WO2013093720A2 - Anti-diabetic compounds - Google Patents

Anti-diabetic compounds Download PDF

Info

Publication number
WO2013093720A2
WO2013093720A2 PCT/IB2012/057227 IB2012057227W WO2013093720A2 WO 2013093720 A2 WO2013093720 A2 WO 2013093720A2 IB 2012057227 W IB2012057227 W IB 2012057227W WO 2013093720 A2 WO2013093720 A2 WO 2013093720A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
fgf21
linker
antibody
composition
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/IB2012/057227
Other languages
English (en)
French (fr)
Other versions
WO2013093720A3 (en
Inventor
Gopinath Vedachalam ANNATHUR
Palani Balu
Rory Francis Finn
Jie Huang
Olivier Alexandre Laurent
Nancy Jane Levin
Nicholas Gary Luksha
Joseph Patrick MARTIN Jr
Haim Moskowitz
Moorthy Sitharamaiah Suriyanarayana Palanki
Mark John Pozzo
Gregory Allan WASZAK
Jin Xie
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Covx Technologies Ireland Ltd
Pfizer Inc
Original Assignee
Covx Technologies Ireland Ltd
Pfizer Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to JP2014548277A priority Critical patent/JP6165168B2/ja
Priority to CA2859969A priority patent/CA2859969A1/en
Priority to KR1020147020397A priority patent/KR101640697B1/ko
Priority to BR112014014898-8A priority patent/BR112014014898A2/pt
Priority to DK12816137.9T priority patent/DK2793928T3/en
Priority to ES12816137.9T priority patent/ES2623786T3/es
Priority to CN201280063933.4A priority patent/CN104066438B/zh
Priority to MX2014007626A priority patent/MX2014007626A/es
Priority to AU2012356219A priority patent/AU2012356219B2/en
Application filed by Covx Technologies Ireland Ltd, Pfizer Inc filed Critical Covx Technologies Ireland Ltd
Priority to SG11201402640SA priority patent/SG11201402640SA/en
Priority to EP12816137.9A priority patent/EP2793928B1/en
Priority to HK15101306.0A priority patent/HK1200726B/xx
Publication of WO2013093720A2 publication Critical patent/WO2013093720A2/en
Publication of WO2013093720A3 publication Critical patent/WO2013093720A3/en
Priority to ZA2014/03755A priority patent/ZA201403755B/en
Priority to IL233206A priority patent/IL233206A/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • A61K38/26Glucagons
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/96Stabilising an enzyme by forming an adduct or a composition; Forming enzyme conjugates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/18Growth factors; Growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/18Growth factors; Growth regulators
    • A61K38/1825Fibroblast growth factor [FGF]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • A61K38/2278Vasoactive intestinal peptide [VIP]; Related peptides (e.g. Exendin)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6843Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a material from animals or humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/04Anorexiants; Antiobesity agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/06Antihyperlipidemics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/12Antihypertensives
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/475Growth factors; Growth regulators
    • C07K14/50Fibroblast growth factor [FGF]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • C07K14/605Glucagons
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/31Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin

Definitions

  • the present invention relates to novel compounds that promote insulin secretion and lower blood glucose levels, and methods of making and using these compounds.
  • Type II diabetes is the most prevalent form of diabetes.
  • the disease is caused by insulin resistance and pancreatic ⁇ cell failure, which results in decreased glucose- stimulated insulin secretion.
  • Fibroblast growth factor (FGF) 21 a member of the FGF family, has been identified as a metabolic regulator and is preferentially expressed in the liver and adipose tissue and exerts its biological activities through a cell surface receptor complex composed of FGFRI c and ⁇ -Klotho on target cells such as liver and adipose tissues (WO0136640, and WO01 18172).
  • the receptor complex is thought to trigger cytoplasmic signaling and to up-regulate the GLUT1 expression through the Ras/MAP kinase pathway. Its abilities to provide sustained glucose and lipid control, and improve insulin sensitivity and ⁇ -cell function, without causing any apparent adverse effects in preclinical settings, have made FGF21 an attractive therapeutic agent for type-2 diabetes and associated metabolic disorders.
  • WO2006065582, WO2006028714, WO2006028595, and WO2005061712 relate to muteins of FGF21 , comprising individual amino-acid substitutions.
  • WO2006078463 is directed towards a method of treating cardiovascular disease using FGF21 .
  • WO2005072769 relates to methods of treating diabetes using combinations of FGF21 and thiazolidinedione.
  • WO03059270 relates to methods of reducing the mortality of critically ill patients comprising administering FGF21 .
  • WO0301 1213 relates to a method of treating diabetes and obesity comprising administering FGF21 .
  • WO2008121563 disclose FGF21 molecules linked to PEG via lysine or cysteine residues, glycosyl groups and non-natural amino acid residues, respectively.
  • WO20051 13606 describes FGF21 molecules recombinantly fused via their C-terminus to albumin and immunoglobulin molecules using polyglycine linkers.
  • Incretins are compounds that stimulate glucose-dependent insulin secretion and inhibit glucagon secretion, have emerged as attractive candidates for the treatment of type II diabetes.
  • Glucagon-like peptide (7-36) amide (GLP1 ) is one of the incretin family members, and has been shown to increase insulin secretion, decrease glucagon secretion, stimulate pro-insulin gene transcription, slow down gastric emptying time, and reduce food intake (WO98019698).
  • GLP1 exerts its physiological effects by binding to the glucagon-like peptide 1 receptor (GLP1 R), a putative seven-transmembrane domain receptor.
  • GLP1 A drawback to the therapeutic use of GLP1 is its short in vivo half-life (1 -2 mins).
  • WO2009020802 discloses a method for lowering body weight comprising administering a FGF21 compound in combination with a GLP1 compound.
  • the invention provides a composition of the formula:
  • FGF21 is an FGF21 homologue
  • Ex4 is an Exendin4 homologue
  • Ab is an aldolase catalytic antibody or antigen binding portion thereof; and the 1 st linker is covalently attached to the side chain of a protein-linking residue in FGF21 and to a combining site of the antibody, and
  • the 2 nd linker is covalently attached to the side chain of a peptide-linking residue in Ex4 and to a combining site of the antibody, and wherein the first and second linker are the same or different; or stereoisomers, tautomers, solvates, prodrugs, and
  • the present invention relates to a composition
  • a composition comprising a FGF21 molecule covalently attached to a first combining site of an antibody or antigen binding portion thereof via a first linker, wherein the first linker is covalently attached to the side chain of a protein-linking residue within FGF21 , and further comprising an
  • Exendin4 homologue covalently attached to a second combining site of the antibody via a second linker, wherein the second linker is covalently attached to the side chain of a peptide-linking residue within the Exendin4 homologue; or stereoisomers, tautomers, solvates, prodrugs, and pharmaceutically acceptable salts thereof
  • the invention comprises the formula:[FGF21 ]-[1 st Linker]-
  • FGF21 is an FGF21 homologue, and may be selected from the group consisting of SEQ ID NOs: 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, and 24; and Ex4 is an Exendin4 homologue , and may be selected from the group consisting of SEQ ID NOs: 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, 49, 50, 51 , 52, 53, 54, 55, 56,57, 58, 59, 60, 61 , 62, 63, 64, 65, 66, 67, 68, 69, 70, 71 , and 72, and the Antibody is an aldolase catalytic antibody or antigen binding portion thereof; and the 1 st linker is covalently attached to the side chain of a protein- linking residue in FGF21 and to the combining site of the antibody, and the 2 nd
  • the protein-linking residue may be cysteine or lysine.
  • the protein-linking residue may be located at a position selected from the group consisting of amino acid residue numbers 56, 59, 69, 79, 86, 122, 125 and 129, according to the numbering of SEQ ID NO:1 .
  • the protein-linking residue may be located at a position selected from the group consisting of amino acid residue numbers 56, 59, 86, and 122 according to the numbering of SEQ ID NO:1 .
  • the protein-linking residue may be located at a position selected from the group consisting of residue 79, 125 and 129 according to the numbering of SEQ ID NO:1 .
  • the protein-linking residue may be located at a position selected from the group consisting of residues 125 and 129 according to the numbering of SEQ ID NO:1 .
  • the side chain of the protein-linking residue may comprise a thiol group.
  • the protein-linking residue may be cysteine.
  • the FGF21 molecule may comprise SEQ ID NO:3.
  • the FGF21 molecule may comprise SEQ ID NO:4.
  • the FGF21 molecule may comprise a sequence selected from the group consisting of SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:1 1 , SEQ ID NO:12, and SEQ ID NO:13.
  • the protein-linking residue may be located at position 125 according to the numbering of SEQ ID NO:1 .
  • the FGF21 molecule may comprise a sequence selected from the group consisting of SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, and SEQ ID NO:7. In some embodiments, the FGF21 sequence is SEQ ID NO:7.
  • the protein-linking residue may be located at position 129 according to the numbering of SEQ ID NO:1 .
  • the FGF21 molecule may comprise a sequence selected from the group consisting of SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:8, SEQ ID NO:9, and SEQ ID NO:10. In some embodiments, the FGF21 sequence is SEQ ID NO:10.
  • the FGF21 molecule may comprise SEQ ID NO:8, SEQ ID NO:9 or SEQ ID NO:10.
  • the protein-linking residue may be located at position 79 according to the numbering of SEQ ID NO:1 .
  • the FGF21 molecule may comprise a sequence selected from the group consisting of SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:1 1 , SEQ ID NO:12, and SEQ ID NO:13. In some embodiments, the FGF21 sequence is SEQ ID NO:13.
  • the protein-linking residue may be located at a position selected from the group consisting of 1 , 2, 56, 59, 69, and 122 according to the numbering of SEQ ID NO:1 . In some embodiments, the protein-linking residue may be located at a position selected from the group consisting of 1 , 2, 56, 59, and 122 according to the numbering of SEQ ID NO:1 .
  • the protein-linking residue may be lysine.
  • the FGF21 molecule may comprise SEQ ID NO:17.
  • the FGF21 molecule may comprise a sequence selected from the group consisting of SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21 , and SEQ ID NO:23.
  • the Exendin4 homologue may comprise the formula:
  • Hx 2 EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSx 40 (SEQ ID NO:38), wherein x 2 is Aib and x 40 is a peptide-linking residue comprising any amino acid or is absent, and wherein one of L 10 , S 11 , K 12 , Q 13 , M 14 , E 16 , E 17 , V 19 , R 20 , L 21 , E 24 , L 26 , K 27 , N 28 , S 32 , S 33 , G 34 , A 35 , P 36 , P 37 , P 38 , S 39 , or X 40 comprises or is substituted with a peptide-linking residue [LR], such that the peptide linking residue comprises a
  • nucleophilic side chain or C-terminus carboxyl group covalently linked to the second combining site of the antibody via the second linker, and where linkable through the nucleophilic side chain, the peptide linking residue being selected from the group consisting of K, K(SH), K(S-MAL), R, Y, C, T, S, homocysteine, homoserine, Dap, and Dab.
  • the peptide-linking residue may be located at a position selected from the group consisting of amino acid residue numbers 1 1 , 12, 13, 14, 15, 16, 17, 19, 20, 21 , 24, 27, 28, 39, and 40, according to the numbering of SEQ ID NO:38. In some embodiments, the peptide-linking residue is located at one of positions of 12, 13, 14, 16, 17, 19, 20, 21 , 24, according to the numbering of SEQ ID NO:38.
  • the Exendin4 homologue comprises a sequence selected from the group consisting of SEQ ID NO:46, SEQ ID NO:48, SEQ ID NO:49, SEQ ID NO:50, SEQ ID NO:51 , SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:54, and SEQ ID NO:55.
  • the peptide-linking residue is located at one of positions of 13, 14, 16, 17, 19, 20, 21 , 24, according to the numbering of SEQ ID NO:38.
  • the Exendin4 homologue comprises a sequence selected from the group consisting of SEQ ID NO:46, SEQ ID NO:48, SEQ ID NO:49, SEQ ID NO:50, SEQ ID NO:51 , SEQ ID NO:52, SEQ ID NO:53, and SEQ ID NO:54.
  • the peptide-linking residue is located at one of positions of 12, 14, 17, 19, 20, or 21 , according to the numbering of SEQ ID NO:38.
  • the Exendin4 homologue comprises a sequence selected from the group consisting of SEQ ID NO:48, SEQ ID NO:49, SEQ ID NO:50, SEQ ID NO:51 , SEQ ID NO:53, and SEQ ID NO:55.
  • the peptide-linking residue is located at one of positions of 12, 14, 19, 20, 21 , or 40 according to the numbering of SEQ ID NO:38.
  • the Exendin4 homologue may comprise SEQ ID NO:60.
  • the Exendin4 homologue comprises a sequence selected from the group consisting of SEQ ID NO:48, SEQ ID NO:49, SEQ ID NO:50, SEQ ID NO:53, SEQ ID NO:55, SEQ ID NO:60, SEQ ID NO:61 , SEQ ID NO:62, SEQ ID NO:63, SEQ ID NO:64, SEQ ID NO:65, SEQ ID NO:66, SEQ ID NO:67, SEQ ID NO:68, SEQ ID NO:69, SEQ ID NO:70, SEQ ID NO:71 , and SEQ ID NO:72.
  • the Exendin4 homologue may comprise SEQ ID NO:60 when x40 is absent.
  • the Exendin4 homologue comprises a sequence selected from the group consisting of SEQ ID NO:48, SEQ ID NO:49, SEQ ID NO:50, SEQ ID NO:53, SEQ ID NO:55, SEQ ID NO:60, SEQ ID NO:61 , SEQ ID NO:62, SEQ ID NO:63, SEQ ID NO:64, SEQ ID NO:65, SEQ ID NO:66, SEQ ID NO:67, SEQ ID NO:68, SEQ ID NO:69, and SEQ ID NO:70.
  • the peptide-linking residue is located at one of positions of
  • the Exendin4 homologue comprises a sequence selected from the group consisting of SEQ ID NO:48, SEQ ID NO:49, SEQ ID NO:50, SEQ ID NO:53, SEQ ID NO:63, SEQ ID NO:64, SEQ ID NO:65, SEQ ID NO:66, SEQ ID NO:67, SEQ ID NO:68, SEQ ID NO:69, and SEQ ID NO:70.
  • the peptide-linking residue is located at position 14, according to the numbering of SEQ ID NO:60.
  • the Exendin4 homologue comprises a sequence selected from the group consisting of SEQ ID NO:53, SEQ ID NO:63, SEQ ID NO:64 and SEQ ID NO:77. In some embodiments, the
  • Exendin4 homologue comprises SEQ ID NO:53. In some embodiments, the Exendin4 homologue comprises SEQ ID NO:63. In some embodiments, the Exendin4 homologue comprises SEQ ID NO:64. In some embodiments, the Exendin4 homologue comprises SEQ ID NO:77.
  • the peptide-linking residue may comprise a nucleophilic sidechain covalently linked to the second linker.
  • the peptide-linking residue may be selected from the group consisting of K, Y, C, Dap, Dab, K(SH) and K(S-MAL).
  • the side chain of the peptide- linking residue may comprise a thiol group.
  • -linking residue [LR] may comprise the structure: K(S-MAL)
  • u is 1 , 2 or 3, and L is the second linker.
  • u is u 1 .
  • u is 2.
  • the Exendin4 homologue further comprises an amino-terminal capping group R 1 selected from the group consisting of CH 3 , C(O)CH3, C(O)CH 2 CH 3 , C(O)CH 2 CH 2 CH 3 , or C(O)CH(CH 3 )CH 3 .
  • the Exendin4 homologue further comprises a carboxy-terminus capping group R 2 selected from the group consisitng of OH, NH 2 , NH(CH 3 ), NHCH 2 CH 3 , NHCH 2 CH 2 CH 3 , NHCH(CH 3 )CH 3 , NHCH 2 CH 2 CH 2 CH 3 , NHCH(CH 3 )CH 2 CH 3 , NHC 6 H 5 , NHCH 2 CH 2 OCH 3 , NHOCH 3 , NHOCH 2 CH 3 , a carboxy protecting group, a lipid fatty acid group or a carbohydrate.
  • R 1 is C(O)CH 3 .
  • R 2 is NH 2 .
  • the Ex4 peptide comprises SEQ ID NO:64 and R1 is C(O)CH 3 and R2 is NH 2
  • the Ex4 peptide may be denoted as SEQ ID NO:77.
  • the Exendin4 homologue comprises the formula:
  • Both the first and second linker each play a critical role in the presentation of the protein and peptide respectively. It is essential that the composition and length of linker be optimized for both protein and peptide in order to maximize the ability of each to interact with their respective cognate.
  • a further complication with an asymmetric bifunctional molecule i.e. one presenting a different protein/peptide on each of the two arms) is the importance that the linker-peptide arrangement or functionality of one arm does not interfere with the linker-protein arrangement or functionality of the other arm, and vice versa.
  • a longer linker length has a tendency to reduce interference between the different arms. Balanced against this, however, is the tendency for longer linkers to offer less protection against proteases.
  • a short linker can allow a peptide or protein to be optimally presented for cognate interaction: increasing the linker length can increase flexibility, and so lose this advantage. Conversely, some protein or peptide interactions with the respective target are improved by a certain amount of flexibility in the linker.
  • finding the optimum linker length and composition for each active protein/ peptide, and balancing each holistically across the entire assembled molecule is critical in order to strike the right balance between half-life and activity of both protein and peptide. All of this must then be offset against the additional manufacturing cost and complexity inherent in having a different linker for each protein/peptide. Using the same linker for each active molecule has clear cost and manufacturing efficiencies.
  • linkers are disclosed in US2009098130, the contents of which are incorporated herein by reference.
  • aspects of US2009098130 pertaining to the general formulae describing linkers, specific linker structure, synthesis of linkers and combinations of different elements of X, Y (which may also be written as yy) and Z groups as specifically and generally described therein are herein included.
  • the first and/or second linker may be linear or branched, and optionally includes one or more carbocyclic or heterocyclic groups.
  • Linker length may be viewed in terms of the number of linear atoms, with cyclic moieties such as aromatic rings and the like to be counted by taking the shortest route around the ring.
  • the first and/or second linker has a linear stretch of between 5-15 atoms, in other embodiments 15-30 atoms, in still other embodiments 30-50 atoms, in still other embodiments 50-100 atoms, and in still other embodiments 100-200 atoms.
  • Other linker considerations include the effect on physical or pharmacokinetic properties of the resulting compound, such as solubility, lipophilicity, hydrophilicity, hydrophobicity, stability (more or less stable as well as planned degradation), rigidity, flexibility, immunogenicity, and modulation of antibody binding, the ability to be incorporated into a micelle or liposome, and the like.
  • the first and/or second linker may comprise the formula: X-Y-Z; wherein X is a biologically compatible connecting chain including any atom selected from the group consisting of C, H, N, O, P, S, F, CI, Br, and I, and may comprise a polymer or block copolymer, and is covalently linked to the protein-linking residue and/or peptide-linking residue where the linker is linear, Y is an optionally present recognition group
  • Z is an attachment moiety comprising a covalent link to an amino acid side chain in a combining site of an antibody.
  • Y may have the optionally substituted structure:
  • a, b, c, d, and e are independently carbon or nitrogen; f is carbon, nitrogen, oxygen, or sulfur; Y is attached to X and Z independently at any two ring positions of sufficient valence; and no more than four of a, b, c, d, e, or f are simultaneously nitrogen and preferably a, b, c, d, and e in the ring structure are each carbon.
  • Y may be phenyl.
  • the first and/or second linker may be designed such that it contains a reactive group capable of covalently or non-covalently forming a bond with a macromolecule, such as an antibody, protein, or fragment thereof.
  • the reactive group is chosen for use with a reactive residue in a particular combining site.
  • a chemical moiety for modification by an aldolase antibody may be a ketone, diketone, beta lactam, active ester haloketone, lactone, anhydride, maleimide, alpha-haloacetamide, cyclohexyl diketone, epoxide, aldehyde, amidine, guanidine, imine, enamine, phosphate,
  • the Z is the reactive group.
  • Other groups may include a lactone, an anhydride, an alpha- haloacetamide, an imine, a hydrazide, or an epoxide.
  • acyl beta-lactam simple diketone
  • succinimide active ester maleimide
  • Z may be a substituted alkyl, substituted cycloalkyl, substituted aryl, substituted arylalkyl, substituted heterocycle, or substituted heterocycloalkyl, wherein at least one substituent is a 1 ,3-diketone moiety, an acyl beta- lactam, an active ester, an alpha-haloketone, an aldehyde, a maleimide, a lactone, an anhydride, an alpha-haloacetamide, an amine, a hydrazide, or an epoxide.
  • the Z group is covalently linked to a macromolecule scaffold that can provide increased half-life to the peptides of the invention.
  • the Z group if present is covalently linked to the combining site of an antibody.
  • q 0-5.
  • q may be 1 or 2.
  • q may be 1 .
  • q may be 2.
  • Z following conjugation with the antibody combining site, Z has structure:
  • Antibody-N- is a covalent bond to a side chain in a combining site of an antibody (wherein the NH is the ⁇ -amino group of a lysine the side chain in the antibody combining site) .
  • q may be 1 or 2.
  • q may be 1 . In other aspects, q may be 2.
  • X may be a group comprising three components; Xp-Xs-Xy, wherein Xp is a group specifically adapted to be combinable with the side chain of the protein-linking residue of the FGF21 protein and/or the peptide linking residue of an Exendin4 homologue, Xs is a spacer region of the X group, and Xy is a group adapted to bind to the Y group.
  • Xy is selected from an amide bond, an enamine bond, or a guanidinium bond.
  • Xy may be selected so as to provide a hydrogen molecule adjacent (within two atoms) to the Y group.
  • the H atom can assist the Y group recognition of a hydrophobic pocket through H- bond interaction, particularly in respect of the hydrophobic pocket of the binding cleft of a catalytic antibody, such as h38C2.
  • the amide bond may be oriented such that the NH group is directly bonded to the Y group, providing the H of the NH group for hydrogen bonding.
  • Xy is absent.
  • the Xy group has the formula: ⁇ Y ⁇
  • Xs is selected such that Xs does not provide any overly reactive groups.
  • Xs may be selected so as to provide an overall length of the X groups of between 2-15 atoms. Xs may be selected so that the overall length of the X group is between 2 and 10 atoms. Xs may be selected so that the overall length of X group is 4-8 atoms. Xs may be selected so that the overall length of X group is 5 atoms. Xs may be selected so that the overall length of X group is 6 atoms.
  • Xs may comprise one of the followin formulae:
  • n 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10, and m is present or absent; n may be 1 , 2, 3, 4, 5, or 6; n may be 1 , 2, 3, or 4; n may be 1 ; n may be 2; n may be 3; n may be 4.
  • Xs comprises one of the following formulae: (exemplified in L1 and L2)
  • Xp ideally is selected so as to enable a specific directional covalent linking strategy to the protein-linking residue of the FGF21 protein and/or the peptide-linking residue of the Exendin4 homologue.
  • the linking residue comprises a nucleophilic group
  • Xp may be an electrophilic group and vice versa.
  • the linking residue side chain comprises an amine group, such as K, H, Y, ornithine, Dap, or Dab
  • Xp may be COOH, or other similarly reactive electrophile.
  • the linking residue is D or E
  • Xp may comprise a nucleophilic group, such as an amine group. Either of these strategies permits a covalent bond to be formed between the Xp group and the linking residue by amide bond formation strategies.
  • the linking residue comprises an amine group
  • Xp may comprise the formula:
  • Xp may comprise a maleimide group (or similar) permitting a thiol- maleimide addition reaction strategy to covalently link the Xp group to the linking residue.
  • Xp may also comprise a thiol group, allowing a disulphide bridge to be formed between the linking residue and Xp group.
  • Xp m maleimide :
  • the mechanism of conjugation may be as follows:
  • PLR is the protein-linking residue or peptide-linking residue
  • S is the sulphur atom of the thiol group of the cysteine or other thiol bearing amino acid, such as K(SH).
  • the Xp group comprises a substituted maleimide:
  • the XY components of the linker prior to conjugation and following conjugation may be selected from the following: XY-1
  • Components XY-1 , XY-2, XY-3, and XY-4 are particularly useful in embodiments conjugating to a thiol-group bearing side chain on the linking residue.
  • the linker may be Linker-1 (L1 ):
  • the L1 -PLR complex may comprise the formula:
  • the antibody-L1 -PLR complex may comprise the formula:
  • the linker may be Linker-2 (L2):
  • the L2- PLR complex may comprise one of the following formulae:
  • the antibody-L2-PLR complex may comprise one of the following formulae:
  • the linker may be Linker-3 (L3):
  • the L3- PLR complex may comprise one of the following formulae:
  • the antibody-L3- PLR complex may comprise the formula:
  • the linker may be Linker-4 (L4): L4
  • the L4- PLR complex When conjugated to the PLR, the L4- PLR complex may comprise the formula:
  • the antibody-L4- PLR complex may comprise the formula:
  • the linker may be Linker-5 (L5):
  • the L5- PLR complex may comprise the formula:
  • the antibody-L5-PLR complex may comprise the formula:
  • Ab-L5-PLR wherein NH is the amino group at the end of a side chain of the LR, such as lysine.
  • the linker may be Linker-6 (L6).
  • L6 Linker-6
  • the L6-PLR complex When L6 is conjugated to the PLR, the L6-PLR complex may comprise the same formula as that for L5-PLR1 . Similarly, when L6 is conjugated to the antibody and the PLR, the antibody-L6-PLR complex may comprise the same formula as that for Ab-L5- PLR.
  • the linker may be Linker-7 (L7):
  • the L7-PLR complex When conjugated to the PLR, the L7-PLR complex may comprise the formula:
  • the antibody-L7-PLR complex When conjugated to the antibody and PLR, the antibody-L7-PLR complex may comprise the formula:
  • the linker may be Linker-8 (L8):
  • the L8-PLR complex may comprise the formula:
  • the antibody-L8-PLR complex may comprise the formula:
  • the linker may be of the formula:
  • Antibody is a covalent linkage to the combining site of an antibody
  • S-PLR is the covalent linkage to a thiol-bearing side chain on the protein-linking residue and/or the peptide-linking residue
  • n 1 , or 2, or 3, or 4, 5, 6, 7, 8, 9, or 10
  • n 1 , or 2, or 3, or 4, 5, 6, 7, 8, 9, or 10
  • n 1 , or 2, or 3, or 4, 5, 6, 7, 8, 9, or 10
  • n may be 1 , 2, 3, 4, 5, or 6
  • n may be 1 ;
  • n may be 2;
  • n may be 3;
  • n may be 4.
  • M may be absent.
  • M may be present.
  • composition comprises the formula:
  • Antibody is a covalent linkage to the combining site of an antibody
  • S-PLR is a covalent linkage to a thiol-bearing side chain on the protein-linking residue and/or the peptide-linking residue.
  • the protein-linking residue comprises an amino or thiol bearing side chain. In some embodiments, the protein linking residue comprises lysine or cysteine. In some embodiments, the protein-linking residue comprises cysteine.
  • the protein-linking residue is located at one of residue numbers 56, 59, 69, 79, 86, 122, 125 and 129, according to the numbering of SEQ ID NO:1
  • the FGF21 molecule comprises SEQ ID NO:10.
  • the FGF21 molecule comprises SEQ ID NO:7.
  • the peptide-linking residue is located at one of positions of 10, 1 1 , 12, 13, 14, 16, 17, 19, 20, 21 , 24, 26, 27, 28, 32, 33, 34, 35, 36, 37, 38, 39, or 40 according to the numbering of SEQ ID NO:60.
  • the 1 st and 2 nd linkers are the same. In some embodiments, the 1 st and 2 nd linkers are the same. In some
  • the 1 st and 2 nd linker both comprise L1 .
  • the structure of the protein linking residue [S-PLR] and/or the peptide-linking residue [S-PLR] when attached to the antibody is of the formula: wherein v is 1 or 2, t is 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10, y is 0, 1 or 2; s is 0, 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10, and q is 1 , 2, 3, 4, or 5.
  • v is 2
  • t is 2
  • y is 1
  • s is 0
  • q is 2.
  • the invention provides a compound of the formula:
  • each independently of vi and v 2 is 1 or 2, each independently of ti and t 2 is 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10, each independently of yi and y 2 is 0, 1 or 2; each independently of s-iand s 2 is 0, 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10, and each independently of qi and q 2 is 1 , 2, 3, 4, or 5.
  • vi and v 2 are both 2.
  • ti and t 2 are both 2.
  • y 2 are both 1 .
  • s 2 are both 0.
  • qi and q 2 are both 2.
  • the invention provides a composition of the formula:
  • first and second linker are each covalently connected to one of the two antibody combining sites, and the antibody comprises SEQ ID NO:25 and SEQ ID NO:26
  • S— Ex4 denotes a covalent link through a thiol group to K(SH) of SEQ ID NO:64
  • S— FGF21 denotes a covalent link through a thiol group to C 129 of SEQ ID NO:10.
  • the structure of the peptide-linking residue [LR] when attached to the second linker and second combining site of the antibody is of the formula:
  • u is 1 , 2 or 3; v is 1 or 2, t is 1 , 2, or 3, y is 1 or 2; s is 0, 1 or 2 and q is 1 or 2.
  • u is 2, v is 2, t is 2, y is 1 , s is 0 and q is 2.
  • the Exendin4 homologue and second linker comprise the formula:
  • u is 1 , 2 or 3; v is 1 or 2, t is 1 , 2, or 3, y is 1 or 2; s is 0, 1 or 2 and q is 1 or 2, and [LR] is the peptide linking residue.
  • u is 2, v is 2, t is 2, y is 1 , S is 0 and q is 2.
  • [LR] is K, K(S-MAL), or K(SH).
  • the invention relates to a composition of the formula: [FGF21 -1 st Linker] 1 -[Ab]-[2 nd -Linker-Ex4] 1 wherein FGF21 is an FGF21 homologue; and Ex4 is an Exendin4 homologue ; and Ab is an aldolase catalytic antibody; and the 1 st linker is covalently attached to the side chain of a protein-linking residue in FGF21 and to the combining site of the antibody, and the 2 nd linker is covalently attached to the side chain of a peptide-linking residue in Ex4 and to the combining site of the antibody, and wherein the first and second linker are the same or different, such that the
  • subcutaneous half-life of the conjugated protein-antibody complex is at least about 20 hrs in murine models.
  • the SC half-life is at least about 25 hrs.
  • the SC half-life is at least about 30 hrs.
  • the SC half-life is at least about 33 hrs.
  • the SC half-life is at least about 40 hrs in primate models.
  • the SC half-life is at least about 45 hrs in primate models.
  • the SC half-life is at least 48 hrs in primate models.
  • the invention provides a conjugated antibody- protein complex with an IV half-life of at least about 28 hrs in murine models.
  • the invention provides a conjugated antibody-protein complex with an IV half-life of at least about 30 hrs in murine models. In some embodiments, the invention provides a conjugated antibody-protein complex with an IV half-life of at least about 34 hrs in murine models. In some embodiments, the invention provides a conjugated antibody-protein complex with an IV half-life of at least about 40 hrs in murine models. In some embodiments, the invention provides a conjugated antibody-protein complex with an IV half-life of at least about 50 hrs in primate models. In some embodiments, the invention provides a conjugated antibody-protein complex with an IV half-life of at least about 55 hrs in primate models. In some embodiments, the invention provides a conjugated antibody-protein complex with an IV half-life of at least about 60 hrs in primate models.
  • the invention relates to a composition of the formula: [FGF21 -1 st Linker]-[Antibody]-[2 nd -Linker-Ex4] wherein FGF21 is an FGF21 homologue; and Ex4 is an Exendin4 homologue ; and Antibody is an aldolase catalytic antibody; and the 1 st linker is covalently attached to the side chain of a protein-linking residue in FGF21 and to the combining site of the antibody, and the 2 nd linker is covalently attached to the side chain of a peptide-linking residue in Ex4 and to the combining site of the antibody, and wherein the first and second linker are the same or different, such that the subcutaneous bioavailability of the conjugated protein-antibody complex is at least about 80% in murine models.
  • the SC bioavailability is at least about 85 %. In some embodiments, the SC bioavailability is at least about 90%. In some embodiments, the SC bioavailability is at least about 50% in primate models. In some embodiments, the SC bioavailability is at least about 55% in primate models. In some embodiments, the SC bioavailability is at least about 60% in primate models.
  • the invention relates to a composition of the formula:
  • iAMP hGLP-1 R
