WO2013038303A1 - Plants having enhanced yield-related traits and methods for making the same - Google Patents

Plants having enhanced yield-related traits and methods for making the same Download PDF

Info

Publication number
WO2013038303A1
WO2013038303A1 PCT/IB2012/054595 IB2012054595W WO2013038303A1 WO 2013038303 A1 WO2013038303 A1 WO 2013038303A1 IB 2012054595 W IB2012054595 W IB 2012054595W WO 2013038303 A1 WO2013038303 A1 WO 2013038303A1
Authority
WO
WIPO (PCT)
Prior art keywords
plant
nucleic acid
polypeptide
seq
plants
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/IB2012/054595
Other languages
English (en)
French (fr)
Inventor
Valerie Frankard
Christophe Reuzeau
Yves Hatzfeld
Ana Isabel Sanz Molinero
Steven Vandenabeele
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
BASF China Co Ltd
BASF Plant Science Co GmbH
Original Assignee
BASF China Co Ltd
BASF Plant Science Co GmbH
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to DE112012003842.8T priority Critical patent/DE112012003842T5/de
Priority to EP12831119.8A priority patent/EP2755465A4/en
Priority to CA2847079A priority patent/CA2847079A1/en
Priority to BR112014006096A priority patent/BR112014006096A2/pt
Priority to MX2014003005A priority patent/MX2014003005A/es
Priority to US14/344,923 priority patent/US20150322449A1/en
Priority to IN1936CHN2014 priority patent/IN2014CN01936A/en
Priority to AU2012310202A priority patent/AU2012310202A1/en
Priority to CN201280056096.2A priority patent/CN103929947A/zh
Application filed by BASF China Co Ltd, BASF Plant Science Co GmbH filed Critical BASF China Co Ltd
Publication of WO2013038303A1 publication Critical patent/WO2013038303A1/en
Priority to PH12014500550A priority patent/PH12014500550A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8261Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/415Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8261Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
    • C12N15/8271Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8261Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
    • C12N15/8271Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance
    • C12N15/8273Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for drought, cold, salt resistance
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/0004Oxidoreductases (1.)
    • C12N9/0065Oxidoreductases (1.) acting on hydrogen peroxide as acceptor (1.11)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y111/00Oxidoreductases acting on a peroxide as acceptor (1.11)
    • C12Y111/01Peroxidases (1.11.1)
    • C12Y111/01009Glutathione peroxidase (1.11.1.9)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y111/00Oxidoreductases acting on a peroxide as acceptor (1.11)
    • C12Y111/01Peroxidases (1.11.1)
    • C12Y111/01012Phospholipid-hydroperoxide glutathione peroxidase (1.11.1.12)
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A40/00Adaptation technologies in agriculture, forestry, livestock or agroalimentary production
    • Y02A40/10Adaptation technologies in agriculture, forestry, livestock or agroalimentary production in agriculture
    • Y02A40/146Genetically Modified [GMO] plants, e.g. transgenic plants

Definitions

  • the present invention relates generally to the field of molecular biology and concerns a method for enhancing yield-related traits in plants by modulating expression in a plant of a nucleic acid encoding an ELM2-related (Egl-27 and MTA1 homology 2 - related) polypeptide, or a WRKY-related polypeptide, or an EMG1 -like (Essential for Mitotic Growth - like) polypeptide, or a GPx-related polypeptide.
  • ELM2-related Egl-27 and MTA1 homology 2 - related
  • WRKY-related polypeptide WRKY-related polypeptide
  • EMG1 -like polypeptide Essential for Mitotic Growth - like
  • the present invention also concerns plants having modulated expression of a nucleic acid encoding an ELM2-related polypeptide, or a WRKY-related polypeptide, or an EMG1 -like polypeptide, or a GPx-related polypeptide, which plants have enhanced yield-related traits relative to corresponding wild type plants or other control plants.
  • the invention also provides constructs useful in the methods of the invention. The ever-increasing world population and the dwindling supply of arable land available for agriculture fuels research towards increasing the efficiency of agriculture. Conventional means for crop and horticultural improvements utilise selective breeding techniques to identify plants having desirable characteristics.
