WO2013078299A1 - Nucleic acid vaccines against herpes simplex virus type 2: compositions and methods for eliciting an immune response - Google Patents
Nucleic acid vaccines against herpes simplex virus type 2: compositions and methods for eliciting an immune response Download PDFInfo
- Publication number
- WO2013078299A1 WO2013078299A1 PCT/US2012/066241 US2012066241W WO2013078299A1 WO 2013078299 A1 WO2013078299 A1 WO 2013078299A1 US 2012066241 W US2012066241 W US 2012066241W WO 2013078299 A1 WO2013078299 A1 WO 2013078299A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- hsv
- polypeptide
- polypeptides
- vaccine
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
- A61K39/245—Herpetoviridae, e.g. herpes simplex virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
- A61P31/22—Antivirals for DNA viruses for herpes viruses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/53—DNA (RNA) vaccination
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55522—Cytokines; Lymphokines; Interferons
- A61K2039/55527—Interleukins
- A61K2039/55538—IL-12
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55577—Saponins; Quil A; QS21; ISCOMS
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/70—Multivalent vaccine
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/16011—Herpesviridae
- C12N2710/16034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/16011—Herpesviridae
- C12N2710/16611—Simplexvirus, e.g. human herpesvirus 1, 2
- C12N2710/16622—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/16011—Herpesviridae
- C12N2710/16611—Simplexvirus, e.g. human herpesvirus 1, 2
- C12N2710/16634—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
Definitions
- NUCLEIC ACID VACCINES AGAINST HERPES SIMPLEX VIRUS TYPE 2 COMPOSITIONS AND METHODS FOR ELICITING AN IMMUNE RESPONSE
- HSV-2 Herpes simplex virus type 2
- HSV-2 is most often transmitted by sexual contact, and infection with the virus typically leads to recurring outbreaks of lesions on the genitals and perianal regions, combined with shedding of virus into the genital tract. Viral shedding can also occur in the absence of lesions or other symptoms.
- HSV-2 also establishes latency in sensory ganglia. HSV-2 infection causes physical discomfort and psychosexual morbidity in affected patients, and introduces additional health risks. In particular, patients infected with HSV-2 are at increased risk for contracting HIV, and pregnant mothers infected with HSV-2 can vertically transmit HSV-2 to their fetuses. In immunocompromised individuals or in neonates, HSV-2 infections can be fatal. Currently, there is no cure for HSV-2 infection.
- HSV-2 infection is widespread, with one study estimating that nearly 20% of the population worldwide is infected (Looker et ah, 2008, Bulletin of the World Health
- HSV-2 symptoms Treatment options for HSV-2 symptoms are limited.
- Antiviral therapy using compounds such as famciclovir, valaciclovir, or aciclovir, limits the duration of symptoms and, in some cases, speeds healing of lesions and reduces incidence of viral shedding.
- Antiviral drugs are not curative, however, and do not prevent recurrence of outbreaks or clear the virus completely.
- use of antiviral drugs requires patients to recognize symptoms of HSV-2 infection, then obtain a confirmative diagnosis, and ultimately, comply with the antiviral regimen. These requirements may be untenable in regions of the world where antiviral drugs are not readily available.
- patients are often unaware that they are infected, either because they do not present symptoms, or because the symptoms of the initial infection subside, suggesting recovery from the disease.
- HSV-2 To address the medical and social problems associated with HSV-2, it is highly desirable to develop pharmaceutical compositions to inhibit or counteract infection by HSV-2.
- An effective composition may be used to elicit an enhanced immune response against HSV-2, thereby preventing initial infection, blocking the ability of the virus to establish latency in sensory ganglia, eliminating recurrence of outbreaks, and/or preventing viral shedding.
- the immune system is known to mount a defense against HSV-2, as evidenced by recurrent infections which manifest with fewer, less intense symptoms and decreased frequency over time.
- HSV vaccine While the ultimate goal of an HSV vaccine would be long-lasting protection from viral infection, the suppression of disease symptoms would also provide significant health benefits.
- One of the current goals for either a prophylactic or therapeutic vaccine is to reduce clinical episodes and viral shedding from primary and latent infections.
- Three categories of prophylactic vaccines have been tested in clinical trials with disappointing results: i) whole virus, ii) protein subunit, and iii) gene-based subunit vaccines (Stanberry et al. , Clinical Infect. Dis., 30(3):549-566, 2000).
- a number of killed virus vaccines were explored, none of which were efficacious. More recently an attenuated HSV was found to be poorly
- Subunit vaccines based on two recombinant glycoproteins have been clinically evaluated in combination with different adjuvant formulations.
- One developed by Chiron contains truncated forms of both glycoprotein D (gD2) and glycoprotein B (gB2) of HSV-2, purified from transfected Chinese Hamster Ovary (CHO) cells and formulated with adjuvants alum and MF59.
- Another developed by Glaxo-Smithkline (GSK) contains a truncated gD2 formulated with adjuvants alum and 3-O-deacylated monophosphoryl lipid A (MPL). Both vaccines were immunogenic and well tolerated in phase I/II trials.
- Subunit vaccines to date, have been selected for vaccine testing based on their assumed importance in disease pathogenesis and immunogenicity during infection. These approaches have identified one candidate against HSV with limited efficacy in some but no efficacy in other formulations. Thus, new and improved methodologies for herpesvirus vaccine discovery are needed to protect against herpes diseases.
- the present disclosure provides, inter alia, certain highly effective vaccines against HSV-2. Such vaccines can be used either therapeutically or prophylactically.
- the present disclosure also provides specific antigens and methods for using the antigens to elicit an immune response against HSV- 2.
- the present disclosure describes a vaccine formulation comprising a pharmaceutically-acceptable carrier and at least one polypeptide consisting of SEQ ID NO: 136 or an immunogenic fragment thereof
- the vaccine formulation may comprise a first polypeptide consisting of the above SEQ ID NO, a second polypeptide consisting of SEQ ID NO: 1 or SEQ ID NO: 4 and optionally a third polypeptide consisting of the other of SEQ ID NOS: 1 and 4.
- the second or third polypeptide consists of polypeptide fragments of SEQ ID NO: 1, such as the polypeptides of SEQ ID NOS: 2, 8-16, 138 and 139, or immunogenic fragments thereof.
- the vaccine formulation may comprise a first polypeptide consisting of SEQ ID NO: 136, a second polypeptide consisting of SEQ ID NO: 4 or SEQ ID NO: 5, a third polypeptide selected from the group consisting of SEQ ID NOS: 2, 8-16, 138 and 139, and optionally a fourth polypeptide selected from the group consisting of SEQ ID NOS: 2, 8-16, 138 and 139, or immunogenic fragments thereof.
- Another aspect of the present invention provides a vaccine formulation comprising a pharmaceutically acceptable carrier, an adjuvant comprising one or more purified fractions of Quillaja saponins, and at least one polypeptide comprising any of SEQ ID NOS: 1, 4, 5, and 136 or an immunogenic fragment thereof.
- at least one polypeptide comprises one or more polypeptide fragments of SEQ ID NO: 1, such as the polypeptides of SEQ ID NOS: 2, 8-16, 138 and 139.
- the present invention provides a vaccine formulation where a polypeptide comprising SEQ ID NO: 5 is present in place of a polypeptide of SEQ ID NO: 4, wherein the polypeptide lacks all or at least an 8 contiguous amino acid residue portion of the transmembrane domain spanning residues 340-363.
- the polypeptide may be glycosylated, or may be unglycosylated.
- polypeptides in the vaccine formulations may be conjugated to an immunogenic carrier, for example keyhole limpet hemocyanin.
- the vaccine formulations further comprise an adjuvant.
- the adjuvant may be one or more purified fractions of Quillaja saponins, or the adjuvant may comprise a cytokine, or the adjuvant may comprise a cationic peptide with TLR agonist.
- the invention provides methods of treating a subject suffering from or susceptible to HSV-2 infection by administering an effective amount of a vaccine formulation disclosed herein.
- the method inhibits HSV-2 symptoms, for example by reducing the number of herpetic lesions, reducing the number of days a subject experiences herpetic lesions, reducing infection by HSV-2 in an uninfected subject, increasing the IgG titer and/or T cell response to one or more HSV-2 antigens, and/or reducing the number of herpetic lesions at the onset of HSV-2 infection.
- compositions comprising two, three, four, or more isolated polypeptides selected from polypeptides having an amino acid sequence of at least one of SEQ ID NOS: 1-38, 135, 136, 138 and 139, or an immunogenic fragment thereof.
- the invention provides vaccine formulations that include a pharmaceutically-acceptable carrier and a polypeptide comprising at least one of SEQ ID NOS: 1-38, 135, 136, 138 and 139, or an immunogenic fragment thereof.
- the polypeptide consists of at least one of SEQ ID NOS: 1-38, 135, 136, 138 and 139.
- compositions comprising two, three, four, or more isolated nucleic acids having a nucleotide sequence that encodes at least one of SEQ ID NOS: 1-38, 135, 136, 138 and 139, or an immunogenic fragment thereof.
- the nucleic acids encode at least one of SEQ ID NOS: 1, 3, 5, 38 or an immunogenic fragment thereof.
- the nucleic acids may include at least one of SEQ ID NOS: 39-45, 117-129, 137, 140 and 141, or a fragment thereof that encodes an immunogenic polypeptide.
- the invention provides vaccine formulations that include a pharmaceutically-acceptable carrier and a nucleic acid having a nucleotide sequence that encodes at least one of SEQ ID NOS: 1, 3, 5, 38, 136 or 138, or an immunogenic fragment thereof.
- the nucleic acids can have a nucleotide sequence comprising at least one of SEQ ID NOS: 39, 46, 118, 137 or 140, or a fragment thereof that encodes an immunogenic polypeptide.
- Another aspect of the present invention provides a method of inducing an immune response in a subject, comprising administering to said subject an effective amount of a vaccine formulation or a pharmaceutical composition as described herein.
- Yet another aspect of the present invention provides a method of reducing one or more symptoms of HSV-2 infection in a subject, comprising administering to said subject an effective amount of a vaccine formulation or a pharmaceutical composition as described herein.
- the symptoms of HSV-2 infection comprise one or more of lesion formation, pain, irritation, itching, fever, malaise, headache, viral shedding, and prodrome.
- a further aspect of the present invention provides a method of inhibiting the onset of HSV-2 infection, comprising administering an effective amount of a vaccine formulation or a composition as described herein.
- Applicants disclose another aspect of the present invention, which provides a method of inhibiting development of a latent HSV-2 infection in a subject exposed to HSV-2, comprising administering an effective amount of a vaccine formulation or a composition as described herein.
- the present invention provides a method of reducing viral shedding in a subject infected with HSV-2, comprising administering an effective amount of a vaccine formulation or a composition as described herein.
- an aspect of the present invention provides a method of reducing recurrence of outbreaks in a subject infected with HSV-2, comprising administering an effective amount of a vaccine formulation or a composition as described herein.
- An additional aspect of the present invention provides a method of producing any of the pharmaceutical compositions described above, comprising expressing said two or more polypeptides; and isolating said two or more polypeptides.
- Applicants further disclose an aspect of the present invention which provides a method for diagnosing severity of symptoms in a subjected infected with HSV-2, comprising (i) measuring activation of T cells in response to autologous antigen presenting cells (APCs) pulsed with one or more isolated HSV-2 polypeptides as described herein, and (ii) comparing said levels to reference levels obtained from infected subjects experiencing frequent outbreaks; whereby a significant increase in said responses relative to reference levels indicates that said subject has less severe symptoms (e.g., the subject is asymptomatic).
- a significant increase in response can, for example, comprise a 1.5-fold or greater, 2-fold or greater, 3-fold or greater, 5-fold or greater, 10-fold or greater or even 20-fold or greater increase.
- Another aspect of the present invention provides a method for diagnosing severity of symptoms in a subject infected with HSV-2, comprising (i) measuring activation of T cells from naturally infected or virus-exposed subjects in response to APCs presenting one or more isolated HSV-2 polypeptides selected from polypeptides as described herein, or an immunogenic fragment thereof, and (ii) comparing said levels to reference levels obtained from infected subjects experiencing frequent outbreaks; whereby a significant decrease in said activation relative to reference levels indicates that said subject has more severe symptoms (e.g., frequent outbreaks).
- compositions comprising an antibody that binds to one or more isolated HSV polypeptides selected from the list as described herein, or an immunogenic fragment thereof.
- a different aspect of the present invention provides a method of identifying immunogenic compositions for HSV-2 by testing two, three, four, or more polypeptides selected from polypeptides having an amino acid sequence as described herein, or an immunogenic fragment thereof, for ability to promote cytokine production in a mammalian T cell, wherein an immunogenic composition is one that elevates levels of a cytokine significantly above the levels of that cytokine produced by a naive mammalian T cell.
- a significant increase in cytokine levels is typically one that is at least 1.5-fold, 2-fold, 3-fold, 5-fold, 10-fold or even 20-fold the level produced by a na ' ive cell.
- Still another aspect of the present invention provides a method of detecting HSV-
- said method comprising (i) contacting said sample with one or more antibodies raised against one or more polypeptides having an amino acid sequence as described herein or an immunogenic fragment thereof, and (ii) detecting said one or more antibodies bound to said one or more HSV-2 polypeptide from the sample.
- compositions comprising two or more isolated polynucleotides, encoding polypeptides as described herein, or fragments encoding immunogenic peptides thereof.
- Figures 1 A and B depict exemplary graphs illustrating, respectively, CD4 + and
- Figures 2A and B depict exemplary graphs illustrating, respectively, CD4 + and
- Figure 3A and B depict exemplary graphs illustrating, respectively, CD4 + and
- FIGS. 4A and B depict exemplary graphs illustrating the number of IFN- ⁇ spot forming units per 2xl0 5 CD4 + 3 ⁇ 4 > anel A) or CD8 + (Panel B) T cells, following immunization with gD2ATMR, ICP4.2, gD2ATMR plus ICP4, gL2s v.2, UL40 protein, and gL2s v.2 plus UL40 protein.
- Figure 5 illustrates IgGl and IgG2c antibody titers against gL2s v.2, UL40 protein, and gL2s v.2 plus UL40 protein.
- Figures 6A and B depict exemplary graphs illustrating the average number of
- Figures 6C and D depict exemplary graphs illustrating the average number of
- IFN- ⁇ spot forming units per 2xl0 5 CD4 + (Panel C) or CD8 + (Panel D) T cells following immunization with gL2s v.2, ICP4.2, ICP4.2 plus gL2s v.2, ICP4.9, ICP4.9 plus gL2s v.2, ICP4.5, and ICP4.5 plus gL2s v.2, as in Figures 6A and B, except that APCs were pulsed with pools of overlapping peptides spanning the indicated proteins rather than with purified proteins.
- Figure 7 depicts an exemplary graph illustrating antibody titers against gL2s v.2,
- ICP4.5 ICP4.5, gL2s v.2 plus ICP4.5, ICP4.9, gL2s v.2 plus ICP4.9, ICP4.2, and gL2s v2 plus ICP4.2.
- Figures 8A and B depict exemplary graphs illustrating the average number of
- Figure 9 depicts an exemplary graph illustrating total IgG antibody titers against
- ICP4.2 and gL2s v.2 also gD2ATMR.
- Figures 10A and B depict exemplary graphs illustrating the number of IFN- ⁇ spot forming units per 2xl0 5 CD4 + (Panel A) or CD8 + (Panel B) T cells, following immunization with gL2s v.2 protein; pULl DNA (encoding gL2); pULl DNA (encoding gL2) with gL2s v.2 protein boost; pRSl DNA (encoding ICP4); pRSl DNA (encoding ICP4) plus pULl DNA (encoding gL2); and pUs6 DNA (encoding gD2).
- Figures 11 depicts an exemplary graph illustrating the number of IFN- ⁇ spot forming units per 2xl0 5 CD4 + (left panel) or CD8 + (right panel) T cells, following immunization with pRSl DNA (encoding ICP4), pRS1.9 DNA (encoding ICP4.9), and pUs4 DNA (encoding gG2) with corresponding DNA boost (first group of mice) or with ICP4.2 protein boost (second group of mice) on day 21.
- pRSl DNA encoding ICP4
- pRS1.9 DNA encoding ICP4.9
- pUs4 DNA encoding gG2
- Figure 12 depicts an exemplary graph illustrating the number of IFN- ⁇ spot forming units per 2xl0 5 CD4 + (left panel) or CD8 + (right panel) T cells, following immunization with pRSl DNA (encoding ICP4) and pUs4 DNA (encoding gG2) with corresponding DNA boosts on days 21 and 35 (third group of mice).
- Vaccine formulations may include a polypeptide comprising a sequence from Table 1 or an immunogenic fragment thereof, or a combination of at least two polypeptides comprising sequences from Table 1 or immunogenic fragments thereof.
- the polypeptide(s) of the vaccines comprise the entire sequence of at least one of SEQ ID NOS: 1- 26, 135, 136, 138 and 139, or consist of the entire sequence of any one of SEQ ID NOS: 1-26, 135, 136, 138 and 139.
- Immunogenic compositions may include a polypeptide comprising a sequence from Table 1 or Table 2 or an immunogenic fragment thereof or a combination of at least two polypeptides comprising sequences from Table 1 or Table 2, or immunogenic fragments thereof.
- the polypeptide(s) of the immunogenic compositions comprise the entire sequence of any one of SEQ ID NOS: 1-38, 135, 136, 138 and 139 or consist of the entire sequence of any one of SEQ ID NO: 1-38, 135, 136, 138 and 139.
- the polypeptides in Tables 1 or 2 may be encoded by SEQ ID NOS: 39-46 and 117-134, 137, 140 and 141 as indicated and/or by cDNA sequences publically available on www.ncbi.nlm.nih.gov/sites/entrez.
- cDNA and protein sequences may also be obtained from any known strains of HSV-2, including HG52, 333, and Strain G.
- cDNA sequences may be accessed by gene or protein name from genomic sequence at NC 001798.1, and may be approximately 97% conserved with sequences disclosed at NC 001798.1.
- the polypeptides may be referred to by protein name, by SEQ ID NO, and/or by the name of the gene encoding the protein.
- the polypeptides can be prepared in a variety of expression systems. Suitable expression systems include E. coli and Baculovirus-based expression systems (e.g., in insect cells). Polypeptides prepared using E. coli are typically full-length and unglycosylated, although truncated variants can be prepared. In certain embodiments, these truncated variants retain all or part of the signal domain. Polypeptides prepared using a Baculovirus system typically lack the N-terminal signal sequence, but are fully or partially glycosylated.
- the polypeptides are prepared in non-mammalian cell systems.
- polypeptides may contain one or more amino acids at the N-terminal end which correspond to the exogenous signal sequence.
- An exogenous signal sequence commonly used in insect expression systems is the honey bee mellitin signal sequence.
- the polypeptides may contain one or more amino acids corresponding to a signal sequence that has been cleaved.
- Exemplary polypeptides may contain one or more amino acids from a mammalian signal sequence that has been left intact or cleaved off, depending on the system used to prepare the polypeptides.
- Table 2 may be used in pharmaceutical compositions.
- the invention provides pharmaceutical compositions containing immunogenic polypeptides or polynucleotides encoding these immunogenic polypeptides together with a pharmaceutical carrier.
- Antigens from HSV-2 may be identified by screening immune cells from patients exposed to or infected with HSV-2. Briefly, a library of HSV-2 antigens was expressed by bacteria and mixed with APCs. The APCs, in turn, processed and presented HSV-2-derived peptides to lymphocytes that had been isolated from human patients exposed to or infected with HSV-2.
- the patients belonged to several populations: (1) exposed to HSV-2 but seronegative for infection, (2) infected with HSV-2 but asymptomatic, (3) infected with HSV-2 and experiencing infrequent outbreaks, (4) infected with HSV-2 and experiencing frequent outbreaks, (5) na ' ive and (6) seronegative for HSV-2 (HSV-2-) but seropositive for HSV-1 (HSV-1+ ). Lymphocyte responses from each population were compared for reactivity to HSV-2-derived polypeptides, and the screen detected antigens that induced reactive lymphocytes with greater frequency in one patient population as compared to the others.