  • the EC50 potency in hGLP-1 R (iAMP) assay is less than about 500pm. In some aspects, the EC 50 potency in hGLP-1 R (iAMP) assay is less than about 100pm. In some aspects, the EC 50 potency in hGLP-1 R (iAMP) assay is less than about 50pm. In some aspects, the EC50 potency in hGLP-1 R (iAMP) assay is between about 10-50pm.
  • the invention relates to a composition of the formula: [FGF21 -1 st Linker]-[Antibody]-[2 nd -Linker-Ex4] wherein FGF21 is an FGF21 homologue; and Ex4 is an Exendin4 homologue; and Antibody is an aldolase catalytic antibody; and the 1 st linker is covalently attached to the side chain of a protein-linking residue in FGF21 and to the combining site of the antibody, and the 2 nd linker is covalently attached to the side chain of a peptide-linking residue in Ex4 and to the combining site of the antibody, and wherein the first and second linker are the same or different, such that the conjugated protein-antibody complex has a EC50 potency in a Glutl Taqman assay of less than about 5nM.
  • the EC 50 potency in a Glutl Taqman assay is less than about 4nM. In some embodiments, the EC50 potency in a Glutl Taqman assay is less than about 3nM. In some embodiments, the EC50 potency in a Glutl Taqman assay is less than about 2nM. In some embodiments, the EC 50 potency in a Glutl Taqman assay is less than about 1 nM.
  • the conjugated protein-antibody complex combines two or more favourable advantages, such as SC half-life, IV half-life, glucose uptake, potency, bioavailability, ease of manufacture, conjugation efficiency, in vivo stability, in vitro stability, resistance to hydrolysis, and compatibility between antibody, linker and protein.
  • the invention provides a composition comprising a FGF21 molecule covalently connected to at least one half-life-increasing moiety at a linking residue located at residue number 171 according to the numbering of SEQ ID NO:1 .
  • the FGF21 molecule is covalently connected to one half life-increasing moiety.
  • the FGF21 molecule is covalently connected to more than one half life-increasing moiety.
  • the linking residue is selected from the group consisting of residue numbers 79,129, and 171 .
  • the linking residue is position 171 .
  • the FGF21 molecule may comprise SEQ ID NO:73.
  • the FGF21 molecule may comprise SEQ ID NO:74.
  • the FGF21 molecule may comprise SEQ ID NO:75.
  • half life-increasing moiety refers to any molecule that when
  • half life-increasing moieties include PEG, mPEG, phosphorylcholine containing polymers, Fc domains, Fab, Fab', F(ab')2, F v , dsF v , scF v , V H , V L , diabodies, minibodies, antibodies, catalytic antibodies (discussed below), proteins (such as albumin), and other macromolecules known in the art.
  • an “antibody” is an immunoglobulin molecule capable of specific binding to a target, such as a carbohydrate, polynucleotide, lipid, polypeptide, etc., through at least one antigen recognition site, located in the variable region of the immunoglobulin molecule.
  • antibody encompasses not only intact polyclonal or monoclonal antibodies, but also any antigen binding fragment (i.e., "antigen-binding portion") or single chain thereof, fusion proteins comprising an antibody, and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site including, for example without limitation, scFv, single domain antibodies ⁇ e.g., shark and camelid antibodies), maxibodies, minibodies, intrabodies, diabodies, triabodies, tetrabodies, v-NAR and bis-scFv (see, e.g., Hollinger and Hudson, 2005, Nature Biotechnology 23(9): 1 126-1 136).
  • An antibody includes an antibody of any class, such as IgG, IgA, or IgM (or sub-class thereof), and the antibody need not be of any particular class.
  • immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., lgG1 , lgG2, lgG3, lgG4, lgA1 and lgA2.
  • the heavy-chain constant regions that correspond to the different classes of immunoglobulins are called alpha, delta, epsilon, gamma, and mu,
  • CL- ⁇ lambda
  • CL- ⁇ kappa
  • the 3 identified CL- ⁇ polymorphisms are Km(1 ):V 46 /L 84 , Km(1 ,2): A 46 /L 84 , and Km(3) A 46 A/ 84 ).
  • Antibodies of the present invention may therefore comprise a constant kappa domain according to any one of SEQ ID NOs:78, 79, 80 or 81 , or variants thereof that comprise no more than 5, 4, 3, 2, or 1 amino acid insertions, substitutions or deletions. It is understood by the skilled person that residue R 1 of SEQ ID NOs:78, 79, 80 and 81 by some counting methods may be included in the variable domain, and that the constant domains may therefore also be considered as beginning from residue T 2 of said sequences.
  • antigen binding portion of an antibody refers to one or more fragments of an intact antibody that retain the ability to specifically bind to a given antigen (e.g., target X). Antigen binding functions of an antibody can be performed by fragments of an intact antibody. Examples of binding fragments encompassed within the term "antigen binding portion" of an antibody include Fab; Fab'; F(ab') 2 ; an Fd fragment consisting of the VH and CH1 domains; an Fv fragment consisting of the VL and VH domains of a single arm of an antibody; a single domain antibody (dAb) fragment (Ward et al., 1989 Nature 341 :544-546), and an isolated complementarity determining region (CDR).
  • Fab fragment antigen binding portion
  • variable region of an antibody refers to the variable region of the antibody light chain or the variable region of the antibody heavy chain, either alone or in combination.
  • variable regions of the heavy and light chain each consist of four framework regions (FRs) connected by three complementarity
  • CDRs determining regions
  • FRs determining regions
  • FRs flank subject CDRs
  • FRs from antibodies which contain CDR1 and CDR2 sequences in the same canonical class are preferred.
  • a "CDR" of a variable domain are amino acid residues within the variable region that are identified in accordance with the definitions of the Kabat, Chothia, the
  • Antibody CDRs may be identified as the hypervariable regions originally defined by Kabat et al. See, e.g., Kabat et al., 1992, Sequences of Proteins of Immunological Interest, 5th e ⁇ , Public Health Service, NIH, Washington D.C. The positions of the CDRs may also be identified as the structural loop structures originally described by Chothia and others. See, e.g., Chothia et al., 1989, Nature 342:877-883.
  • CDRs In another approach, referred to herein as the "conformational definition" of CDRs, the positions of the CDRs may be identified as the residues that make enthalpic contributions to antigen binding. See, e.g., Makabe et al., 2008, Journal of Biological Chemistry, 283:1 156-1 166. Still other CDR boundary definitions may not strictly follow one of the above approaches, but will nonetheless overlap with at least a portion of the Kabat CDRs, although they may be shortened or lengthened in light of prediction or experimental findings that particular residues or groups of residues or even entire CDRs do not significantly impact antigen binding.
  • a CDR may refer to CDRs defined by any approach known in the art, including combinations of approaches.
  • the methods used herein may utilize CDRs defined according to any of these approaches.
  • the CDRs may be defined in accordance with any of Kabat, Chothia, extended, AbM, contact, and/or conformational definitions.
  • US2006205670 describes a number of compositions and techniques directly applicable to the present application, in particular at paragraphs [0153]-[0233], describing antibodies, useful fragments and variants and modifications thereof, combining sites and CDRs, antibody preparation, expression, humanization, amino acid modification, glycosylation, ADCC, CDC, increasing serum half life of antibodies, expression vectors, mammalian host systems, and folding, amongst other elements of antibody technology.
  • Combining site refers to the region of the immunoglobulin or Ig domains that combine (or can combine) with the determinant of an appropriate antigen (or a structurally similar protein).
  • the term generally includes the CDRs and the adjacent framework residues that are involved in antigen binding.
  • Aldolase antibodies refers to antibodies containing combining site portions that, when unencumbered (for example by conjugation), catalyze an aldol addition reaction between an aliphatic ketone donor and an aldehyde acceptor. Aldolase antibodies are capable of being generated by immunization of an immune-responsive animal with an immunogen that includes a 1 ,3 diketone hapten of the formula: coupled to a carrier protein, and further characterized by having a lysine with a reactive ⁇ -amino group in the combining site of the antibody.
  • Aldolase antibodies are further characterized by their catalytic activity being subject to inhibition with the 1 ,3-diketone hapten by formation of a complex between the 1 ,3-diketone hapten and the ⁇ -amino group of the lysine of the catalytic antibody.
  • certain antibodies that can be used in conjunction with compounds of the invention may require a reactive side chain in the antibody combining site.
  • a reactive side chain may be present naturally or may be placed in an antibody by mutation.
  • the reactive residue of the antibody combining site may be associated with the antibody, such as when the residue is encoded by nucleic acid present in the lymphoid cell first identified to make the antibody.
  • the amino acid residue may arise by purposely mutating the DNA so as to encode the particular residue (e.g. WO 01/22922).
  • the reactive residue may be a non-natural residue arising, for example, by biosynthetic incorporation using a unique codon, tRNA, and aminoacyl-tRNA as discussed herein.
  • the amino acid residue or its reactive functional groups may be attached to an amino acid residue in the antibody combining site.
  • covalent linkage with the antibody occurring "through an amino acid residue in a combining site of an antibody” as used herein means that linkage can be directly to an amino acid residue of an antibody combining site or through a chemical moiety that is linked to a side chain of an amino acid residue of an antibody combining site.
  • the amino acid is cysteine
  • the reactive group of the side chain is a sulfhydryl group.
  • the amino acid residue is lysine, and the reactive group of the side chain is the ⁇ -amino group.
  • the amino acid is Lys93 on the heavy chain according to Kabat numbering.
  • the amino acid is Lys-99 on HC h38C2 (SEQ ID NO:26).
  • Catalytic antibodies are one source of antibodies with suitable combining sites that comprise one or more reactive amino acid side chains.
  • Such antibodies include aldolase antibodies, beta lactamase antibodies, esterase antibodies, and amidase antibodies.
  • One embodiment comprises an aldolase antibody such as the mouse monoclonal antibodies mAb 33F12 and mAb 38C2, as well as suitably chimeric and humanized versions of such antibodies (e.g. h38C2, SEQ ID NOs:25 and 26).
  • Mouse mAb 38C2 (and h38C2) has a reactive lysine near to but outside HCDR3, and is the prototype of a new class of catalytic antibodies that were generated by reactive immunization and mechanistically mimic natural aldolase enzymes. See C.F.
  • aldolase catalytic antibodies that may be used include the antibodies produced by the hybridoma 85A2, having ATCC accession number PTA- 1015; hybridoma 85C7, having ATCC accession number PTA-1014; hybridoma 92F9, having ATCC accession number PTA-1017; hybridoma 93F3, having ATCC accession number PTA-823; hybridoma 84G3, having ATCC accession number PTA-824;
  • hybridoma 84G1 1 having ATCC accession number PTA-1018; hybridoma 84H9, having ATCC accession number PTA-1019; hybridoma 85H6, having ATCC accession number PTA-825; hybridoma 90G8, having ATCC accession number PTA-1016.
  • these antibodies catalyze aldol and retro-aldol reactions using the enamine mechanism of natural aldolases.
  • Aldolase antibodies and methods of generating aldolase antibodies are disclosed in U.S. Patents Nos. 6,210,938, 6,368,839, 6,326,176, 6,589,766, 5,985,626, and 5,733,75, which are incorporated herein by reference.
  • Compounds of the invention may also be formed by linking a compound of the invention to a reactive cysteine, such as those found in the combining sites of
  • thioesterase and esterase catalytic antibodies Suitable thioesterase catalytic antibodies are described by K.D. Janda et al., Proc. Natl. Acad. Sci. U.S.A. 91 :2532-2536 (1994). Suitable esterase antibodies are described by P. Wirsching et al., Science 270:1775- 1782 (1995).
  • Reactive amino acid-containing antibodies may be prepared by means well known in the art, including mutating an antibody combining site residue to encode for the reactive amino acid or chemically derivatizing an amino acid side chain in an antibody combining site with a linker that contains the reactive group.
  • the antibody may be a humanized antibody. Where compounds of the invention are covalently linked to the combining site of an antibody, and such antibodies are humanized, it is important that such antibodies be humanized with retention of high linking affinity for the Z group.
  • Various forms of humanized murine aldolase antibodies are contemplated.
  • One embodiment uses the humanized aldolase catalytic antibody h38c2 lgG1 or h38c2 Fab with human constant domains C K and C Y i1 .
  • C. Rader et al., J. Mol. Bio. 332:889-899 (2003) discloses the gene sequences and vectors that may be used to produce h38c2 Fab and h38c2 lgG1 .
  • FIG. 1 illustrates a sequence alignment between the variable light and heavy chains in m38c2, h38c2, and human germlines.
  • h38c2 may utilize lgG1 , lgG2, lgG3, or lgG4 constant domains, including any of the allotypes thereof.
  • Z binds to the side chain of the lysine residue at position 99 of the heavy chain.
  • Another embodiment uses a chimeric antibody comprising the variable domains (V L and V H ) of h38c2 (SEQ ID NOS:27 and 28) and the constant domains from an lgG1 , lgG2, lgG3, or lgG4.
  • the antibody may be a full-length antibody, Fab, Fab', F(ab') 2 , F v , dsF v , scF v , V H , V L , diabody, or minibody.
  • the antibody may be a full length antibody, and may be selected from the group consisting of lgG1 , lgG2, lgG 2Aa , lgG3, lgG4, lgG 4A b, lgG 4A c, lgG 4 S228P, lgG 4Ab S228P and lgG 4Ac S228P.
  • the antibody or antigen binding portion thereof may comprise the V H and V L domains from h38c2.
  • the antibody may be an antibody comprising the V L and V H domains from h38c2 and a constant domain selected from the group consisting of lgG1 , lgG2, lgG 2Aa , lgG3, lgG4, lgG 4Ab , lgG 4 Ac, lgG 4 S228P, lgG 4Ab S228P and lgG 4Ac S228P.
  • the antibody may be h38C2 lgG1 (SEQ ID NOS:25 and 26).
  • the antibody may be h38C2 lgG2 (SEQ ID NOS:25 and 76).
  • the antibody may be a humanized version of a murine aldolase antibody comprising a constant region from a human IgG, IgA, IgM, IgD, or IgE antibody.
  • the antibody is a chimeric antibody comprising the V L and V H region from a murine aldolase antibody and a constant region from a human IgG, IgA, IgM, IgD, or IgE antibody.
  • the antibody comprises the VL and V H regions from m38C2 (SEQ ID NOS:29 and 30).
  • the antibody is a fully human version of a murine aldolase antibody comprising a
  • the antibody may comprise a light chain variable region (V L ) comprising a V L CDR1 , V L CDR2, and V L CDR3 of the V L sequence shown in SEQ ID NO:27; and a heavy chain variable region (V H ) comprising a V H CDR1 , V H CDR2, and VH CDR3 of the V H sequence shown in SEQ ID NO:28.
  • V L light chain variable region
  • V H heavy chain variable region
  • the CDRs may be determined by a number of known methods of the art.
  • the antibody the antibody comprises a light chain at least 95% identical to SEQ ID NO:25 and a heavy chain at least 95% identical to SEQ ID NO:26.
  • the light chain may be at least 96% identical to SEQ ID NO:25.
  • the light chain may be at least 96% identical to SEQ ID NO:25.
  • the light chain may be at least 97% identical to SEQ ID NO:25.
  • the light chain may be at least 98% identical to SEQ ID NO:25.
  • the light chain may be at least 99% identical to SEQ ID NO:25.
  • the heavy chain may be at least 96% identical to SEQ ID NO:26.
  • the heavy chain may be at least 97% identical to SEQ ID NO:26.
  • the heavy chain may be at least 98% identical to SEQ ID NO:26.
  • the heavy chain may be at least 99% identical to SEQ ID NO:26.
  • the light chain may differ from SEQ ID NO:25 by one amino acid.
  • the heavy chain may differ from SEQ ID NO:26 by one amino acid.
  • the differences between the light chain and SEQ ID NO:25 may be located in the constant region only.
  • the differences between the heavy chain and SEQ ID NO:26 may be located in the constant region only.
  • h38c2 F(ab')2 may be produced by the proteolytic digestion of h38c2 lgG1 .
  • Another embodiment uses an h38c2 scFv comprising the V L and V H domains from h38c2 which are optionally connected by the intervening linker (Gly 4 Ser) 3 (SEQ ID NO:31 ).
  • human antibodies can be generated. For example, it is now possible to produce transgenic animals (e.g. mice) that are capable, upon immunization (or reactive immunization in the case of catalytic antibodies) of producing a full repertoire of human antibodies in the absence of endogenous immunoglobulin production.
  • phage display technology can be used to produce human antibodies and antibody fragments in vitro using immunoglobulin variable (V) domain gene repertoires from unimmunized donors.
  • V immunoglobulin variable
  • human antibodies may also be generated by in vitro activated B cells, e.g., U.S. Patent Nos. 5,567,610 and 5,229,275.
  • Amino acid sequence modification(s) of the antibodies described herein are contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the antibody.
  • Amino acid sequence variants of an antibody are prepared by introducing appropriate nucleotide changes into the antibody nucleic acid, or by peptide synthesis. Such modifications include, for example, deletions from, insertions into, and/or substitutions of residues within the amino acid sequences of the antibody. Any combination of deletion, insertion, and substitution is made to arrive at the final construct, provided that the final construct possesses the desired characteristics.
  • the amino acid changes also may alter post-translational processes of the antibody, such as changing the number or position of glycosylation sites.
  • An antibody or antibody portion of the invention can be derivatized or linked to another molecule (e.g. another peptide or protein).
  • another molecule e.g. another peptide or protein.
  • the antibodies or portion thereof is derivatized such that the ability of the linker to covalently conjugate to the antibody combining is not affected adversely by the derivatization or labelling.
  • an antibody or antibody portion of the invention can be functionally linked (by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other molecular entities, such as another antibody (e.g. a bispecific antibody or a diabody), a detection agent, a cytotoxic agent, a pharmaceutical agent, and/or a protein or peptide that can mediate associate of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
  • another antibody e.g. a bispecific antibody or a diabody
  • a detection agent e.g. a cytotoxic agent, a pharmaceutical agent, and/or a protein or peptide that can mediate associate of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
  • the antibody or antigen binding portion thereof of the invention may be a fusion antibody or an antibody linked to another polypeptide.
  • the variable regions of the antibody are linked to the polypeptide.
  • the antibody is covalently conjugated to a peptide in such a way so as to not interfere with the binding ability of the combining site.
  • the polypeptide may be a therapeutic agent, such as a targeting agent, peptide, protein agonist, protein antagonist, metabolic regulator, hormone, toxin, growth factor or other regulatory protein, or may be a diagnostic agent, such as an enzyme that may be easily visualized, such as horseradish peroxidase.
  • fusion antibodies can be created in which two (or more) single-chain antibodies are linked to one another. This is useful if one wants to create a divalent or polyvalent antibody on a single polypeptide chain, or if one wants to create a bispecific antibody.
  • One type of derivatized antibody is produced by crosslinking two or more antibodies (of the same type or of different types, e.g. to create bispecific antibodies).
  • Suitable crosslinkers include those that are heterobifunctional, having two distinctly reactive groups separated by an appropriate spacer (e.g. m-maleimidobenzoyl-N- hydroxysuccinimide ester) or homobifunctional (e. g. disuccinimidyl suberate).
  • Another type of derivatized antibody is a labelled antibody.
  • useful detection agents with which an antibody or antibody portion of the invention may be derivatized include fluorescent compounds, including fluorescein, fluorescein isothiocyanate, rhodamine, 5-dimethylamine-1 -napthalenesulfonyl chloride, phycoerythrin, lanthanide phosphors and the like.
  • An antibody may also be labelled with enzymes that are useful for detection, such as horseradish peroxidase, galactosidase, luciferase, alkaline phosphatase, glucose oxidase and the like.
  • an antibody When an antibody is labelled with a detectable enzyme, it is detected by adding additional reagents that the enzyme uses to produce a reaction product that can be discerned. For example, when the agent horseradish peroxidase is present, the addition of hydrogen peroxide and
  • diaminobenzidine leads to a colored reaction product, which is detectable.
  • An antibody may also be labelled with biotin, and detected through indirect measurement of avidin or streptavidin binding.
  • An antibody may be labelled with a magnetic agent, such as gadolinium.
  • An antibody may also be labelled with a predetermined polypeptide epitopes recognized by a secondary reporter (e. g., leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags).
  • a secondary reporter e. g., leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags.
  • labels are attached by spacer arms of various lengths to reduce potential steric hindrance.
  • the antibody may also be derivatized with a chemical group such as
  • PEG polyethylene glycol
  • a methyl or ethyl group or a carbohydrate group.
  • These groups may be useful to improve the biological characteristics of the antibody, e.g. to increase serum half-life or to increase tissue binding.
  • the invention provides for processes for generating compounds of the formula:
  • FGF21 is an FGF21 homologue
  • Ex4 is an Exendin4 homologue
  • Ab is an aldolase catalytic antibody or antigen binding portion thereof.
  • the 1 st linker is covalently attached to the side chain of a protein-linking residue in FGF21 and to the combining site of the antibody, and
  • the 2 nd linker is covalently attached to the side chain of a peptide-linking residue in Ex4 and to the combining site of the antibody, and
  • the invention provides a process comprising the steps:
  • tris(2- carboxyethyl)phosphine (TCEP) may be added to a final concentration 0.1 X to 10X fold in comparison to FGF21 (0.5X and 0.75X have been shown to work particularly well). This has the advantage of minimizing the tendency of FGF21AH-A129C to dimerize, such that approximately >75% of the protein is in monomeric form. If the protein is dimerized, then TCEP will break it back to monomer. Apart from TCEP,
  • mercaptoethanol ( ⁇ - ⁇ ) or dithiothreitol (DTT) in concentrations between 0.1 X to 10X may be used to break dimer break to monomer.
  • the reagents such as ⁇ - mercaptoethanol ( ⁇ - ⁇ ) or dithiothreitol (DTT) also react with FGF21 and form a covalent bond with thiol sulphur, and TCEP does not form a covalent bond with FGF21 .
  • Other reagents such as tefra/ / ' s-hydroxymethyl phosphonium chloride and tris- diethylaminomethyl phosphine can readily reduce disulfide and useful for reducing dimer to monomer.
  • the 1 st linker is provided in about 100% DMSO at a concentration of about 10mM.
  • the FGF21 and 1 st linker may be conjugated together by incubation at about room temperature for about 30 mins with gentle swirling.
  • [FGF21 -1 st linker] complexes may be obtained by eluting the mixture through a pre-equilibrated Zeba column, such that excess linker remains in the Zeba column resin.
  • the conjugation of FGF21 with 1 st linker can be carried out at a ratio of between about 1 :1 to about 1 :4.
  • the conjugation between FGF21 and 1 st linker can be carried out at a range of ratios, where the lower limit is selected form the group consisting of about 1 :1 , about 1 :1 .25, about 1 :1 .5, about 1 .75, about 1 :2, and the upper limit is selected from the group consisting of about 1 :2, about 1 :2.25, about 1 :2.5, about 1 :2.75, about 1 :3, about 1 :3.5, and about 1 :4.
  • the amount of linker can be increased to about 2- to about 4- fold excess in equivalent basis compared to FGF21 .
  • the increased amount of 1 st linker can help to expedite the conjugation time. Adding more than about 4-fold excess linker, however, does not produce any further increase in product formation or reaction time. In an excess of about 2-fold of 1 st linker is preferable which provides the FGF21 -linker material. Decreasing the amount of 1 st linker to less than 1 equivalent results in reduced amount of product formation. As the amount of linker dropped to about 0.9 equivalent, and about 0.8 equivalent, 0.7 equivalent, and so on, the amount of product formed decreases. The highest amount of product formed is when the ratio of FGF21 and the 1 st linker is between about 1 :1 to about 1 :2.
  • the [FGF21 -1 st linker] is conjugated to the antibody in a MES or phosphate buffer, at a concentration between about 25 mM and about 150 mM, with a pH range of about 5.5 to about 7.5, or about 6.0 to about 7.0, at between about 0°C and 37°C, and preferably at between about 4°C and about RT.
  • a MES or phosphate buffer at a concentration between about 25 mM and about 150 mM, with a pH range of about 5.5 to about 7.5, or about 6.0 to about 7.0, at between about 0°C and 37°C, and preferably at between about 4°C and about RT.
  • [FGF21 -1 st linker] is conjugated to the antibody in a 100 mM a phosphate buffer with a pH range about 6.0 to about 6.5 at RT.
  • the [FGF21 -1 st linker] may be conjugated to the antibody in a reaction carried out for a time selected from the group consisting of at least 30 mins, at least about 60 mins, at least about 90 mins, at least about 2 hrs, at least about 3 hrs, at least about four hrs, at least about 6 hrs, at least about 12 hrs, at least about 18 hrs and at least about 24 hrs.
  • the invention is based on the surprising application of reverse phase chromatography to isolate Ab- [FGF21 -1 st linker]- ! at high purity.
  • the reverse phase chromatography is conducted over a hydrophobic interaction chromatography(HIC) butyl column.
  • the HIC resin typically comprises beads (for example of hydroxylated methylacrylated polymer) covalently attached to butyl ligands (-OCH 2 CH 2 CH 2 CH3).
  • the invention provides for a process for extracting Ab-[FGF21 -1 st linker]i from a mixture of unconjugated antibody, unconjugated [FGF21 -1 st linker] , Ab-[FGF21 -1 st linker] ⁇ and Ab-[FGF21 -1 st linker] 2 , by reverse phase chromatography over a butyl column.
  • the particle size of the column beads may be below about 50 ⁇ .
  • the particle size of the column beads may be below about 40 ⁇ .
  • the particle size of the column beads may be between about 50 ⁇ and about 20 ⁇ .
  • the particle size of the column beads may be between about 40 ⁇ and about 30 ⁇ .
  • the particle size of the column beads may be about 35 ⁇ .
  • a butyl column of "S" grade may be used.
  • the beads may comprise pores of at least about 500 A.
  • the beads may comprise pores of at least about 750 A.
  • the beads may comprise pores of at least about 1000 A.
  • the beads may comprise pores of between about 450 A and 1050A.
  • the beads may comprise pores of between about 950 A and 1050A.
  • the HIC column may comprise butly conjugated resin beads of about 35 ⁇ comprising pores of between about 1000A.
  • the column may be a butyl 650 S column.
  • This may be at a temperature of between about 0°C and 37°C. This may be at RT (about 15°C to about 25°C). This may be at a temperature of between about 15°C to about 20°C. This may be at between about 16°C to about 18°C. In some aspects of the invention, too high a temperature can result in excess Ab-[FGF21 -1 st linker] 2 species, whereas in too low a temperature, not enough of the desired Ab-[FGF21 -1 st linker] ! species is trapped by the column.
  • the butyl column may subjected to an isocratic wash step with comprising 1 ,6 hexanediol at a concentration of about 2% to about 3%, preferably between about 2.2% and about 2.6%, and most preferably about 2.4%.
  • the wash buffer may be between about pH 6.5 and about pH 7.5, and may be about pH 7.0.
  • the wash buffer may comprise 50 mM sodium phosphate.
  • the 1 ,6 hexanediol may be substituted with an alternative organic diol, such as propylene glycol or unoxol. Alcohols such as isopropanol did not provide satisfactory results.
  • HIC columns are typically run over a steadily decreasing salt concentration: the present invention is in part based on the surprising discovery of particular advantages associated with running a relatively low salt concentration elution buffer with an increasing diol concentration in the isolation of AB-[FGF21 -1 st linker]i species from the conjugation reaction.
  • the elution on the butyl column may be conducted using a linear gradient with a buffer comprising 1 ,6 hexanediol.
  • the elution linear gradient may progress from an initial concentration of between about 2% to about 3%, and preferably between about 2.2% and about 2.6%, and most preferably about 2.4%.
  • the diol elution may be run over a large column volume (at least 20, preferably at least 25 column volumes (CV).