  • Yield is normally defined as the measurable produce of economic value from a crop. This may be defined in terms of quantity and/or quality. Yield is directly dependent on several factors, for example, the number and size of the organs, plant architecture (for example, the number of branches), seed production, leaf senescence and more. Root development, nutrient uptake, stress tolerance and early vigour may also be important factors in determining yield. Optimizing the abovementioned factors may therefore contribute to increasing crop yield.
  • Seed yield is a particularly important trait, since the seeds of many plants are important for human and animal nutrition.
  • Crops such as corn, rice, wheat, canola and soybean account for over half the total human caloric intake, whether through direct consumption of the seeds themselves or through consumption of meat products raised on processed seeds. They are also a source of sugars, oils and many kinds of metabolites used in industrial processes. Seeds contain an embryo (the source of new shoots and roots) and an endosperm (the source of nutrients for embryo growth during germination and during early growth of seedlings).
  • the development of a seed involves many genes, and requires the transfer of metabolites from the roots, leaves and stems into the growing seed.
  • the endosperm in particular, assimilates the metabolic precursors of carbohydrates, oils and proteins and synthesizes them into storage macromolecules to fill out the grain.
  • a further important trait is that of improved abiotic stress tolerance.
  • Abiotic stress is a primary cause of crop loss worldwide, reducing average yields for most major crop plants by more than 50% (Wang et al., Planta 218, 1 -14, 2003).
  • Abiotic stresses may be caused by drought, salinity, extremes of temperature, chemical toxicity and oxidative stress.
  • the ability to improve plant tolerance to abiotic stress would be of great economic advantage to farmers worldwide and would allow for the cultivation of crops during adverse conditions and in territories where cultivation of crops may not otherwise be possible.
  • Crop yield may therefore be increased by optimising one of the above-mentioned factors.
  • the modification of certain yield traits may be favoured over others.
  • an increase in the vegetative parts of a plant may be desirable, and for applications such as flour, starch or oil production, an increase in seed parameters may be particularly desirable. Even amongst the seed parameters, some may be favoured over others, depending on the application.
  • Various mechanisms may contribute to increasing seed yield, whether that is in the form of increased seed size or increased seed number.
  • ELM2 Egl-27 and MTA1 homology 2
  • ELM2 Egl-27 and MTA1 homology 2
  • the domain is usually found to the N-terminus of a myb-like DNA binding domain pfam00249.
  • ELM2 is also found associated with an ARID (AT rich interactive domain) DNA binding domain pfam01388 in a protein from Arabidopsis thaliana. This suggests that ELM2 may also be involved in DNA binding, or perhaps is a protein-protein interaction domain.
  • the ELM2 domain functions as a transcriptional repression domain through recruitment of a trichostatin A- sensitive histone deacetylase 1 (HDAC1).
  • HDAC1 histone deacetylase 1
  • WRKY-related polypeptides Although not limited to WRKY-related polypeptides, however, nothing is reported on modification of yield-related traits in plants with regard to WRKY-related polypeptide until the present day. Rushton, 2010 reports on WRKY proteins playing roles in repression and de-repression of important plant processes. Furthermore, it is described that a single WRKY-related polypeptide might be involved in regulating several seemingly disparate processes. Mechanisms of signalling and transcriptional regulation are being dissected, uncovering WRKY protein functions via interactions with a diverse array of protein partners, including MAP kinases, MAP kinase kinases, 14-3-3 proteins, calmodulin, histone deacetylases, resistance proteins and other WRKY-related polypeptides. WRKY genes exhibit extensive autoregulation and cross-regulation that facilitates transcriptional reprogramming in a dynamic web with built-in redundancy.
  • WCS417r and ⁇ -aminobutyric acid prime jasmonate- and salicylate-inducible genes, respectively, they subsequently investigated the role of transcription factors.
  • a quantitative PCR-based genome-wide screen for putative WCS417r- and ⁇ -aminobutyric acid-responsive transcription factor genes revealed distinct sets of priming-responsive genes. Transcriptional analysis of a selection of these genes showed that they can serve as specific markers for priming.