- Infected but asymptomatic, and exposed but seronegative patients may activate protective immune responses that patients who experience frequent outbreaks do not; in particular, exposed but seronegative patients are presumed to have mounted sterilizing immunity to HSV-2 infection. It is believed that a unique set of polypeptides will activate lymphocytes from these patient populations.
- the present invention contemplates compositions of the specific HSV- 2 polypeptides that activate the lymphocytes of infected but asymptomatic, or exposed but seronegative patients or a combination of these polypeptides for inhibiting or counteracting infection by HSV-2.
- a polypeptide may induce an innate immune response, a humoral immune response, or a cell-mediated immune response.
- the cell-mediated immune response may involve CD4+ and/or CD8+ T cells, and in certain embodiments, the immune response involving CD4+ T cells is an immune response in which TH1 cells are activated.
- an immunogenic polypeptide avoids induction of TH2 cytokines.
- the immune response involving CD4+ T cells is an immune response in which TH17 cells are activated.
- Polypeptides (or immunogenic fragments thereof) in compositions of the invention may induce T cell responses in multiple individuals, regardless of the HLA haplotype of the individuals.
- epitopes in the polypeptides may induce T cell responses in individuals with one or more of the following HLA supertypes: HLA-A2, -A3, -A24, -Al, -B7, -B8, -B27, -B44, -B58, and B62, and HLA-DQB01, -DQB02, -DQB03, -DQB-04, and -DQB05.
- one or more, e.g. two, three, four, or more polypeptides from Table 1 and/or Table 2 (or immunogenic fragments thereof) are provided in a composition of the invention.
- two polypeptides from Table 1 and/or Table 2 are provided in a composition of the invention.
- three polypeptides from Table 1 and/or Table 2 are provided in a composition of the invention.
- four polypeptides from Table 1 and/or Table 2 are provided in a composition of the invention.
- Table 2 (or immunogenic fragments thereof) are provided together as a conjugate.
- two polypeptides from Table 1 and/or Table 2, or three polypeptides from Table 1 and/or Table 2, or four polypeptides from Table 1 and/or Table 2 are provided as a conjugate.
- two, three, four, or more polypeptides from Table 1 and/or Table 2 are covalently bound to each other, e.g., as a fusion protein.
- two polypeptides from Table 1 and/or Table 2, or three polypeptides from Table 1 and/or Table 2, or four polypeptides from Table 1 and/or Table 2 are covalently bound to each other, e.g. as a fusion protein.
- compositions comprise two, three, four, or more polypeptides selected from the group consisting of SEQ ID NOS: 1-38, 135, 136, 138 and 139, and may contain or may not contain any other HSV-2 polypeptides.
- Applicants provide polypeptides that are at least 70%,
- homologous polypeptide is at least 8, 10, 15, 20, 30, 40, 50, 60, 80, 100, 120, 140, 160, 180, 200, 220, 240, 260, 280, 300, 350, 400, 450, or 500 amino acids in length. In some embodiments, such as those described immediately above, the polypeptide is no more than 300, 350, 400, 450, or 500 amino acids in length.
- An immunogenic composition may also comprise portions of said polypeptides and genes, for example deletion mutants, truncation mutants, oligonucleotides, and peptide fragments.
- the portions of said proteins are immunogenic.
- the immunogenicity of a portion of a protein or a homolog thereof can be readily determined using the same assays that are used to determine the immunogenicity of the full- length protein.
- the portion of the protein has substantially the same immunogenicity as the full-length proteins.
- the immunogenicity is no more than 10%, 20%, 30%, 40%, or 50% less than that of the full-length protein.
- the protein fragments may be, for example, linear, circular, or branched.
- a protein or protein fragment comprises one or more non-natural amino acids (e.g. an amino acid other than the 20 typically found in natural proteins).
- a non-natural amino acid may have an atypical side chain.
- peptidomimetics may be used; these may incorporate alterations to the peptide backbone.
- polypeptide compositions described herein include an immunogenic polypeptide that contains a membrane translocating sequence (MTS), to facilitate introduction of the polypeptide into the mammalian cell and subsequent stimulation of the cell- mediated immune response.
- exemplary membrane translocating sequences include hydrophobic region in the signal sequence of Kaposi fibroblast growth factor, the MTS of a-synuclein, ⁇ - synuclein, or ⁇ -synuclein, the third helix of the Antennapedia homeodomain, SN50, integrin ⁇ 3 h-region, HIV Tat, pAntp, PR-39, abaecin, apidaecin, Bac5, Bac7, P. berghei CS protein, and those MTSs described in US Patents 6,248,558, 6,432,680 and 6,248,558.
- the immunogenic polypeptide is conjugated (i.e.
- molecule covalently bound
- This may, for example, increase the half-life, solubility, bioavailability, or immunogenicity of the antigen.
- Molecules that may be conjugated to an immunogenic polypeptide include a carbohydrate, biotin, poly(ethylene glycol) (PEG), polysialic acid, N-propionylated polysialic acid, nucleic acids, polysaccharides, and PLGA.
- PEG poly(ethylene glycol)
- PEG polysialic acid
- N-propionylated polysialic acid nucleic acids
- polysaccharides and PLGA.
- PEG chains can be linear, branched, or with comb or star geometries.
- a vaccine formulation may comprise any one or more of SEQ ID NOS: 1-26, 136, 138 or 139.
- a vaccine formulation may comprise any one, two, three, or four of ICP4, ICP4.2, ICP4.5, ICP4.9, ICP4.10, gL2, gL2s v.2, gD2ATMR and gD2 (SEQ ID NOS: 1-5, 13, 136, 138 and 139), or immunogenic fragment(s) thereof.
- combinations contain polypeptides or immunogenic fragments from only one of ICP4 (SEQ ID NO: 1), ICP4.2 (SEQ ID NO: 2), ICP4.5 (SEQ ID NO: 13), ICP4.9 (SEQ ID NO: 138) and ICP4.10 (SEQ ID NO: 139).
- combinations contain polypeptides or immunogenic fragments from only one of gD2ATMR (SEQ ID NO: 4) and gD2 (SEQ ID NO: 5). In yet other embodiments, combinations contain polypeptides or immunogenic fragments from only one of gL2 (SEQ ID NO: 3) and gL2s v.2s (SEQ ID NO: 136). In some embodiments, combinations contain polypeptides or immunogenic fragments from any two of ICP4.2 (SEQ ID NO: 2), ICP4.5 (SEQ ID NO: 13), ICP4.9 (SEQ ID NO: 138) and ICP4.10 (SEQ ID NO: 139).
- the vaccine formulation may comprise at least one polypeptide fragment of SEQ ID NO: 1 , such as the polypeptides of SEQ ID NOS: 2, 8-16, 138 and 139. In some embodiments, the vaccine formulation may comprise at least two polypeptide fragments of SEQ ID NO: 1 , such as the polypeptides of SEQ ID NOS: 2, 8-16, 138 and 139. One or more polypeptide fragments of SEQ ID NO: 1 may replace SEQ ID NO: 1 in any of the vaccine formulations or immunogenic compositions as described herein.
- Exemplary combinations of ICP4, ICP4.2, ICP4.5, ICP4.9, ICP4.10, gL2, gL2s v.2, gD2ATMR and gD2 include:
- ICP4.2 ICP4.10 gL2s v.2 gD2ATMR
- ICP4.2 ICP4.5 gL2s v.2 gD2
- ICP4.2 ICP4.10 gL2s v.2 gD2
- the individual antigens and combinations described above can also include additional peptides from or derived from HSV-2, such as polypeptides comprising sequences selected from SEQ ID NOS: 6-12, 14-26, and SEQ ID NO: 135, or immunogenic fragments thereof.
- the individual antigens and combinations described above are provided as isolated nucleic acids.
- the nucleic acids have the nucleotide sequence of at least one of SEQ ID NOS: 39-45, 117-129, 137, 140, 141, or an immunogenic fragment thereof.
- Nucleic acids can be present in compositions of the invention singly or in combinations. Exemplary combinations include nucleic acids encoding for two or more of ICP4 (SEQ ID NO: 1), ICP4.9 (SEQ ID NO: 138), gL2 (SEQ ID NO: 3), gG2 (SEQ ID NO: 38) and gD2 (SEQ ID NO: 5).
- ICP4 (SEQ ID NO: 1) encoded by RSI
- RS 1 encodes ICP4, a transcriptional transactivator that may interact with and recruit specific components of the general transcription machinery to viral promoters and stabilize their formation for transcription initiation.
- ICP4 contains distinct domains for transactivation/phosphorylation (approximately spanning amino acid residues 150-200 of SEQ ID NO: 1), DNA binding (approximately spanning residues 380-540 of SEQ ID NO: 1), nuclear localization (approximately spanning residues 630-730 of SEQ ID NO: 1), and late regulatory transactivation (approximately spanning residues 1220-1319 of SEQ ID NO: 1).
- the DNA and protein sequence of RSI may be found by searching for RSI in the publicly available database, Entrez Gene (on the NCBI NIH web site on the World Wide Web, at
- vaccines against HSV-2 include a polypeptide containing at least 20 consecutive amino acid residues selected from residues 383-766 of ICP4 (SEQ ID NO: 1), but no more than 1000 amino acids of ICP4 (SEQ ID NO: 1).
- the polypeptide may also be a variant of the at least 20 residue fragment.
- the polypeptide includes no more than 950, 900, 850,
- Exemplary polypeptides correspond approximately to amino acids residues of full-length ICP4 as follows: 383-766; 1-400 (RS1.1); 750-1024 (RS1.3.1); 1008-1319 (RS1.3.2); 750-1319 (RSI .3); 280-785 (RSI .4 comprising the full DNA binding region); 680-1319 (RSI .5 comprising the glycosylase/C-terminal region); 208-1319 (RSI .6 which may also comprise a Met residue at the N-term end); 1-380 plus 545-1319 (RSI .7, in which a region spanning approximately residues 381-544 is deleted, removing the DNA binding regions); 1-785 plus 870-1319 (RS1.8, in which a region spanning approximately residues 786-869 is deleted, removing the nuclear localization domain), or 1-766, 383-1318, 100-750, 400-1300, 250-766, 383-900 of ICP4 (SEQ ID NO: 1) and the like.
- ICP4 internal fragment ICP4.2 (SEQ ID NO: 2) encoded by RSI.2
- RSI .2 encodes a 391 amino acid fragment denoted ICP4.2..
- vaccines against HSV-2 include a polypeptide containing from 50 to all 391 amino acids residues of ICP4.2 (SEQ ID NO: 2), such as from 100 to 391, 200 to 391 or 250 to 350 residues.
- the polypeptide includes all of ICP4.2 (SEQ ID NO: 2) or is ICP4.2 (SEQ ID NO: 2) itself.
- These polypeptides may, for example, include the full length or fragments of ICP4.2 (SEQ ID NO: 2) described herein with amino acid residues 1-382 or 767-1318 of ICP4 (SEQ ID NO: 1) or fragments thereof, which, in certain embodiments, are consecutive with the amino acid residues of ICP4.2 being used.
- An immunogenic fragment of ICP4.2 comprises at least one immunogenic portion, as measured experimentally or identified by algorithm.
- Peptides identified by such methods include the following:
- ALPRSPRLL (SEQ ID NO: 57)
- ADLLFQNQS (SEQ ID NO: 59)
- ARNSSSFIS SEQ ID NO: 60
- FVRDALVLM (SEQ ID NO: 62)
- FDGDLAAVP (SEQ ID NO: 63)
- ECLAACRGI (SEQ ID NO: 66)
- the fragments are close in size to the full-length polypeptide. For example, they may lack at most one, two, three, four, five, ten, or twenty amino acids from one or both termini. In other embodiments, the fragment is 100-391 amino acids in length, or 150- 391, or 200-391, or 250-391 amino acids in length.
- exemplary fragments are amino acid residues 1-350, 1-300, 1-250, 1-200, 1-150, 1-100, 1-50, 50-391, 50-350, 50-300, 50-250, 50- 200, 50-150, 50-100 , 100-391, 100-350, 100-300, 100-250, 100-200, 100-150, 150-391, 150- 350, 150-300, 150-250, 150-200, 200-391, 200-350, 200-300, 200-250, 250-391, 250-350, 250- 300, 300-391 and 350-391.
- fragments described above or sub-fragments thereof preferably have one of the biological activities described below, such as increasing the T cell response by at least 1.5 fold or 2 fold.
- a fragment may be used as the polypeptide in the vaccines described herein or may be fused to another protein, protein fragment or a polypeptide.
- this application provides immunogenic polypeptides with at least 90%, 95%, 97%, 98%, 99%, or 99.5% identity to ICP4.2 or an immunogenic fragment thereof.
- Glycoprotein L-2 (SEQ ID NO: 3 or SEQ ID NO: 136) encoded by ULl
- ULl encodes Glycoprotein L-2 (gL2), a heterodimer glycoprotein that is required for the fusion of viral and cellular membranes and enables the virus to enter the host cell.
- the DNA and protein sequence of ULl may be found by searching in the publicly available database, Entrez Gene (on the NCBI NIH web site on the World Wide Web, at
- the polypeptide may be a cytoplasmic form of ULl (SEQ ID NO:
- the polypeptide may be a secreted form of ULl, which lacks one or more amino acids of the signal sequence.
- An exemplary polypeptide of the secreted form of ULl is the polypeptide of SEQ ID NO: 136. In certain embodiments, this polypeptide will not form an aggregate after it is substantially purified. In some embodiments, the polypeptide will contain one or more amino acids corresponding to a signal sequence that has been cleaved.
- the signal sequence may be a mammalian signal sequence or may be a non-mammalian signal sequence, depending on the system from which the polypeptide was purified.
- vaccines against HSV-2 include a polypeptide containing at least 20 consecutive amino acid residues selected from residues 1-224 or 1-200 of gL2 (SEQ ID NO: 3 or SEQ ID NO: 136), but no more than 224 or 200 amino acids of gL2 (SEQ ID NO: 3 or SEQ ID NO: 136).
- the polypeptide may also be a variant of the at least 20 residue fragment.
- the polypeptide is at least 85% identical to a fragment of
- the polypeptide includes no more than 200 or 100 consecutive amino acids from gL2.
- Exemplary polypeptides are amino acids residues 1-20, 21- 40, 41-60, of 61-80, 81-100, 101-120, 121-140, 141-160, 161-180, 181-200, 201-221 of gL2 (SEQ ID NO: 3 or amino acids residues 1-20, 21-40, 41-60, of 61-80, 81-100, 101-120, 121-140, 141-160, 161-180, or 181-200 SEQ ID NO: 136) and the like.
- this application provides an immunogenic fragment of gL2.
- An immunogenic fragment of gL2 comprises at least one immunogenic portion, as measured experimentally or identified by algorithm.
- Peptides identified by such methods include the following:
- FVCLFGLVV (SEQ ID NO: 112) LYKEIRDAL (SEQ ID NO: 113)
- RVSPTRGRR (SEQ ID NO: 115)
- DILRVPCMR SEQ ID NO: 117
- Glycoprotein D-2 (SEQ ID NO: 5) encoded by US6 and internally-deleted Glycoprotein D-2 (SEQ ID NO: 4) encoded by US6ATMR
- US6 encodes envelope glycoprotein D-2 (gD2), an envelope glycoprotein that binds to host cell entry receptors and may trigger fusion of the virus with the host membrane.
- the gD2 protein has several distinct domains, including a signal domain (amino acid residues 1- 25) which is cleaved from the mature protein, and a transmembrane domain (spanning approximately amino acids residues 340-363).
- vaccines against HSV-2 include a polypeptide comprising gD2 that is missing all or part of the transmembrane domain (which spans approximately amino acids residues 340-363 inclusive) as well as the signal sequence.
- the deleted region may additionally include 5-10 amino acids of the sequence flanking the transmembrane domain.
- the deleted region may also comprise a portion of the transmembrane domain, for example at least 3 amino acids between residues 340-363.
- at least one residue in the transmembrane domain has been modified, deleted or substituted, such that the transmembrane domain is no longer functional.
- a variant may have its internal deletion begin at amino acid residue 336, 337, 338, 339, 340, 341, 342, 343, 344, 345 or 346 and end at amino acid residue 358, 359, 360, 361, 362, 363, 364, 365, 366, 367 or 368.
- a construct encoding gD2 which is missing amino acid residues 340-363 (the transmembrane domain) is called US6ATMR (SEQ ID NO: 40).
- the corresponding protein is denoted gD2ATMR (SEQ ID NO: 4).
- an immunogenic fragment of gD2 or gD2ATMR may comprise a deletion in a portion of the transmembrane domain, and/or may comprise a deletion in the flanking sequence outside of the transmembrane domain.
- this application provides an immunogenic fragment of gD2 or gD2ATMR.
- An immunogenic fragment of gD2 or gD2ATMR comprises at least one
- immunogenic portion as measured experimentally or identified by algorithm.
- Peptides identified by such methods include the following:
- VIGGIAFWV SEQ ID NO: 70
- VYYAVLER (SEQ ID NO: 79)
- NLGFLMHAP (SEQ ID NO: 83)
- VIGGIAFWV (SEQ ID NO: 84)
- SEDNLGFLM (SEQ ID NO: 86)
- IAFWVRRRA (SEQ ID NO: 88)
- TSTLLPPEL (SEQ ID NO: 94)
- TAGTYLRLV (SEQ ID NO: 96)
- AFWVRRRAQ (SEQ ID NO: 98)
- RVYHIQPSL (SEQ ID NO: 99)
- this application provides an immunogenic fragment of gD2
- the fragments in some instances, are close in size to the full-length polypeptide. For example, they may lack at most one, two, three, four, five, ten, or twenty amino acids from one or both termini. In other embodiments, the fragment is 100- 393 amino acids in length, or 150-393, or 200-393, or 250-393 amino acids in length.
- exemplary fragments are amino acid residues 1-350, 1-300, 1-250, 1-200, 1-150, 1-100, 1-50, 50-393, 50-350, 50-300, 50-250, 50-200, 50-150, 50-100, 100-393, 100-350, 100-300, 100-250, 100-200, 100-150, 150-393, 150-350, 150-300, 150-250, 150-200, 200-393, 200-350, 200-300, 200-250, 250-393, 250-350, 250-300, 300-393 and 350-393.
- fragments described above or sub-fragments thereof preferably have one of the biological activities described below, such as increasing the T cell response by at least 1.5 fold or 2 fold.
- a fragment may be used as the polypeptide in the vaccines described herein or may be fused to another protein, protein fragment or a polypeptide.
- polypeptide comprises the entire sequence of SEQ ID NO:
- an immunogenic fragment of gD2 retains all or part of the signal domain (amino acid residues 1-25) and/or the transmembrane domain (amino acids residues 340- 363).
- polypeptides have less than 20%, 30%, 40%, 50%, 60% or 70% homology with human autoantigens.
- autoantigens include UL6 from HSV-1 and gK or UL53 from HSV-2.
- this application provides immunogenic polypeptides with at least 90%, 95%, 97%, 98%, 99%, or 99.5% identity to gD2ATMR, or an immunogenic fragment thereof.
- ICP4 internal fragment ICP4.5 (SEQ ID NO: 13) encoded by RSI.5
- RS 1.5 encodes a 544 amino acid fragment corresponding to residues 775-1318 of
- ICP4 denoted ICP4.5.
- vaccines against HSV-2 include a polypeptide containing from 50 to all 544 amino acids residues of ICP4.5 (SEQ ID NO: 13), such as 50, 100, 150, 200, 250, 300, 350, 400, 450, 500, or 544 residues.
- the polypeptide includes all of ICP4.5 (SEQ ID NO: 13) or is ICP4.5 (SEQ ID NO: 13) itself.
- These polypeptides may, for example, include the full length or fragments of ICP4.5 (SEQ ID NO: 13) described herein with amino acid residues 1-774 of ICP4 (SEQ ID NO: 1) or fragments thereof, which, in certain embodiments, are consecutive with the amino acid residues of ICP4.5 being used. Exemplary fragments that combine the residues of SEQ ID NO: 13 with select residues from 1-774 of SEQ ID NO: 1 are described above.