  • the initial diol concentration may be as described as above
  • the final concentration of the linear gradient may be over 20% and may be around 25%.
  • the elution step is run over between 5 and 15 CV, preferably between 8 and 13 CV, more preferably between 10 and 12 CV, most preferably 1 1 CV.
  • the elution buffer may be between about pH 6.5 and about pH 7.5, and may be about pH 7.0.
  • the elution buffer may comprise between about 10 and about 100 mM sodium phosphate.
  • the elution buffer may comprise between about 20 mM and about 80 mM sodium phosphate.
  • the elution buffer may comprise between about 40 mM and about 60 mM sodium phosphate.
  • the elution buffer may comprise 50 mM sodium phosphate.
  • This material may then be diafiltered into suitable buffer (for example, 30 mM sodium lactate pH 4.8 or 20 mM sodium glutamate pH 4.5).
  • suitable buffer for example, 30 mM sodium lactate pH 4.8 or 20 mM sodium glutamate pH 4.5.
  • the Exendin4 homologue and the 2 nd linker may be mixed together a ratio of between about 2:1 to about 1 :2 to form the complex [2 nd Iinker-Ex4]. In some aspects, mixing the Exendin4 homologue and the 2 nd linker together may be done at a ratio of about 1 .5:1 , to form the complex [2 nd Iinker-Ex4]. In some aspects, mixing the Exendin4 homologue and the 2 nd linker together may be done at a ratio of about 1 :1 , to form the complex [2 nd Iinker-Ex4].
  • mixing the Exendin4 homologue and the 2 nd linker together may be done at a ratio of about 1 :1 .5, to form the complex [2 nd Iinker-Ex4]. In some aspects, mixing the Exendin4 homologue and the 2 nd linker together may be done at a ratio of about 1 :2, to form the complex [2 nd Iinker-Ex4].
  • the Exendin4 homologues of the invention comprise a peptide linking residue whose side chain comprises a thiol group. In some embodiments, this thiol group may then undergo a Michael reaction or conjugation additions to the maleimide ring of certain linkers disclosed herein.
  • Exendin4 homologues and 2 nd linkers may be carried out in wide range of solvents including dimethyl sulfoxide, dimethyl formamide, dichloromethane, water, ethanol, acetonitrile acetone, propylene glycol, and any combination of the above solvents.
  • solvents including dimethyl sulfoxide, dimethyl formamide, dichloromethane, water, ethanol, acetonitrile acetone, propylene glycol, and any combination of the above solvents.
  • solvent for the solvent for the solvent including dimethyl sulfoxide, dimethyl formamide, dichloromethane, water, ethanol, acetonitrile acetone, propylene glycol, and any combination of the above solvents.
  • the solvent for the solvent including dimethyl sulfoxide, dimethyl formamide, dichloromethane, water, ethanol, acetonitrile acetone, propylene glycol, and any combination of the above solvents.
  • Exendin4/2 nd linker reaction is selected from the group consisting of dimethyl sulfoxide, dimethyl formamide and water.
  • the conjugation reaction can also be done in mixed solvent system such as acetonitrile-water, dimethyl sulfoxide-water and dimethyl formamide-water.
  • the use of dimethyl sulfoxide, dimethyl formamide, water-acetonitirle solvents are preferred choice due to the ease of solubility of Exendin4 peptides and the 2 nd linker, efficiency of conjugation reaction and subsequent ease of purification of product.
  • the key criterion is the solubility of Exendin4 homologues at concentrations that would be suitable for conjugation and efficiency of conjugation with minimal side products. If the Exendin4 peptide and the 2 nd linker are sparingly soluble (for example, less than about 0.1 M) then the conjugation efficiency will be reduced.
  • an organic base or inorganic base greatly facilitates the formation of thiolate anion in Exendin4 peptides and subsequent conjugation to 2 nd linker.
  • Primary amines and secondary amines generally are not preferred due to their reactivity with the linker. However, primary amines or secondary amines can be used in certain embodiments, provided they react poorly with the linker, tertiary amines such as trimethylamine, triethylamine, diethylmethylamine, diisopropylmethylamine,
  • diethylisopropylamine, triisopropylamine, tributylamine, N-methylmorpholine, and N- methylpiperdine can be used in the conjugation reactions.
  • Most of the above listed amine bases are suited for conjugation reaction. However, the efficiency of the reaction is different among different bases. Some bases are more resistant to react with the linker than the others. In general bulkier bases are preferred, since these bases do not react readily with the linker. Bases such as diisopropylethylannine, triisopropylamine and diethylisopropylamine are preferred as they offer good balance of almost no reactivity with the linker and efficient formation of product.
  • the reactions may also be carried out in aqueous system using inorganic bases such as sodium bicarbonate, sodium carbonate, potassium bicarbonate, potassium carbonate lithium bicarbonate, lithium carbonate, provided these bases do not react with the linker or peptide.
  • the reactions can also be carried out aqueous buffered systems with or without an organic co-solvent.
  • the addition of thiol to double bond is achieved more readily when pH is about 7 and above.
  • the conjugation reaction is slower at pH ⁇ about 7.
  • the conjugation reactions between Ex4 and the linker can generally take place between pH about 5 to about 8. However under more basic conditions the linkers are less stable. The pH closer to neutral level offers both the efficiency and the stability. Wide range of buffers can be used to facilitate the reactions.
  • buffers are suitable for the conjugation reactions including but not limited to phosphate buffer, citrate buffer, glycine/histidine buffer, 2-amino-2-hydroxymethyl-propane-1 ,3-diol buffer, 4-2- hydroxyethyl-1 -piperazineethanesulfonic acid, and 3-(N-morpholino)propanesulfonic acid.
  • Ab-[FGF21 -1 st linker] ! and [2 nd Iinker-Ex4] may be combined at a ratio of about Ab-[FGF21 -linker] :[2 nd Iinker-Ex4] of between about 0.7:1 to about 2:1 .
  • the ratio is about 1 .1 :1 to about 1 .7:1 .
  • the ratio is about 1 :3:1 to about 1 .5:1 .
  • the ratio may be about 1 .4:1 .
  • Ab-[FGF21 -1 st linker] i and [2 nd Iinker-Ex4] may be combined at a pH of between about 5.5 and about 6.5. In some aspects, Ab-[1 st FGF21 -linker] i and [2 nd Iinker-Ex4] may be combined at a pH of between about 6 and about 6.5. In some aspects, Ab-[FGF21 -1 st linker] ! and [2 nd Iinker-Ex4] may be combined at a pH of about 6.3.
  • Ab-[FGF21 -1 st linker] i and [2 nd Iinker-Ex4] may be combined at RT. In some aspects, Ab-[FGF21 -1 st linker] ! and [2nd Iinker-Ex4] may be combined at between about 17°C to about 22°C. In some aspects, Ab-[FGF21 -1 st linker] ! and [2 nd Iinker-Ex4] may be combined at about 19°C.
  • Ab-[FGF21 -1 st linker] i and [2 nd Iinker-Ex4] may be combined following a reaction of at least 6 hrs. In some aspects, Ab-[FGF21 -1 st linker] ! and [2 nd Iinker-Ex4] may be combined following a reaction of at least 8 hrs. In some aspects, Ab- [FGF21 -1 st linker] ! and [2 nd Iinker-Ex4] may be combined following a reaction of at least 12 hrs. According to another embodiment of a process for generating compounds of the invention, the process comprises the steps:
  • [FGF21 -1 st linker] and [Ex4-2 nd linker] may be prepared as described above.
  • [2 nd Iinker-Ex4] and Ab may be conjugated together at a ratio of from about 0.5:1 to about 1 :3 to form [Ab]-[2 nd Iinker-Ex4] i .
  • the ratio may be about 0.6:1 . In some embodiments, the ratio may be about 0.7:1 . In some embodiments, the ratio may be about 0.75:1 . In some
  • the ratio may be about 0.8:1 . In some embodiments, the ratio may be about 0.9:1 . In some embodiments, the ratio may be about 1 :1 . In some embodiments, the ratio may be about 1 .1 :1 . In some embodiments, the ratio may be about 1 .2:1 . In some embodiments, the ratio may be between about 1 :1 and about 0.5:1 . In some embodiments, the ratio may be about 0.7:1 .
  • the ratio of [2 nd Iinker-Ex4] and Ab is about 1 :1 , this provides the maximum amount of [Ab]-[2 nd Iinker-Ex4] species, relative to unconjugated Ab and [Ab]-[2nd Iinker-Ex4] 2 .
  • the ratio is about 1 :1 , a favourable distribution of about 40-50% [Ab]-[2 nd Iinker-Ex4] i is observed, together with about 25% unconjugated Ab, and about 25% Ab-[2 nd Iinker-Ex4] 2 .
  • the reaction ratio may be within a range of two ratios, defined by a lower limit selected from the group consisting of about 0.5:1 , about 0.6:1 , about 0.7:1 , about 0.8:1 , about 0.9:1 and an upper limit selected from the group consisting of about 0.6:1 , about 0.7:1 , about 0.8:1 , about 0.9:1 and about 1 :1 .
  • the ratio is between about 0.6:1 and about 0.8:1 .
  • the ratio is about 0.7:1 .
  • the advantageous ratios of [2 nd linker-Ex4]:[Ab] of the invention help to minimize the formation of [Ab]-[2 nd Iinker-Ex4] 2 while maintaining the amount of formation of [Ab]- [2 nd Iinker-Ex4] i .
  • the peptide may be conserved while still maintaining the yields.
  • buffered system where the pH can be maintained to improve the conjugation efficiency.
  • buffer systems including formulation buffer (made up of glycine, histdine, sucrose), (4-(2-hydroxyethyl)-1 -piperazineethanesulfonic acid ) buffer, N-cyclohexyl-3- aminopropanesulfonic acid buffer, 3-(N-morpholino)propanesulfonic acid buffer, 2-(N- morpholino)ethanesulfonic acid buffer, 3-[4-(2-Hydroxyethyl)-1 - piperazinyljpropanesulfonic acid buffer.
  • phosphate buffer can be used, although may promote antibody aggregation.
  • Other buffers can be used to maintain the pH between about 6 and about 8. Appropriate pH, along with appropriate buffer, plays a critical role in forming maximum amount of Ex4 and antibody adduct.
  • Antibody fusion buffer can be used, although may promote antibody aggregation.
  • Other buffers can be used to maintain the pH between about 6 and about 8. Appropriate pH, along with appropriate buffer, plays a critical role in forming maximum amount of Ex4 and antibody adduct.
  • reaction time to conjugate Ex4 to antibody can vary anywhere between about 2 hrs to about 24 hrs. In most suitable buffers, the reaction times are between about 6 to about 14 hrs. In antibody fusion buffer, the reaction is completed in about 12 to about 15 hrs.
  • the reaction time to conjugate [2 nd Iinker-Ex4] to Ab may be between two time points; the lowest of which may be about 1 , about 2, about 4, about 6, about 8, about 12 hrs or about overnight, and the upper of which may be about 2, about 4, about 6, about 8, about 12, about 14, about 15, about 16, about 17, about 18, about 19, about 20, about 21 , about 22, about 23, about 24, about 36, and about 48, hrs.
  • the conjugation reaction between [2 nd Iinker-Ex4] and Ab may occur between about 5°C and about 40°C. At higher temperature, the conjugation reaction is faster. However, the stability of peptide and linker may be compromised by keeping them at higher temperature for longer period of time.
  • the temperature is lowered, the stability of antibody, peptide and linker is improved, but the conjugation efficiency is subjected to temperature gradation.
  • the temperature between about 15°C and about 25°C is most preferable.
  • the temperature between about 20°C and about 25°C offers efficient conjugation and stability of reagents and products.
  • the temperature at which to conjugate [2 nd Iinker-Ex4] to Ab may be within a range defined by a lower and an upper limit; the lower limit of which may be about 10, about 12, about 13, about 14, about 15, about 16, about 17, about 18, about 19, about 20, about 21 degrees Celsius, and the upper of which may be about 1 1 , about 15, about 16, about 18, about 20, about 22, about 23, about 24, about 25, about 26, about 27, about 28, about 29, about 30, about 31 , about 32, about 33, and about 34, degrees Celsius.
  • the conjugation mixture contains free antibody ([Ab]), antibody with one conjugated Ex4 peptide ([Ab]-[2 nd Iinker-Ex4] i ), and antibody with 2 conjugated Ex4 peptides ([Ab]-[2 nd Iinker-Ex4] 2 ), in addition to free [2 nd Iinker-Ex4] conjugates.
  • the next step involves purification of [Ab]-[2 nd Iinker-Ex4] from rest of the materials.
  • the material can be purified using chromatography columns such as butyl column, carboxymethyl column and ion-exchange column such as strong cation exchange column. Suitable solvents for eluting the antibody conjugates include buffered solutions.
  • the pH of the buffer solutions may be between about 6 and about 8.
  • the aqueous buffers may be made up of either one or combination of ammonium sulphate, sodium phosphate, potassium phosphate, sodium chloride, sodium acetate, ammonium hydroxide, or 2-amino-2-hydroxymethyl-propane-1 ,3-diol 2-[4-(2-hydroxyethyl)piperazin- 1 -yl]ethanesulfonic acid, with or without an organic co-solvent such as isopropanol, propanol, butanol, or ethyl alcohol.
  • the conjugation of [2 nd Iinker-Ex4] with [Ab] in the ratio of 0.7:1 using the process of the invention as described yields about 35% unconjugated antibody; about 48% [Ab]-[2 nd linker-Ex ⁇ ; and about 17% [Ab]-[2 nd Iinker-Ex4] 2 at step (ii) above.
  • loading buffer ammonium sulphate between 0.6M to 0.9M, sodium phosphate between 25 mM to 75 mM, pH between 6.5 and 7.5
  • Another aspect of the invention provides pharmaceutical compositions
  • compositions and/or compounds of the invention comprising compositions and/or compounds of the invention.
  • Agents comprising compositions of the invention may be formulated and administered systemically.
  • compositions of the invention may be formulated in aqueous solutions, emulsions or suspensions, or nonaqueous solutions, suspensions, emulsions, dispersions or sterile powders or lyophilisates suitable for reconstitution into sterile injectable solutions or dispersions.
  • suitable aqueous and nonaqueous diluents, solvents, and carriers include water, ethanol, polyols (such as propylene glycol, polyethylene glycol, glycerol, and the like), suitable mixtures thereof, and oils. Fluidity can be maintained or improved, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
  • compositions of the invention may be formulated in aqueous solutions containing physiologically compatible buffers such as citrate, acetate, histidine or phosphate.
  • physiologically compatible buffers such as citrate, acetate, histidine or phosphate.
  • such formulations may also contain various tonicity adjusting agents, solubilizing agents and/or stabilizing agents (e.g., salts such as sodium chloride, sugars such as sucrose, mannitol, and trehalose, proteins such as albumin, amino acids such as glycine and histidine, surfactants such as polysorbates (Tweens), or cosolvents such as ethanol, polyethylene glycol and propylene glycol).
  • Compositions of the invention may also comprise adjuvants, such as wetting agents, emulsifying and suspending agents, dispersing agents, and preserving agents.
  • compositions of the invention may also comprise suspending agents, such as agar-agar, aluminum metahydroxide, bentonite, ethoxylated isostearyl alcohols, microcrystalline cellulose, polyoxyethylene sorbitol and sorbitan esters, and tragacanth, or mixtures thereof.
  • suspending agents such as agar-agar, aluminum metahydroxide, bentonite, ethoxylated isostearyl alcohols, microcrystalline cellulose, polyoxyethylene sorbitol and sorbitan esters, and tragacanth, or mixtures thereof.
  • compositions of the invention may also comprise various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, and the like. It may also be desirable to include isotonic agents, for example, sugars, sodium chloride, and the like. Prolonged absorption of injectable compositions of the invention may be affected by the use of agents capable of delaying absorption, for example, aluminum monostearate and gelatin.
  • compositions of the invention may contain formulation materials for modifying, maintaining, or preserving, for example, the pH, osmolarity, viscosity, clarity, color, isotonicity, odor, sterility, stability, rate of dissolution or release, adsorption, or
  • Suitable formulation materials include, but are not limited to, amino acids (such as glycine, glutamine, asparagine, arginine, or lysine),
  • antioxidants such as L-methionine ascorbic acid, sodium sulfite, or sodium hydrogen-sulfite
  • buffers such as sodium acetate, lactate, borate, bicarbonate, Tris-HCI, citrates, phosphates, or other organic acids
  • bulking agents such as mannitol or glycine
  • chelating agents such as ethylenediamine tetraacetic acid (EDTA), DPTA
  • complexing agents such as caffeine, polyvinylpyrrolidone, beta-cyclodextrin, or hydroxypropyl- beta-cyclodextrin
  • fillers monosaccharides, disaccharides, and other carbohydrates (such as glucose, mannose, or dextrins), proteins (such as serum albumin, gelatin, or immunoglobulins), coloring, flavoring and diluting agents, emulsifying agents, hydrophilic polymers (such as polyvinylpyrrolidone), low molecular weight poly
  • the formulation components may be present in concentrations that are
  • Buffers may be used to maintain the
  • composition at physiological pH or at a slightly lower pH, typically within a pH range of from about 5 to about 8.
  • compositions of the invention may be prepared wherein compounds of the invention are formulated for the controlled or sustained release of the compound.
  • examples include hyaluronic acid and the like, polymeric gels, beads, particles, injectable microspheres, liposomes, films, microcapsules, sustained release matrices, and implantable drug delivery devices.
  • compositions of the invention are provided in single- or multi-chambered pre-filled syringes.
  • the invention provides for a kit comprising at least one compound or composition of the invention together with at least one additional ingredient suitable for use in a pharmaceutical composition. In some aspects, the invention provides for a kit comprising at least one compound or composition of the invention together with at least one means for delivery of said composition to a patient.
  • compositions comprising [FGF21 -1 st Linker]-[Ab]-[2 nd - Linker-Ex4]; wherein FGF21 is an FGF21 homologue; and Ex4 is an Exendin4 homologue; and Ab is an aldolase catalytic antibody or antigen binding portion thereof; and the 1 st linker is covalently attached to the side chain of a protein-linking residue in FGF21 and to a combining site of the antibody, and the 2 nd linker is covalently attached to the side chain of a peptide-linking residue in Ex4 and to a combining site of the antibody, and wherein the first and second linker are the same or different for use in one or more therapies as herein described. Also provided is the use of compositions of the invention in the treatment of one or more conditions herein described. Also provided is the use of compositions of the invention for the manufacture of a medicament for the treatment of one or more diseases or disorders as herein described.
  • a human, humanized, or human chimeric antibody or antigen binding portion thereof is a preferred antibody form of the antibody portion of the compound or composition of the invention.
  • One aspect of the invention is a method for treating diabetes or a diabetes- related condition comprising administering a therapeutically effective amount of a composition of the invention to a subject suffering from diabetes or a diabetes-related condition.
  • Another aspect of the invention is a method for increasing insulin secretion in a subject comprising administering to the subject a therapeutically effective amount of a composition of the invention or a pharmaceutical derivative thereof.
  • Another aspect of the invention is a method for decreasing blood glucose levels in a subject comprising administering to the subject a therapeutically effective amount of a composition of the invention or a pharmaceutical derivative thereof.
  • Another aspect of the invention is a method for treating obesity in a subject comprising administering to the subject a therapeutically effective amount of a composition of the invention or a pharmaceutical derivative thereof.
  • Another aspect of the invention is a method for controlling or reducing weight levels in a subject comprising administering to the subject a therapeutically effective amount of a composition of the invention or a pharmaceutical derivative thereof.
  • Another aspect of the invention is a method for treating dislipidemia in a subject comprising administering to the subject a therapeutically effective amount of a composition of the invention or a pharmaceutical derivative thereof.
  • Another aspect of the invention is a method for treating hypertension in a subject comprising administering to the subject a therapeutically effective amount of a composition of the invention or a pharmaceutical derivative thereof.
  • Another aspect of the invention is a method for treating hepatosteaotosis in a subject comprising administering to the subject a therapeutically effective amount of a composition of the invention or a pharmaceutical derivative thereof.
  • Another aspect of the invention is a method for treating cardiovascular disease in a subject comprising administering to the subject a therapeutically effective amount of a composition of the invention or a pharmaceutical derivative thereof.
  • Another aspect of the invention is a method for reducing glucagon levels in a subject comprising administering to the subject a therapeutically effective amount of a composition of the invention or a pharmaceutical derivative thereof.
  • Another aspect of the invention is a method for reducing triglyceride levels in a subject comprising administering to the subject a therapeutically effective amount of a composition of the invention or a pharmaceutical derivative thereof.
  • Another aspect of the invention is a method for increasing non-esterified free fatty acid levels in a subject comprising administering to the subject a therapeutically effective amount of a composition of the invention or a pharmaceutical derivative thereof.
  • Another aspect of the invention is a method for reducing low density cholesterol levels in a subject comprising administering to the subject a therapeutically effective amount of a composition of the invention or a pharmaceutical derivative thereof.
  • Another aspect of the invention is a method for reducing C-reactive protein levels in a subject comprising administering to the subject a therapeutically effective amount of a composition of the invention or a pharmaceutical derivative thereof.
  • Another aspect of the invention is a method for reducing fructosamine levels in a subject comprising administering to the subject a therapeutically effective amount of a composition of the invention or a pharmaceutical derivative thereof.
  • Another aspect of the invention is a method for controlling glycemic control in a subject comprising administering to the subject a therapeutically effective amount of a composition of the invention or a pharmaceutical derivative thereof.
  • Another aspect of the invention is a method for increasing levels of adipsin in a subject comprising administering to the subject a therapeutically effective amount of a composition of the invention or a pharmaceutical derivative thereof.
  • composition of the invention or a pharmaceutical derivative thereof.
  • the invention provides for a method of treating diabetes related conditions, obesity, dislipidemia, hypertension, hepatosteaotosis, or cardiovascular disease; or controlling or reducing weight levels; or controlling glycemic control; or increasing insulin secretion, or levels of non-esterified free fatty acids, HDL or adipsin; or reducing levels of blood glucose, glucagon, triglyceride, fructosamine, low density cholesterol, or C-reactive protein; comprising administering a therapeutically effective amount of a compound or a pharmaceutical composition of the invention to a subject.
  • the invention provides for the use of a composition or a pharmaceutical composition of the invention in the preparation of a medicament for treating diabetes related conditions, obesity, dislipidemia, hypertension,
  • hepatosteaotosis or cardiovascular disease; or controlling or reducing weight levels; or controlling glycemic control; or increasing insulin secretion, HDL, or non-esterified free fatty acid levels; or reducing levels of blood glucose, glucagon, triglyceride,
  • fructosamine low density cholesterol, or C-reactive protein.
  • terapéuticaally effective dose means that amount of compound, composition or pharmaceutical composition of the invention that elicits the biological or medicinal response in a tissue system, animal, or human being sought by a researcher, medical doctor, or other clinician, which includes alleviation of the symptoms of a disease or disorder being treated.
  • Administration routes of composition of the invention may include parenteral delivery, including intramuscular, SC, or intramedullary injections, as well as intrathecal, direct intraventricular, IV, and intraperitoneal delivery.
  • parenteral delivery including intramuscular, SC, or intramedullary injections, as well as intrathecal, direct intraventricular, IV, and intraperitoneal delivery.
  • compositions of the invention may be administered through any of the parenteral routes either by direct injection of the formulation or by infusion of a mixture of the formulation of the composition of the invention with an infusion matrix such as normal saline, D5W, lactated Ringers solution or other commonly used infusion media.
  • parenteral routes either by direct injection of the formulation or by infusion of a mixture of the formulation of the composition of the invention with an infusion matrix such as normal saline, D5W, lactated Ringers solution or other commonly used infusion media.
  • a therapeutically effective amount of a composition of the invention or a pharmaceutically acceptable derivative is any of the conditions discussed herein or a condition associated with a symptom herein discussed.
  • composition of the invention may be administered as a daily IV infusion from about 0.1 mg/kg body weight to about 15 mg/kg body weight.
  • some embodiments provide a dose of about 0.5 mg/kg body weight. Other embodiments provide a dose of about 0.75 mg/kg body weight. Other embodiments provide a dose of about 1 .0 mg/kg body weight. Other embodiments provide a dose of about 2.5 mg/kg body weight. Other embodiments provide a dose of about 5 mg/kg body weight. Other embodiments provide a dose of about 10.0 mg/kg body weight. Other embodiments provide a dose of about 15.0 mg/kg body weight. Doses of a composition of the invention or a pharmaceutically acceptable derivative should be administered in intervals of from about once per day to 2 times per week, or
  • a dose is administered to achieve peak plasma concentrations of a composition of the invention according to the invention or a pharmaceutically acceptable derivative thereof from about .002 mg/ml to 30 mg/ml. This may be achieved by the sterile injection of a solution of the administered ingredients in an appropriate formulation (any suitable formulation solutions known to those skilled in the art of chemistry may be used).
  • Desirable blood levels may be maintained by a continuous infusion of composition of the invention according to the invention as ascertained by plasma levels measured by a validated analytical methodology.
  • One method for administering a composition of the invention to an individual comprises administering a FGF21 -linker conjugate to the individual and allowing it to form a covalent compound with a combining site of an appropriate antibody in vivo.
  • the antibody portion of a composition of the invention that forms in vivo may be
  • an antibody may be present in the circulation of the individual following immunization with an appropriate immunogen.
  • catalytic antibodies may be generated by immunizing with a reactive intermediate of the substrate conjugated to a carrier protein.
  • aldolase catalytic antibodies may be generated by administering with keyhole limpet hemocyanin linked to a diketone moiety.
  • composition can therefore be administered as a single dose, as two or more doses (which may or may not contain the same amount of the desired molecule) over time, or as a continuous infusion via an implantation device or catheter. Further refinement of the appropriate dosage is routinely made by those of ordinary skill in the art and is within the ambit of tasks routinely performed by them. Appropriate dosages can be ascertained through use of appropriate dose-response data.
  • the route of administration of the pharmaceutical composition is in accord with known methods, e.g. orally, through injection by SC, IV, intraperitoneal, intracerebral (intraparenchymal), intracerebroventricular, intramuscular, intraocular, intraarterial, intraportal, or intralesional routes; by sustained release systems; or by implantation devices.
  • the connpositions can be administered by bolus injection or continuously by infusion, or by implantation device.
  • the composition can be administered locally via implantation of a membrane, sponge, or other appropriate material onto which the desired molecule has been absorbed or encapsulated.
  • a membrane, sponge, or other appropriate material onto which the desired molecule has been absorbed or encapsulated.
  • the device can be implanted into any suitable tissue or organ, and delivery of the desired molecule can be via diffusion, timed-release bolus, or continuous administration.
  • a composition of the invention may be used in combination with other therapeutic agents used to treat diabetes or diabetes-related conditions, or to increase insulin secretion or decrease blood glucose levels, or to treat any of the conditions discussed herein.
  • a composition of the invention may be administered in combination with insulin, such as for example synthetic human insulin, including rapid acting, short-acting, intermediate-acting, or long-lasting insulin.