  • WRKY genes identified a putative cis- element that is strongly over-represented in promoters of 21 NPR1 -dependent, ⁇ - aminobutyric acid-inducible WRKY genes. It is shown that priming of defence is regulated by different pathways, depending on the inducing agent and the challenging pathogen. Furthermore, it is demonstrated that priming is associated with the enhanced expression of transcription factors.
  • ribosome biogenesis is a complex stepwise process that begins with the transcription of ribosomal RNA (rRNA) and continues with a coordinated processing pathway by which the rRNA is processed and ribosomal proteins are assembled.
  • Ribosomal RNA processing and ribosome assembly require several non- ribosomal protein factors, as well as small nucleolar RNA (snoRNA) molecules. These factors not only guide cleavage steps, but also carry out site-specific rRNA modifications that include methylation and pseudouridylation.
  • Nep1 Nucleolar essential protein 1
  • Arabidopsis thaliana the At3g57000 gene
  • the structure of EMG1 has revealed that it is a novel member of the superfamily of alpha/beta knot fold methyltransferases.
  • GPx encodes glutathione peroxidase and belongs to the large family of Peroxidase (Px) enzymes. Green plants contain thousands of Px proteins classified in multiple classes. GPx belong to the class of Thiol peroxidase Selenium-dependent enzyme containing GPx and Peroxiredoxin proteins.
  • GPx are present across kingdom with hundreds of members identified in plants and animals so far.
  • a role of GPx in alleviating oxidative stress generated from polyunsaturated fatty acid metabolism in breast cancer cells has been revealed recently (Margis, 2008).
  • GPx could act as homo-multimers or homo-monomers and are known to have distinct subcellular localization (cytosolic, nuclear, mitochondrial or membrane-bound).
  • plant GPx could be grouped into 5 distinct clusters clearly separated according to their predicted subcellular localization suggesting existence of multiple duplication events during the evolution of GPx in different plant cellular compartment.
  • Margis, 2008 reports on an evolutionary overview of Glutathione peroxidase family.
  • Glutathione peroxidases (EC 1.1 1.1.9 and EC 1.1 1.1.12) catalyze the reduction of H2O2 or organic hydroperoxides to water or corresponding alcohols using reduced glutathione.
  • Some glutathione peroxidase isozymes have a selenium-dependent glutathione peroxidase activity and present a selenocysteine encoded by the opal TGA codon.
  • Margis insights into the evolution of the whole glutathione peroxidase gene family were obtained after a comprehensive phylogenetic analysis using the improved number of glutathione peroxidase sequences recorded in known PeroxiBase database.
  • peptides amino acids in a polymeric form of any length, linked together by peptide bonds, unless mentioned herein otherwise.
  • nucleic acid sequence(s) refers to nucleotides, either ribonucleotides or deoxyribonucleotides or a combination of both, in a polymeric unbranched form of any length.
  • “Homologues” of a protein encompass peptides, oligopeptides, polypeptides, proteins and enzymes having amino acid substitutions, deletions and/or insertions relative to the unmodified protein in question and having similar biological and functional activity as the unmodified protein from which they are derived.
  • Orthologues and paralogues are two different forms of homologues and encompass evolutionary concepts used to describe the ancestral relationships of genes. Paralogues are genes within the same species that have originated through duplication of an ancestral gene; orthologues are genes from different organisms that have originated through speciation, and are also derived from a common ancestral gene.
  • a “deletion” refers to removal of one or more amino acids from a protein.
  • An “insertion” refers to one or more amino acid residues being introduced into a predetermined site in a protein. Insertions may comprise N-terminal and/or C-terminal fusions as well as intra-sequence insertions of single or multiple amino acids. Generally, insertions within the amino acid sequence will be smaller than N- or C-terminal fusions, of the order of about 1 to 10 residues.
  • N- or C-terminal fusion proteins or peptides include the binding domain or activation domain of a transcriptional activator as used in the yeast two-hybrid system, phage coat proteins, (histidine)-6-tag, glutathione S- transferase-tag, protein A, maltose-binding protein, dihydrofolate reductase, Tag » 100 epitope, c-myc epitope, FLAG ® -epitope, lacZ, CMP (calmodulin-binding peptide), HA epitope, protein C epitope and VSV epitope.