- An immunogenic fragment of ICP4.5 comprises at least one immunogenic portion, as measured experimentally or identified by algorithm.
- this application provides an immunogenic fragment of ICP4.5.
- the fragments in some instances, are close in size to the full-length polypeptide. For example, they may lack at most one, two, three, four, five, ten, or twenty amino acids from one or both termini.
- the fragment is 50-544 amino acids in length, or 100-544, or 150-544, or 200-544, or 250-544, or 300-544, or 350-544, or 400-544, or 450-544, or 500-544 amino acids in length.
- exemplary fragments are amino acid residues 1-500, 1-450, 1-400, 1-350, 1-300, 1-250, 1-200, 1-150, 1-100, 1-50, 50-544, 50-500, 50-450, 50-400, 50-350, 50-300, 50-250, 50-200, 50-150, 50-100, 100-544, 100-500, 100-450, 100-400, 100-350, 100-300, 100-250, 100-200, 100-150, 150-544, 150-500, 150-450, 150-400, 150-350, 150-300, 150-250, 150-200, 200-544, 200-500, 200-450, 200-400, 200-350, 200-300, 200-250, and so forth.
- fragments described above or sub-fragments thereof preferably have one of the biological activities described below, such as increasing the T cell response by at least 1.5 fold or 2 fold.
- a fragment may be used as the polypeptide in the vaccines described herein or may be fused to another protein, protein fragment or a polypeptide.
- this application provides immunogenic polypeptides with at least 90%, 95%, 97%, 98%, 99%, or 99.5% identity to ICP4.5 or an immunogenic fragment thereof.
- ICP4 fragment ICP4.9 (SEQ ID NO: 138) encoded by RSI.9
- ICP4 fragment ICP4.10 (SEQ ID NO: 139) encoded by RSI.10
- RSI .9 encodes a 1 130 amino acid fragment of ICP4, carrying a double internal deletion of residues 391-544 and residues 786-821 of ICP4, denoted ICP4.9.
- RSI .10 encodes a 1166 amino acid fragment of ICP4, carrying a double internal deletion of residues 391-508 and residues 786-821 of ICP4, denoted ICP4.10.
- the DNA and protein sequences of RSI .9 and RSI .10 may be found by searching for RSI in the publicly available database, Entrez Gene (on the NCBI NIH web site on the World Wide Web, at
- vaccines against HSV-2 include a polypeptide containing from 50 to all 1130 or 1166 amino acids residues of ICP4.9 (SEQ ID NO: 138) or ICP4.10 (SEQ ID NO: 139), such as 50, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1130 or 1166 residues.
- the polypeptide includes all of ICP4.9 (SEQ ID NO: 138) or ICP4.10 (SEQ ID NO: 139), or is ICP4.9 (SEQ ID NO: 138) or ICP4.10 (SEQ ID NO: 139) itself.
- These polypeptides may, for example, include the full length or fragments of ICP4.9 (SEQ ID NO: 138) or ICP4.10 (SEQ ID NO: 139) described herein.
- An immunogenic fragment of ICP4.9 or ICP4.10 comprises at least one immunogenic portion, as measured experimentally or identified by algorithm.
- this application provides an immunogenic fragment of ICP4.9 or ICP4.10.
- the fragments are close in size to the full-length polypeptide. For example, they may lack at most one, two, three, four, five, ten, or twenty amino acids from one or both termini.
- the fragment is 50-1130 amino acids in length, or 100-1130, 150-1130, or 200-1130, or 250-1130, or 300-1130, or 400-1130, or 500-1130, or 600-1130, or 700-1130, or 800-1130, or 900-1130, or 1000-1130 amino acids in length.
- exemplary fragments are amino acid residues 1-1130, 1-1000, 1-900, 1-800, 1-700, 1-600, 1-500, 1-400, 1-300, 1-200, 1- 150, 1-100, 1-50, 50-1130, 50-1000, 50-900, 50-800, 50-700, 50-600, 50-500, 50-400, 50-300, 50-250, 50-200, 50-150, 50-100, 100-1130, 100-1000, 100-900, 100-800, 100-700, 100-600, 100-500, 100-400, 100-300, 100-250, 100-200, 100-150, and so forth.
- fragments described above or sub-fragments thereof preferably have one of the biological activities described below, such as increasing the T cell response by at least 1.5 fold or 2 fold.
- a fragment may be used as the polypeptide in the vaccines described herein or may be fused to another protein, protein fragment or a polypeptide.
- an analog of ICP4.9 is based on SEQ ID NO: 1, where at least 50, 75, 100, 125, 130, 140, 145 or 150 residues from residues 391-544 are deleted.
- At least 20, 25, or 30 residues from residues 786-821 are deleted.
- an analog of ICP4.10 is based on SEQ ID NO: 1, where at least 25, 50, 75, 90, 95, 100, 105, 110 or 115 residues from residues 391-508 are deleted. Separately or in combination, at least 25, 50, 60, 65, 70 or 75 residues from residues 786-821 are deleted.
- this application provides immunogenic polypeptides with at least 90%, 95%, 97%, 98%, 99%, or 99.5% identity to ICP4.9 or ICP4.10, or an immunogenic fragment or analog thereof.
- polypeptides present in the vaccine formulations or pharmaceutical compositions described herein are immunogenic, either alone or as a variant, which includes polypeptides fused to another polypeptide or mixed with or complexed to an adjuvant.
- variants also include sequences with less than 100% sequence identity, as described herein.
- fragments, precursors and analogs that have an appropriate immunogenicity.
- polypeptides may be immunogenic in mammals, for example, mice, guinea pigs, or humans.
- An immunogenic polypeptide is typically one capable of raising a significant immune response in an assay or in a subject.
- an immunogenic polypeptide may (i) induce production of antibodies, e.g., neutralizing antibodies, that bind to the polypeptide (ii) induce T R I immunity, (iii) activate the CD8 + T cell response, for example by increasing the number of CD8 + T cells, increasing localization of CD8 + T cells to the site of infection or reinfection, , (iv) induce T R 17 immunity, and/or (v) activate innate immunity.
- an immunogenic polypeptide causes the production of a detectable amount of antibody specific to that antigen.
- polypeptides have less than 20%, 30%, 40%, 50%, 60% or 70% homology with human autoantigens.
- a polypeptide may comprise one or more immunogenic portions and one or more non-immunogenic portions.
- the immunogenic portions may be identified by various methods, including protein microarrays, ELISPOT/ELISA techniques, and/or specific assays on different deletion mutants ⁇ e.g., fragments) of the polypeptide in question.
- Immunogenic portions may also be identified by computer algorithms. Some such algorithms, like EpiMatrix (produced by EpiVax), use a computational matrix approach.
- PEPVAC Promiscuous EPitope-based VACcine, hosted by Dana Farber Cancer Institute on the world wide web at immunax.dfci.harvard.edu/PEPVAC
- MHCPred which uses a partial least squares approach and is hosted by The Jenner Institute on the world wide web at www.jenner.ac.uk/MHCPred
- Syfpeithi hosted on the world wide web at www.syfpeithi.de/.
- the vaccine or pharmaceutical composition may comprise fusion proteins and/or fusion DNA constructs.
- the underlying DNA sequences above may be modified in ways that do not affect the sequence of the protein product.
- the DNA sequence may be codon-optimized to improve expression in a host such as E. coli or an insect cell line (e.g., using the baculovirus expression system) or mammalian (e.g., Chinese Hamster Ovary) cell line.
- the DNA sequence may comprise an exogenous sequence, such as an exogenous signal sequence, for expression in non-mammalian cells.
- modification may be useful in eliciting the desired immune response.
- the smaller polypeptides can be conjugated to an appropriate immunogenic carrier such as proteins from other pathogenic organisms or viruses ⁇ e.g., tetanus toxoid), large proteins ⁇ e.g., keyhole limpet hemocyanin) or the like. Conjugation may be direct or indirect ⁇ e.g., via a linker).
- an appropriate immunogenic carrier such as proteins from other pathogenic organisms or viruses ⁇ e.g., tetanus toxoid), large proteins ⁇ e.g., keyhole limpet hemocyanin) or the like. Conjugation may be direct or indirect ⁇ e.g., via a linker).
- a fusion protein may comprise a polypeptide disclosed above or an immunogenic fragment or variant thereof and a tag.
- a tag may be N-terminal or C-terminal.
- tags may be added to the nucleic acid or polypeptide to facilitate purification, detection, solubility, or confer other desirable characteristics on the protein or nucleic acid.
- a purification tag may be a peptide, oligopeptide, or polypeptide that may be used in affinity purification.
- the fused portion is short.
- the fusion protein comprises no more than 1, 2, 3, 4, 5, 10, 20, or 50 additional amino acids on one or both termini of a polypeptide described above, such as consecutive amino acids from any of the polypeptides in Table 1.
- tags, secretion signals, or other signal sequences may be added to the C-terminal end and/or to the N-terminal end of the polypeptide.
- Tags may be used to aid in purification of expresssed polypeptides.
- Exemplary tags include HHHHHH (SEQ ID NO: 130) and MSYYHHHHHH (SEQ ID NO: 131).
- Secretion signals may be optimized for use with non-mammalian cells, such as insect cells.
- An exemplary secretion signal is
- a detection tag may be used to detect the tag and, consequently, any amino acid sequence fused to it.
- Detection tags include fluorescent proteins, proteins that bind a fiuorescent label, and proteins that bind an electron-dense moeity. Examples of fluorescent proteins include dsRed, mPvFP, YFP, GFP, CFP, BFP, and Venus.
- An example of a protein that binds a fluorescent or electron-dense label is FlAsH.
- Another aspect disclosed herein is an antibody preparation generated against a composition of the invention (e.g., a composition comprising one or more, or two or more of the polypeptides listed in Table 1). Any of a variety of antibodies are included.
- Such antibodies include, e.g., polyclonal, monoclonal, recombinant, humanized or partially humanized, single chain, Fab, and fragments thereof, etc.
- the antibodies can be of any isotype, e.g., IgA, IgG, various IgG isotypes such as IgGi, IgG 2 , IgG 2a , IgG 2 b, IgG 3 , IgG 4 , etc.; and they can be from any animal species that produces antibodies, including goat, rabbit, mouse, chicken or the like.
- Fab molecules are expressed and assembled in a genetically transformed host like E. coli.
- a lambda vector system is available thus to express a population of Fab's with a potential diversity equal to or exceeding that of the subject generating the predecessor antibody. See Huse et al. (1989), Science 246, 1275-81.
- the vaccines and pharmaceutical compositions comprise one or more of the polypeptides and nucleic acids described above and one or more of the following: an adjuvant, stabilizer, buffer, surfactant, controlled-re lease component, salt, preservative, and an antibody specific to said antigen.
- the vaccine formulations and pharmaceutical compositions described herein may each include an adjuvant.
- Adjuvants can be broadly separated into two classes, based on their principal mechanisms of action: vaccine delivery systems and immunostimulatory adjuvants (see, e.g., Singh et ah, Curr. HIV Res. 1 :309-20, 2003).
- Vaccine delivery systems are often particulate formulations, e.g., emulsions, microparticles, immune-stimulating complexes (ISCOMs), which may be, for example, particles and/or matrices, and liposomes.
- ISCOMs immune-stimulating complexes
- immunostimulatory adjuvants are sometimes derived from pathogens and can represent pathogen associated molecular patterns (PAMP), e.g., lipopolysaccharides (LPS), monophosphoryl lipid (MPL), or CpG-containing DNA, which activate cells of the innate immune system.
- PAMP pathogen associated molecular patterns
- LPS lipopolysaccharides
- MPL monophosphoryl lipid
- CpG-containing DNA which activate cells of the innate immune system.
- adjuvants may be classified as organic and inorganic.
- Inorganic adjuvants include aluminum salts such as aluminum phosphate, amorphous aluminum hydroxyphosphate sulfate, and aluminum hydroxide, which are commonly used in human vaccines.
- Organic adjuvants comprise organic molecules including macromolecules.
- An example of an organic adjuvant is cholera toxin.
- Adjuvants may also be classified by the response they induce, and adjuvants can activate more than one type of response.
- the adjuvant induces the activation of CD4 T cells.
- the adjuvant may induce activation of T H 1 cells and/or activation of T R 17 cells and/or activation of T R 2 cells. Alternately, the adjuvant may induce activation of T R I cells and/or T H 17 cells but not activation of T H 2 cells, or vice versa.
- the adjuvant induces activation of CD8 T cells.
- the adjuvant may induce activation of Natural Killer T (NKT) cells.
- NKT Natural Killer T
- the adjuvant induces the activation of T R I cells or T R 17 cells or T R 2 cells. In other embodiments, the adjuvant induces the activation of B cells. In yet other embodiments, the adjuvant induces the activation of APCs. These categories are not mutually exclusive; in some cases, an adjuvant activates more than one type of cell.
- an adjuvant is a substance that increases the numbers or activity of APCs such as dendritic cells. In certain embodiments, an adjuvant promotes the maturation of APCs such as dendritic cells.
- the adjuvant is or comprises a saponin.
- the saponin is a triterpene glycoside, such as those isolated from the bark of the Quillaja saponaria tree.
- a saponin extract from a biological source can be further fractionated ⁇ e.g., by chromatography) to isolate the portions of the extract with the best adjuvant activity and with acceptable toxicity. Typical fractions of extract from Quillaja saponaria tree used as adjuvants are known as fractions A and C.
- QS-21 fraction C
- QS-21 is an oligosaccharide-conjugated small molecule.
- QS-21 may be admixed with a lipid such as 3D-MPL or cholesterol.
- ISCOMs immunostimulating complexes
- lipids ⁇ e.g., cholesterol and phospholipids such as phosphatidyl choline.
- an ISCOM is assembled together with a polypeptide or nucleic acid of interest.
- saponin fractions may be used in different ratios.
- the different saponin fractions may either exist together in the same particles or have substantially only one fraction per particle (such that the indicated ratio of fractions A and C are generated by mixing together particles with the different fractions).
- Such adjuvants may comprise fraction A and fraction C mixed into a ratio of 70-95 A: 30-5 C, such as 70 A : 30 C to 75 A : 25 C; 75 A : 25 C to 80 A : 20 C; 80 A : 20 C to 85 A : 15 C; 85 A : 15 C to 90 A : 10 C; 90 A : 10 C to 95 A : 5 C; or 95 A : 5 C to 99 A : 1 C.
- ISCOMatrix produced by CSL, and AblSCO 100 and 300, produced by Isconova, are ISCOM matrices comprising saponin, cholesterol and phospholipid (lipids from cell membranes), which form cage-like structures typically 40-50 nm in diameter.
- Posintro produced by Nordic Vaccines, is an ISCOM matrix where the immunogen is bound to the particle by a multitude of different mechanisms, e.g., electrostatic interaction by charge modification, incorporation of chelating groups, or direct binding.
- the adjuvant is a TLR ligand.
- TLRs are proteins that may be found on leukocyte membranes, and recognize foreign antigens (including microbial antigens).
- An exemplary TLR ligand is IC-31, which is available from Intercell.
- IC-31 comprises an anti-microbial peptide, KLK, and an immuno stimulatory oligodeoxynucleotide, ODNla.
- IC- 31 has TLR9 agonist activity.
- Another example is CpG-containing DNA.
- Vaxlmmune is CpG 7909 (a (CpG)- containing oligodeoxy-nucleotide)
- Actilon is CpG 10101 (a (CpG)-containing oligodeoxynucleotide).
- the adjuvant is a nanoemulsion.
- One exemplary nanoemulsion is a nanoemulsion.
- Nanoemulsion adjuvant is Nanostat Vaccine, produced by Nanobio.
- This nanoemulsion is a high- energy, oil-in- water emulsion.
- This nanoemulsion typically has a size of 150-400 nanometers, and includes surfactants to provide stability. More information about Nanostat can be found in US Patents 6,015,832, 6,506,803, 6,559,189, 6,635,676, and 7,314,624.
- an adjuvant includes a cytokine.
- the cytokine is an interleukin such as IL-1, IL-6, IL-12, IL-17 and IL-23.
- the cytokine is granulocyte -macrophage colony-stimulating factor (GM-CSF).
- the adjuvant may include cytokine as a purified polypeptide. Alternatively, the adjuvant may include nucleic acids encoding the cytokine.
- Adjuvants may be covalently bound to antigens (e.g., the polypeptides described above).
- the adjuvant may be a protein which induces inflammatory responses through activation of APCs.
- one or more of these proteins can be recombinantly fused with an antigen of choice, such that the resultant fusion molecule promotes dendritic cell maturation, activates dendritic cells to produce cytokines and
- chemokines and ultimately, enhances presentation of the antigen to T cells and initiation of T cell responses (see Wu et ah, Cancer Res 2005; 65(11), pp 4947-4954).
- Other exemplary adjuvants that may be covalently bound to antigens comprise polysaccharides, synthetic peptides, lipopeptides, and nucleic acids.
- the adjuvant can be used alone or in combination of two or more kinds.
- Adjuvants may be directly conjugated to antigens. Adjuvants may also be combined to increase the magnitude of the immune response to the antigen. Typically, the same adjuvant or mixture of adjuvants is present in each dose of a vaccine. Optionally, however, an adjuvant may be administered with the first dose of vaccine and not with subsequent doses (i.e. booster shots). Alternatively, a strong adjuvant may be administered with the first dose of vaccine and a weaker adjuvant or lower dose of the strong adjuvant may be administered with subsequent doses. The adjuvant can be administered before the administration of the antigen, concurrent with the administration of the antigen or after the administration of the antigen to a subject (sometimes within 1, 2, 6, or 12 hours, and sometimes within 1, 2, or 5 days). Certain adjuvants are appropriate for human patients, non-human animals, or both.
- a vaccine formulation or pharmaceutical composition may include one or more additional components.
- the vaccine formulation or pharmaceutical composition may include one or more stabilizers such as sugars (such as sucrose, glucose, or fructose), phosphate (such as sodium phosphate dibasic, potassium phosphate monobasic, dibasic potassium phosphate, or monosodium phosphate), glutamate (such as monosodium L-glutamate), gelatin (such as processed gelatin, hydrolyzed gelatin, or porcine gelatin), amino acids (such as arginine, asparagine, histidine, L-histidine, alanine, valine, leucine, isoleucine, serine, threonine, lysine, phenylalanine, tyrosine, and the alkyl esters thereof), inosine, or sodium borate.
- stabilizers such as sugars (such as sucrose, glucose, or fructose), phosphate (such as sodium phosphate dibasic, potassium phosphate monobasic, dibasic potassium phosphate, or monos
- the vaccine formulation or pharmaceutical composition includes one or more buffers such as a mixture of sodium bicarbonate and ascorbic acid.
- the vaccine formulation may be administered in saline, such as phosphate buffered saline (PBS), or distilled water.
- PBS phosphate buffered saline
- the vaccine formulation or pharmaceutical composition includes one or more surfactants such as polysorbate 80 (Tween 80), Polyethylene glycol tert- octylphenyl ether t-Octylphenoxypolyethoxyethanol 4-(l,l,3,3-Tetramethylbutyl)phenyl- polyethylene glycol (TRITON X-100); Polyoxyethylenesorbitan monolaurate Polyethylene glycol sorbitan monolaurate (TWEEN 20); and 4-(l,l,3,3-Tetramethylbutyl)phenol polymer with formaldehyde and oxirane (TYLOXAPOL).
- a surfactant can be ionic or nonionic.
- the vaccine formulation or pharmaceutical composition includes one or more salts such as sodium chloride, ammonium chloride, calcium chloride, or potassium chloride.
- a preservative is included in the vaccine. In other embodiments, no preservative is used. A preservative is most often used in multi-dose vaccine vials, and is less often needed in single-dose vaccine vials. In certain embodiments, the preservative is 2-phenoxyethanol, methyl and propyl parabens, benzyl alcohol, and/or sorbic acid.
- the vaccine formulation or pharmaceutical composition is a controlled-release formulation.
- the vaccine comprises one or more of the nucleic acids disclosed herein.
- the corresponding gene product such as a desired antigen
- nucleic acid vaccine vectors that include optimized recombinant polynucleotides can be delivered to a mammal (including humans) to induce a therapeutic or prophylactic immune response.