  • a composition of the invention may be administered in combination with compounds belonging to the a-glucosidase inhibitor, sulfonylurea, meglitinide, biguanide, or thiazolidinedione (TZD) families.
  • compositions of the invention may also be administered in combination with metabolism-modifying proteins or peptides such as glucokinase (GK), glucokinase regulatory protein (GKRP), uncoupling proteins 2 and 3 (UCP2 and UCP3), glucagon, glucagon like peptide 1 and 2 (Glp1 and Glp2), an exendin, (such as Exendin4), gastric inhibitory polypeptide (GIP), Glp2peroxisome proliferator-activated receptor a (PPARa), leptin receptor (OB-Rb), DPP-IV inhibitors, sulfonylureas, or other incretin peptides.
  • GK glucokinase
  • GKRP glucokinase regulatory protein
  • UCP3 uncoupling proteins 2 and 3
  • glucagon glucagon like peptide 1 and 2
  • Glp1 and Glp2 glucagon like peptide 1 and 2
  • compositions of the invention In order to evaluate potential therapeutic efficacy of a composition of the invention or a pharmaceutically acceptable derivative thereof in combination with other therapeutic agents used to treat diabetes or diabetes-related conditions, increase insulin secretion, or decrease blood glucose levels, these combinations may be tested using methods known in the art.
  • the ability of a combination of a composition of the invention and another therapeutic agent to increase insulin secretion may be measured using an in vitro glucose-stimulated insulin secretion assay.
  • pancreatic ⁇ cells are treated with various concentrations of glucose for a set period of time, and insulin levels are measured using methods known in the art, such as for example a radioimmunoassay.
  • compositions of the invention and other therapeutic agents on insulin secretion may also be measured in vivo, by administering the agents directly to a subject and measuring insulin levels in bodily fluid samples at various time points.
  • Methods for administering known therapeutic agents to a subject for use in combination therapies will be well known to clinical health care providers.
  • Effective dosages of composition of the invention to be administered may be determined through procedures well known to those in the art which address such parameters as biological half-life, bioavailability, and toxicity. Effective amounts of therapeutic agents to be used in combination with composition of the invention or pharmaceutically acceptable derivatives thereof are based on the recommended doses known to those skilled in the art for these agents. These recommended or known levels will preferably be lowered by 10% to 50% of the cited dosage after testing the
  • a therapeutically effective dose refers to that amount of the compound sufficient to result in amelioration of symptoms or a prolongation of survival in a patient.
  • the effective in vitro concentration of a composition of the invention may be determined by measuring the EC 50 . Toxicity and therapeutic efficacy of such agents in vivo can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD 50 (the dose lethal to 50% of the population) and the ED 50 (the dose therapeutically effective in 50% of the population).
  • the dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio LD 5 o/ED 5 o. Compounds which exhibit large therapeutic indices are preferred.
  • the data obtained from these cell culture assays and animal studies can be used in formulating a range of dosage for use in humans.
  • the dosage of such compounds lies preferably within a range of circulating concentrations that include the ED 50 with little or no toxicity.
  • the dosage may vary within this range depending upon the dosage form employed and the route of administration utilized.
  • the therapeutically effective dose can be estimated initially from cell culture assays.
  • a dose may be formulated in animal models to achieve a circulating plasma concentration range that includes the IC 50 (i.e. the concentration of the test compound which achieves a half- maximal inhibition of RT production from infected cells compared to untreated control as determined in cell culture).
  • IC 50 i.e. the concentration of the test compound which achieves a half- maximal inhibition of RT production from infected cells compared to untreated control as determined in cell culture.
  • levels in plasma may be measured, for example, by high performance liquid chromatography (HPLC).
  • compositions of the invention are administered in combination with other therapeutic agents
  • the combined effect of the agents can be calculated by the multiple drug analysis method of Chou and Talalay (T.C. Chou and P. Talalay, Adv. Enzyme Regul. 22:27-55 (1984)) using the equation:
  • fa is the fraction affected by dose D
  • fu is the uninfected fraction
  • Dm is the dose required for 50% effect
  • m is the slope of the dose-effect curve.
  • mutually exclusive drugs i.e., similar modes of action
  • both drugs alone and their parallel lines in the median effect plot both drugs alone and their parallel lines in the median effect plot.
  • mutually nonexclusive drugs i.e., independent mode of action
  • a is 1 .
  • Values obtained assuming mutual non-exclusiveness will always be slightly greater than mutually exclusive drugs.
  • CI values of ⁇ 1 indicate synergy
  • values >1 indicate antagonism
  • values equal to 1 indicate additive effects.
  • the combined drug effects may also be calculated using the CalcuSyn software package from Biosoft (Cambridge, UK).
  • the compounds according to the invention may be solvated, especially hydrated. Hydration may occur during manufacturing of the compounds or compositions
  • the compounds of the invention may be lyophilized.
  • the invention also provides for stereoisomers, tautomers, solvates, prodrugs, and pharmaceutically acceptable salts of compounds of the invention.
  • the invention also provides for compounds according to any of the sequences disclosed herein.
  • Exendin4 homologue means a molecule with at least 80%, and preferably at least 85%, more preferably at least 90% and most preferably at least 95% identity with wildtype Exendin4 (SEQ ID NO:35), and that binds the glucagon-like peptide 1 receptor (GLP1 R) with an affinity equal to or greater than that of wildtype Exendin4, or within at least 2 log below.
  • Exendin4 homologues include variants (comprising natural amino acid deletions, additions and substitutions) and derivatives (comprising non-natural amino acid additions and substitutions and/or further chemical modification).
  • the Exendin4 homologue may be selected from one of the Ex4 sequences provided herein.
  • FGF21 homologue means a molecule with at least 80%, and preferably at least 85%, more preferably at least 90% and most preferably at least 95% identity with wildtype human FGF21 (SEQ ID NO:2), and binds each of FGFRI c and ⁇ -Klotho with an affinity equal to or greater than that of wildtype FGF21 , or within at least 2 log below.
  • FGF21 homologues include variants (comprising natural amino acid deletions, additions and substitutions) and derivatives (comprising non-natural amino acid additions and substitutions and further chemical modification).
  • Known polymorphisms are also included (such as P/L 146 ).
  • the FGF21 homologue may be selected from one of the FGF21 sequences provided herein.
  • xl46 P or L NKSPxRDPxP RGPARFLPLP GLPPAxPEPP GILAPQPPDV
  • FGF2 ⁇ -HIC CPIPDSSPLL QFGGQVRQRY LYTDDAQQTE AHLEIREDGT H1C, L146 VGGAADQSPE SLLQLKALKP GVIQILGVKT SRFLCQRPDG
  • VGGAADQSPE SLLQLKALRP GVIQILGVRT SRFLCQRPDG ALYGSLHFDP EACSFRELLL EDGYNVYQSE AHGLPLHLPG NRSPHRDPAP RGPARFLPLP GLPPALPEPP GILAPQPPDV GSSDPLSMVG PSQGRSPSYAS
  • Ex4 homologue x2 Aib HxEGTFTSDL SKQMEEEAVR LFIEWLKNGG PSSGAPPPS
  • Ex4 homologue x40 K, KSH, HGEGTFTSDL SKQMEEEAVR LFIEWLKNGG PSSGAPPPSx KSMAL, Dap, Dab, R, Y, C, T, S
  • Ex4 homologue x2 is Aib PLR@x31 HxEGTFTSDL SKQMEEEAVR LFIEWLKNGG X
  • Ex4 homologue xl is d-His
  • x2 is xxEGTFTSDL SKQxEEEAVR LFIEWLKNGG PSSGAPPPS
  • Ex4 homologue x2 is Aib HxEGTFTSDL SxQxEEEAxx xFIEWLKNGG PSSGAPPPSx x40 when present is any amino
  • x20, x21 is a PLR selected from
  • X1 H or absent, P146, P171C, VGGAADQSPE SLLQLKALKP GVIQILGVKT SRFLCQRPDG
  • h38C2-IgG2 HC EVQLVESGGG LVQPGGSLRL SCAASGFTFS NYWMSWVRQS
  • Ex4 homologue XI is C(0)CH 3 XHXEGTFTSD LSKQxEEEAV RLFIEWLKNG
  • x3 is Aib GPSSGAPPPSx
  • SEQ ID NO:1 shows the 181 -residue expressed protein where H 1 is optional and residue 146 may be L or P. Residue positions tested for conjugation are underlined and in bold. The numbering for SEQ ID NO:1 is used throughout.
  • variable regions (VC and VH) are underlined and complementarity determining regions (CDRs) presented in bold. Lysine 99, whose side chain covalently combines with the linkers described herein, is adjacent HC CDR3.
  • Figure 1 Amino acid sequence alignment of the variable domains of m38c2, h38c2, and human germlines.
  • Framework regions (FR) and CDRs are defined according to Kabat et al. Asterisks mark differences between m38c2 and h38c2 or between h38c2 and the human germlines.
  • FIG. 2A, 2B, and 2C Single dose mouse pharmacokinetic studies with Ab- FGF21AH-A129C conjugated with Linker-1 (L-1 ) in comparison with L-2, L-3, or L-4. Young adult male Swiss-Webster mice were dosed either IV or SC at 3 mg/kg. In all cases, the conjugate with L-1 performed better with respect to half-life (-33 hrs SC and IV for L-1 conjugate, 13-23 hrs SC and 22-37 hrs IV for L-2, -3, and -4 conjugates) and/or SC bioavailability (-100% for L-1 conjugate, 48-53% for L-2, -3, or -4
  • FIG. 3A Single dose rat pharmacokinetic study with Ab-FGF21AH-A129C conjugated with L-1 in comparison with L-2.
  • Adult male Sprague Dawley rats were dosed either IV or SC at 3 mg/kg.
  • the conjugate with L-1 performed better than the L-2 conjugate with respect to half-life (-39 hrs SC and -60 hrs IV for L-1 conjugate, -33 hrs SC and -52 hrs IV for L-2 conjugate) and SC bioavailability (-52% for L-1 conjugate, 36% for L-2 conjugate).
  • Figure 3B Comparison of PK of Ab-L1 -FGF21AH-D79C, Ab-L7-FGF21AH-D79C, and Ab-L8-FGF21AH-D79C.
  • FIGs 4A and 4B Glucose area under the curve (AUC) during oral glucose tolerance test (OGTT) in ob/ob mice given a single SC dose (Mean Glucose AUC (% of vehicle control) in square brackets):Vehicle [100], FGF21AH (1 mg/kg [74]), FGF21AH (0.6 mg/kg [103]) (not shown in Figure 4B for clarity), Ab-FGF21AH-H125C (3 mg/kg [66] and 1 mg/kg [87]) (conjugated with L1 ), Ab-FGF21AH-K59 (3 mg/kg [105])
  • FIG. 5A and 5B Cumulative body weight (A) and liver weight (B) change during
  • OGTT in ob/ob mice given a single SC dose (mean body weight (g) in square brackets, mean liver weight (g) in curly brackets): Vehicle [2.6] ⁇ 2.4 ⁇ , FGF21AH (1 mg/kg [2.5] ⁇ 2.2 ⁇ ), FGF21AH (0.6 mg/kg [3.2] ⁇ 2.4 ⁇ ), Ab-FGF21AH-A129C (3 mg/kg[1 .7] ⁇ 2.0 ⁇ ) (conjugated with L1 ), Ab-FGF21AH-K59 (3 mg/kg [2.7] ⁇ 2.4 ⁇ ) (conjugated with L5), Ab- FGF21AH-Knull-H1 K (3 mg/kg [2.6] ⁇ 2.4 ⁇ ) (conjugated with L5), lean control [0.6] ⁇ 1 .0 ⁇ . * P ⁇ 0.05, ** P ⁇ 0.01 vs PBS by two-way ANOVA (A) and one-way ANOVA (B).
  • Figure 6A Cumulative body weight change in ob/ob mice given a single dose (mean body weight (g) in square brackets): Vehicle [1 .7], FGF21AH [1 .9], FGF21AH- D79C (2mg/kg [2.1]), Ab-FGF21AH-D79C (10mg/kg [1 .4]), Ab-FGF21AH-H125C
  • FIG. 6B Glucose AUC during OGTT in ob/ob mice given a single dose (mean glucose AUC % in square brackets): vehicle [100], FGF21AH [63], Ab- FGF21AH-D79C (2mg/kg [86]), FGF21AH-D79C (10mg/ml [54]), Ab-FGF21AH-H125C (10mg/ml [51 ]), and Ab-FGF21AH-A129C (10 mg/kg [54]), lean control [48]. All Ab conjugates used L1 . ** P ⁇ 0.01 vs Vehicle by one-way ANOVA.
  • FIG. 6C Glucose AUC during OGTT in ob/ob mice dosed with FGF21AH and Ab-FGF21AH-D79C, (10 mg/kg). Ab-FGF21AH-D79C was conjugated with Linker-1 . ** P ⁇ 0.01 vs Vehicle.
  • Figure 6D Glucose AUC during OGTT in ob/ob mice dosed with FGF21AH and Ab-FGF21AH-D79C (10 mg/kg) on day 6. Ab-FGF21AH-D79C was conjugated with L1 . ** P ⁇ 0.01 vs ob/ob-PBS.
  • FIG. 6E Glucose AUC during OGTT conducted on d6 in ob/ob mice given a single dose of Ab-FGF21AH-A129C on day 0, 1 , 2, or 3 (3 mg/kg). Ab-FGF21AH-A129C was conjugated with L1 . * P ⁇ 0.05, *** P ⁇ 0.001 vs PBS by one-way ANOVA.
  • FIG. 6F A single dose of Ab-FGF21AH-A129C increases Ucp1 expression in white adipose tissue in ob/ob mice (10 mg/kg). Ab-FGF21AH-A129C was conjugated with L1 .
  • FIG. 6G A single dose of Ab-FGF21AH-A129C decreases liver triglycerides in ob/ob mice (10 mg/kg). Ab-FGF21AH-A129C was conjugated with L1 . * P ⁇ 0.05,
  • Figure 6H Cumulative body weight change in ob/ob mice given a single dose of Ab-FGF21AH-A129C on day 0, 1 , 2, or 3 (10 mg/kg). Ab-FGF21AH-A129C was conjugated with L1 .
  • Figure 7A Repeat dose of Ab-FGF21AH-A129C (10 mg/kg on day 0 and 7) improves glucose tolerance in DIO mice. OGTT was conducted on day 10. Ab- FGF21AH-A129C was conjugated with L1 . * P ⁇ 0.05, ** P ⁇ 0.01 , *** P ⁇ 0.001 vs Vehicle by one-way ANOVA.
  • FGF21AH-A129C on day 0 and 7 (10 mg/kg). Ab-FGF21AH-A129C was conjugated with L1 . * P ⁇ 0.05, vs Vehicle by two-way ANOVA.
  • FIG. 7C Repeat dose of Ab-FGF21AH-A129C increases Ucp1 expression in white adipose tissue in DIO mice (10 mg/kg). Ab-FGF21AH-A129C was conjugated with L1 . ** P ⁇ 0.01 vs Vehicle by one-way ANOVA.
  • FIG. 7D Ab-FGF21AH-A129C lowers serum triglycerides in DIO mice (10 mg/kg).
  • Figure 7E Ab-FGF21AH-A129C lowers serum non-esterified fatty acids in DIO mice (10 mg/kg).
  • Figure 7F Ab-FGF21AH-A129C Liver weight. Ab-FGF21AH-A129C was conjugated with L1 . * P ⁇ 0.05, ** P ⁇ 0.01 , *** P ⁇ 0.001 vs Vehicle (A, B) and vs PBC (C) by one-way ANOVA.
  • Figure 7G, 7H, 7i Effect of Ab-FGF21AH-A129C on Hepatic Gene Expression in ob/ob Mice.
  • SCD1 stearoyl-CoA desaturase 1
  • MOGAT2 monoacyglycerol acyltransferase 2
  • FoxA2 forkhead transcription factor A2.
  • Ab-FGF21AH-A129C was conjugated with L1 . ** P ⁇ 0.01 vs Vehicle by one-way ANOVA.
  • Ab[FGF21] 2 h38C2(lgG2)-[SEQ ID NO:10-L1 ] 2 .
  • Ab[Ex4] 2 h38C2(lgG1 )-[SEQ ID NO:64-L1 ] 2 .
  • ABC-1 [SEQ ID NO:10-L1 ] i-[h38C2-lgG1 ]-[L1 -SEQ ID NO:64] i .
  • conjugation through a surface lysine side-chain and conjugation through a surface cysteine side-chain.
  • globular proteins do not have unpaired cysteine residues on their surface, and thus incorporation of a single cysteine in the protein surface can be used to engineer in a single site for specific conjugation.
  • the mutation of surface residues with cysteine can often cause problems such as inter- molecular dimerization, mis-pairing of native disulphide bonds, and interference with receptor binding. For these reasons, protein conjugation is most commonly affected through lysine residues.
  • FGF21 binds to both FGFRI c and FGFR4, but the receptor complex can be activated only through FGFRI c.
  • FGFRI b and FGFRI c share 87% identity (FGFR1 b is identical to FGFR1 c except for the lllb/c alternative splicing region)
  • FGF21 specifically recognizes only FGFRI c.
  • homology modelling of the complex structure of FGF21 -FGFR1 c was performed by using the FGFR2-FGFR1 c crystal structure as a template. MOE software was used for homology modelling and structural analyses. The activation of the receptor requires another cell-surface receptor, ⁇ .
  • has two domains which are very similar ( ⁇ 35% identical) to human cytosolic ⁇ - glucosidase.
  • the human ⁇ structure was modelled by using human cytosolic ⁇ - glucosidase, and the structure in the modelled structure of FGF21 -FGFRI c aligned.
  • This modelled complex structure provided rational guidelines for the optimum lysine conjugation sites and optimum cysteine residue incorporation in FGF21 , which should not interrupt the binding interfaces between FGF21 and FGFRI c and between FGF21 and ⁇ .
  • the following criteria were used for conjugation site selection: (1 ) residues should be exposed to the solvent in the structure as much as possible; (2) residues should be far from the disulphide bond; (3) residues should be far from the receptor and ⁇ -Klotho binding surfaces.
  • Exposure to solvent can be assessed based on the accessible surface area
  • ASA ASA
  • CCP4 The CCP4 Suite: Programs for Protein Crystallography”. (1994) Acta Cryst. D50, 760-763) and an in-house program. Briefly the program in CCP4 calculates a value in square angstroms per residue in its log file. In order to calculate the fraction of ASA (fASA), an in-house program was used to normalize ASA per residue. Table 1 shows residues of ASA as well as fASA. Residues whose side chain is predicted to be obscured the surface are not included. Column 1 is the amino acid name, 2 is the residue number, 3 is ASA (as square angstrom), 4 is the fraction exposed. The fASA value defines the accessibility of solvent to the amino acid residue in a given
  • a fASA value close to zero indicates that the residue is predicted to be inaccessible to solvent, suggesting that it is more unlikely to be accessible to the linkers for conjugation.
  • An absolute minimum fASA value of 0.3 was used, with surface area values >1 .00 suggestive of particularly likely candidate conjugation sites.
  • K122 surface area of 164.4
  • K59 surface area of 1 17.2
  • K69 surface area 91
  • K56 surface area 73
  • FGF21 cDNA was purchased from ATCC. Mammalian and bacterial expression vectors were constructed by using pcDNA3.1 (Invitrogen® and pET21 b (EMD), respectively. For the mutational variants of FGF21 , mutations were introduced into the expression vectors using a QuikChange® site-directed mutagenesis kit (Stratagene®). The presence of the desired mutations was verified by DNA sequencing.
  • HEK293F cells (Invitrogen®) were transfected with the mammalian expression vector of FGF21 using 293fectin reagent (Invitrogen®) and grown in serum-free medium. Sterile-filtered, conditioned media were dialyzed against buffer A (20 mM Tris-HC1 , pH 7.5) and loaded onto a HiTrap Q column (GE).
  • FGF21 protein was eluted with a linear gradient from buffer A to buffer B (20 mM Tris-HC1 , pH 7.5, and 100 mM NaCI). The pooled fraction was concentrated and loaded onto Sephadex 300 with phosphate buffer saline (PBS, pH 7.4). The resulting protein solution was concentrated and stored below - 80°C. The purity was confirmed by SDS-PAGE and RP-HPLC.
  • the bacterial expression vector was transformed into the host strain BL21 - (DE3)-RIL (Stratagene®).
  • the transformed cells were grown in 1 liter of LB medium at 37°C, and expression was initiated by addition of 1 mM isopropyl ⁇ -D-thiogalactopyranoside. After 4 hr, cells were harvested and frozen at -20°C. The frozen cell paste was suspended in lysis buffer (50 mM Tris, 10 mM EDTA, pH 7.5), and passed through the microfluidizer 4 times. After 30 min
  • the inclusion body (IB) containing pellet was resuspended in 50 mM Tris, pH 7.5.
  • the washed IB slurry was centrifuged (30 min, 17,000 X g, 4°C).
  • the IB pellet was stored at -80°C.
  • the frozen IB pellet was solubilized with 7 M urea, 5 mM DTT and 50 mM bis-tris propane, pH 10.5 at 1 to 10 mg/ml FGF21 and stirred for 1 hr to dissolve and reduce protein.
  • the solubilized IB was then diluted 10 times into 50 mM Bis-Tris propane, pH 8.0. Final protein concentration was 0.1 to 1 mg/mL.
  • the solution was stirred for ⁇ 2 days and dialyzed against 4 liters of 20 mM Tris- HCI, pH7.5.
  • the protein solution was centrifuged at 14,000 X g for 30 min.
  • the supernatant was loaded to HiTrap Q HP (GE Healthcare®) and equilibrated with buffer A (see above). Unbound bacterial proteins were washed with buffer A and FGF21 protein was eluted with a linear gradient of buffer B.
  • the FGF21 fraction was then loaded onto a HiTrap chelating HP column (GE Healthcare®) pre-equilibrated with PBS buffer.
  • FGF21 protein was eluted with a linear gradient from PBS to PBS buffer plus 100 mM imidazole (pH was adjusted to 7.4).
  • the fractions were collected and concentrated (up to 50 mg/mL) and the protein solution applied to a size exclusion column (Hiload 26/60, superdex 300) equilibrated with PBS (Gibco®, pH7.4).
  • Purified protein was sterilized by 0.22 ⁇ filter and stored at -80°.
  • Typical yield of FGF21 AH from 8L culture media was 600 ⁇ 700 mg.
  • Typical purity was > 95%.
  • Typical endotoxin level was ⁇ 1 EU/mg.
  • the cysteine and lysine-to-arginine mutants of FGF21 were produced and purified in a similar manner to FGF21 AH.
  • a typical yield of purified protein was 350 ⁇ 400 mg. Free cysteine was confirmed by using Ellman's reagent.
  • Linker 1 Palladium on carbon (e.g. about 1 .0 g, about 0.47 mmol) was added in one portion followed by hydrochloric acid (e.g. about 2.5 ml_, about 30.2 mmol) dropwise to a suspension of 13A (e.g. about 5 g, about 20.1 mmol) in methanol (e.g. about 200 ml_) at about 35°C under an atmosphere of nitrogen. Hydrogen was slowly bubbled in to the solution at about 35°C and the solution was stirred for about 2 hrs at that temperature. The solid was filtered through a bed of celite, and collected. The filtrate was concentrated under reduced pressure and the solid was dried under vacuum to give 13B as hydrochloride salt.
  • hydrochloric acid e.g. about 2.5 ml_, about 30.2 mmol
  • 13A e.g. about 5 g, about 20.1 mmol
  • methanol e.g. about 200 ml_
  • Compound 13B was mixed with dichloromethane (e.g. about 200 ml_) and saturated solution of sodium bicarbonate (for example, about 250 ml_), and the dichloromethane layer was separated. The dichloromethane layer was washed with saturated sodium chloride (e.g. about 250 ml_) and dried on sodium sulphate. The organic layer was filtered, concentrated under reduced pressure and purified using flash chromatography (SiO 2 , about 60% ethyl acetate in hexanes) to give a yield of about 68% (e.g. about 2.94 g) of 13C. A solution of 13C (e.g. about 4.65 g, about 21 .3 mmol), 13D (e.g.
  • Linker 1 (e.g. about 8.25 g a yield of about 73%).
  • DMF e.g. about 10 mL
  • HOBT e.g. about 1 .9 g, about 16.7 mmol
  • Diisopropylethylamine (e.g. about 5 eq, about 83.5 mmol) was added and the reaction mixture was warmed to room temperature and stirred for another about 16 hrs.
  • the reaction was poured into water, acidified with 1 N HCI, and extracted with ethyl acetate (e.g. about 3x about 30 mL).
  • the organic layer was washed with water (e.g. about 2 X about 30 mL) and brine (e.g. about 30 mL), and then dried over sodium sulphate.
  • the solvent was removed under vacuum and the crude mixture was purified by column chromatography. The desired fractions were pooled and concentrated under reduced pressure to give 17A.
  • Compound 17A (e.g. about 0.5 g, about 2.09 mmol) was stirred in about 15% trifluoroacetic acid in dichloromethane at room temperature for about 2 hrs and concentrated to dryness under reduced pressure.
  • the free acid 18 was added to N- hydroxysuccinimide (e.g. about 0.25 g, about 2.09 mmol) in tetrahydrofuran (e.g. about 20 mL), followed by diisopropylcarbodiimide (e.g. about 0.33 ml, about 2.09 mmol) and was stirred for about 4 hrs at room temperature. Diisopropyl urea was filtered off. The filtrate was evaporated to dryness. Petroleum ether (e.g. about 30 mL) was added to the residue, triturated, shaken and the petroleum ether layer was decanted. This procedure was repeated one more time with petroleum ether and the product 18 dried under vacuum.
  • N- hydroxysuccinimide e.g
  • Amine-peg2-tbutyl ester, 19 (e.g. about 0.5 g, 2.09 mmol) was added to a THF solution of the activated 18 followed by excess DIPEA (e.g. about 3 equivalents). The solution was stirred at room temperature for a minimum of 1 hr and purified by HPLC- MS collecting Mass of 343 and 399. The fractions containing the desired product were pooled and lyophilized to collect 20. The residue was dissolved in about 15% trifluoroacetic acid in dichloromethane and few drops of water and stirred at room temperature for about 2 hrs. The reaction was concentrated to approximately 1 ml and treated with water precipitate the product. The crude material was purified using HPLC- MS to yield 21 (M+343).
  • a solution of acid 21 e.g. about 60 mg, about 0.18 mmol
  • HBTU e.g. about 137 mg, about 0.36 mmol
  • aniline hydrochloride 13B e.g. about 45 mg, about 0.18 mmol
  • diisopropylethylamine e.g. about 0.14 ml, about 0.90 mmol
  • DMF e.g. about 2 mL
  • the desired fraction was pooled and concentrated to collect L2 (e.g. about 16 mg, about 0.03 mmol).
  • a solution of citraconic anhydride, 14 e.g. about 0.5 g, about 16.4 mmol
  • amine-peg2- tbutyl ester 23 e.g. about 1 .0 g, about 4.2 mmol
  • DMF e.g. about 10 mL
  • Diisopropylcarbodiimide e.g. about 0.8 mL, about 5.2 mmol
  • HOBT e.g. about 0.7 g, about 6.1 mmol
  • the reaction solution was cooled to about 0°C, DIPEA (e.g. about 1 .98 ml_, about 1 1 .4 mmol) followed by pentafluorophenyl trifluoroacetate (e.g.
  • N-Methyl morpholine (e.g. about 290 ⁇ _, about 2.64 mmol) was added to the solution of the pentafluorophenyl ester intermediate (15, e.g. about 550 mg, about 1 .32 mmol) and 3-[2-(2-amino-ethoxy)-ethoxy]-propionic acid terf-butyl ester (e.g. about 295 mg, about 1 .32 mmol) in terahydrofuran (THF, e.g. about 5 ml_) and stirred at room temperature for about 2 hrs. The solvent was removed under vacuum and the residue was dissolved in DMF and purified by preparative HPLC.
  • the terf-butyl ester e.g. about 290 ⁇ _, about 2.64 mmol
  • the material was concentrated under reduced pressure and dried on a vacuum pump overnight to afford IV.
  • the crude IV was dissolved in dichloromethane (e.g. about 15 ml_), and dimethyl formamide (about 2 drops) and stirred with oxalyl chloride (e.g. about 465 mg, about 3.66 mmol) for about 2 hrs.
  • the solvent was removed under reduced pressure and the oil was dried under vacuum for 1 hr.
  • the oil was dissolved in dichloromethane (e.g. about 15 ml_) and stirred with 13B (e.g. about 464 mg, about 1 .83 mmol) and diisopropyl ethylamine (e.g.
  • Linker 7 (e.g. about 323 mg, about 39%).
  • FGF21 mutant proteins were reacted with the relevant linker at 1 :10 molar ratio at room temperature for 2 hrs. All linker-attached FGF21 proteins were then purified using PD-10 column and buffer exchanged into 20 mM Tris-HCI, 20 mM NaCI, pH 7.0.
  • Example 12 Conjugating protein-linker complex with antibody.
  • FGF21 proteins were expressed in E. coli. Bacterially expressed FGF21 proteins were found in inclusion bodies. After lysing the cells and removal of the supernatant, the pellets were dissolved in 7 M urea, 50 mM Bis-Tris propane, pH 10.5 at 4°C. The solubilized inclusion bodies were diluted into 50 mM Bis-Tris propane, 10 mM oxidized glutathione, ph 9.0 and stirred for 2 hrs, followed by dialysis against 20 mM Tris-HCI, ph 7.5 at 4°C overnight. The soluble fractions were purified by HiTrap Q column. Proteins were characterized by SDS-PAGE analysis. Expression levels of the lysine mutants were 10-50 mg/L.
  • Differentiated 3T3-L1 adipocytes were used to measure the Glutl mRNA expression by qPCR method. Overnight serum starved day 10-14 differentiated 3T3-L1 adipocytes were treated with compounds for 6 hrs. Total RNA was extracted from these cells, and Glutl and GAPDH mRNA expression was measured using a Quantitect Probe RT-PCR kit and running a quantitative real time PCR reaction in a Taqman machine (Applied Biosystems®). The bioactivity of the compounds was determined by a fold change in Glutl mRNA levels normalized by the GAPDH mRNA levels from each sample. EC50 values as measurements of the potency of the compounds were obtained from the dose response curves in the assay.
  • Differentiated 3T3-L1 adipocytes were treated with compounds in the absence of serum for 24 hrs. Cells were then incubated with 14 C-2-deoxyglucose for 1 hr and glucose uptake into the cells was quantitated in Wallac 1450 MicroBeta (Trilux) instrument. Glucose uptake was expressed in counts per min (CPM). EC50 values as measurements of the potency of the compounds were obtained from the dose response curves in the assay.
  • the PK of FGF21 antibody conjugates were examined in mice after IV or SC administration.
  • Antibody conjugates were injected into young adult male Swiss-Webster mice (20-25 g), and blood samples were obtained at time points from 5 mins to 120 hrs after dosing.
  • Antibody conjugates concentrations in serum were determined using an ELISA which captured the FGF21 portion of the antibody conjugates through a monoclonal anti-hFGF21 antibody bound to a 96-well plate.
  • FGF21 antibody conjugates bound to the plate were detected through an anti-hFc monoclonal antibody, and concentrations were determined using a standard curve of the PK dosing solution diluted into serum-containing assay buffer.
  • SC bioavailability was calculated as the ratio of the area-under the curve (AUC) of the SC serum concentration profile divided by the AUC of the IV serum concentration profile.
  • FGF21 antibodies conjugates were evaluated in two murine obese insulin resistant models - ob/ob mice and high-fat diet-induced obese mice.
  • male mice (6-8 weeks of age for ob/ob, 12-14 weeks of age for DIO with high- fat diet initiated at 6 weeks of age) were housed 2-4/cage and FGF21 antibody conjugates were administered by SC injection.
  • Body weight was measured daily in the morning.
  • Glucose tolerance was assessed by oral glucose tolerance test. Briefly, mice were fasted for 4-5 hrs in the morning of the day of testing. A basal blood sample was obtained and blood glucose levels were determined using a portable glucometer.
  • glucose was administered by oral gavage, and blood samples were drawn from 15 to 120 mins thereafter.
  • Glucose tolerance was calculated as the AUC from the basal to the 120 min time point.
  • FGF21AH-K56R-K59R-K69-K122R was combined with L5 at K69, and conjugated with h38C2 to form Ab-L5-FGF21AH-K69.
  • FGF21AH-Knull-P2 (SEQ ID NO:22) was generated and purified as described.
  • FGF21AH- Knull-P2 was combined at the N' terminus of P 2 with L5, and conjugated with h38C2 to form Ab-L5-FGF21AH-Knull-P2.
  • FGF21AH-Knull-H1 K was combined with L5 at H1 K and conjugated with h38C2 to form Ab-L5-FGF21 AK-Knull-H1 K.
  • cysteine residue may find itself in contact with other residues, and/or form a salt bridge or hydrogen bond.