  • a transcriptional activator as used in the yeast two-hybrid system
  • phage coat proteins phage coat proteins
  • glutathione S- transferase-tag glutathione S- transferase-tag
  • protein A maltose-binding protein
  • dihydrofolate reductase Tag » 100 epitope
  • c-myc epitope FL
  • substitution refers to replacement of amino acids of the protein with other amino acids having similar properties (such as similar hydrophobicity, hydrophilicity, antigenicity, propensity to form or break a-helical structures or ⁇ -sheet structures).
  • Amino acid substitutions are typically of single residues, but may be clustered depending upon functional constraints placed upon the polypeptide and may range from 1 to 10 amino acids.
  • the amino acid substitutions are preferably conservative amino acid substitutions. Conservative substitution tables are well known in the art (see for example Creighton (1984) Proteins. W.H. Freeman and Company (Eds) and Table 1 below).
  • Amino acid substitutions, deletions and/or insertions may readily be made using peptide synthetic techniques known in the art, such as solid phase peptide synthesis and the like, or by recombinant DNA manipulation. Methods for the manipulation of DNA sequences to produce substitution, insertion or deletion variants of a protein are well known in the art.
  • substitution mutations at predetermined sites in DNA are well known to those skilled in the art and include M13 mutagenesis, T7-Gen in vitro mutagenesis (USB, Cleveland, OH), QuickChange Site Directed mutagenesis (Stratagene, San Diego, CA), PCR-mediated site-directed mutagenesis or other site-directed mutagenesis protocols (see Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989 and yearly updates)).
  • “Derivatives” include peptides, oligopeptides, polypeptides which may, compared to the amino acid sequence of the naturally-occurring form of the protein, such as the protein of interest, comprise substitutions of amino acids with non-naturally occurring amino acid residues, or additions of non-naturally occurring amino acid residues.
  • “Derivatives” of a protein also encompass peptides, oligopeptides, polypeptides which comprise naturally occurring altered (glycosylated, acylated, prenylated, phosphorylated, myristoylated, sulphated etc.) or non-naturally altered amino acid residues compared to the amino acid sequence of a naturally-occurring form of the polypeptide.
  • a derivative may also comprise one or more non-amino acid substituents or additions compared to the amino acid sequence from which it is derived, for example a reporter molecule or other ligand, covalently or non-covalently bound to the amino acid sequence, such as a reporter molecule which is bound to facilitate its detection, and non-naturally occurring amino acid residues relative to the amino acid sequence of a naturally-occurring protein.
  • reporter molecule or other ligand covalently or non-covalently bound to the amino acid sequence, such as a reporter molecule which is bound to facilitate its detection, and non-naturally occurring amino acid residues relative to the amino acid sequence of a naturally-occurring protein.
  • derivatives also include fusions of the naturally-occurring form of the protein with tagging peptides such as FLAG, HIS6 or thioredoxin (for a review of tagging peptides, see Terpe, Appl. Microbiol. Biotechnol. 60, 523-533, 2003).
  • domain refers to a set of amino acids conserved at specific positions along an alignment of sequences of evolutionarily related proteins. While amino acids at other positions can vary between homologues, amino acids that are highly conserved at specific positions indicate amino acids that are likely essential in the structure, stability or function of a protein. Identified by their high degree of conservation in aligned sequences of a family of protein homologues, they can be used as identifiers to determine if any polypeptide in question belongs to a previously identified polypeptide family.
  • motif or "consensus sequence” or “signature” refers to a short conserved region in the sequence of evolutionarily related proteins.
  • Motifs are frequently highly conserved parts of domains, but may also include only part of the domain, or be located outside of conserved domain (if all of the amino acids of the motif fall outside of a defined domain).
  • GAP uses the algorithm of Needleman and Wunsch ((1970) J Mol Biol 48: 443-453) to find the global (i.e. spanning the complete sequences) alignment of two sequences that maximizes the number of matches and minimizes the number of gaps.
  • the BLAST algorithm (Altschul et al. (1990) J Mol Biol 215: 403-10) calculates percent sequence identity and performs a statistical analysis of the similarity between the two sequences.