- the nucleic acid may be, for example, DNA, RNA, or a synthetic nucleic acid.
- the nucleic acid may be single stranded or double-stranded.
- Nucleic acid vaccine vectors e.g., adenoviruses, liposomes, papillomaviruses, retroviruses, etc.
- the nucleic acid vaccines can be formulated as pharmaceutical compositions for administration in any suitable manner, including parenteral administration. Plasmid vectors are typically more efficient for gene transfer to muscle tissue. The potential to deliver DNA vectors to mucosal surfaces by oral administration has also been reported (PLGA encapsulated Rotavirus and Hepatitis B) and DNA plasmids have been utilized for direct introduction of genes into other tissues.
- DNA vaccines have been introduced into animals primarily by intramuscular injection, by gene gun delivery, or by electroporation. After being introduced, the plasmids are generally maintained episomally without replication. Expression of the encoded proteins has been shown to persist for extended time periods, providing stimulation of B and T cells.
- the physician evaluates vector toxicities, progression of the disease, and the production of anti-vector antibodies, if any.
- the dose equivalent of a naked nucleic acid from a vector is from about 1 ⁇ g to 1 mg for a typical 70 kilogram patient, and doses of vectors used to deliver the nucleic acid are calculated to yield an equivalent amount of therapeutic nucleic acid.
- Administration can be accomplished via single or divided doses.
- the toxicity and therapeutic efficacy of the nucleic acid vaccine vectors can be determined using standard pharmaceutical procedures in cell cultures or experimental animals.
- a nucleic acid vaccine can contain DNA, RNA, a modified nucleic acid, or a combination thereof.
- the vaccine comprises one or more cloning or expression vectors; for instance, the vaccine may comprise a plurality of expression vectors each capable of autonomous expression of a nucleotide coding region in a mammalian cell to produce at least one immunogenic polypeptide.
- An expression vector often includes a eukaryotic promoter sequence, such as the nucleotide sequence of a strong eukaryotic promoter, operably linked to one or more coding regions.
- the compositions and methods herein may involve the use of any particular eukaryotic promoter, and a wide variety are known, such as a CMV or RSV promoter.
- the promoter can be, but need not be, heterologous with respect to the host cell.
- the promoter used may be a constitutive promoter.
- a vector useful in the present compositions and methods can be circular or linear, single-stranded or double stranded and can be a plasmid, cosmid, or episome.
- each nucleotide coding region is on a separate vector; however, it is to be understood that one or more coding regions can be present on a single vector, and these coding regions can be under the control of a single or multiple promoters.
- Numerous plasmids may be used for the production of nucleic acid vaccines.
- Suitable embodiments of the nucleic acid vaccine employ constructs using the plasmids VR1012 (Vical Inc., San Diego Calif), pCMVI.UBF3/2 (S. Johnston, University of Texas) or pcDNA3.1 (InVitrogen Corporation, Carlsbad, Calif.) as the vector.
- the vector construct can contain immunostimulatory sequences (ISS), such as unmethylated dCpG motifs, that stimulate the animal's immune system.
- the nucleic acid vaccine can also encode a fusion product containing the immunogenic polypeptide.
- Plasmid DNA can also be delivered using attenuated bacteria as delivery system, a method that is suitable for DNA vaccines that are administered orally. Bacteria are transformed with an independently replicating plasmid, which becomes released into the host cell cytoplasm following the death of the attenuated bacterium in the host cell.
- DNA vaccines including the DNA encoding the desired antigen, can be introduced into a host cell in any suitable form including, the fragment alone, a linearized plasmid, a circular plasmid, a plasmid capable of replication, an episome, RNA, etc.
- the gene is contained in a plasmid.
- the plasmid is an expression vector.
- Individual expression vectors capable of expressing the genetic material can be produced using standard recombinant techniques. See e.g., Maniatis et al., 1985 Molecular Cloning: A
- Routes of administration include, but are not limited to, intramuscular, intranasal, intraperitoneal, intradermal, subcutaneous, intravenous, intraarterially, intraoccularly and oral as well as topically, transdermally, by inhalation or suppository or to mucosal tissue such as by lavage to vaginal, rectal, urethral, buccal and sublingual tissue.
- Typical routes of administration include intramuscular, intraperitoneal, intradermal and subcutaneous injection.
- Genetic constructs may be administered by means including, but not limited to, traditional syringes, needleless injection devices, "microprojectile bombardment gene guns", or other physical methods such as electroporation ("EP”), "hydrodynamic method", or ultrasound.
- DNA vaccines can be delivered by any method that can be used to deliver DNA as long as the DNA is expressed and the desired antigen is made in the cell.
- a DNA vaccine is delivered via known transfection reagents such as cationic liposomes, fluorocarbon emulsion, cochleate, tubules, gold particles, biodegradable microspheres, or cationic polymers.
- Cochleate delivery vehicles are stable phospholipid calcium precipitants consisting of phosphatidyl serine, cholesterol, and calcium; this nontoxic and noninflammatory transfection reagent can be present in a digestive system.
- Biodegradable microspheres comprise polymers such as poly(lactide-co-glycolide), a polyester that can be used in producing microcapsules of DNA for transfection.
- Lipid-based microtubes often consist of a lipid of spirally wound two layers packed with their edges joined to each other.
- the nucleic acid can be arranged in the central hollow part thereof for delivery and controlled release into the body of an animal.
- DNA vaccine is delivered to mucosal surfaces via microspheres.
- Bioadhesive microspheres can be prepared using different techniques and can be tailored to adhere to any mucosal tissue including those found in eye, nasal cavity, urinary tract, colon and gastrointestinal tract, offering the possibilities of localized as well as systemic controlled release of vaccines.
- Application of bioadhesive microspheres to specific mucosal tissues can also be used for localized vaccine action.
- an alternative approach for mucosal vaccine delivery is the direct administration to mucosal surfaces of a plasmid DNA expression vector which encodes the gene for a specific protein antigen.
- DNA plasmid vaccines according to the present invention are formulated according to the mode of administration to be used.
- DNA plasmid vaccines are injectable compositions, they are sterile, and/or pyrogen free and/or particulate free.
- an isotonic formulation is preferably used.
- additives for isotonicity can include sodium chloride, dextrose, mannitol, sorbitol and lactose.
- isotonic solutions such as phosphate buffered saline are preferred.
- stabilizers include gelatin and albumin.
- a vasoconstriction agent is added to the formulation.
- a stabilizing agent that allows the formulation to be stable at room or ambient temperature for extended periods of time, such as LGS or other polycations or polyanions is added to the formulation.
- the DNA vaccine may further comprises a
- Suitable carriers for the vaccine are well known to those skilled in the art and include but are not limited to proteins, sugars, etc. Such carriers may be aqueous or non-aqueous solutions, suspensions, and emulsions. Examples of nonaqueous carriers are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate.
- Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media.
- Parenteral vehicles include sodium chloride solution, Ringer's dextrose and sodium chloride, lactated Ringer's or fixed oils.
- Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers such as those based on Ringer's dextrose, and the like.
- Preservatives and antimicrobials include antioxidants, chelating agents, inert gases and the like.
- Preferred preservatives include formalin, thimerosal, neomycin, polymyxin B and amphotericin B.
- An alternative approach to delivering the nucleic acid to an animal involves the use of a viral or bacterial vector.
- suitable viral vectors include adenovirus, polio virus, pox viruses such as alphaviruses, vaccinia, canary pox, and fowl pox, herpes viruses, including catfish herpes virus, adenovirus-associated vector, and retroviruses.
- Virus-like vectors include virosomes and virus-like particles.
- Exemplary bacterial vectors include attenuated forms of Salmonella, Shigella, Edwardsiella ictaluri, Yersinia ruckerii, and Listeria monocytogenes.
- the nucleic acid is a vector, such as a plasmid, that is capable of autologous expression of the nucleotide sequence encoding the immunogenic polypeptide.
- the vaccines described herein may be used for prophylactic and/or therapeutic treatment of herpes, including HSV-1 and particularly HSV-2.
- the subject receiving the vaccination may be a male or a female, and may be a child or adult.
- the subject being treated is a human.
- the subject is a non-human animal.
- the HSV-2 vaccine is administered to a subject to induce an immune response that can help protect against the establishment of HSV-2.
- the vaccine compositions of the invention confer protective immunity, allowing a vaccinated individual to exhibit delayed onset of symptoms or reduced severity of symptoms (e.g., reduced number of lesions at the onset of infection), as the result of his/her exposure to the vaccine (e.g., a memory response).
- the reduction in severity of symptoms is at least 25%, 40%, 50%, 60%, 70%, 80% or even 90%.
- Some vaccinated individuals may display no symptoms upon contact with, HSV-2, or even no infection by HSV-2.
- Protective immunity is typically achieved by one or more of the following mechanisms: mucosal, humoral, or cellular immunity.
- Mucosal immunity is primarily the result of secretory IgA (sIGA) antibodies on mucosal surfaces of the respiratory, gastrointestinal, and genitourinary tracts.
- the sIGA antibodies are generated after a series of events mediated by antigen-processing cells, B and T lymphocytes, that result in sIGA production by B lymphocytes on mucosa- lined tissues of the body.
- Humoral immunity is typically the result of IgG antibodies and IgM antibodies in serum.
- the IgG titer can be raised by 1.5-fold, 2-fold, 3-fold, 4-fold, 5 -fold, 10-fold, 20-fold, 50-fold, or even 100-fold or more following administration of a vaccine formulation described herein.
- Cellular immunity can be achieved through cytotoxic T lymphocytes or through delayed-type hypersensitivity that involves macrophages and T lymphocytes, as well as other mechanisms involving T cells without a requirement for antibodies.
- cellular immunity may be mediated by TRI cells or TR17 cells.
- Activation of TRI cells can be measured by secretion of IFN- ⁇ , relative to the level of IFN- ⁇ released in response to a polypeptide that does not generate an immunologic response.
- the amount of IFN- ⁇ released is 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold, 20-fold, 50-fold or even 100-fold greater.
- the primary result of protective immunity is the destruction of HSV-2 viral particles or inhibition of HSV-2's ability to replicate.
- the protective immunity conferred by presentation of antigen before exposure to HSV-2 will reduce the likelihood of seroconversion to an HSV-2 -positive status.
- the duration of protective immunity is preferably as long as possible.
- vaccine formulations produce protective immunity lasting six months, one year, two years, five years, ten years, twenty years or even a lifetime.
- a combination of specific polypeptides may prove efficacious for inhibiting HSV-2 infection or the onset of symptoms described above.
- An exemplary vaccine formulation for prophylactic use may comprise a pharmaceutically- acceptable carrier, a first polypeptide consisting of SEQ ID NOS: 136, a second polypeptide consisting of SEQ ID NO: 1 or 4, and optionally a third polypeptide consisting of the other of SEQ ID NOS: 1 and 4, or immunogenic fragments thereof.
- the second or third polypeptide consists of polypeptide fragments of SEQ ID NO: 1, such as the polypeptides of SEQ ID NOS: 2, 8-16, 138 and 139, or immunogenic fragments thereof.
- the vaccine formulation for prophylactic use may comprise a first polypeptide consisting of SEQ ID NO: 136, a second polypeptide consisting of SEQ ID NO: 4 or SEQ ID NO: 5, a third polypeptide selected from the group consisting of SEQ ID NOS: 2, 8-16, 138 and 139, and optionally a fourth polypeptide selected from the group consisting of SEQ ID NOS: 2, 8-16, 138 and 139, or immunogenic fragments thereof.
- a vaccine formulation for prophylactic use comprises a pharmaceutically-acceptable carrier and a nucleic acid having a nucleotide sequence that encodes at least one of SEQ ID NOS: 1, 3, 5, 38, 136 or 138, or an immunogenic fragment thereof.
- the nucleic acids can have a nucleotide sequence comprising at least one of SEQ ID NOS: 39, 46, 118, 137 or 140, or a fragment thereof that encodes an immunogenic polypeptide.
- the vaccine comprising a polypeptide or nucleic acid of the invention may be administered to a patient suffering from HSV-2, in an amount sufficient to treat the patient. Treating the patient, in this case, may refer to delaying or reducing symptoms of HSV-2 in an infected individual. In some embodiments, treating the patient refers to reducing the duration of lesions, reducing the number of lesions, reducing the duration of symptoms per episode, and/or otherwise reducing the intensity of symptoms per episode. In certain
- the vaccine reduces the duration or severity of mild symptoms; in some embodiments, the vaccine reduces the duration or severity of serious symptoms. In some embodiments, the vaccine reduces viral shedding and therefore the transmissibility of HSV-2 from the vaccinated patient. In certain embodiments, the reductions described above are at least 25%, 30%, 40%, 50%, 60%, 70%, 80% or even 90%. In certain embodiments, the reductions described above include the complete cessation of symptoms, viral shedding and/or future outbreaks (e.g., by blocking the ability of the virus to establish latency in sensory ganglia).
- the HSV-2 vaccine is administered to an individual post-infection.
- the HSV-2 vaccine may be administered shortly after infection, e.g. before symptoms manifest, or may be administered during or after manifestation of symptoms.
- the HSV-2 vaccine may prevent endogenous reactivation of earlier infection.
- a post-infection vaccine could be administered to patients in high-risk groups.
- vaccine formulations produce therapeutic effects lasting one month, two months, three months, six months, one year, two years, five years, ten years, twenty years or even a lifetime.
- a combination of specific polypeptides may prove efficacious for treating a patient suffering from HSV-2 as described above.
- An exemplary vaccine formulation for therapeutic use may comprise a pharmaceutically-acceptable carrier, a first polypeptide consisting of SEQ ID NOS: 136, a second polypeptide consisting of SEQ ID NO: 1 or 4, and optionally a third polypeptide consisting of the other of SEQ ID NOS: 1 and 4, or immunogenic fragments thereof.
- the second or third polypeptide consists of polypeptide fragments of SEQ ID NO: 1, such as the polypeptides of SEQ ID NOS: 2, 8-16, 138 and 139, or immunogenic fragments thereof.
- the vaccine formulation for therapeutic use may comprise a first polypeptide consisting of SEQ ID NO: 136, a second polypeptide consisting of SEQ ID NO: 4 or SEQ ID NO: 5, a third polypeptide selected from the group consisting of SEQ ID NOS: 2, 8-16, 138 and 139, and optionally a fourth polypeptide selected from the group consisting of SEQ ID NOS: 2, 8-16, 138 and 139, or immunogenic fragments thereof.
- a vaccine formulation for therapeutic use comprises a pharmaceutically-acceptable carrier and a nucleic acid having a nucleotide sequence that encodes at least one of SEQ ID NOS: 1, 3, 5, 38, 136 or 138 or an immunogenic fragment thereof.
- the nucleic acids can have a nucleotide sequence comprising at least one of SEQ ID NOS: 39, 46, 118, 137 or 140, or a fragment thereof that encodes an immunogenic polypeptide.
- Vaccine efficacy may be assayed in various model systems. Suitable model systems used to study HSV-2 include a guinea pig model and a mouse model, as described in the examples below. Briefly, the animals are vaccinated and then challenged with HSV-2 or the vaccine is administered to already-infected animals. The response of the animals to the HSV-2 challenge or the vaccine is then compared with control animals, using one of the measures described above. A similar assay could be used for clinical testing of humans. The treatment and prophylactic effects described above represent additional ways of determining efficacy of a vaccine.
- efficacy may be evaluated by in vitro immunization of naive human peripheral blood mononuclear cells (PBMC), where APCs are exposed to the vaccine and then the APCs are co-cultured with naive T cells from the same donor to evaluate the primary response to immunization in a test tube.
- PBMC peripheral blood mononuclear cells
- Vaccine efficacy may further be determined by viral neutralization assays.
- animals are immunized and serum is collected on various days post-immunization.
- Serial dilutions of serum are pre-incubated with virus during which time antibodies in the serum that are specific for the virus will bind to it.
- the virus/serum mixture is then added to permissive cells to determine infectivity by a plaque assay. If antibodies in the serum neutralize the virus, there are fewer plaques compared to the control group.
- compositions of the present disclosure are designed to elicit an immune response against HSV-2.
- Compositions described herein may stimulate an innate immune response, an antibody response or a cell-mediated immune response, or a combination of these responses, in the subject to which it is administered.
- the composition stimulates immune cells at the peripheral site of infection or sensory ganglia, such as neutrophils, macrophages, and NK cells.
- the composition may stimulate infiltration by macrophages; production of antiviral compounds such as nitric oxide, TNF-a, interferons (IFN), and interleukin 12 (IL-12) by neutrophils; and/or stimulation of NK cells to produce IFN- ⁇ .
- IFN interferons
- IL-12 interleukin 12
- composition and are believed to aid in controlling infection.
- the composition comprises antigens that stimulate production of neutralizing antibodies.
- Neutralizing antibodies may target the glycoproteins of the viral envelope, which mediate the interaction of virions with host cell and are responsible for attachment, binding, and entry of HSV-2 into cells.
- an exemplary composition comprises one or more glycoproteins described above or encoded by nucleic acids described above. Immunogenic antigens and/or epitopes as described herein may be administered separately, in series, or in combination with one another.
- the composition elicits a cell-mediated response, which may involve CD4 + T cells, CD8 + T cells and/or production of antiviral cytokines.
- the composition may trigger IL-17 secretion by T R 17 cells.
- the composition may trigger IFN- ⁇ secretion, for example through the activation of the innate immune response, and mediate CD8 + T cell clearing of the virus.
- IFN- ⁇ is also secreted by T H 1 cells, Tc cells, dendritic cells, and NK cells, and the composition may trigger IFN- ⁇ secretion by any of these cell types.
- Such activity of CD8 + T cells may be cytolytic, or, alternately, may be regulated by inhibitor molecules on the surface of the neurons which prevent neuronal killing.
- CD4 + and/or CD8 + T cells may play a role in maintaining latency of the virus, thus preventing reactivation.
- the composition boosts a CD4 + T cell response and/or a CD8 + T cell response that prevents reactivation of the virus from its latent state.
- the composition blocks the ability of HSV to evade the host immune response, or, alternately, boosts immune responses normally evaded by HSV.
- the composition inhibits HSV-2 from shifting the immunological balance towards tolerance of HSV antigens. HSV-2 may mediate tolerance through T R 2 cells.
- HSV-2 may induce suppressor T cells, such as CD4 + CD25 + T cells and Trl cells that secrete IL-10, a T H 2 cytokine.
- T H 2 cytokines downregulate costimulatory molecules and inhibit the maturation and function of antigen-presenting dendritic cells.
- infection with HSV-2 inhibits the maturation and migration of dendritic cells, which are essential for efficient induction of CD8 + killer T cells.
- T H 2 cytokines are produced during recurrence of HSV-2 infection, in contrast to T H 1 cytokines, which are produced during recurrence-free episodes.
- the compositions of the invention repress suppressor T cells and/or induce maturation or migration or both of dendritic cells.
- methods of inducing an immune response against HSV-2 in a mammal comprise administering the compositions described above.
- the composition may be used to induce an immune response at different time points, such as before exposure to HSV- 2, after initial infection with HSV-2, before or after HSV-2 has established latency, before or after HSV-2 shedding occurs, and/or before or after recurrent outbreaks occur.
- an immune response against HSV-2 may be induced at one or more of the timepoints above.
- the composition may induce a T H 1 response and/or a T H 17 response but not a T R 2 response, or may activate the responses at the same time or at different times.
- administration of the composition reduces symptoms associated with initial infection, latency, or recurrent infection with HSV.
- Such a composition may reduce incidence and/or severity of lesions, sores, pain, irritation, itching, fever, malaise, headache, viral shedding, or prodromes associated with HSV infection or outbreak.
- one or more antibodies to antigens of HSV-2 may be administered to individuals in order to produce passive immunity. Passive immunity results from the transfer of active humoral immunity in the form of ready-made antibodies, from one individual to another. Passive immunization may be used when there is a high risk of infection and insufficient time for the body to develop its own immune response, or to reduce the symptoms of ongoing or immunosuppressive diseases. Adoptive transfer of T cells may provide another method of eliciting an immune response to HSV-2 antigens in patients.
