (en) 2018-04-24
US20130344070A1 (en) 2013-12-26
US20190062440A1 (en) 2019-02-28
EP2864358A2 (en) 2015-04-29
JP2018199681A (ja) 2018-12-20
US20160289329A1 (en) 2016-10-06
EP2864358B1 (en) 2019-08-07
HK1208236A1 (en) 2016-02-26
CN105051065A (zh) 2015-11-11
JP6438391B2 (ja) 2018-12-12
US9315579B2 (en) 2016-04-19
CA2877814A1 (en) 2013-12-27
US10696746B2 (en) 2020-06-30
JP2015527978A (ja) 2015-09-24
EP2864358A4 (en) 2016-04-06

Similar Documents

Publication Publication Date Title
US10696746B2 (en) Antigen binding proteins that bind CCR2
US11242391B2 (en) Antigen binding proteins that bind PD-1
AU2018202465A1 (en) Antigen binding proteins that bind PD-L1
US10717779B2 (en) Methods for blocking an interaction between notch-1 and delta-like 4 (DLL-4) by administering a DDL-4 antibody
US9944707B2 (en) Antibodies that bind epidermal growth factor receptor (EGFR)
AU2017212717A1 (en) Antigen binding proteins that bind PD-L1
US10668148B2 (en) Fully human anti-C-X-C chemokine receptor 3 (CXCR3) antibodies and methods of use thereof

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 201380043633.4

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13807252

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 2013807252

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2015518629

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2877814

Country of ref document: CA