  • the software for performing BLAST analysis is publicly available through the National Centre for Biotechnology Information (NCBI). Homologues may readily be identified using, for example, the ClustalW multiple sequence alignment algorithm (version 1.83), with the default pairwise alignment parameters, and a scoring method in percentage.
  • BLASTN or TBLASTX (using standard default values) are generally used when starting from a nucleotide sequence, and BLASTP or TBLASTN (using standard default values) when starting from a protein sequence.
  • the BLAST results may optionally be filtered.
  • the full-length sequences of either the filtered results or non-filtered results are then BLASTed back (second BLAST) against sequences from the organism from which the query sequence is derived.
  • the results of the first and second BLASTs are then compared.
  • a paralogue is identified if a high-ranking hit from the first blast is from the same species as from which the query sequence is derived, a BLAST back then ideally results in the query sequence amongst the highest hits; an orthologue is identified if a high-ranking hit in the first BLAST is not from the same species as from which the query sequence is derived, and preferably results upon BLAST back in the query sequence being among the highest hits.
  • High-ranking hits are those having a low E-value.
  • Computation of the E-value is well known in the art.
  • comparisons are also scored by percentage identity. Percentage identity refers to the number of identical nucleotides (or amino acids) between the two compared nucleic acid (or polypeptide) sequences over a particular length. In the case of large families, ClustalW may be used, followed by a neighbour joining tree, to help visualize clustering of related genes and to identify orthologues and paralogues.
  • hybridisation is a process wherein substantially homologous complementary nucleotide sequences anneal to each other.
  • the hybridisation process can occur entirely in solution, i.e. both complementary nucleic acids are in solution.
  • the hybridisation process can also occur with one of the complementary nucleic acids immobilised to a matrix such as magnetic beads, Sepharose beads or any other resin.
  • the hybridisation process can furthermore occur with one of the complementary nucleic acids immobilised to a solid support such as a nitro-cellulose or nylon membrane or immobilised by e.g. photolithography to, for example, a siliceous glass support (the latter known as nucleic acid arrays or microarrays or as nucleic acid chips).
  • the nucleic acid molecules are generally thermally or chemically denatured to melt a double strand into two single strands and/or to remove hairpins or other secondary structures from single stranded nucleic acids.
  • stringency refers to the conditions under which a hybridisation takes place.
  • the stringency of hybridisation is influenced by conditions such as temperature, salt concentration, ionic strength and hybridisation buffer composition. Generally, low stringency conditions are selected to be about 30°C lower than the thermal melting point (T m ) for the specific sequence at a defined ionic strength and pH. Medium stringency conditions are when the temperature is 20°C below T m , and high stringency conditions are when the temperature is 10°C below T m . High stringency hybridisation conditions are typically used for isolating hybridising sequences that have high sequence similarity to the target nucleic acid sequence. However, nucleic acids may deviate in sequence and still encode a substantially identical polypeptide, due to the degeneracy of the genetic code. Therefore medium stringency hybridisation conditions may sometimes be needed to identify such nucleic acid molecules.
  • the Tm is the temperature under defined ionic strength and pH, at which 50% of the target sequence hybridises to a perfectly matched probe.
  • the T m is dependent upon the solution conditions and the base composition and length of the probe. For example, longer sequences hybridise specifically at higher temperatures.
  • the maximum rate of hybridisation is obtained from about 16°C up to 32°C below T m .
  • the presence of monovalent cations in the hybridisation solution reduce the electrostatic repulsion between the two nucleic acid strands thereby promoting hybrid formation; this effect is visible for sodium concentrations of up to 0.4M (for higher concentrations, this effect may be ignored).
  • Formamide reduces the melting temperature of DNA-DNA and DNA-RNA duplexes with 0.6 to 0.7°C for each percent formamide, and addition of 50% formamide allows hybridisation to be performed at 30 to 45°C, though the rate of hybridisation will be lowered.
  • Base pair mismatches reduce the hybridisation rate and the thermal stability of the duplexes.