- autologous T cells may be expanded on APCs presenting the antigens derived from the polypeptides described above. Subsequently, the expanded HSV-2-specific T cells are transferred back into the patient from which the T cells were derived.
- patient refers to an individual (such as a human) that either has an HSV-2 infection or has the potential to contract an HSV-2 infection.
- the instant disclosure also provides a method of phenotyping biological samples from patients suspected of having a HSV-2 infection that involves: (a) rendering a biological sample amenable to immunoassay, if necessary; (b) contacting the sample with an appropriate HSV-2-specific antibody or antigen-binding portion thereof under conditions that allow for binding of the antibody or antigen-binding portion to an epitope of HSV-2; and (c) determining if the sample shows the presence of HSV-2 as compared to a control tissue; where if the test tissue shows the presence of HSV-2, the patient is identified as likely having a HSV-2 infection.
- the instant disclosure also provides a method of phenotyping biological samples from patients suspected of having a HSV-2 infection: (a) rendering a biological sample amenable to an affinity assay such as ELISA, if necessary; (b) contacting the sample with a HSV-2-specific antigen or portion thereof under conditions that allow for binding of the antigen to any host antibodies present in the sample; and (c) determining if the sample shows the presence of HSV-2 as compared to a control tissue; where if the test tissue shows the presence of HSV-2, the patient is identified as likely having a HSV-2 infection.
- an affinity assay such as ELISA
- aforementioned test may be appropriately adjusted to detect other viral infections, for instance by using a homolog (from another viral species) of the proteins described above, such as in Table 1 and/or Table 2.
- a number of methods for measuring antibody-antigen binding are known in the art, including ELISA (enzyme-linked immunosorbent assay), Western blotting, competition assay, and spot-blot.
- the detection step may be, for instance, chemiluminescent, fluorescent, or colorimetric.
- One suitable method for measuring antibody-protein binding is the Luminex xMAP system, where peptides are conjugated to a dye-containing microsphere. Certain systems, including the xMAP system, are amenable to measuring several different markers in multiplex, and could be used to measure levels of antibodies at once.
- profiling may be performed using any of the following systems: antigen microarrays, bead microarrays, nanobarcodes particle technology, arrayed proteins from cDNA expression libraries, protein in situ array, protein arrays of living transformants, universal protein array, lab-on-a-chip microfluidics, and peptides on pins.
- Another type of clinical assay is a chemiluminescent assay to detect antibody binding.
- antibodies are bound to a solid-phase support made up of microparticles in liquid suspension, and a surface fluorometer is used to quantify the enzymatic generation of a fluorescent product.
- the instant disclosure provides a method of phentoyping biological samples from patients suspected of having a HSV-2 infection, involving (a) rendering a biological sample amenable to an assay for activation of T cells, if necessary, (b) contacting the sample with a HSV-2-specific polypeptide or portion thereof under conditions that allow APCs to process the polypeptide, and (c) determining activation of the T cells in response to the HSV-2-specific polypeptide, where an elevated T cell activation relative to an uninfected patient indicates HSV-2 infection.
- This diagnostic assay is intended to detect the presence of HSV-2-specific T cells in any patients, including those patients who have been exposed to HSV-2 but have not seroconverted to produce detectable levels of anti-HSV-2 antibodies.
- T cell activation may be measured using many assays, including cytokine-specific
- ELISA cell proliferation measured by tritiated thymidine incorporation or membrane intercolating (PKH-67) or cytoplasmic (CFSE) dyes, ELISPOT, flow cytometry, and bead arrays.
- PPH-67 tritiated thymidine incorporation or membrane intercolating (PKH-67) or cytoplasmic (CFSE) dyes
- ELISPOT flow cytometry
- bead arrays e.g., cell proliferation measured by tritiated thymidine incorporation or membrane intercolating (PKH-67) or cytoplasmic (CFSE) dyes
- ELISPOT cytoplasmic
- flow cytometry flow cytometry
- bead arrays e.g., cell proliferation measured by tritiated thymidine incorporation or membrane intercolating (PKH-67) or cytoplasmic (CFSE) dyes
- ELISPOT cytoplasmic
- flow cytometry e.g., cytometry
- Infection with HSV-2 may be acute or latent.
- the biological sample shows the presence of HSV-2, one may administer a therapeutically effective amount of the compositions and therapies described herein to the patient.
- the biological sample may comprise, for example, blood, semen, urine, vaginal fluid, mucus, saliva, feces, urine, cerebrospinal fluid, or a tissue sample.
- the biological sample is an organ intended for transplantation.
- the biological sample is subject to culture conditions that promote the growth of HSV-2.
- the diagnostic tests herein may be used to detect HSV-2 in a variety of samples, including samples taken from patients and samples obtained from other sources.
- the diagnostic tests may be used to detect HSV-2 on objects such as medical instruments.
- the tests herein may be performed on samples taken from animals such as agricultural animals (cows, pigs, chickens, goats, horses and the like), companion animals (dogs, cats, birds, and the like), or wild animals.
- the tests herein may be performed on samples taken from cell cultures such as cultures of human cells that produce a therapeutic protein, cultures of bacteria intended to produce a useful biological molecule, or cultures of cells grown for research purposes.
- the invention also includes a method of determining the location of a HSV-2 infection in a patient comprising: (a) administering a pharmaceutical composition comprising a labeled HSV-2 antibody or antigen-binding portion thereof to the patient, (b) detecting the label, and (c) determining if the patient has HSV-2 compared to a control.
- the method further comprises, if the patient has an HSV-2 infection, administering a therapeutically effective amount of a composition described herein to the patient.
- the method may further comprise determining the infected cell types and/or volume of the HSV-2 in the patient. This method may be used to evaluate the spread of HSV-2 in the patient and determine whether a localized therapy is appropriate.
- the polypeptides described herein may be used to make a prognosis of the course of infection.
- T cell or antibody responses specific for the polypeptides herein may be detected in a sample taken from a patient. If antibodies or T cells are present at normal levels, it would indicate that the patient has raised an effective immune response against the pathogen. If antibodies or T cells are absent, or present at reduced levels, it would indicate that the patient is failing to raise a sufficient response against the pathogen, and a more aggressive treatment would be recommended. In some embodiments, antibody or T cells present at reduced levels refers to responses that are present at less than 50%, 20%, 10%), 5%o, 2%o, or 1% the typical level in a patient with a protective immune response. T cell responses may be detected by methods known in the art such as T cell proliferation,
- ELISPOT or ELISA antibodies may be detected by affinity for any of the antigens described herein, using methods known in the art such as ELISA.
- detection of T cells specific for HSV-2 antigens may be used to predict the progress and symptoms of HSV-2 infection in a patient. After infection with HSV-2, some patients remain asymptomatic, although the virus may establish latency. Other patients exhibit symptoms of HSV-2 infection, and may experience recurrent outbreaks. The HSV-2 antigens found in asymptomatic patients may differ from those antigens found in patients who present symptoms and/or recurrent outbreaks. Accordingly, the detection methods of the present invention may be used to distinguish between subgroups within the population of patients infected with HSV-2.
- Subgroups may be further divided into patients who experience frequent outbreaks and those who infrequently or never experience outbreaks, or patients who shed high levels of virus and those who shed low levels or do not shed.
- the categorization of patients based on the presence and levels of T cell responses to certain HSV-2 antigens but not others, may help health care practitioners to determine appropriate treatment regimens.
- differences in the magnitude of T cell responses and/or differences in the combination and levels of cytokines produced by T cells may also be used to predict the progress and symptoms of HSV-2 infection in a patient.
- an infected patient whose complement of HSV-2 antigens to which T cells respond predicts severe symptoms, frequent outbreaks, and/or high levels of viral shedding may require more intensive antiviral therapy and/or a longer course of therapeutic treatment than a patient whose complement of HSV-2 antigens predicts an asymptomatic infection.
- the methods herein are not limited to detection of HSV-2.
- Other embodiments include the detection of related viruses including viruses with proteins homologous to the proteins described above, such as those in Table 1 and/or Table 2.
- related viruses include, for example, other members of the Herpesviridae family. Depending on the homology, these related viruses may also include viruses that are not members of the Herpesviridae family.
- any individual has a certain risk of infection with HSV-2. However, certain sub-populations have an increased risk of infection.
- patients receiving the composition for HSV-2 are immunocompromised.
- An immunocompromising condition arising from a medical treatment is likely to expose the individual in question to a higher risk of infection. It is possible to treat an infection prophylactically in an individual having the immunocompromised condition before or during treatments known to generate such a condition. By prophylactically treating with the antigen before or during a treatment known to generate such a condition it is possible to prevent a subsequent infection or to reduce the risk of the individual contracting an infection due to the immunocompromised condition. Should the individual contract an infection, e.g., following a treatment leading to an immunocompromised condition, it is also possible to treat the infection by administering to the individual an antigen composition.
- compositions are administered to children or adult patients.
- compositions are appropriate for pregnant women who were infected before becoming pregnant, or who became infected during pregnancy, such as to inhibit infection of a fetus or baby.
- the compositions may also be administered to neonates and infants who became infected in utero or during delivery.
- the amount of antigen in each vaccine dose is selected as an effective amount, which induces a prophylactic or therapeutic response, as described above, in either a single dose or over multiple doses.
- the dose is without significant adverse side effects in typical vaccinees. Such amount will vary depending upon which specific antigen is employed.
- a dose will comprise 1-1000 ⁇ g of protein, in some instances 2-100 ⁇ g, for instance 4-40 ⁇ g.
- a dose will comprise 10-6000 ⁇ g of nucleic acid, in some instances 20-4000 ⁇ g, for instance 30-4000 ⁇ g.
- An optimal amount for a particular vaccine can be ascertained by standard studies involving observation of antibody titers, T cell activation levels, and other responses in subjects.
- the appropriate amount of antigen to be delivered will depend on the age, weight, and health (e.g. , immunocompromised status) of a subject.
- typically an adjuvant will be present in amounts from 1 ⁇ g - 250 ⁇ g per dose, for example 50-150 ⁇ g, 75-125 ⁇ g or 100 ⁇ g.
- only one dose of the vaccine is administered to achieve the results described above.
- subjects receive one or more boost vaccinations, for a total of two, three, four or five vaccinations.
- a boost vaccination may be administered, for example, about 1 month, 2 months, 4 months, 6 months, or 12 months after the initial vaccination, such that one vaccination regimen involves administration at 0, 0.5-2 and 4-8 months. It may be advantageous to administer split doses of vaccines which may be administered by the same or different routes.
- the invention supplies a treatment regimen comprising a first dose of vaccine and a second, third or fourth dose of vaccine (a boost vaccine).
- a first dose of vaccine comprises one or more polypeptide antigens, or nucleic acids encoding one or more polypeptide antigens, or a combination of one or more polypeptide antigens and nucleic acids encoding the same or other protein antigens.
- a boost vaccine is formulated with the same polypeptide antigens, nucleic acids, or polypeptide antigens and nucleic acids as the first dose.
- a boost vaccine is formulated with different polypeptide antigens, nucleic acids, or polypeptide antigens and nucleic acids from the first dose.
- the first dose may comprise only polypeptide antigens and boost vaccine may comprise only nucleic acids, or the first dose may comprise only nucleic acids and boost vaccine may comprise only polypeptide.
- the first dose may comprise polypeptide antigens and nucleic acids, and boost vaccine may comprise only protein antigens or only nucleic acids.
- the first dose may comprise only protein antigens or only nucleic acids, and boost vaccine may comprise protein antigens and nucleic acids.
- the boost vaccine is a polypeptide
- the polypeptide is gL2 (SEQ ID NO: 3) or ICP4 (SEQ ID NO: 1) or an
- immunogenic fragment thereof e.g., ICP4.2, and gL2s v.2, SEQ ID NOS: 2 and 136
- polypeptide boost vaccines are particularly useful in conjunction with any one of the nucleic acid vaccines described above (e.g., nucleic acids having nucleotide sequences that encode at least one of SEQ ID NOS: 1 , 3, 5, 38, 136 or 138, or an immunogenic fragment thereof).
- compositions described herein may take on a variety of dosage forms.
- the composition is provided in solid or powdered (e.g., lyophilized) form; it also may be provided in solution form.
- a dosage form is provided as a dose of lyophilized composition and at least one separate sterile container of diluent.
- the antigen is delivered to a patient at an amount of ⁇ ⁇ per dose. In some embodiments, the antigen is delivered at a dose ranging from 10 nmol to 100 nmol per dose.
- the appropriate amount of antigen to be delivered may be determined by one of skill in the art. In some embodiments, the appropriate amount of antigen to be delivered will depend on the age, weight, and health (e.g., immunocompromised status) of a subject.
- compositions disclosed herein are (in some embodiments) administered in amounts sufficient to elicit production of antibodies as part of an immunogenic response.
- the composition may be formulated to contain 5 ⁇ g /0.5 ml or an amount ranging from 10 ⁇ g IX ml to 200 ⁇ g IX ml of an antigen.
- the composition may comprise a combination of antigens.
- the plurality of antigens may each be the same concentration, or may be different concentrations.
- the composition will be administered in a dose escalation manner, such that successive administrations of the composition contain a higher concentration of composition than previous administrations. In some embodiments, the composition will be administered in a manner such that successive administrations of the composition contain a lower concentration of composition than previous administrations.
- compositions are administered to a patient suffering from a disease in an amount sufficient to cure or at least partially arrest the disease and its complications.
- Therapeutic applications of a composition described herein include reducing transmissibility, slowing disease progression, reducing viral shedding, or eliminating recurrent infections in patients that have been infected with HSV-2, such as by 90%, 80%>, 70%>, 60%>, 50%o, 40%), 30%), 20%) or 10%> of the levels at which they would occur in individuals who are not treated with the composition.
- the composition may also reduce the quantity of HSV-2 shed by infected individuals, inhibit the expression of proteins required for reactivation of HSV-2 from the latent stage in infected patients, and/or inhibit replication of HSV-2 in neurons of infected patients, such as by 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, or 10% of the levels at which they would occur in individuals not treated with the composition.
- compositions are administered to a human or other mammal to induce an immune response that can inhibit the establishment of an infectious disease or other condition.
- a composition may partially block the virus from establishing latency or reduce the efficiency with which latency is established.
- only one dose (administration) of the composition is given.
- composition is administered in multiple doses.
- composition is administered in multiple doses.
- the composition is administered once, twice, three times, or more than three times.
- the number of doses administered to a subject is dependent upon the antigen, the extent of the disease or the expected exposure to the disease, and the response of a subject to the composition.
- the compositions are administered in combination with antimicrobial molecules.
- Antimicrobial molecules may include antiviral molecules. Many antiviral molecules are currently known in the art, and target one or more stage of the viral life cycle, including viral attachment to host cells, release of viral genes and/or enzymes into the host cell, replication of viral components using host-cell machinery, assembly of viral components into complete viral particles, and release of viral particles to infect new hosts. Routes of administration
- the vaccine formulations and pharmaceutical compositions herein can be delivered by administration to an individual, typically by systemic administration ⁇ e.g. , intravenous, intraperitoneal, intramuscular, intradermal, subcutaneous, transdermal, subdermal, intracranial, intranasal, mucosal, anal, vaginal, oral, sublingual, buccal route or they can be inhaled) or they can be administered by topical application.
- systemic administration e.g. , intravenous, intraperitoneal, intramuscular, intradermal, subcutaneous, transdermal, subdermal, intracranial, intranasal, mucosal, anal, vaginal, oral, sublingual, buccal route or they can be inhaled
- topical application e.g., intravenous, intraperitoneal, intramuscular, intradermal, subcutaneous, transdermal, subdermal, intracranial, intranasal, mucosal, anal, vaginal, oral, sublingual, buccal route
- the composition may be administered directly to the likely sites of infection.
- the composition may be applied topically to mucosal membranes, or delivered vaginally or rectally using devices and methods known in the art.
- the vaginal and rectal routes of delivery permit extended, continuous or pulsed delivery and administration of composition dosages, and may be administered either before or after exposure to HSV, depending on the use of a prophylactic or therapeutic composition.
- the composition may be applied topically to the skin or mucosal membranes, or delivered rectally. In both patient populations, the composition may also be targeted to the sensory ganglia.
- HSV-2 vaccine or pharmaceutical composition is often administered via the intramuscular route. Typically, in this route, the vaccine is injected into an accessible area of muscle tissue. Intramuscular injections are, in some embodiments, given in the deltoid, vastus lateralis, ventrogluteal or dorsogluteal muscles. The injection is typically given at an
- An HSV-2 vaccine may also be administered subcutaneously.
- the injection is typically given at a 45° angle to the surface of the skin, so the vaccine is administered to the subcutis and not the muscle.
- the HSV-2 vaccine is administered intradermally.
- Intradermal administration is similar to subcutaneous administration, but the injection is not as deep and the target skin layer is the dermis.
- the injection is typically given at a 10-15° angle to the surface of the skin, so the vaccine is delivered just beneath the epidermis.
- the HSV-2 vaccine is administered by electroporation.
- Delivery by electroporation may be intramuscular or intradermal.
- Suitable devices for electroporation include devices made by Inovio Pharmaceuticals, Inc. (Blue Bell, PA) and the TriGridTM Delivery System made by Ichor Medical Systems, Inc. (San Diego, CA).
- the vaccine formulation may be suitable for administration to a human patient, and vaccine preparation may conform to USFDA guidelines.
- the vaccine formulation is suitable for administration to a non-human animal.
- the vaccine is substantially free of either endotoxins or exotoxins.
- Endotoxins include pyrogens, such as lipopolysaccharide (LPS) molecules.
- LPS lipopolysaccharide
- the vaccine may also be substantially free of inactive protein fragments.
- the vaccine has lower levels of pyrogens than industrial water, tap water, or distilled water.
- Other vaccine components may be purified using methods known in the art, such as ion-exchange chromatography, ultrafiltration, or distillation.
- the pyrogens may be inactivated or destroyed prior to administration to a patient.
- Raw materials for vaccines such as water, buffers, salts and other chemicals may also be screened and depyrogenated. All materials in the vaccine may be sterile, and each lot of the vaccine may be tested for sterility.
- the endotoxin levels in the vaccine fall below the levels set by the USFDA, for example 0.2 endotoxin (EU)/kg of product for an intrathecal injectable composition; 5 EU/kg of product for a non-intrathecal injectable composition, and 0.25-0.5 EU/ml for sterile water.
- EU endotoxin
- the vaccine comprising a polypeptide contains less than
- the vaccine contains less than 5%, less than 2%, less than 1%, less than 0.5%, less than 0.2%, or less than 0.1% DNA and/or RNA.
- the vaccine has low or no toxicity, within a reasonable risk- benefit ratio.
- compositions suitable for introduction of the pharmaceutical composition vary according to route of administration.
- routes of administration such as, for example, by intraarticular (in the joints), intravenous, intramuscular, intradermal,
- intraperitoneal, intranasal, and subcutaneous routes include aqueous and non-aqueous, isotonic sterile injection solutions, which can contain antioxidants, buffers, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient, and aqueous and nonaqueous sterile suspensions that can include suspending agents, solubilizers, thickening agents, stabilizers, and preservatives.
- the formulations can be presented in unit-dose or multi-dose sealed containers, such as ampoules and vials.
- Injection solutions and suspensions can be prepared from sterile powders, granules, and tablets of the kind previously described. Cells transduced by the packaged nucleic acid can also be administered intravenously or parenterally.
- Formulations suitable for oral administration can consist of (a) liquid solutions, such as an effective amount of the polypeptides or packaged nucleic acids suspended in diluents, such as water, saline or PEG 400; (b) capsules, sachets or tablets, each containing a
- Tablet forms can include one or more of lactose, sucrose, mannitol, sorbitol, calcium phosphates, corn starch, potato starch, tragacanth, microcrystalline cellulose, acacia, gelatin, colloidal silicon dioxide, croscarmellose sodium, talc, magnesium stearate, stearic acid, and other excipients, colorants, fillers, binders, diluents, buffering agents, moistening agents, preservatives, flavoring agents, dyes,
- Lozenge forms can comprise the active ingredient in a flavor, usually sucrose and acacia or tragacanth, as well as pastilles comprising the active ingredient in an inert base, such as gelatin and glycerin or sucrose and acacia emulsions, gels, and the like containing, in addition to the active ingredient, carriers known in the art.