  • a number of residues were selected based on potential for being distally located from the FGFRI c and Klotho binding sites: His1 , Thr40, Asp79, Leu86, His125 and Ala129.
  • FGF21 AH-H1 C (SEQ ID NO:16) was generated and expressed. However,
  • FGF21 AH-H1 C mutants lacked the N' cysteine group, and therefore investigation of this mutant was discontinued.
  • FGF21 AH-T40C (SEQ ID NO:15) presented significant challenges.
  • the cysteine mutation of threonine at position 40 caused multiple species of FGF21 ⁇ - T40C in RP-HPLC after refolding. Further attempts were made to improve the refolding process by changing the concentration of protein and pH, with and without addition of glutathione. The refolding process was monitored by RP-HPLC. Addition of glutathione resulted in efficient refolding of T40C; however, it was found that glutathione was attached on FGF21 , most likely through the introduced cysteine at position 40. The glutathione adduct showed the same biological activity as wild type FGF21AH, indicating that the position 40 is not involved in the receptor activation by FGF21 .
  • FGF21 AH-D79C (SEQ ID NO:12) was generated and purified as described.
  • Example 30 Stability assay of FGF21AH-D79C FGF21AH-D79C mutant protein was produced in E. coli and purified as described above. FGF21AH-D79C was expressed from 1 L of culture. A 150 mg inclusion body was obtained and 85 mg purified protein was obtained, representing a 60% yield. To test the stability of FGF21AH-D79C as well as FGF21AH (SEQ ID NO:2), freshly thawed samples were kept at 4°C over seven days, and examined for their integrity by RP- HPLC, SEC_HPLC, Ellman assay and SDS-PAGE on day 0, 3 and 7.
  • FGF21AH-D79C is stable at neutral pH 7.4: only slight amounts of FGF21AH-D79C appeared oxidized and dimerized even after seven-day incubation at 4°C, while more than half of FGF21AH-D79C was oxidized at lower pH 6.0 after three-day incubation at 4°C.
  • PBS pH7.4
  • 20 mM Tris-HCI 50 mM NaCI pH7.5
  • FGF21AH-D79C was more stable at pH 7.4 than at pH 6.0.
  • the calculated isoelectric point (pi) of WT FGF21 was 5.43 (e.e., FGF21 -H1 -P146); the pi of FGF21 AH was 5.27; and the pi of FGF21AH-D79C was 5.47. It is possible that the solubility of FGF21AH-D79C may be reduced at pH6.0.
  • the stability of FGF21AH-D79C was examined upon multiple freeze/thaw cycles. The proteins were repeated to freeze (-80 C) and thaw (4°C) 9 times. Neither sample showed any difference between cycle 1 and cycles 9 in RP-HPLC, SEC and Ellman assay. In conclusion, FGF21 AH-D79C appeared to be significantly less stable at 4°C than at -80°C.
  • FGF21 AH-L86C (SEQ ID NO:14) was generated and purified as described.
  • Leu86 is a hydrophobic residue, and appears solvent exposed in the modelled structure of FGF21 . It was postulated that the mutation L86C may provide solubility benefits.
  • the L86C mutation resulted in inefficient refolding and low protein yield.
  • Addition of glutathione resulted in efficient refolding of L86C; however, it was found that more than one glutathione was attached on one FGF21 molecule, most likely through the introduced C86 as well as native cysteine residues.
  • the glutathione adduct showed approximately 10-fold reduction of biological activity, and therefore investigation of FGF21 AH-L86C was discontinued.
  • Ab-L1 -FGF21 AH-A129C showed an IV half-life in rat of 60 hrs, a SC half-life in rat of 39 hrs, and SC bioavailability in rat of 52%.
  • the IV half-life was 65 hrs
  • the SC half-life was 48 hrs
  • FGF21 AH-H125C and FGF21 AH-A129C protein were produced by E. coli fermentation culture. To reduce endotoxin levels, an additional Q step was utilized after the first Q which reduced the endotoxin levels from 10 EU/ml -> 0.1 EU/mL.
  • the purification protocol was modified as follows. Approximately 10 g IB was obtained from 1 L culture media, and solubilized with 40 ml_ of 7M Urea, 5 mM DTT, 50 mM BTP (Bis- tris Propane) pH10.5 (1 - 2 hrs). Reduction of FGF21 protein was monitored by RP- HPLC.
  • solubilized protein was refolded by dilution into 400 ml_ of 50 mM BTP, pH 8.0 (24 ⁇ 36 hrs). Oxidation of native disulphide bond of FGF21 was monitored by RP- HPLC. Once refolding was almost completed, the solution was dialyzed twice against 4L of 20 mM Tris-HCI, pH 7.5. Unsolubilized proteins were precipitated out by
  • the desired fractions were dialyzed twice against 4L of 20 mM Tris-HCI, 0.01 mM TCEP, pH 7.5 and loaded onto a Hitrap Q HP column with 0 ⁇ 100 mM NaCI gradient (20 CV, 20 mM Tris-HCI, pH 7.5) for elution. Purified protein fractions were collected, sterilized with a 0.22 mm filter and stored at -80°.
  • the typical yield from 1 L culture media was about 350 to about 400 mg.
  • the typical yield of purified protein was about 220 to about 280 mg.
  • This purification technique yielded protein with a purity of > 95%, and a typical endotoxin level of about 1 EU/mg.
  • Maleimide linker such as L1 can react with thiol to form a thiol adduct with maleimide part as shown in Scheme 1 .
  • This addition reaction of thiol to maleimide is referred as to a Michael reaction.
  • a group containing amine such as antibody h38C2
  • AZD ⁇ -lactam
  • the resulting thiol-succinimide adduct is stable.
  • the succinimide ring can undergo a slow hydrolytic cleavage over time resulting in 7 and / or 8. Therefore it is desirable to have a maleimide ring with improved stability towards hydrolytic cleavage, while preserving its ability to undergo Michael reaction,
  • Linker 2 which has a methyl group on the succinimide ring, was prepared.
  • a water molecule adds to the carbonyl group and forms a tetrahedral intermediate as transition state.
  • the presence of the methyl group would sterically and electronically limit the formation of the tetrahedral intermediate, and slow down the hydrolysis rate considerably.
  • the second modification was focused on the propionamide carbonyl group in close vicinity to the carbonyl group of the maleimide ring.
  • Carbonyl groups in general attract water. Having a carbonyl group in close proximity to the maleimide ring helps attract water and facilitates the attack on the carbonyl group of the maleimide ring.
  • the propionamide carbonyl group By removing the propionamide carbonyl group, the hydrolytic ring opening reaction is slowed down. This modification was seen in L3.
  • the third modification was the introduction of a cyclohexyl methylene group in the place of propionamide group as seen in L4.
  • the bulky hydrophobic nature of the cyclohexyl ring would interfere both electronically and sterically towards the formation of a tetrahedral intermediate by the addition of water to the carbonyl group of the ring which is required for the ring opened hydrolytic cleavage. It was anticipated that this would slow down the hydrolytic cleavage.
  • each linker was conjugated to FGF21 , placed at +4°C storage conditions, and aliquots were removed and quenched by freezing at specific time points, and linker stability was monitored by LCMS analysis.
  • the four linkers were dissolved in DMSO from lyophilized stock material.
  • Linker hydrolysis is the critical analytical variable in this experiment. Hydrolysis was monitored by observing the subsequent addition of H 2 O to the FGF21 -linker complex. A single addition of H 2 O, +(1 ) H 2 O, likely indicates the hydrolysis of the active AZD group that is present on all 4 linkers. The addition of a second H 2 O molecule, +(2) H 2 O, is a strong indicator of hydrolysis (eg- chemical instability) in the linker. L1 is particularly susceptible because of the presence of a maleimide functional group.
  • L2-L4 had previously been shown to be more stable than L1 with glutathione conjugations under various conditions (see Tables 3A-C) and FGF21 (Table 4).
  • the modified maleimide linkers L2-L4 were fused to FGF21 AH-A129C (conjugation efficiencies shown in Table 5), and showed activity in the Glutl Taqman assay (Table 5): EC50 values are normalized against the relative value for FGF21 AH).
  • A129C was conjugated to h38C2 using each of L1 , L2, L3 and L4. Each sample was diluted in mouse serum to 0.3 mg/ml and incubated at 37°C before freezing, followed by subsequent analysis by 2DLC/MS. Compared against a reference standard, Ab-L1 - FGF21AH-A129C was detected at 149% after 5 mins, 66% after 34 hrs, 81 % after 72 hrs, and was undetectable by 120 hrs. In contrast, Ab-L2-FGF21AH-A129C, Ab-L3- FGF21AH-A129C, Ab-L4-FGF21AH-A129C were undetectable in all samples.
  • PK Single dose pharmacokinetics (PK) of two versions of Ab-FGF21AH-A129C differing by the linker used to conjugate the FGF21 protein to the antibody scaffold were determined in male Sprague Dawley rats. Rats were dosed IV or SC (3 mg/kg) with either Ab-L1 -FGF21AH-A129C (maleimide linker) or Ab-L2-FGF21AH-A129C (methyl maleimide linker), and blood samples were drawn at intervals from 5 mins to 14 days post dose. Serum Ab-FGF21AH-A129C levels were determined by ELISA, in which the FGF21 conjugate was captured via a monoclonal antibody specific for FGF21 and detected by anti-human Fc. The resulting PK data demonstrated that the Ab-L1 -
  • 3T3-L1 adipocytes were seeded at day 8 in 24-well tissue culture plates
  • DMEM complete medium (10% FBS, 2 mM L- glutamine, 1 % P/S) at 37°C, 5% CO 2 .
  • the cells were starved (day 12) with serum-free DMEM medium with 0.2% BSA overnight and treated with Ab-L1 -FGF21 ⁇ - ⁇ 129C and Ab-L2-FGF21 AH-A129C in serum-free DMEM containing 0.2% BSA at 37°C for 6 hrs.
  • the medium was aspirated, and then RNA extracted from the cells using the RNeasy mini Kit according to the manufacturer's instructions. RNA was measured at A260nm using the Spectramax® Plus spectrophotometer.
  • H1 C, T40C, D79C, L86C, H125C and A129C were tested as potential
  • His125 are both located in the loop region which is flexible in the modelled structure of FGF21 . These regions are usually heparin binding sites for other heparin binding FGF members. Since FGF19, FGF21 and FGF23 do not interact with heparin, maintaining sequence fidelity of this region may not be critical for their biological function. The flexibility of the position may be beneficial for antibody-conjugation to avoid interference of receptor binding. Second; Ala129 is surrounded by positively charged resides, namely His125, Arg126, Arg131 , and Arg135. This positively charged patch may avoid the SS-dimerization of FGF21 AH-A129C due to the strong charged repulsion.
  • Ab-L1 - FGF21 AH-A129C and Ab-L1 - FGF21 AH-H125C both show high IV half- lives and SC half-lives of at least 30 hrs in murine models as well as good bioavailability Both conjugates demonstrate potency below 4nM in the Glutl Taqman assay.
  • Ab-L1 - FGF21 AH-A129C shows slightly improved half-life and potency compared to Ab-L1 - FGF21 AH-H125C.
  • Use of L1 in Ab-L1 - FGF21 AH-A129C also showed surprising in vivo advantages over what in vitro tests suggested, and appeared overall the most advantageous linker compared with those tested.
  • antibody linker, linking residue position, linking residue, protein
  • antibody linker, linking residue position, linking residue, protein
  • Glucose tolerance was tested for in ob/ob mice treated with compounds Ab- FGF21AH-K56 and Ab-FGF21AH-Knull-H1 K. Both compounds compared poorly against Ab-FGF21AH-H125C ( Figure 4A and 4B) and Ab-FGF21AH-A129C ( Figure 5A and 5B). In contrast, Ab-FGF21AH-D79C and Ab-FGF21AH-H125C were shown to improve glucose tolerance and reduce body weight gain ( Figures 4A, 4B, 6A, 6B, 6C, 6D, and Table 1 1 ).
  • Ab-FGF21AH-A129C caused body weight loss due to increased energy expenditure as suggested by increased Ucp1 expression in WAT, reduced serum triglycerides and fatty acid levels in DIO mice and decreased liver weight ( Figures 7A, 7B, 7C, 7D, 7E, and Table 13). A reduction in liver weight was also observed in ob/ob mice ( Figure 7F and Table 14). Further tests in ob/ob mice
  • Table 13 Results on day 10 after a repeat SC injection of Ab-FGF21 AH-A129C at 10 mg/kg on day 0 & 7 in DIO mice (see Figures 7A, 7B, 7C, 7D, 7E). * p ⁇ 0.05,
  • Table 14 Liver weight on day 6 after a single SC injection of Ab-FGF21 AH-A129C at 10 mg/kg at indicated time in ob/ob mice (for Fig 7F). ** p ⁇ 0.01 , *** p ⁇ 0.001 vs vehicle by One-way ANOVA with Dunnett's post-tests. SEM values provided in parentheses.
  • Table 15 Mean fold changes of mRNA expression using qPCR from liver tissue samples collected on day 6 after a single SC injection of Ab-FGF21 AH-A129C at 10 mg/kg at indicated time in ob/ob mice (for Fig 7G, 7H, 7i). ** p ⁇ 0.01 vs vehicle by Oneway ANOVA with Dunnett's post-tests. SEM values provided in parentheses.
  • Exendin4 homologues The ability of certain Exendin4 homologues to stimulate insulin secretion from pancreatic ⁇ cells in vitro was tested using a glucose-stimulated insulin secretion (GSIS) assay. Briefly, the relevant Exendin4 homologue was conjugated to both combining sites of h38C2, and this conjugated molecule was applied, together with glucose, at various concentrations to pancreatic ⁇ cell cultures. Insulin secretion was detected by measuring insulin levels over time. EC50 was calculated for each compound. The results of this assay are set forth in Table 16 below.
  • Example 50 Glucose Tolerance Test (GTT), Body Weight Change and Food Intake on Exendin4 compounds
  • Exendin4 homologues were assessed using a single- or repeat-dose glucose tolerance testing paradigm.
  • Young adult male ob/ob mice (Jackson Laboratories, Bar Harbor, ME) were dosed with 0.3 mg/kg of test compounds of the invention subcutaneously (SC) in the mid-scapular region, using brief manual restraint, with injection volumes of 0.2-0.3 ml.
  • Food intake and cumulative body weight change were monitored daily in the morning (08:00-09:00 H; lights on at 06:00 H and off at 18:00 H). Results are shown as average values over days 0-9, as well as the value at day 9. Each compound was tested with 8-10 animals.
  • OGTT oral glucose tolerance testing
  • Linking at position 23 did not decrease body weight or feeding and did not improve glucose tolerance @ 48 hrs.
  • Linking at positions 17, 24, 38 and at the C-terminus (SEQ ID NOs: 51 , 46, 39, and 38) decreased body weight and feed but did not improve glucose tolerance at 72 hrs.
  • Linking at position 26 (SEQ ID NO:45) did not decrease body weight or feeding but did improve glucose tolerance at 48 hrs. Clear advantages are seen for linking at positions 12, 14, 19, 20 and 21 .
  • Linking at position 14 was seen as providing the graeatest overall advantage. All examples used K or K(SH) residues as the linking residue.
  • Co-solvents such as ethanol, DMF, and DMSO inhibit the formation of Ab-[2 nd Iinker-Ex4] 2 , whereas propylene glycol did not have any effect on the formation of Ab-[2 nd Iinker-Ex4] or Ab-[2 nd Iinker-Ex4] 2 .
  • the analysis was done using HPLC.
  • H38C2 + Exendin 4 reaction 2.76 gm of h38C2 (SEQ ID NO:25 and SEQ ID NO:26) (in 10mM Histidine, 10mM Glycine, 2% sucrose, pH 6.5, 136 mL) was treated with 62.3 mg of Ex4 peptide (SEQ ID NO:64 with K(SH) as peptide linking residue) conjugated to linker L1 in 1 .29 ml (concentration 10mM) of deionized water and left at room temperature overnight. A small amount of material was analyzed using high performance liquid chromatography equipped with HIC-Butyl column and mass spectroscopy to monitor the formation of Ab-[L1 -SEQ ID NO:64]i.
  • the fractions containing Ab-[ L1 -SEQ ID NO:64] were combined.
  • Hydrophobic Interaction Chromatography (HIC) separation is based on the interaction between the stationary phase and hydrophobic characteristics of the molecules.
  • the antibody h38C2 is less hydrophobic than Ab-[L1 -SEQ ID NO:64] , which is less hydrophobic than Ab-[L1 -SEQ ID NO:64] 2 .
  • Ab-[L1 -SEQ ID NO:64]L Ab-[L1 -SEQ ID NO:64] 2 elutes at the end.
  • This isolated antibody was again fused with Ex4 peptide (SEQ ID NO:64 with K(SH) as peptide linking residue) and purified. In some aspects of the invention, this can be cycled 3-fold to yield -70% Ab-[ L1 -SEQ ID NO:64]i .
  • FGF21 + linker FGF21AH-A129C (715 mg in 105 mL of 20 mM
  • FGF21AH- A129C can have a problem with dimer formation due to the unreacted thiol at position 129, which can be particularly disadvantageous if the unreacted protein is to be stored between generation and subsequent attachment to the linker. This problem can be overcome by adding TCEP to a final concentration of about 0.1 mM.
  • L1 was generally maintained at 10 mM (48.28 mg/ml) in 100% DMSO, although other solvents are also suitable, such as dimethyl formamide, methanol, ethanol, water, propylene glycol and mixtures thereof.
  • L1 has potential to undergo hydrolysis in both methanol and ethanol.
  • the solubility of L1 is higher in both dimethyl sulfoxide and dimethyl formamide. Since dimethyl sulfoxide readily mixes with buffer system used in linker-protein conjugation, dimethyl sulfoxide is preferred for preparing the L1 stock solution.
  • the present invention provides a first strategy (strategy 1 ) for the conjugation process wherein Ab-[Ex4-2 nd linker]i is conjugated to [FGF21 -1 st linker]. While this process is advantageous, it requires two high resolution chromatography steps for the final bispecific antibody ABC-1 : one HIC for Ab-[Ex4-2 nd linker] ! and the other for product ABC-1 purification. In some favorable aspects, the process gave the final product ABC-1 with 74% purity with 14 % unreacted Ab-[Ex4-2 nd linker]i process intermediate and other impurities in poor yield.
  • the present invention also provides for an alternative method of producing asymmetric bifunctional antibody conjugates, according to strategy 2.
  • Strategy 2
  • the Strategy 2 also reduced chromatography steps to only one HIC
  • a Butyl 650 S reverse phase chromatographic step was developed to generate Ab-[SEQ ID NOil O-U ⁇ as process intermediate.
  • Single conjugated Ab-[SEQ ID NO:10- L1 ] i species was selectively recovered at high yield > 90% and high purity > 90% in the elution step and was well resolved from the other conjugation reaction species including free [SEQ ID NO:10-L1 ], dimeric [SEQ ID NO:10-L1 ] 2 , doubly conjugated Ab-[SEQ ID NO:10-L1 ] 2 , aggregates and free h38C2 species.
  • the process scale up was
  • the acceptable operating conditions for conjugation for h38C2-[SEQ ID NO:10-L1 ] i was identified as using a MES or phosphate buffer, at a concentration between about 25 mM and about 150 mM, with a pH range of about 5.5 to about 7.5, or about 6.0 to about 7.0, at between about 0°C and 37°C, and preferably at between about 4°C and about RT.
  • the optimum conjugation conditions for h38C2-[SEQ ID NOil O-LI ⁇ comprised about 100 mM a phosphate buffer with a pH range about 6.0 to about 6.5 at RT.
  • the conjugation reaction may be carried out for a time selected from the group consisting of at least 30 mins, at least about 60 mins, at least about 90 mins, at least about 2 hrs, at least about 3 hrs, at least about four hrs, at least about 6 hrs, at least about 12 hrs, at least about 18 hrs and at least about 24 hrs.
  • Fine tune of conjugation conditions for FGF21 -linker The laboratory scale-ups were performed at different scales with a variety of optimized buffers and pHs.
  • the conjugation efficiency for h38C2-[SEQ ID NO:10-L1 ] i remained comparable in the range of about 40% ⁇ about 45% (Table 26). Since hydrolysis of reactive group of SEQ ID NO:10-L1 occurs over time (Table 27), post activation diafiltration of SEQ ID NO:10-L1 should be operated at between about 2 and about 10°C.
  • the amount of SEQ ID NO:10- L1 after post activation diafiltration varied in different experiments, and the difference could contribute to the variation of the conjugation efficiency for h38C2-[ SEQ ID NO:10- L1 ] i .
  • About 100 mM Phosphate pH about 6.3 gave the least aggregates and highest % h38C2 remaining for recycle purpose.
  • Table 27 The time course study of hydrolysis of reactive group of [SEQ ID NO:10- L1 ] at 4 °C by FGF21 RP chromatography.
  • the monomer and dimer ratio for FGF21 was checked before the experiment.
  • FGF21 RHPLC analysis showed the monomer: dimer ratio was 27%:73%.
  • 0.207 mM of SEQ ID NO:10 (17.1 g in 20mM TRIS, 50 mM NaCI, 2.346 L, pH 7.0 was first diluted with 100 mM MES buffer pH 7.0 (1 .920 L) to target concentration 4 g/L as measured by absorbance at 280 nm. 7.631 ml_ TCEP stock solution (50 g/L) was added next. The mixture was mixed thoroughly for 5 min and then mixing was reduced at ambient condition. The reaction lasted for 90 min. After the reduction with TCEP, the sample was analyzed by FGF21 RF showing the monomer: dimer ratio was 89%:6.3% as the in- process control.
  • the L1 (656.7 mg) was dissolved in 8.76 ml of DMSO (the final concentration of L1 was 0.29 mM, or about 0.15 mg/ml), and the solution was added to the SEQ ID NO:10 solution.
  • the container of L1 was flushed with buffer to ensure all L1 was added.
  • Activation started after all of L1 had been added to the [SEQ ID NO:10 pool.
  • the reaction was mixed thoroughly for 5 min and then mixing was reduced at RT. This mixture was left at RT for 30 min with swirling to complete the reaction between SEQ ID NO:10 and the linker L1 .
  • Activation temperature could be lowered if necessary.
  • Further analysis by FGF21 reverse phase HPLC (RP) showed the 73% formation of [SEQ ID NO:10-L1 ].
  • the above sample was further passed through the UFDF to remove excess linker and TCEP.
  • the membrane was sanitized with 1 N NaOH for 30 min, drained, and equilibrated with 100 mM MES, pH 7.0. Buffer 100 mM MES, pH 7.0 was used for diafilteration (7 X diafilteration). Diafiltration was done at 4 g/L retentate concentration. Foaming and splashing may be avoided during UF/DF. Hydrolysis of the reactive group of [SEQ ID NO:10-L1 ] occurred over the diafiltration process. The hold time for post- activation DF pool should be minimized.
  • UF may be operated at 2-10°C using 10K Sartorius Hydrosart membrane.
  • the combined species [SEQ ID NO:10-L1 ] confirmed by FGF21 RP was down from 73% to 64% after UF/DF.
  • the concentration was estimated by UV 280nm using extinction coefficient of
  • [SEQ ID NO:10-L1 ] component was added. The reaction was mixed thoroughly for about 5 min and then mixing was reduced at RT. This mixture was left at RT overnight, between about 15 and about 20 hrs with gentle stirring. A small amount of material was taken for analysis by SEC chromatography to confirm the formation h38C2-[SEQ ID NO:10-L1 ]i conjugate in the mixture. SEC analysis showed the conjugation step yield of h38C2-[SEQ ID NOil O-L ⁇ as 40% as shown in Table 33. The conjugation step yield was calculated as purity of h38C2-[SEQ ID NO:10-L1]i valency by SEC (%).
  • h38C2-[SEQ ID NO:10-L1 ]i was enriched using a 19 L scale column packed with Tosoh ⁇ Butyl 650S resin using a 35 cm diameter XK column packed to a bed height of 20 cm. The column was pre-equilibrated and washed with 3 CV (column volume) of WFI and 5 CV of 50 mM sodium phosphate pH 7.0. The filtered conjugation pool of h38C2- [SEQ ID NOil O-LI ] ! was loaded at 5 mg/mL onto the Butyl 650S column at 17°C. Then the Butyl 650S load was processed through the Tosoh Butyl 650 S resin using a programmed Unicorn method on the automated chromatography skid at 17-18°C.
  • FGF21 FGF21 ) species.
  • the fractions from Butyl 650S chromatography were pooled together and further concentrated and diafiltered. Concentration was estimated by UV 280 nm using extinction of 1 .47 equal 1 mg of protein.
  • the container of the [SEQ ID NO:10- L1 ] was flushed with buffer to ensure all peptide was added.
  • Final reaction mixture may be 6.0 g/L for h38C2-[SEQ ID NOil O-L ⁇ .
  • the reaction was mixed thoroughly for about 5 min and then mixing was reduced at RT. This mixture was left at RT overnight, between about 15 and about 20 hrs with gentle stirring.
  • a small amount of material was taken for analysis by H IC chromatography to confirm the formation of [SEQ ID NO:10- L1 ]-[SEQ ID NOs:25 and 26]-[L1 -SEQ ID NO:64] 1 (ABC-1 ).
  • H IC analysis showed a 90% yield of (ABC-1 ).
  • the conjugation step yield was calculated as purity of [SEQ ID NO:10- L1 ]-[SEQ ID NOs:25 and 26]-[L1 -SEQ ID NO:64] 1 (ABC-1 ) +2 valency by HIC (%).
  • the fully reactive Ab (h38C2) was enriched using a 9.5 L scale column packed with Tosoh phenyl 650S resin using a 30 cm diameter column packed to a bed height of 14 cm.
  • the column was pre-equilibrated and washed with 2 CV (column volume) of WFI and 5 CV of 20 mM sodium phosphate, 1 M NaCI, pH 7.0.
  • the h38C2 pool (153 g) was loaded at 15 mg/mL onto the phenyl 650S column at RT. Then h38C2 load was processed through the Tosoh phenyl 650 S resins using a programmed Unicorn method on the automated chromatography skid.
  • Elution was performed first with 1 CV wash using 20 mM sodium phosphate, 1 M NaCI, pH 7.0; then the salt reduction from 100% A (20 mM sodium phosphate, 1 M NaCI, pH 7.0) to 67% B (20 mM sodium phosphate, pH 7.0) in 7 CV, hold at 67% B for 6 CV, then to 100% B in 3 CV, followed by elution from 100% B to 70% C (20 mM sodium phosphate, 20% hexanediol, pH 7.0) in 1 CV, then gradient hold at 70% C for 5 CV. Fractions were collected and analyzed by HIC assay for purity to determine which fractions would be pooled. The fully conjugatable h38C2 can serve as feed material for subsequent bioconjugation steps leading to desired final product.
  • Buffer A 50 mM Phosphate pH 7.0
  • Buffer B 50 mM Phosphate pH 7.0, 20% 1 ,6-hexanediol
  • Buffer C 50 mM Phosphate pH 6.5
  • each column run was flushed with 5CV of 100% Buffer B. Following this, each column run was cleaned with 5CV of 0.5 N NaOH in an upflow direction, and then flushed with 5CV 0.1 N NaOH. All the preliminary evaluations were performed using a 4 mL column (0.5 cm diameter x 20 cm height) packed with Tosoh Butyl 650S resin.
  • Run #1 18 The first Butyl 650 S column run #1 18 was performed at 5 mg/mL column loading using h38C2-[SEQ ID NO:10-L1 ] i conjugation reaction solution. The column was loaded without any added lyotropic salt and operated under ambient temperature conditions. The column was pre-equilibrated and washed with 3 CV
  • Run #128 Effect of increasing the protein loading to 10 mg/mL was assessed in column run #128, while the gradient was kept the same as column run #1 18.
  • This reaction had been optimized for higher relative concentration of Ab-[SEQ ID NO:10-L1 ]i (i.e. 44.7%) but also had a higher relative concentration of Ab-[SEQ ID NO:10-L1 ] 2 (i.e., 24.4 %) and lower concentration of mAb 24.7% species by SEC assay compared to load solution used in column run # 1 18.
  • Higher levels of Ab-[SEQ ID NO:10-L1 ] 2 species and higher protein loading are expected to impact the column performance and elution pool product composition.
  • Table 34 increased loading results in diminished resolution of Ab-[SEQ ID NO:10-L1 ] 2 species from Ab-[SEQ ID NOil O-LI ]!
  • Run #132 To improve resolution of Ab-[SEQ ID NO:10-L1 ]i species a shallow gradient elution (100% A + 0% B to 10% A + 90% B in 20 CVs) was performed in column run #132 at 5 mg/mL column loading using the same load material used in column run #128. Table 35 shows the elution profile and relative purity of various conjugated species as determined by SEC for elution fractions.
  • Run #138 Subsequently an experiment with 2.4% 1 ,6-hexanediol isocratic wash (i.e. column run #138) followed by an elution gradient of 2.4%-18% in 30 CVs was performed at a loading density of 5 mg/ml. Table 36 shows the elution profile from this run with the SEC assay of fractions. Enhanced separation was obtained using the 2.4% wash step preceding the elution gradient as seen in this elution profile.
  • Buffer B 12% of Buffer B and 88% Buffer A was determined to provide a suitable initial concentration of 1 ,6 hexanediol to the linear gradient elution over 30 CV, whereas column run #134 appeared to initially wash out too much Ab-[SEQ ID NO:10-L1 ]i due to the slightly higher initial 1 ,6 hexanediol concentration.
  • Run #148 Temperature and pH have been shown to be important process parameters influencing column performance and resolution of the various conjugated species. Impact of lower temperature was evaluated in column run #148 for separation of Ab-[SEQ ID NO:10-L1 ]i species from other species in this study. For this experiment the column and buffers were stored and operated at 17°C in a temperature controlled refrigerator. The column was loaded up to 5 mg/mL and washed and eluted using protocol similar to column run #138. Reducing the temperature from 22°C to 17°C resulted in greatly diminished binding capacity for Ab-[SEQ ID NO:10-L1 ] 2 species. Operating the column at the decreased temperature (i.e. about 17°C) was found to enhance the separation of the Ab-[SEQ ID NO:10-L1] 2 species in the wash step and improved resolution of product Ab-[SEQ ID NO:10-L1]i as evident in the profile shown in Table 37.
  • the decreased temperature i.e. about 17°C
  • Run #152 Equilibrating the column at a lower pH of 6.5 but performing the elution at a higher pH of 7.0 was found to be detrimental to the separation performance in 152.
  • Ab-[SEQ ID NO:10-L1 ] 2 species is observed to strongly bind to the column at a lower pH and a shift in the elution profile to the right was seen resulting in poor separation between Ab-[SEQ ID NO:10-L1 ] 2 species and Ab-[SEQ ID NOil O-LI ⁇ species (Table 38)
  • Run #156 The selected combination of operating conditions i.e. pH, temperature, wash and linear gradient elution conditions used in column run #148 provided adequate resolution of Ab-[SEQ ID NOil O-LI ⁇ species from Ab-[SEQ ID NO:10-L1 ] 2 species. Further improvement in separation to achieve resolution of Ab-[SEQ ID NO:10-L1 ]i species from mAb species was explored in column run #156 using a isocratic hold step at 8% 1 ,6-hexanediol during the gradient elution.
  • operating conditions i.e. pH, temperature, wash and linear gradient elution conditions used in column run #148 provided adequate resolution of Ab-[SEQ ID NOil O-LI ⁇ species from Ab-[SEQ ID NO:10-L1 ] 2 species. Further improvement in separation to achieve resolution of Ab-[SEQ ID NO:10-L1 ]i species from mAb species was explored in column run #156 using a isocratic hold step at 8% 1 ,6