- the pharmaceutical compositions can be encapsulated, e.g., in liposomes, or in a formulation that provides for slow release of the active ingredient.
- the antigens alone or in combination with other suitable components, can be made into aerosol formulations (e.g. , they can be "nebulized") to be administered via inhalation. Aerosol formulations can be placed into pressurized acceptable propellants, such as
- Suitable formulations for vaginal or rectal administration include, for example, suppositories, which consist of the polypeptides or packaged nucleic acids with a suppository base.
- Suitable suppository bases include natural or synthetic triglycerides or paraffin hydrocarbons.
- gelatin rectal capsules which consist of a combination of the polypeptides or packaged nucleic acids with a base, including, for example, liquid triglycerides, polyethylene glycols, and paraffin hydrocarbons.
- the formulation may be suitable for administration to a human patient, and the preparation may conform to US FDA guidelines. In some embodiments, the formulation is suitable for administration to a non-human animal.
- the composition is substantially free of either endotoxins or exotoxins.
- Endotoxins may include pyrogens, such as lipopolysaccharide (LPS) molecules.
- LPS lipopolysaccharide
- the composition may also be substantially free of inactive protein fragments which may cause a fever or other side effects.
- the composition contains less than 1%, less than 0.1%, less than 0.01%, less than 0.001%, or less than 0.0001% of endotoxins, exotoxins, and/or inactive protein fragments.
- the composition has lower levels of pyrogens than industrial water, tap water, or distilled water. Other components may be purified using methods known in the art, such as ion-exchange chromatography, ultrafiltration, or distillation.
- the pyrogens may be inactivated or destroyed prior to administration to a patient.
- Raw materials for compositions such as water, buffers, salts and other chemicals may also be screened and depyrogenated. All materials in the composition may be sterile, and each lot of the composition may be tested for sterility.
- the endotoxin levels in the composition fall below the levels set by the USFDA: 0.2 endotoxin (EU)/kg of product for an intrathecal injectable composition; 5 EU/kg of product for a non-intrathecal injectable composition, and 0.25-0.5 EU/ml for sterile water.
- EU endotoxin
- the preparation comprises less than 50%>, 20%>, 10%>, or
- the desired molecule is present in the substantial absence of other biological macromolecules, such as other proteins (particularly other proteins which may substantially mask, diminish, confuse or alter the characteristics of the component proteins, either as purified preparations or in their function in the subject reconstituted mixture).
- other biological macromolecules such as other proteins (particularly other proteins which may substantially mask, diminish, confuse or alter the characteristics of the component proteins, either as purified preparations or in their function in the subject reconstituted mixture).
- the composition has low or no toxicity, within a reasonable risk-benefit ratio.
- the composition comprises ingredients at concentrations that are less than LD 50 measurements for the animal being treated with the composition. LD 50 measurements may be obtained in mice or other experimental model systems, and extrapolated to humans and other animals. Methods for estimating the LD 50 of compounds in humans and other animals are well-known in the art.
- a composition, and any component within it, might have an LD 50 value in rats of greater than 100 g/kg, greater than 50g/kg, greater than 20 g/kg, greater than 10 g/kg, greater than 5 g/kg, greater than 2 g/kg, greater than 1 g/kg, greater than 500 mg/kg, greater than 200 mg/kg, greater than 100 mg/kg, greater than 50 mg/kg, greater than 20 mg/kg, or greater than 10 mg/kg.
- the therapeutic index of the composition is greater than 1, greater than 10, or greater than 100.
- the HSV-2 vaccines described herein may be produced using a variety of techniques.
- a polypeptide may be produced using recombinant DNA technology in a suitable host cell.
- a suitable host cell may be bacterial, yeast, mammalian, or other type of cell.
- the host cell may be modified to express an exogenous copy of one of the relevant polypeptide genes.
- the gene is operably linked to appropriate regulatory sequences such as a strong promoter and a polyadenylation sequence.
- the promoter is inducible or repressible.
- the gene may be present on an extrachromosomal plasmid, or may be integrated into the host genome.
- One of skill in the art will recognize that it is not necessary to use a nucleic acid 100% identical to the naturally- occurring sequence. Rather, some alterations to these sequences are tolerated and may be desirable. For instance, the nucleic acid may be altered to take advantage of the degeneracy of the genetic code such that the encoded polypeptide remains the same.
- the gene is codon-optimized to improve expression in a particular host.
- the nucleic acid may be produced, for example, by PCR or by chemical synthesis.
- a polypeptide may be isolated from it. The isolation may be accomplished, for example, by affinity purification techniques or by physical separation techniques (e.g., a size column).
- a method of manufacture comprising mixing one or more polypeptides or an immunogenic fragment or variant thereof with a carrier and/or an adjuvant.
- the adjuvant is one that stimulates a T H 1 cell response.
- antigens for inclusion in compositions of the invention may be produced in cell culture.
- One method comprises providing one or more mammalian expression vectors and cloning nucleotides encoding two or more polypeptides selected from polypeptides having an amino acid sequence of any one of SEQ ID NOS: 1-38, 135, 136, 138 or 139, then expressing and isolating the polypeptides.
- nucleic acids for inclusion in compositions of the invention may be produced by replication in a bacterial host such as E. coli and purified by standard R A or DNA purification methods.
- the immunogenic polypeptides described herein, and nucleic acid compositions that express the polypeptides can be packaged in packs, dispenser devices, and kits for administering nucleic acid compositions to a mammal.
- packs or dispenser devices that contain one or more unit dosage forms are provided.
- administration of the compounds will be provided with the packaging, along with a suitable indication on the label that the compound is suitable for treatment of an indicated condition, such as those disclosed herein.
- PBMC peripheral blood mononuclear cells
- Infected but asymptomatic, and exposed but seronegative patients may activate protective immune responses that patients who experience frequent outbreaks do not; in particular, exposed but seronegative patients are presumed to have mounted sterilizing immunity to HSV-2 infection. It is believed that a unique set of polypeptides will activate lymphocytes from these patient populations.
- Lymphocytes were isolated from patients belonging to several populations:
- Table 3 shows the frequency analysis for thirteen HSV-2 antigens encoded by ULIO, UL19, UL40, US4, US6, RS I (RS1.1 , RS 1.2, RS 1.3), UL36 (UL36.3, UL 36.4, UL36.5), UL32, and RL2 in the exposed patient cohort compared to the recurrer cohorts (frequent and less-frequent recurrers combined).
- Lymphocytes were isolated from patients belonging to several populations:
- Table 5 shows the frequency analysis for three HSV-2 antigens encoded by RLl
- Example 2 In vivo data: protein antigen immunizations
- the results of exemplary studies are presented below in Tables 6-10.
- the neutralizing antibody titer was determined at day 41 post-infection and 7 days after third immunization using an average of 4 out of the 12-20 animals in each group.
- the mean recurrent lesion scores and mean lesion days were each determined from day 15 to day 63 or day 70 postinfection.
- the lesion scores represent total lesions for each group from day 15 to 60 and then a mean was calculated.
- Mean lesion days represent the mean number of days post-infection that immunized or non-immunized animals had herpetic lesions present.
- Vaginal-swab samples were collected from all animals for 12 days between days 20-63 post-infection and stored at -80°C until assayed for virus shedding titers by quantitative real-time PCR. Table 6. Results of therapeutic vaccination studies with ICP4.2 (SEQ ID NO: 2): lesions
- mice Female C57BL/6 mice from 6 to 8 weeks of age were immunized subcutaneous ly with antigen (HSV-2 polypeptide) plus adjuvant (12 ⁇ g dose of an ISCOM matrix with a 82: 18 mixture of Quillaja saponin matrices A and C) on day 0 and day 9. On day 11, estrous cycles were synchronized with Depo Provera and then the mice were challenged on day 16 via intra vaginal deposition of 10 times the LD 50 of HSV-2 strain 333 while under anaesthesia. All animals were monitored for morbidity (clinical score) and mortality, and body weights and vaginal swabs were collected between days 17 and 28 post-infection.
- HSV-2 polypeptide antigen
- adjuvant (12 ⁇ g dose of an ISCOM matrix with a 82: 18 mixture of Quillaja saponin matrices A and C) on day 0 and day 9.
- estrous cycles were synchronized with Depo Provera and then the mice were challenged on day 16 via
- mice were immunized subcutaneously with either 5 ⁇ g or 10 ⁇ g of antigen plus adjuvant (12 ⁇ g dose of an ISCOM matrix with an 82: 18 mixture of Quillaja saponin matrices A and C) on day 0 and day 9.
- Control animals received phosphate buffered saline (PBS) only, or adjuvant only.
- PBS phosphate buffered saline
- C57BL/6 mice are immunized subcutaneously with either 5 ⁇ g or 10 ⁇ g of antigen plus adjuvant (24 ⁇ g dose of an ISCOM matrix with a 91 :9 mixture of Quillaja saponin matrices A and C) on day 0 and day 21.
- Control animals receive phosphate buffered saline (PBS) only, or adjuvant only.
- Animals are challenged intravaginally with 10 4 PFU HSV-2 strain 333 seven days after the last immunization. In some cases, a subset of unchallenged animals is euthanized on the day of challenge for immunogenicity experiments to monitor T cell and antibody responses to the vaccine.
- mice All challenged mice are monitored for morbidity (clinical score) and mortality, and body weights and vaginal swabs for viral shedding evaluation are collected between days 17 and 28 post-infection, as described above. Clinical scores are recorded and compared across experimental and control groups of mice.
- Guinea pigs were evaluated daily (day 1-14), and primary genital skin disease was quantified using a lesion severity score scale from 1-4. Numerical scores were assigned to specific disease signs as follows: 0, no disease; 1, redness or swelling; 2, a few small vesicles; 3, several large vesicles; 4, several large vesicles with maceration.
- the guinea pigs were euthanized , and the dorsal root ganglia (DRG) were harvested, stored at -80°C until they were processed for quantitative real-time PCR analysis.
- DDG dorsal root ganglia
- Vaccination studies are also performed with gL2s v.2, ICP4, and gD2ATMR.
- mice Female Hartley guinea pigs from 250-350 grams (weight) are immunized subcutaneous ly with 15 ⁇ g of antigen(s) plus adjuvant (50 ⁇ g dose of an ISCOM matrix with a 91 :9 mixture of Quillaja saponin matrix A and matrix C) on day 0 and day 21.
- Control animals receive phosphate buffered saline (PBS) only, or adjuvant only.
- Sera are collected by toenail clip after immunization for monitoring total IgG responses and antibody neutralization of virus in vitro, and the immunized guinea pigs are challenged via intravaginal deposition of 5xl0 5 PFU of HSV- 2 strain MS. Animals are monitored for acute infection for 15 days post challenge.
- Vaginal-swab samples are collected from all animals on days 2, 4, and 6 after challenge and stored at -80°C until assayed for virus titers by quantitative real-time PCR.
- Guinea pigs are evaluated daily (day 1-14), and primary genital skin disease is quantified using a lesion severity score scale from 1-4. Numerical scores are assigned to specific disease signs as follows: 0, no disease; 1, redness or swelling; 2, a few small vesicles; 3, several large vesicles; 4, several large vesicles with maceration. After the acute phase, animals are monitored daily (day 15-63) for recurrences.
- Groups are evaluated for length of time to first recurrence, monitored for genital skin disease, and in some cases, vaginal swabs taken at regular intervals to monitor viral shedding.
- the guinea pigs are euthanized, and the dorsal root ganglia (DRG) are harvested, stored at -80°C until they are processed for viral titers by quantitative real-time PCR analysis.
- DRG dorsal root ganglia
- mice were immunized subcutaneously in the scruff of the neck with a 100 ⁇ injection of 5 ⁇ g antigen plus adjuvant (12 ⁇ g dose of an ISCOM matrix with a 82: 18 mixture of Quillaja saponin matrices A and C) in saline. The mice received one or two injections, 7 days apart. Analysis of immunogenicity occurred 7 days after the final injection.
- the immunogenicity assay was an ex vivo IFN- ⁇ ELISPOT.
- CD4 + and CD8 + T cells were enriched from the spleen and separately analyzed.
- membrane plates were prepared by coating them overnight with capture antibody and subsequently blocked by supplemented medium for a minimum of 2 hours at 37°C. The mice were euthanized and their spleens harvested. The T cells were then prepared by sorting the splenocytes for CD4 + and CD8 + T cells using magnetic beads. The blocking solution was washed out from ELISPOT plates and the T cells were added to the blocked plates. The plates were returned to the incubator to allow the T cells to settle.
- APCs were prepared by pulsing na ' ive T cell-depleted splenocytes with antigen for 2 hours at 37°C.
- CD4 + ELISPOTs APCs were pulsed with whole protein.
- CD8 + ELISPOTs APCs were pulsed with E. coli expressing protein plus cLLO.
- a medium control was APCs incubated for 2 hours at 37°C with no additional antigen.
- the pulsed APCs were irradiated and added to appropriate wells of plates containing T cells. Phorbol myristate acetate (PMA) and ionomycin were added to separate T cell-containing control wells as a positive control.
- PMA Phorbol myristate acetate
- ionomycin were added to separate T cell-containing control wells as a positive control.
- HRP horseradish peroxidase
- AEC 3-amino-9-ethylcarbazole
- Immunogenicity assay I showed a robust immunogenic response for both one- and two-injection regimens with ICP4.2.
- the number of IFN- ⁇ spots per 200,000 T cells were 8 and 101 for CD4 + and CD8 + T cells, respectively.
- the two- injection regimen there were 50 and 70 spots, respectively. In contrast, less than 15 spots were observed for media or adjuvant alone in either CD4 + or CD8 + T cells.
- mice per group were immunized intraperitoneally with lxl 0 8 bacteria in
- mice received 1-2 additional boosters at 1 week intervals. Seven days after the last boost, sera were collected and analyzed in an HSV-2 neutralization assay. Five-fold serial dilutions were prepared for plasma or serum samples in a 96-well round-bottom plate, followed by the addition of 50 PFUs HSV-2 (strain 333) to each well. The plates were covered and incubated at 37°C for 1 hour. 200 ⁇ of the virus-serum mixtures was transferred in duplicate to Vero cells grown in a 48-well tissue culture plate and incubated for 1 hour at 37°C. 300 ⁇ of DMEM containing 2% FBS was then added to each well and the plates were incubated for 48 hours at 37°C. To visualize virus plaques, the plates were stained with crystal violet.
- mice were immunized with 2 ⁇ g/mouse of pooled, overlapping peptides (OLP) spanning the entire sequence of gL2 and ICP4 fragments encoded by RSI .3.1 and RSI .3.2.
- OLPs were formulated in TiterMax adjuvant (Alexis Biochemical) in a total volume of 100 ⁇ per mouse where adjuvant represented 1/3 of the subcutaneous dose.
- Mice were immunized on day 0, boosted on day 6 and spleens and blood were collected on day 11.
- Single cell suspensions were prepared from spleens and erythrocytes were lysed. The splenocyte suspensions were then divided into halves.
- the first half was separated into APCs, CD4 + and CD8 T cells; 200,000 T cells were seeded per well of an IFN- ⁇ ELISPOT plate and stimulated with 100,000 APCs and OLP pool corresponding to immunization, irrelevant peptide, positive and negative control. Cells were incubated in plates overnight, after which the plates were developed and spots per well were counted. The second half of each splenocyte suspension was run as unseparated splenocytes (400,000/well), pulsed with peptides, and assayed as described above.
- Purified protein was mixed with adjuvant and immunized into na ' ive mice to evaluate the ability to make CD4 + and CD8 + T cell responses to the protein antigens. Briefly, antigen alone (gD2ATMR ⁇ g)) or combinations of antigens (gD2ATMR and ICP4.2 (l( ⁇ g)) were mixed with adjuvant (12 ⁇ g dose of an ISCOM matrix with a 82: 18 mixture of Quillaja saponin matrices A and C) and administered subcutaneously to mice, twice, 9 days apart. Seven days after the second immunization, mice were euthanized and spleens were harvested for ex VIVO IFN- ⁇ ELISPOT assays.
- CD4 + and CD8 T cells were enriched using antibody-coated magnetic beads and then co-cultured on IFN-y-specific antibody-coated membranes in 96-well plates.
- APCs were na ' ive splenocytes pulsed with specific or non-specific purified proteins (as indicated) and irradiated with an x-ray irradiator. After 18 hour co-culture of T cells and APCs, captured IFN- ⁇ was detected with a biotinylated secondary IFN-y-specific antibody and visualized with horseradish peroxidase and 3-amino-9-ethylcarbazole substrate.
- mice were immunized with a combination of gD2ATMR and ICP4.2 antigens and challenged as described above. Mice immunized with the combination of antigens plus adjuvant showed a lower mean disease score at ten days after virus challenge compared to animals receiving gD2ATMR with adjuvant.
- Table 16 shows the data as the mean recurrent lesion score for each week after the guinea pigs recovered from their acute disease.
- the guinea pigs treated with a combination of gD2 and ICP4.2 antigens showed a reduction in the mean lesion score at 7 (day 42) and 14 (day 49) days after their last immunization compared to animals receiving the individual antigens with adjuvant.
- the animals were randomized into groups of 12 and immunized subcutaneously with antigen (each HSV-2 polypeptide at 15 ⁇ g dose) plus adjuvant (50 ⁇ g dose of an ISCOM matrix with a 91 :9 mixture of Quillaja saponin matrices A and C).
- antigen each HSV-2 polypeptide at 15 ⁇ g dose
- adjuvant 50 ⁇ g dose of an ISCOM matrix with a 91 :9 mixture of Quillaja saponin matrices A and C.
- Genital swabs were collected during the vaccination period to monitor viral shedding, and daily observations were recorded.
- Table 17 shows the data as the mean recurrent lesion score for each week after the guinea pigs recovered from their acute disease. The guinea pigs treated with a combination of gD2ATMR and ICP4.2 antigens showed a reduction in the mean lesion score after their last immunization compared to animals receiving the individual antigens with adjuvant.
- Purified protein was mixed with adjuvant and immunized into naive mice to evaluate the ability to make both antibody responses and CD4 + and CD8 + T cell responses to the protein antigens. Briefly, antigen alone or combinations of antigens were mixed with adjuvant (ISCOM matrix with a 91 :9 mixture of Quillaja saponin matrices A and C) and administered subcutaneously to mice, twice, 21 days apart. Seven days after the second immunization, mice were euthanized. Blood was collected to determine antigen-specific antibody titers by direct protein ELISA assays, as described below, and spleens were harvested for ex vivo IFN- ⁇ ELISPOT assays.
- CD4 + and CD8 + T cells were enriched using antibody-coated magnetic beads and then co-cultured on IFN-y-specific antibody-coated membranes in 96-well plates.
- APCs were na ' ive splenocytes pulsed with specific or non-specific purified proteins (as indicated) and irradiated with an x-ray irradiator. After 18 hour co-culture of T cells and APCs, captured IFN- ⁇ was detected with a biotinylated secondary IFN-y-specific antibody and visualized with horseradish peroxidase and 3-amino-9-ethylcarbazole substrate. Data are reported as the number of IFN- ⁇ spot forming units per 2xl0 5 T cells ⁇ standard deviation of three mice per group.
- Antigen-specific serum antibody titers of immunized mice were determined by direct protein ELISA. The sera were processed from blood collected above and stored at -80°C. ELISA plates were coated overnight at 4°C with 5 ⁇ g of whole protein in 0.1 M carbonate buffer, pH 9.5. Plates were washed with TBS + 0.05% Tween-20 (TBS-T) and blocked with TBS-T + 1% bovine serum albumin for lh. Serum samples were serially diluted and incubated in the antigen-coated wells for 2 hours at room temperature.
- AP activity was achieved by the addition of p-Nitrophenyl phosphate (pNPP;
- Endpoint titers were calculated by extrapolation of the linear portion of the serial dilutions and defining the endpoint as the dilution at which the linear portion of the curve intersects with the background cut-off.
- the cut-off used for data calculation was 2 times the value of the negative control serum from a na ' ive mouse.
- Figures 4A and B depict exemplary graphs illustrating the number of IFN- ⁇ spot forming units per 2xl0 5 CD4 + (Panel A) or CD8 + (Panel B) T cells, following immunization with gD2ATMR, ICP4.2, gD2ATMR plus ICP4, gL2s v.2, UL40 protein, and gL2s v.2 plus UL40 protein. Strong T cell responses specific for ICP4.2, gD2ATMR, UL40 and gL2 were observed when mice were immunized with individual antigens or in the following combinations:
- Figure 5 illustrates IgGl and IgG2c antibody titers against gL2s v.2, UL40 protein, and gL2s v.2 plus UL40 protein. Antibodies to gL2s v.2 and UL40 protein were observed when mice were immunized with cognate antigens, either individually or in
- IgGl and IgG2c subtypes of antigen-specific antibodies were detected for all antigens.
- Exemplary Study 7 Immunogenicity of gL2s v.2, ICP4.2, ICP4.2 plus gL2s v.2, ICP4.9, ICP4.9 plus gL2s v.2, ICP4.5, and ICP4.5 plus gL2s v.2 in C57BL/6 mice
- Purified protein was mixed with adjuvant and immunized into naive mice to evaluate the ability to make both antibody responses and CD4 + and CD8 + T cell responses to the protein antigens as described for Exemplary Study 6 above, except that APCs were pulsed with either the indicated purified proteins, or with pools of overlapping peptides spanning the indicated proteins.
- Mice received gL2s v.2, ICP4.5 at two different doses, ICP4.9 at two different doses, ICP4.2, or combinations of ICP4.5, ICP4.9, and ICP4.2 plus gL2s v.2.
- Figures 6A and B depict exemplary graphs illustrating the average number of
- IFN- ⁇ spot forming units per 2xl0 5 CD4 + (Panel A) or CD8 + (Panel B) T cells following immunization with gL2s v.2, ICP4.2, ICP4.2 plus gL2s v.2, ICP4.9, ICP4.9 plus gL2s v.2, ICP4.5, and ICP4.5 plus gL2s v.2. Strong gL2s v.2, ICP4.2, ICP4.9, and ICP4.5 T cell responses were obtained. Some expected cross-reactivity due to sequence overlap among proteins was observed. Unexpected cross-reactivity was observed between gL2s v.2 and ICP4.5.
- Figures 6C and D depict exemplary graphs illustrating the average number of
- IFN- ⁇ spot forming units per 2xl0 5 CD4 + (Panel C) or CD8 + (Panel D) T cells following immunization with gL2s v.2, ICP4.2, ICP4.2 plus gL2s v.2, ICP4.9, ICP4.9 plus gL2s v.2, ICP4.5, and ICP4.5 plus gL2s v.2, as in Figures 6A and B, except that APCs were pulsed with pools of overlapping peptides spanning the indicated proteins rather than with purified proteins.
- Figure 7 depicts an exemplary graph illustrating antibody titers against gL2s v.2,
- Example 3 In vivo data: Murine prophylactic vaccination studies with protein antigen plus DNA, and DNA only
- mice were immunized intramuscularly on day 0 and 21 with 10 ⁇ g of gL2s v.2 protein plus adjuvant (24 ⁇ g dose of an ISCOM matrix with a 91 :9 mixture of Quillaja saponin matrix A and matrix C), or 100 ⁇ g of DNA plasmid encoding gD2 (pUs6) combined with 50 ⁇ g of DNA plasmid encoding murine IL-12 (pIL-12) as adjuvant.
- Another group received 100 ⁇ g of DNA plasmid encoding gL2 (pULl) and 50 ⁇ g of pIL-12 as the prime immunization at day 0, and 10 ⁇ g of gL2s v.2 protein plus ISCOM adjuvant for the boost on day 21.
- Control animals received 50 ⁇ g of pIL-12 or ISCOM adjuvant only. Animals were challenged intra vaginally with 10 4 PFU HSV-2 strain 333 seven days after the last immunization. In some cases, a subset of unchallenged animals were euthanized on the day of challenge for immunogenicity experiments to monitor T cell and antibody responses to the vaccine (as described in Exemplary Studies 3 and 4 below).
- Table 18 and Table 19 illustrate exemplary results of two separate prophylactic vaccination studies.
- Vaccination study 1 mouse protection results for gL2s v.2, pUs6 DNA, and pULl DNA with gL2s v.2 protein boost
- Vaccination study 2 mouse protection results for gL2s v.2, pUs6 DNA, and pULl DNA plus gL2s v.2 boost
- mice were immunized with plasmid DNA encoding gD2, ICP4 or gL2 along with plasmid DNA encoding IL-12 or gL2s v.2 protein with or without ISCOM adjuvant, as described in Exemplary Studies 1 and 2 above.
- Two groups were primed with plasmid DNA encoding gL2 and plasmid DNA encoding IL12 and boosted with gL2s v.2 protein.
- mice were immunized with a combination of gL2s v.2 protein and ICP4 plasmid DNA along with IL12 plasmid.
- CD4 + and CD8 T cells were enriched using antibody-coated magnetic beads and then co-cultured on IFN-y-specific antibody-coated membranes in 96-well plates.
- APCs were na ' ive splenocytes pulsed with pools of overlapping peptides spanning indicated proteins and irradiated with an x-ray irradiator.
- IFN- ⁇ was detected with a biotinylated secondary IFN-y- specific antibody and visualized with horseradish peroxidase and 3-amino-9-ethylcarbazole substrate. Data are reported as the number of IFN- ⁇ spot forming units per 2xl0 5 T cells ⁇ standard deviation of three mice per group.
- Antigen-specific serum antibody titers of immunized mice were determined by direct protein ELISA. The sera were processed from blood collected above and stored at -80°C. ELISA plates were coated overnight at 4°C with 5 ⁇ g of whole protein in 0.1 M carbonate buffer, pH 9.5. Plates were washed with TBS + 0.05% Tween-20 (TBS-T) and blocked with TBS-T + 1% bovine serum albumin for lh. Serum samples were serially diluted and incubated in the antigen-coated wells for 2 hours at room temperature.
- AP activity was achieved by the addition of p-Nitrophenyl phosphate (pNPP;
- Endpoint titers were calculated by extrapolation of the linear portion of the serial dilutions and defining the endpoint as the dilution at which the linear portion of the curve intersects with the background cut-off.
- the cut-off used for data calculation was 2 times the value of the negative control serum from a naive mouse.
- Figures 8A and B depict exemplary graphs illustrating the average number of
- mice that were primed with pULl and pIL-12 DNA and boosted with gL2s v.2 protein.
- Weak T cell response was observed when pULl DNA was used for priming and boost. Very low levels of ICP4-specific T cells were detected.
- Figure 9 depicts an exemplary graph illustrating total IgG antibody titers against
- ICP4.2 and gL2s v.2 (also gD2ATMR). Prime and/or boost with gL2s v.2 protein was required for development of gL2s v.2-specific antibodies.
- Exemplary Study 4 Immunogenicity of gL2s v.2 protein; pULl DNA (encoding gL2) ; pULl DNA (encoding gL2) with gL2s v.2 protein boost; pRSl DNA (encoding ICP4) ; pRSl DNA (encoding ICP4) plus pULl DNA (encoding gL2); and pUs6 DNA (encoding gD2) in C57BL/6 mice
- C57BL/6 mice were immunized as described in Exemplary Studies 1 and 2 above with gL2s v.2 protein plus adjuvant; pULl DNA (encoding gL2); pULl DNA (encoding gL2) with gL2s v.2 protein plus adjuvant boost; pRSl DNA (encoding ICP4); pRSl DNA (encoding ICP4) plus pULl DNA (encoding gL2); and pUs6 DNA (encoding gD2). Seven days post last immunization, spleens were harvested for ex vivo IFN- ⁇ ELISPOT assays as described in Exemplary Study 3 above.
- Figures 10A and B depict exemplary graphs illustrating the number of IFN- ⁇ spot forming units per 2xl0 5 CD4 + (Panel A) or CD8 + (Panel B) T cells, following immunization with gL2s v.2 protein; pULl DNA (encoding gL2); pULl DNA (encoding gL2) with gL2s v.2 protein boost; pRSl DNA (encoding ICP4); pRSl DNA (encoding ICP4) plus pULl DNA (encoding gL2); and pUs6 DNA (encoding gD2).
- Exemplary Study 5 Immunogenicity of pRSl DNA (encoding ICP4), pRS1.9 DNA (encoding ICP4.9), and pUs4 DNA (encoding gG2) with corresponding DNA boost; pRSl DNA (encoding ICP4), pRS 1.9 DNA (encoding ICP4.9), and pUs4 DNA (encoding gG2) with ICP4.2 boost
- mice were immunized as described in Exemplary Studies 1 and 2 above with plasmid DNA encoding ICP4, ICP4.9, gG2 or empty plasmid in combination with a plasmid encoding mouse IL-12. Mice were then divided into three groups. Mice of the first group were boosted on day 21 the same way they were primed. Mice of the second group were boosted on day 21 with ICP4.2 protein plus ISCOM adjuvant. Mice of the third group were boosted on days 21 and 35 the same way they were primed. Seven days post last immunization, spleens were harvested for ex vivo IFN- ⁇ ELISPOT assays as described in Exemplary Study 3 above.
- Figures 11 depicts an exemplary graph illustrating the number of IFN- ⁇ spot forming units per 2xl0 5 CD4 + (left panel) or CD8 + (right panel) T cells, following immunization with pRSl DNA (encoding ICP4), pRS1.9 DNA (encoding ICP4.9), and pUs4 DNA (encoding gG2) with corresponding DNA boost (first group of mice) or with ICP4.2 protein boost (second group of mice) on day 21. Strong ICP4.2-specific T cell response was observed in mice primed with pRSl or pRS1.9 DNA, then boosted with ICP4.2 protein plus ISCOM adjuvant.
- Figure 12 depicts an exemplary graph illustrating the number of IFN- ⁇ spot forming units per 2xl0 5 CD4 + (left panel) or CD8 + (right panel) T cells, following immunization with pRSl DNA (encoding ICP4)and pUs4 DNA (encoding gG2) with corresponding DNA boosts on days 21 and 35 (third group of mice).
- SEQ ID NO: 2 ICP4 internal fragment
- SEQ ID NO: 4 gD2 internal deletion dD2ATMR encoded by construct US6ATMR
- SEQ ID NO: 5 predicted sequence for gD2 encoded by US6
- SEQ ID NO: 6 ICP34.5 encoded by RL1
- SEQ ID NO: 7 ICPO encoded by RL2
- SEQ ID NO: 8 ICP4 internal fragment encoded by construct RS1.1 (#1-400)
- SEQ ID NO: 9 ICP4 internal fragment encoded by construct RS1.3.1 (#750-1024)
- SEQ ID NO: 10 ICP4 internal fragment encoded by construct RSI .3.2 (#1008-1319)
- SEQ ID NO: 11 ICP4 internal fragment encoded by construct RSI .3 (#750-1319)
- SEQ ID NO: 12 ICP4 internal fragment encoded by construct RSI .4 (#340-883)
- SEQ ID NO: 13 ICP4 internal fragment encoded by construct RS1.5 (#775-1318)
- SEQ ID NO: 14 ICP4 internal fragment encoded by construct RSI .6 (#210-1318)
- SEQ ID NO: 15 ICP4 internal fragment encoded by construct RS1.7 (deletion of #391-544)
- SEQ ID NO: 16 ICP4 internal fragment encoded by construct RSI .8 (deletion of #786-868)
- SEQ ID NO: 17 predicted sequence for uracil DNA glycosylase encoded by UL2
- SEQ ID NO: 18 predicted sequence for tegument protein encoded by UL11
- SEQ ID NO: 19 gL2 secreted v.1 encoded by construct ULls v.1
- SEQ ID NO: 20 predicted sequence for VP5 encoded by construct UL19a
- SEQ ID NO: 21 VP5 encoded by construct UL19ATEV
- SEQ ID NO: 22 predicted sequence for ICPl/2 encoded by UL36 MI PAALPHPTMKRQGDRDIWTGVRNQFATDLEPGGSVSCMRS SLSFLSLLFDVGPRDVLSAEAIEGCLVEGGEWTR AAAGSGPPRMCS I IELPNFLEYPAARGGLRCVFSRVYGEVGFFGEPTAGLLETQCPAHTFFAGPWAMRPLSYTLL I GPLGMGLYRDGDTAYLFDPHGLPAGTPAFIAKVRAGDVYPYLTYYAHDRPKVRWAGAMVFFVPSGPGAVAPADLTAA ALHLYGASETYLQDEPFVERRVAI THPLRGE IGGLGALFVGWPRGDGEGSGPWPALPAPTHVQTPGADRPPEAPR GASGPPDTPQAGHPNRPPDDVWAAALEGTPPAKPSAPDAAASGPPHAAPPPQTPAGDAAEEAEDLRVLEVGAVPVGR HRARYSTGLPKRRRPTWTPPS SVEDLTSGERPAPK
- SEQ ID NO: 23 ICPl/2 internal fragment encoded by construct UL36.3.4.1
- SEQ ID NO: 24 ICPl/2 internal fragment encoded by construct UL36.4.2.5
- SEQ ID NO: 25 predicted sequence for reductase encoded by UL40 MDPAVSPASTDPLDTHASGAGAAPIPVCPTPERYFYTSQCPDINHLRSLSILNRWLETELVFVGDEE DVSKLSEGELGFYRFLFAFLSAADDLVTENLGGLSGLFEQKDILHYYVEQECIEWHSRVY I IQLVLFHNNDQARR AYVARTINHPAIRVKVDWLEARVRECDSIPEKFILMILIEGVFFAASFAAIAYLRTNNLLRVTCQSNDLISRDEAVH TTASCYIYNNYLGGHAKPEAARVYRLFREAVDIEIGFIRSQAPTDSSILSPGALAAIENYVRFSADRLLGLIHMQPL YSAPAPDASFPLSLMSTDKHTNFFECRSTSYAGAWNDL
- SEQ ID NO: 26 ICP47 encoded by US 12
- SEQ ID NO: 27 gM2 encoded by UL10
- SEQ ID NO: 28 predicted sequence for cleavage/packaging protein encoded by UL15
- SEQ ID NO: 29 predicted sequence for ICP35 encoded by UL26.5 MNPVSASGAPAPPPPGDGSYLWIPASHYNQLVTGQSAPRHPPLTACGLPAAGTVAYGHPGAGPSPHYPPPPAHPYPG MLFAGPSPLEAQIAALVGAIAADRQAGGLPAAAGDHGIRGSAKRRRHEVEQPEYDCGRDEPDRDFPYYPGEARPEPR PVD S RRAARQAS G PHE I ALVGAVT S LQQE LAHMRARTHAP YG P Y P PVG P YHH PHADTE T PAQ P PRY PAKAVYL P P PHIAPPGPPLSGAVPPPSYPPVAVTPGPAPPLHQPSPAHAHPPPPPPGPTPPPAASLPQPEAPGAEAGALVNASSAA H V VD TARAAD L FVSQMMG S R
- SEQ ID NO: 30 predicted sequence for polymerase encoded by UL30
- SEQ ID NO: 31 predicted sequence for helicase/primase complex encoded by UL5
- SEQ ID NO: 32 predicted sequence for helicase/primase complex encoded by UL8
- SEQ ID NO: 33 predicted sequence for unknown protein encoded by UL15.5
- SEQ ID NO: 34 predicted sequence for packaging protein encoded by UL32
- SEQ ID NO: 35 predicted sequence for ICPl/2 fragment encoded by construct UL36.4.2 MEYDSFDALLAARLESGQTLGPAGGREASLPEAPHALYRPTGQHVAVLAAATHRTPAARVTAMDLVLAAVLLGAPW VALRNTTAFSRESELELCLTLFDSRPGGPDAALRDWSSDIETWAVGLLHTDLNPIENACLAAQLPRLSALIAERPL ADGPPCLVLVDISMTPVAVLWEAPEPPGPPDVRFVGSEATEELPFVATAGDVLAASAADADPFFARAILGRPFDASL LTGELFPGHPVYQRPLADEAGPSAPTAARDPRDLAGGDGGSGPEDPAAPPARQADPGVLAPTLLTDATTGEPVPPRM WAWIHGLEELASDDAGGPT
- SEQ ID NO: 36 predicted sequence for ICP27 encoded by UL54
- SEQ ID NO: 37 virion protein encoded by UL49.5
- SEQ ID NO: 38 gG2 encoded by US4
- SEQ ID NO: 40 construct US6ATMR
- SEQ ID NO: 44 construct UL36.4.2.5
- SEQ ID NO: 117 construct RSI .2
- SEQ ID NO: 119 construct ULls
- SEQ ID NO: 121 construct RS1.1
- SEQ ID NO: 123 construct RSI .3.2
- SEQ ID NO: 124 construct RSI .3
- SEQ ID NO: 125 construct RSI .4
- SEQ ID NO: 126 construct RSI .5
- SEQ ID NO: 127 construct RSI .6
- SEQ ID NO: 128 construct RSI .7
- SEQ ID NO: 129 construct RSI .8
- MSYYHHHHHH SEQ ID NO: 132 Secretion Signal
- SEQ ID NO: 135 uracil DNA glycosylase encoded by UL2
- SEQ ID NO: 138 ICP4 internal fragment encoded by construct RS1.9 (deletion of #391-544 and #786-821)
- SEQ ID NO: 140 construct RSI .9
- SEQ ID NO: 141 construct RSI .10
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Virology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Microbiology (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Biochemistry (AREA)
- Zoology (AREA)
- Molecular Biology (AREA)
- Biotechnology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Biophysics (AREA)
- Biomedical Technology (AREA)
- General Engineering & Computer Science (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2014543554A JP6199878B2 (ja) | 2011-11-23 | 2012-11-21 | 単純ヘルペスウイルス2型に対する核酸ワクチン:免疫応答を誘発する組成物及び方法 |
| US14/360,137 US9624273B2 (en) | 2011-11-23 | 2012-11-21 | Nucleic acid vaccines against herpes simplex virus type 2: compositions and methods for eliciting an immune response |
| EP12851895.8A EP2782597B1 (en) | 2011-11-23 | 2012-11-21 | Nucleic acid vaccines against herpes simplex virus type 2: compositions and methods for eliciting an immune response |
| AU2012340712A AU2012340712B2 (en) | 2011-11-23 | 2012-11-21 | Nucleic acid vaccines against Herpes Simplex Virus type 2: compositions and methods for eliciting an immune response |
| CA2885693A CA2885693C (en) | 2011-11-23 | 2012-11-21 | Nucleic acid vaccines against herpes simplex virus type 2: compositions and methods for eliciting an immune response |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201161563507P | 2011-11-23 | 2011-11-23 | |
| US61/563,507 | 2011-11-23 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2013078299A1 true WO2013078299A1 (en) | 2013-05-30 |
Family
ID=48470287
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2012/066241 Ceased WO2013078299A1 (en) | 2011-11-23 | 2012-11-21 | Nucleic acid vaccines against herpes simplex virus type 2: compositions and methods for eliciting an immune response |
Country Status (6)
| Country | Link |
|---|---|
| US (1) | US9624273B2 (enExample) |
| EP (1) | EP2782597B1 (enExample) |
| JP (1) | JP6199878B2 (enExample) |
| AU (1) | AU2012340712B2 (enExample) |
| CA (1) | CA2885693C (enExample) |
| WO (1) | WO2013078299A1 (enExample) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10350288B2 (en) | 2016-09-28 | 2019-07-16 | Genocea Biosciences, Inc. | Methods and compositions for treating herpes |
| US10653771B2 (en) | 2009-05-22 | 2020-05-19 | Genocea Biosciences, Inc. | Vaccines against herpes simplex virus type 2: compositions and methods for eliciting an immune response |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2011336894B2 (en) | 2010-11-24 | 2016-11-17 | Genocea Biosciences, Inc. | Vaccines against Herpes Simplex Virus type 2: compositions and methods for eliciting an immune response |
| SI2850431T1 (en) | 2012-05-16 | 2018-08-31 | Immune Design Corp. | Vaccines for hsv-2 |
Citations (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6015832A (en) | 1997-12-31 | 2000-01-18 | The Regents Of The University Of Michigan | Methods of inactivating bacteria including bacterial spores |
| US6248558B1 (en) | 1998-03-31 | 2001-06-19 | Vanderbilt University | Sequence and method for genetic engineering of proteins with cell membrane translocating activity |