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Zoology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Genetics & Genomics (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Epidemiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biochemistry (AREA)
  • Wood Science & Technology (AREA)
  • Endocrinology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Biophysics (AREA)
  • Diabetes (AREA)
  • Microbiology (AREA)
  • Toxicology (AREA)
  • Biomedical Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Obesity (AREA)
  • Hematology (AREA)
  • Vascular Medicine (AREA)
  • Cardiology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Child & Adolescent Psychology (AREA)
  • Mycology (AREA)
  • Emergency Medicine (AREA)
PCT/IB2012/057227 2011-12-22 2012-12-12 Anti-diabetic compounds Ceased WO2013093720A2 (en)

Priority Applications (14)

Application Number Priority Date Filing Date Title
AU2012356219A AU2012356219B2 (en) 2011-12-22 2012-12-12 Anti-diabetic compounds
KR1020147020397A KR101640697B1 (ko) 2011-12-22 2012-12-12 항당뇨병 화합물
SG11201402640SA SG11201402640SA (en) 2011-12-22 2012-12-12 Anti-diabetic compounds
DK12816137.9T DK2793928T3 (en) 2011-12-22 2012-12-12 Process for purifying a sample of H38C2 antibody
ES12816137.9T ES2623786T3 (es) 2011-12-22 2012-12-12 Procedimiento de purificación de una muestra de anticuerpo H38C2
CN201280063933.4A CN104066438B (zh) 2011-12-22 2012-12-12 抗糖尿病化合物
MX2014007626A MX2014007626A (es) 2011-12-22 2012-12-12 Compuestos anti-diabetes.
JP2014548277A JP6165168B2 (ja) 2011-12-22 2012-12-12 抗糖尿病化合物
BR112014014898-8A BR112014014898A2 (pt) 2011-12-22 2012-12-12 processo para purificar uma amostra de anticorpo h38c2, ou variante do mesmo, e composição compreendendo o referido h38c2
CA2859969A CA2859969A1 (en) 2011-12-22 2012-12-12 Processes for purifying a sample of h38c2 antibody or variant thereof
EP12816137.9A EP2793928B1 (en) 2011-12-22 2012-12-12 Process for purifying a sample of h38c2 antibody
HK15101306.0A HK1200726B (en) 2011-12-22 2012-12-12 Anti-diabetic compounds
ZA2014/03755A ZA201403755B (en) 2011-12-22 2014-05-22 Anti-diabetic compounds
IL233206A IL233206A (en) 2011-12-22 2014-06-17 Diabetic Remedies