| WO2001044477A1 (en) | 1999-12-17 | 2001-06-21 | American Cyanamid Company | Method of enhancing immune responses to herpes simplex virus vaccine |
| US6506803B1 (en) | 1999-04-28 | 2003-01-14 | Regents Of The University Of Michigan | Methods of preventing and treating microbial infections |
| US20030017174A1 (en) * | 1997-06-02 | 2003-01-23 | Rae Lynn Burke | Herpes simplex virus vp22 vaccines and methods of use |
| US6559189B2 (en) | 1999-04-28 | 2003-05-06 | Regents Of The University Of Michigan | Non-toxic antimicrobial compositions and methods of use |
| US6635676B2 (en) | 1999-04-28 | 2003-10-21 | Regents Of The University Of Michigan | Non-toxic antimicrobial compositions and methods of use |
| WO2003086308A2 (en) | 2002-04-11 | 2003-10-23 | Corixa Corporation | Compositions and methods for the diagnosis and treatment of herpes simplex virus infection |
| US7314624B2 (en) | 2001-06-05 | 2008-01-01 | The Regents Of The University Of Michigan | Nanoemulsion vaccines |
| WO2009006618A2 (en) * | 2007-07-05 | 2009-01-08 | University Of Kansas | Herpes simplex virus mutant icp0 protein |
Family Cites Families (70)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4818694A (en) | 1982-07-20 | 1989-04-04 | American Cyanamid Company | Production of herpes simplex viral protein |
| US7264817B1 (en) | 1983-08-30 | 2007-09-04 | Genentech, Inc. | Immunogenic composition based on a truncated derivative of a membrane bound protein and process for making it |
| NZ209308A (en) | 1983-08-30 | 1991-08-27 | Genentech Inc | Vaccine against hsv involving a truncated membrane-free derivative of a membrane-bound protein |
| US5171568A (en) | 1984-04-06 | 1992-12-15 | Chiron Corporation | Recombinant herpes simplex gb-gd vaccine |
| US5244792A (en) | 1984-04-06 | 1993-09-14 | Chiron Corporation | Expression of recombinant glyoprotein B from herpes simplex virus |
| US5612041A (en) | 1984-07-17 | 1997-03-18 | Chiron Corporation | Recombinant herpes simplex gD vaccine |
| US5149529A (en) | 1988-04-08 | 1992-09-22 | Board Of Trustees Of Leland Chiron Corporation | Compositions and treatment for herpes simplex |
| WO1990013652A1 (en) | 1989-05-12 | 1990-11-15 | Triton Diagnostics, Inc. | Herpes simplex virus type 2-glycoprotein g proteins and polypeptides |
| JP3005292B2 (ja) | 1990-08-02 | 2000-01-31 | カイロン コーポレイション | 単純ヘルペスウィルスのvp16のワクチン |
| DK31991D0 (da) | 1991-02-25 | 1991-02-25 | Carlbiotech Ltd As | Peptid og farmaceutisk praeparat indeholdende et saadant peptid |
| GB9105992D0 (en) | 1991-03-21 | 1991-05-08 | Smithkline Beecham Biolog | Vaccine |
| US5679348A (en) * | 1992-02-03 | 1997-10-21 | Cedars-Sinai Medical Center | Immunotherapy for recurrent HSV infections |
| US5955088A (en) * | 1992-02-03 | 1999-09-21 | Cedars-Sinai Medical Center | Pharmaceutical compsition of herpes simplex virus type-1 (HSV-1), glycoproteins |
| US5593972A (en) | 1993-01-26 | 1997-01-14 | The Wistar Institute | Genetic immunization |
| JPH08510918A (ja) | 1993-06-08 | 1996-11-19 | アボツト・ラボラトリーズ | 単純ヘルペスウィルス2型プロテアーゼ |
| CA2169748A1 (en) | 1993-08-20 | 1995-03-02 | Anthony G. Dilella | Hsv-2 ul26 gene, capsid proteins, immunoassays and protease inhibitors |
| GB9325496D0 (en) * | 1993-12-14 | 1994-02-16 | Smithkline Beecham Biolog | Vaccines |
| US7094767B2 (en) | 1994-07-22 | 2006-08-22 | Merck & Co., Inc. | Polynucleotide herpes virus vaccine |
| US6156319A (en) | 1994-07-25 | 2000-12-05 | The Trustees Of The University Of Pennsylvania | Soluble herpesvirus glycoprotein complex vaccine |
| US5807557A (en) * | 1994-07-25 | 1998-09-15 | The Trustees Of The University Of Pennsylvania | Soluble herpesvirus glycoprotein complex |
| AUPM873294A0 (en) * | 1994-10-12 | 1994-11-03 | Csl Limited | Saponin preparations and use thereof in iscoms |
| US5962428A (en) | 1995-03-30 | 1999-10-05 | Apollon, Inc. | Compositions and methods for delivery of genetic material |
| US6197497B1 (en) | 1995-04-21 | 2001-03-06 | University Of New Mexico | Immunoassay for herpes simplex virus |
| US5654174A (en) | 1995-07-07 | 1997-08-05 | Competitive Technologies, Inc. | Herpes simplex virus glycoprotein D variants |
| US5876923A (en) * | 1996-07-26 | 1999-03-02 | Arch Development Corporation | Herpes simplex virus ICP4 as an inhibitor of apoptosis |
| CA2269754A1 (en) | 1996-10-23 | 1998-04-30 | American Home Products Corporation | Dna vaccines for herpes simplex virus 1 and 2 |
| EP0948508A4 (en) | 1996-11-04 | 2001-11-07 | Smithkline Beecham Corp | NEW CODING SEQUENCES FOR HERPES SIMPLEX TYPE 2 VIRUS |
| US6054131A (en) | 1998-01-16 | 2000-04-25 | University Of Maryland Baltimore | Vaccine composition for herpes simplex virus and method of using |
| ES2273482T3 (es) | 1998-03-09 | 2007-05-01 | Glaxosmithkline Biologicals S.A. | Composiciones de vacunas combinadas. |
| JP2002522451A (ja) | 1998-08-07 | 2002-07-23 | ユニバーシティ オブ ワシントン | 免疫学的単純ヘルペスウイルス抗原とその使用法 |
| US6692752B1 (en) | 1999-09-08 | 2004-02-17 | Smithkline Beecham Biologicals S.A. | Methods of treating human females susceptible to HSV infection |
| EP1185662B1 (fr) | 1999-06-10 | 2011-03-02 | Merial | Vaccins adn pour les chiens |
| GB9921146D0 (en) | 1999-09-07 | 1999-11-10 | Smithkline Beecham Biolog | Novel composition |
| US6413518B1 (en) | 1999-09-30 | 2002-07-02 | University Of Washington | Immunologically significant herpes simplex virus antigens and methods for identifying and using same |
| US7196066B1 (en) | 1999-11-03 | 2007-03-27 | Powderject Vaccines, Inc. | DNA-vaccines based on constructs derived from the genomes of human and animal pathogens |
| US7078388B2 (en) | 2000-01-21 | 2006-07-18 | Merial | DNA vaccines for farm animals, in particular bovines and porcines |
| US7157437B2 (en) | 2000-03-10 | 2007-01-02 | Dynavax Technologies Corporation | Methods of ameliorating symptoms of herpes infection using immunomodulatory polynucleotide sequences |
| US20030165819A1 (en) * | 2000-06-29 | 2003-09-04 | Corixa Corporation | Compositions and methods for the diagnosis and treatment of herpes simplex virus infection |
| ATE349533T1 (de) | 2000-06-29 | 2007-01-15 | Corixa Corp | Zusammensetzung zur diagnose und behandlung von herpes simplex virusinfektionen |
| US6682892B2 (en) | 2000-07-13 | 2004-01-27 | Pharmacia & Upjohn Company | Method for treating herpes viruses |
| JP2004505113A (ja) | 2000-07-27 | 2004-02-19 | ザ・トラスティーズ・オブ・ザ・ユニバーシティ・オブ・ペンシルベニア | 単純疱疹ウイルス糖蛋白質dを用いた組成物及びそれを用いて免疫応答を抑制する方法 |
| EP1178111A1 (en) * | 2000-08-03 | 2002-02-06 | Lohmann Animal Health GmbH & Co. KG | Vaccination against host cell-associated herpesviruses |
| US20020094337A1 (en) | 2000-11-16 | 2002-07-18 | University Of Maryland, Baltimore | Prevention of recurrent viral disease |
| US6867000B2 (en) | 2000-12-07 | 2005-03-15 | Wyeth Holdings Corporation | Method of enhancing immune responses to herpes |
| US6814969B2 (en) | 2001-07-31 | 2004-11-09 | University Of Washington | Immunologically significant herpes simplex virus antigens and methods for using same |
| AU2002323443A1 (en) | 2001-09-04 | 2003-03-18 | Corixa Corporation | Compositions and methods for the diagnosis and treatment of herpes simplex virus infection |
| US20030219448A1 (en) | 2002-05-24 | 2003-11-27 | Cedars-Sinai Medical Center | Peptide epitope-based vaccine for treating herpes simplex virus infections and related diseases |
| US20080299140A1 (en) | 2002-05-24 | 2008-12-04 | The Regents Of The University Of California, | Immunogenic Composition and Peptide Sequences for Prevention and Treatment of an Hsv Condition |
| DK2011510T3 (da) | 2002-07-18 | 2011-03-28 | Univ Washington | Farmaceutiske sammensætninger indeholdende immunologisk aktive Herpes simplex-virus(HSV) proteinfragmenter |
| US7267940B2 (en) | 2003-03-04 | 2007-09-11 | Bio-Rad Laboratories, Inc. | HSV-2 type-specific immunoassays using glycoprotein G2 peptides |
| AU2004274430A1 (en) | 2003-09-12 | 2005-03-31 | Antigenics, Inc. | Vaccine for treatment and prevention of herpes simplex virus infection |
| GB0321615D0 (en) | 2003-09-15 | 2003-10-15 | Glaxo Group Ltd | Improvements in vaccination |
| AU2006338570B2 (en) | 2005-11-18 | 2013-07-11 | The Ohio State University Research Foundation | Viral gene products and methods for vaccination to prevent viral associated diseases |
| CA2645507A1 (en) | 2006-03-10 | 2007-09-20 | The Regents Of The University Of California | Vaccine for viruses that cause persistent or latent infections |
| EP2521786B1 (en) | 2006-07-20 | 2015-06-24 | Vical Incorporated | Compositions for vaccinating against hsv-2 |
| WO2008027394A2 (en) | 2006-08-28 | 2008-03-06 | The Wistar Institute Of Anatomy And Biology | Constructs for enhancing immune responses |
| CA2663109A1 (en) | 2006-09-08 | 2008-03-13 | The Trustees Of The University Of Pennsylvania | Hsv-1 and hsv-2 vaccines and methods of use thereof |
| EP2087128A4 (en) | 2006-11-01 | 2009-11-04 | Immport Therapeutics Inc | COMPOSITIONS AND METHODS FOR IMMUNOMINANT ANTIGENES |
| US9284355B2 (en) | 2006-12-28 | 2016-03-15 | The Trustees Of The University Of Pennsylvania | Herpes simplex virus combined subunit vaccines and methods of use thereof |
| US8057804B2 (en) | 2006-12-28 | 2011-11-15 | The Trustees Of The University Of Pennsylvania | Herpes simplex virus combined subunit vaccines and methods of use thereof |
| WO2009006680A1 (en) | 2007-07-06 | 2009-01-15 | Sydney West Area Health Service | Epitopes of herpes simplex virus |
| SE532551C2 (sv) | 2008-06-30 | 2010-02-16 | Senseair Ab | Ett för spektralanalys anpassat arrangemang |
| US8313894B2 (en) * | 2008-07-01 | 2012-11-20 | Genocea Biosciences, Inc. | Antigen screening system |
| WO2010078027A1 (en) * | 2008-12-17 | 2010-07-08 | Genocea Biosciences, Inc. | Chlamydia antigens and uses thereof |
| US8460674B2 (en) | 2009-02-07 | 2013-06-11 | University Of Washington | HSV-1 epitopes and methods for using same |
| AU2010249330B2 (en) * | 2009-05-22 | 2015-11-05 | Genocea Biosciences Inc. | Vaccines against Herpes Simplex Virus type 2: compositions and methods for eliciting an immune response |
| US9089537B2 (en) * | 2010-02-26 | 2015-07-28 | The Trustees Of The University Of Pennslyvania | Subunit vaccines for herpes viruses and methods of use |
| US20130195961A1 (en) * | 2010-03-09 | 2013-08-01 | Kejian Yang | Novel mucosal vaccination approach for herpes simplex virus type-2 |
| CA2849391A1 (en) * | 2010-10-20 | 2012-04-26 | Genocea Biosciences, Inc. | Chlamydia antigens and uses thereof |
| AU2011336894B2 (en) * | 2010-11-24 | 2016-11-17 | Genocea Biosciences, Inc. | Vaccines against Herpes Simplex Virus type 2: compositions and methods for eliciting an immune response |
-
2012
- 2012-11-21 AU AU2012340712A patent/AU2012340712B2/en not_active Ceased
- 2012-11-21 EP EP12851895.8A patent/EP2782597B1/en not_active Not-in-force
- 2012-11-21 US US14/360,137 patent/US9624273B2/en active Active
- 2012-11-21 JP JP2014543554A patent/JP6199878B2/ja not_active Expired - Fee Related
- 2012-11-21 CA CA2885693A patent/CA2885693C/en active Active
- 2012-11-21 WO PCT/US2012/066241 patent/WO2013078299A1/en not_active Ceased
Patent Citations (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20030017174A1 (en) * | 1997-06-02 | 2003-01-23 | Rae Lynn Burke | Herpes simplex virus vp22 vaccines and methods of use |
| US6015832A (en) | 1997-12-31 | 2000-01-18 | The Regents Of The University Of Michigan | Methods of inactivating bacteria including bacterial spores |
| US6248558B1 (en) | 1998-03-31 | 2001-06-19 | Vanderbilt University | Sequence and method for genetic engineering of proteins with cell membrane translocating activity |
| US6432680B1 (en) | 1998-03-31 | 2002-08-13 | Vanderbilt University | Sequence and method for genetic engineering of proteins with cell membrane translocating activity |
| US6506803B1 (en) | 1999-04-28 | 2003-01-14 | Regents Of The University Of Michigan | Methods of preventing and treating microbial infections |
| US6559189B2 (en) | 1999-04-28 | 2003-05-06 | Regents Of The University Of Michigan | Non-toxic antimicrobial compositions and methods of use |
| US6635676B2 (en) | 1999-04-28 | 2003-10-21 | Regents Of The University Of Michigan | Non-toxic antimicrobial compositions and methods of use |
| WO2001044477A1 (en) | 1999-12-17 | 2001-06-21 | American Cyanamid Company | Method of enhancing immune responses to herpes simplex virus vaccine |
| EP1238086A1 (en) * | 1999-12-17 | 2002-09-11 | American Cyanamid Company | Method of enhancing immune responses to herpes simplex virus vaccine |
| US7314624B2 (en) | 2001-06-05 | 2008-01-01 | The Regents Of The University Of Michigan | Nanoemulsion vaccines |
| WO2003086308A2 (en) | 2002-04-11 | 2003-10-23 | Corixa Corporation | Compositions and methods for the diagnosis and treatment of herpes simplex virus infection |
| WO2009006618A2 (en) * | 2007-07-05 | 2009-01-08 | University Of Kansas | Herpes simplex virus mutant icp0 protein |
Non-Patent Citations (14)
| Title |
|---|
| BRAUN: "Multi-antigenic DNA immunization using herpes simplex virus type 2 genomic fragments", HUMAN VACCINES, vol. 4, no. 1, 1 January 2008 (2008-01-01), pages 36 - 43, XP055194334, DOI: 10.4161/hv.4.1.4876 |
| DATABASE UNIPROT KB [online] 1 December 1992 (1992-12-01), XP003033881, Database accession no. P28278 * |
| DATABASE UNIPROT KB [online] 1 November 1996 (1996-11-01), XP003033882, Database accession no. Q69467 * |
| DOLAN A. ET AL., J. VIROL., vol. 72, no. 3, March 1998 (1998-03-01), pages 2010 - 2021, Retrieved from the Internet <URL:http://www. uniprot. org/uniprotlQ69467> [retrieved on 20130109] * |
| HUSE ET AL., SCIENCE, vol. 246, 1989, pages 1275 - 81 |
| LOOKER ET AL., BULLETIN OF THE WORLD HEALTH ORGANIZATION, vol. 86, 2008, pages 10 |
| MCCLEMENTS: "Immunization with DNA vaccines encoding glycoprotein D or glycoprotein B, alone or in combination, induces protective immunity in animal models of herpes simplex virus-2 disease", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, vol. 93, no. 21, pages 11414 - 11420, XP002176700, DOI: 10.1073/pnas.93.21.11414 |
| MCGEOCH D.J. ET AL., J. GEN. VIROL., vol. 72, December 1991 (1991-12-01), pages 3057 - 3075, Retrieved from the Internet <URL:http://www.uniprot.org/uniprot/P28278> [retrieved on 20130109] * |
| See also references of EP2782597A4 |
| SIN: "DNA vaccines encoding interleukin-8 and RANTES enhance antigen-specific Thl-type CD4(+) T-cell-mediated protective immunity against herpes simplex virus type 2 in vivo", JOURNAL OF VIROLOGY, vol. 74, no. 23, pages 11173 - 11180, XP002315792, DOI: 10.1128/JVI.74.23.11173-11180.2000 |
| SIN: "IL-12 gene as a DNA vaccine adjuvant in a herpes mouse model: IL-12 enhances Thl-type CD4+ T cell-mediated protective immunity against herpes simplex virus-2 challenge", JOURNAL OF IMMUNOLOGY, vol. 162, no. 5, pages 2912 - 2921 |
| SINGH ET AL., CURR. HIV RES., vol. 1, 2003, pages 309 - 20 |
| STANBERRY ET AL., CLINICAL INFECT. DIS., vol. 30, no. 3, 2000, pages 549 - 566 |
| WU, CANCER RES, vol. 65, no. 11, 2005, pages 4947 - 4954 |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10653771B2 (en) | 2009-05-22 | 2020-05-19 | Genocea Biosciences, Inc. | Vaccines against herpes simplex virus type 2: compositions and methods for eliciting an immune response |
| US10350288B2 (en) | 2016-09-28 | 2019-07-16 | Genocea Biosciences, Inc. | Methods and compositions for treating herpes |
Also Published As
| Publication number | Publication date |
|---|---|
| CA2885693C (en) | 2020-07-28 |
| EP2782597A4 (en) | 2015-11-11 |
| EP2782597B1 (en) | 2022-04-13 |
| US9624273B2 (en) | 2017-04-18 |
| US20140328870A1 (en) | 2014-11-06 |
| JP6199878B2 (ja) | 2017-09-20 |
| CA2885693A1 (en) | 2013-05-30 |
| AU2012340712A1 (en) | 2014-06-12 |
| AU2012340712B2 (en) | 2017-09-14 |
| JP2014534262A (ja) | 2014-12-18 |
| EP2782597A1 (en) | 2014-10-01 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10653771B2 (en) | Vaccines against herpes simplex virus type 2: compositions and methods for eliciting an immune response | |
| US9782474B2 (en) | Vaccines against herpes simplex virus type 2: compositions and methods for eliciting an immune response | |
| US10350288B2 (en) | Methods and compositions for treating herpes | |
| US9624273B2 (en) | Nucleic acid vaccines against herpes simplex virus type 2: compositions and methods for eliciting an immune response |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 12851895 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14360137 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 2014543554 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2012340712 Country of ref document: AU Date of ref document: 20121121 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2012851895 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2885693 Country of ref document: CA |