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201161579609P 2011-12-22 2011-12-22
US61/579,609 2011-12-22
US201261644831P 2012-05-09 2012-05-09
US61/644,831 2012-05-09

Publications (2)

Publication Number Publication Date
WO2013093720A2 true WO2013093720A2 (en) 2013-06-27
WO2013093720A3 WO2013093720A3 (en) 2013-10-24

Family

ID=47561699

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2012/057227 Ceased WO2013093720A2 (en) 2011-12-22 2012-12-12 Anti-diabetic compounds

Country Status (16)

Country Link
US (1) US9163227B2 (enExample)
EP (1) EP2793928B1 (enExample)
JP (1) JP6165168B2 (enExample)
KR (1) KR101640697B1 (enExample)
CN (1) CN104066438B (enExample)
AU (1) AU2012356219B2 (enExample)
BR (1) BR112014014898A2 (enExample)
CA (1) CA2859969A1 (enExample)
DK (1) DK2793928T3 (enExample)
ES (1) ES2623786T3 (enExample)
IL (1) IL233206A (enExample)
MX (1) MX2014007626A (enExample)
SG (1) SG11201402640SA (enExample)
TW (1) TWI560202B (enExample)
WO (1) WO2013093720A2 (enExample)
ZA (1) ZA201403755B (enExample)

Cited By (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017009236A3 (en) * 2015-07-10 2017-02-16 Sanofi New exendin-4 derivatives as selective peptidic dual glp-1 / glucagon receptor agonists
US9670261B2 (en) 2012-12-21 2017-06-06 Sanofi Functionalized exendin-4 derivatives
US9694053B2 (en) 2013-12-13 2017-07-04 Sanofi Dual GLP-1/glucagon receptor agonists
US9750788B2 (en) 2013-12-13 2017-09-05 Sanofi Non-acylated exendin-4 peptide analogues
US9751926B2 (en) 2013-12-13 2017-09-05 Sanofi Dual GLP-1/GIP receptor agonists
US9758561B2 (en) 2014-04-07 2017-09-12 Sanofi Dual GLP-1/glucagon receptor agonists derived from exendin-4
US9771406B2 (en) 2014-04-07 2017-09-26 Sanofi Peptidic dual GLP-1/glucagon receptor agonists derived from exendin-4
US9775904B2 (en) 2014-04-07 2017-10-03 Sanofi Exendin-4 derivatives as peptidic dual GLP-1/glucagon receptor agonists
US9789165B2 (en) 2013-12-13 2017-10-17 Sanofi Exendin-4 peptide analogues as dual GLP-1/GIP receptor agonists
US9932381B2 (en) 2014-06-18 2018-04-03 Sanofi Exendin-4 derivatives as selective glucagon receptor agonists
US10758592B2 (en) 2012-10-09 2020-09-01 Sanofi Exendin-4 derivatives as dual GLP1/glucagon agonists
US10806797B2 (en) 2015-06-05 2020-10-20 Sanofi Prodrugs comprising an GLP-1/glucagon dual agonist linker hyaluronic acid conjugate
CN112986575A (zh) * 2020-12-29 2021-06-18 上海药明康德新药开发有限公司 一种串联式验证dna编码苗头化合物修饰抗体的方法
US11945839B2 (en) 2017-12-22 2024-04-02 Hoffmann-La Roche Inc. Depletion of light chain mispaired antibody variants by hydrophobic interaction chromatography

Families Citing this family (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20220051197A (ko) 2012-05-17 2022-04-26 익스텐드 바이오사이언시즈, 인크. 개선된 약물 전달용 캐리어
US9585934B2 (en) 2014-10-22 2017-03-07 Extend Biosciences, Inc. Therapeutic vitamin D conjugates
US9789197B2 (en) 2014-10-22 2017-10-17 Extend Biosciences, Inc. RNAi vitamin D conjugates
WO2016065052A1 (en) 2014-10-22 2016-04-28 Extend Biosciences, Inc. Insulin vitamin d conjugates
CA2976005A1 (en) * 2015-02-06 2016-08-11 Cell Idx, Inc. Antigen-coupled immunoreagents
EP3650460A4 (en) * 2017-07-05 2021-03-17 Biocells (Beijing) Biotech Co., Ltd. PHARMACEUTICAL SALT OF A POLYPEPTID AND ITS USES
AU2019297327A1 (en) * 2018-07-03 2021-02-18 Bristol-Myers Squibb Company FGF21 formulations
WO2021139744A1 (en) 2020-01-11 2021-07-15 Beijing Ql Biopharmaceutical Co., Ltd. Conjugates of fusion proteins of glp-1 and fgf21
CN111333714A (zh) * 2020-03-05 2020-06-26 成都奥达生物科技有限公司 一种长效glp-1化合物
WO2022133148A1 (en) * 2020-12-17 2022-06-23 Intarcia Therapeutics, Inc. Long acting glucagon like polypeptide-1 (glp-1) receptor agonists and methods of use
TW202423476A (zh) * 2021-03-23 2024-06-16 美商美國禮來大藥廠 含腸促胰島素(incretin)類似物之組合物及其用途
WO2022228498A1 (zh) * 2021-04-30 2022-11-03 信达生物制药(苏州)有限公司 一种oxm3储存剂、oxm3制剂及制备方法
EP4593867A2 (en) 2022-09-30 2025-08-06 Extend Biosciences, Inc. Long-acting parathyroid hormone
EP4713369A1 (en) * 2023-05-17 2026-03-25 OncoC4, Inc. Ph-sensitive anti-ctla-4 antibodies and uses thereof
CN116804630B (zh) * 2023-08-03 2024-03-05 中拓生物有限公司 一种血清同型半胱氨酸测定试剂盒

Citations (24)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5229275A (en) 1990-04-26 1993-07-20 Akzo N.V. In-vitro method for producing antigen-specific human monoclonal antibodies
US5567610A (en) 1986-09-04 1996-10-22 Bioinvent International Ab Method of producing human monoclonal antibodies and kit therefor
US5733757A (en) 1995-12-15 1998-03-31 The Scripps Research Institute Aldolase catalytic antibody
WO1998019698A1 (en) 1996-11-05 1998-05-14 Eli Lilly And Company Use of glp-1 analogs and derivatives administered peripherally in regulation of obesity
WO2001018172A2 (en) 1999-09-07 2001-03-15 Amgen, Inc. Fibroblast growth factor-like polypeptides
US6210938B1 (en) 1999-10-08 2001-04-03 The Scripps Research Institute Antibody catalysis of enantio- and diastereo-selective aldol reactions
WO2001022922A2 (en) 1999-09-27 2001-04-05 The Regents Of The University Of California Engineering antibodies that bind irreversibly
WO2001036640A2 (en) 1999-11-18 2001-05-25 Chiron Corporation Human fgf-21 gene and gene expression products
US6326176B1 (en) 1997-12-18 2001-12-04 The Scripps Research Institute Aldol condensations by catalytic antibodies
WO2003011213A2 (en) 2001-07-30 2003-02-13 Eli Lilly And Company Method for treating diabetes and obesity
WO2003059270A2 (en) 2002-01-15 2003-07-24 Eli Lilly And Company Method for reducing morbidity and mortality in critically ill patients
WO2005061712A1 (en) 2003-12-10 2005-07-07 Eli Lilly And Company Muteins of fibroblast growth factor 21
WO2005072769A1 (en) 2004-01-26 2005-08-11 Eli Lilly And Company Use of fgf-21 and thiazolidinedione for treating type 2 diabetes
WO2005091944A2 (en) 2004-03-17 2005-10-06 Eli Lilly And Company Glycol linked fgf-21 compounds
WO2005113606A2 (en) 2004-05-13 2005-12-01 Eli Lilly And Company Fgf-21 fusion proteins
WO2006028714A1 (en) 2004-09-02 2006-03-16 Eli Lilly And Company Muteins of fibroblast growth factor 21
WO2006028595A2 (en) 2004-09-02 2006-03-16 Eli Lilly And Company Muteins of fibroblast growth factor 21
WO2006050247A2 (en) 2004-10-29 2006-05-11 Neose Technologies, Inc. Remodeling and glycopegylation of fibroblast growth factor (fgf)
WO2006065582A2 (en) 2004-12-14 2006-06-22 Eli Lilly And Company Muteins of fibroblast growth factor 21
WO2006078463A2 (en) 2005-01-21 2006-07-27 Eli Lilly And Company Method for treating cardiovascular disease
US20060205670A1 (en) 2005-03-03 2006-09-14 Bradshaw Curt W Anti-angiogenic compounds
WO2008121563A2 (en) 2007-03-30 2008-10-09 Ambrx, Inc. Modified fgf-21 polypeptides and their uses
WO2009020802A2 (en) 2007-08-03 2009-02-12 Eli Lilly And Company Treatment for obesity
US20090098130A1 (en) 2007-01-05 2009-04-16 Bradshaw Curt W Glucagon-like protein-1 receptor (glp-1r) agonist compounds

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN101287485A (zh) * 2005-03-03 2008-10-15 爱尔兰考夫克斯科技有限公司 抗血管生成化合物
CN101993485B (zh) * 2009-08-20 2013-04-17 重庆富进生物医药有限公司 促胰岛素分泌肽类似物同源二聚体及其用途
US20120148586A1 (en) * 2009-08-27 2012-06-14 Joyce Ching Tsu Chou Glucagon-like protein-1 receptor (glp-1r) agonists for treating autoimmune disorders

Patent Citations (27)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5567610A (en) 1986-09-04 1996-10-22 Bioinvent International Ab Method of producing human monoclonal antibodies and kit therefor
US5229275A (en) 1990-04-26 1993-07-20 Akzo N.V. In-vitro method for producing antigen-specific human monoclonal antibodies
US5985626A (en) 1994-03-10 1999-11-16 The Scripps Research Institute Catalytic antibody/substrate intermediates
US6368839B1 (en) 1995-12-15 2002-04-09 The Scripps Research Institute Aldolase catalytic antibody
US5733757A (en) 1995-12-15 1998-03-31 The Scripps Research Institute Aldolase catalytic antibody
WO1998019698A1 (en) 1996-11-05 1998-05-14 Eli Lilly And Company Use of glp-1 analogs and derivatives administered peripherally in regulation of obesity
US6589766B1 (en) 1997-12-18 2003-07-08 The Scripps Research Institute Aldol consensations by catalytic antibodies
US6326176B1 (en) 1997-12-18 2001-12-04 The Scripps Research Institute Aldol condensations by catalytic antibodies
WO2001018172A2 (en) 1999-09-07 2001-03-15 Amgen, Inc. Fibroblast growth factor-like polypeptides
WO2001022922A2 (en) 1999-09-27 2001-04-05 The Regents Of The University Of California Engineering antibodies that bind irreversibly
US6210938B1 (en) 1999-10-08 2001-04-03 The Scripps Research Institute Antibody catalysis of enantio- and diastereo-selective aldol reactions
WO2001036640A2 (en) 1999-11-18 2001-05-25 Chiron Corporation Human fgf-21 gene and gene expression products
WO2003011213A2 (en) 2001-07-30 2003-02-13 Eli Lilly And Company Method for treating diabetes and obesity
WO2003059270A2 (en) 2002-01-15 2003-07-24 Eli Lilly And Company Method for reducing morbidity and mortality in critically ill patients
WO2005061712A1 (en) 2003-12-10 2005-07-07 Eli Lilly And Company Muteins of fibroblast growth factor 21
WO2005072769A1 (en) 2004-01-26 2005-08-11 Eli Lilly And Company Use of fgf-21 and thiazolidinedione for treating type 2 diabetes
WO2005091944A2 (en) 2004-03-17 2005-10-06 Eli Lilly And Company Glycol linked fgf-21 compounds
WO2005113606A2 (en) 2004-05-13 2005-12-01 Eli Lilly And Company Fgf-21 fusion proteins
WO2006028595A2 (en) 2004-09-02 2006-03-16 Eli Lilly And Company Muteins of fibroblast growth factor 21
WO2006028714A1 (en) 2004-09-02 2006-03-16 Eli Lilly And Company Muteins of fibroblast growth factor 21
WO2006050247A2 (en) 2004-10-29 2006-05-11 Neose Technologies, Inc. Remodeling and glycopegylation of fibroblast growth factor (fgf)
WO2006065582A2 (en) 2004-12-14 2006-06-22 Eli Lilly And Company Muteins of fibroblast growth factor 21
WO2006078463A2 (en) 2005-01-21 2006-07-27 Eli Lilly And Company Method for treating cardiovascular disease
US20060205670A1 (en) 2005-03-03 2006-09-14 Bradshaw Curt W Anti-angiogenic compounds
US20090098130A1 (en) 2007-01-05 2009-04-16 Bradshaw Curt W Glucagon-like protein-1 receptor (glp-1r) agonist compounds
WO2008121563A2 (en) 2007-03-30 2008-10-09 Ambrx, Inc. Modified fgf-21 polypeptides and their uses
WO2009020802A2 (en) 2007-08-03 2009-02-12 Eli Lilly And Company Treatment for obesity

Non-Patent Citations (12)

* Cited by examiner, † Cited by third party
Title
"Remington's Pharmaceutical Sciences, 18th Ed.,", 1990, MACK PUBLISHING CO.
BARBAS 3RD ET AL., SCIENCE, vol. 278, 1997, pages 2085 - 2092
C. RADER ET AL., J. MOL. BIO., vol. 332, 2003, pages 889 - 899
CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 877 - 883
CHOTHIA; LESK, J MOL BIOL, vol. 196, no. 4, 1987, pages 901 - 917
HOLLINGER; HUDSON, NATURE BIOTECHNOLOGY, vol. 23, no. 9, 2005, pages 1126 - 1136
K.D. JANDA ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 91, 1994, pages 2532 - 2536
MACCALLUM ET AL., J. MOL. BIOL., vol. 262, 1996, pages 732 - 745
MAKABE ET AL., JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 283, 2008, pages 1156 - 1166
P. WIRSCHING ET AL., SCIENCE, vol. 270, 1995, pages 1775 - 1782
T.C. CHOU; P. TALALAY, ADV. ENZYME REGUL., vol. 22, 1984, pages 27 - 55
WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546

Cited By (20)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10758592B2 (en) 2012-10-09 2020-09-01 Sanofi Exendin-4 derivatives as dual GLP1/glucagon agonists
US10253079B2 (en) 2012-12-21 2019-04-09 Sanofi Functionalized Exendin-4 derivatives
US9670261B2 (en) 2012-12-21 2017-06-06 Sanofi Functionalized exendin-4 derivatives
US9745360B2 (en) 2012-12-21 2017-08-29 Sanofi Dual GLP1/GIP or trigonal GLP1/GIP/glucagon agonists
US9751926B2 (en) 2013-12-13 2017-09-05 Sanofi Dual GLP-1/GIP receptor agonists
US9789165B2 (en) 2013-12-13 2017-10-17 Sanofi Exendin-4 peptide analogues as dual GLP-1/GIP receptor agonists
US9694053B2 (en) 2013-12-13 2017-07-04 Sanofi Dual GLP-1/glucagon receptor agonists
US9750788B2 (en) 2013-12-13 2017-09-05 Sanofi Non-acylated exendin-4 peptide analogues
US9775904B2 (en) 2014-04-07 2017-10-03 Sanofi Exendin-4 derivatives as peptidic dual GLP-1/glucagon receptor agonists
US9771406B2 (en) 2014-04-07 2017-09-26 Sanofi Peptidic dual GLP-1/glucagon receptor agonists derived from exendin-4
US9758561B2 (en) 2014-04-07 2017-09-12 Sanofi Dual GLP-1/glucagon receptor agonists derived from exendin-4
US9932381B2 (en) 2014-06-18 2018-04-03 Sanofi Exendin-4 derivatives as selective glucagon receptor agonists
US10806797B2 (en) 2015-06-05 2020-10-20 Sanofi Prodrugs comprising an GLP-1/glucagon dual agonist linker hyaluronic acid conjugate
WO2017009236A3 (en) * 2015-07-10 2017-02-16 Sanofi New exendin-4 derivatives as selective peptidic dual glp-1 / glucagon receptor agonists
CN108026153A (zh) * 2015-07-10 2018-05-11 赛诺菲 作为选择性肽双重glp-1/胰高血糖素受体激动剂的新毒蜥外泌肽-4衍生物
US9982029B2 (en) 2015-07-10 2018-05-29 Sanofi Exendin-4 derivatives as selective peptidic dual GLP-1/glucagon receptor agonists
JP2018528931A (ja) * 2015-07-10 2018-10-04 サノフイSanofi 選択的ペプチド二重glp−1/グルカゴン受容体アゴニストとしての新しいエキセンジン−4誘導体
CN108026153B (zh) * 2015-07-10 2022-05-27 赛诺菲 作为选择性肽双重glp-1/胰高血糖素受体激动剂的新毒蜥外泌肽-4衍生物
US11945839B2 (en) 2017-12-22 2024-04-02 Hoffmann-La Roche Inc. Depletion of light chain mispaired antibody variants by hydrophobic interaction chromatography
CN112986575A (zh) * 2020-12-29 2021-06-18 上海药明康德新药开发有限公司 一种串联式验证dna编码苗头化合物修饰抗体的方法

Also Published As

Publication number Publication date
IL233206A (en) 2017-06-29
CN104066438B (zh) 2015-09-23
JP6165168B2 (ja) 2017-07-19
TW201333041A (zh) 2013-08-16
EP2793928A2 (en) 2014-10-29
US9163227B2 (en) 2015-10-20
ES2623786T3 (es) 2017-07-12
WO2013093720A3 (en) 2013-10-24
DK2793928T3 (en) 2017-05-01
US20130164310A1 (en) 2013-06-27
ZA201403755B (en) 2015-11-25
CN104066438A (zh) 2014-09-24
MX2014007626A (es) 2014-09-16
AU2012356219A1 (en) 2014-06-19
IL233206A0 (en) 2014-07-31
SG11201402640SA (en) 2014-10-30
EP2793928B1 (en) 2017-03-15
KR20140105594A (ko) 2014-09-01
KR101640697B1 (ko) 2016-07-18
CA2859969A1 (en) 2013-06-27
BR112014014898A2 (pt) 2020-10-27
HK1200726A1 (zh) 2015-08-14
AU2012356219B2 (en) 2016-03-31
JP2015506926A (ja) 2015-03-05
TWI560202B (en) 2016-12-01

Similar Documents

Publication Publication Date Title
AU2012356219B2 (en) Anti-diabetic compounds
US8722622B2 (en) FGF21 conjugates and anti-diabetic uses thereof
JP5270753B2 (ja) 抗血管形成化合物
WO2008056346A2 (en) Anti-angiogenic compounds
EP1853294A2 (en) Anti-angiogenic compounds
KR20240136924A (ko) 항 Nectin-4 항체, 약물 접합체 및 이의 제조방법 및 용도
HK1200726B (en) Anti-diabetic compounds
HK1188945A (en) Anti-diabetic compounds
EP4595977A1 (en) Ultra-long-acting platform comprising fc-advanced fatty acid chain
EP4732850A1 (en) Antibody-drug conjugates and their uses
HK40129608A (en) Ultra-long-acting platform comprising fc-advanced fatty acid chain
JP2026510595A (ja) サシツズマブ薬物複合体及びその調製
HK1156864A (en) Anti-angiogenic compounds

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12816137

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 233206

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2859969

Country of ref document: CA

Ref document number: 2012356219

Country of ref document: AU

Date of ref document: 20121212

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2014548277

Country of ref document: JP

Kind code of ref document: A

REEP Request for entry into the european phase

Ref document number: 2012816137

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2012816137

Country of ref document: EP

Ref document number: MX/A/2014/007626

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 20147020397

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2014125158

Country of ref document: RU

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112014014898

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112014014898

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20140618