  • the Tm decreases about 1 °C per % base mismatch. The T m may be calculated using the following equations, depending on the types of hybrids: 1 ) DNA-DNA hybrids (Meinkoth and Wahl, Anal. Biochem., 138: 267-284, 1984):
  • T m 81.5°C + 16.6xlogio[Na + ] a + 0.41x%[G/C b ] - 500x[L c ]- 1 - 0.61 x% formamide
  • T m 79.8°C+ 18.5 (logio[Na + ] a ) + 0.58 (%G/C b ) + 1 1.8 (%G/C b ) 2 - 820/L c
  • c L length of duplex in base pairs.
  • Non-specific binding may be controlled using any one of a number of known techniques such as, for example, blocking the membrane with protein containing solutions, additions of heterologous RNA, DNA, and SDS to the hybridisation buffer, and treatment with Rnase.
  • a series of hybridizations may be performed by varying one of (i) progressively lowering the annealing temperature (for example from 68°C to 42°C) or (ii) progressively lowering the formamide concentration (for example from 50% to 0%).
  • annealing temperature for example from 68°C to 42°C
  • formamide concentration for example from 50% to 0%
  • hybridisation typically also depends on the function of post-hybridisation washes.
  • samples are washed with dilute salt solutions.
  • Critical factors of such washes include the ionic strength and temperature of the final wash solution: the lower the salt concentration and the higher the wash temperature, the higher the stringency of the wash.
  • Wash conditions are typically performed at or below hybridisation stringency. A positive hybridisation gives a signal that is at least twice of that of the background.
  • suitable stringent conditions for nucleic acid hybridisation assays or gene amplification detection procedures are as set forth above. More or less stringent conditions may also be selected. The skilled artisan is aware of various parameters which may be altered during washing and which will either maintain or change the stringency conditions.
  • typical high stringency hybridisation conditions for DNA hybrids longer than 50 nucleotides encompass hybridisation at 65°C in 1x SSC or at 42°C in 1x SSC and 50% formamide, followed by washing at 65°C in 0.3x SSC.
  • Examples of medium stringency hybridisation conditions for DNA hybrids longer than 50 nucleotides encompass hybridisation at 50°C in 4x SSC or at 40°C in 6x SSC and 50% formamide, followed by washing at 50°C in 2x SSC.
  • the length of the hybrid is the anticipated length for the hybridising nucleic acid. When nucleic acids of known sequence are hybridised, the hybrid length may be determined by aligning the sequences and identifying the conserved regions described herein.
  • 1 xSSC is 0.15M NaCI and 15mM sodium citrate; the hybridisation solution and wash solutions may additionally include 5x Denhardt's reagent, 0.5-1.0% SDS, 100 ⁇ g/ml denatured, fragmented salmon sperm DNA, 0.5% sodium pyrophosphate.
  • splice variant encompasses variants of a nucleic acid sequence in which selected introns and/or exons have been excised, replaced, displaced or added, or in which introns have been shortened or lengthened. Such variants will be ones in which the biological activity of the protein is substantially retained; this may be achieved by selectively retaining functional segments of the protein. Such splice variants may be found in nature or may be manmade. Methods for predicting and isolating such splice variants are well known in the art (see for example Foissac and Schiex (2005) BMC Bioinformatics 6: 25).
  • Allelic variants are alternative forms of a given gene, located at the same chromosomal position. Allelic variants encompass Single Nucleotide Polymorphisms (SNPs), as well as Small Insertion/Deletion Polymorphisms (INDELs). The size of INDELs is usually less than 100 bp. SNPs and INDELs form the largest set of sequence variants in naturally occurring polymorphic strains of most organisms.
  • an "endogenous" gene not only refers to the gene in question as found in a plant in its natural form (i.e., without there being any human intervention), but also refers to that same gene (or a substantially homologous nucleic acid/gene) in an isolated form subsequently (re)introduced into a plant (a transgene).
  • a transgenic plant containing such a transgene may encounter a substantial reduction of the transgene expression and/or substantial reduction of expression of the endogenous gene.
  • the isolated gene may be isolated from an organism or may be manmade, for example by chemical synthesis.
  • Gene shuffling or “directed evolution” consists of iterations of DNA shuffling followed by appropriate screening and/or selection to generate variants of nucleic acids or portions thereof encoding proteins having a modified biological activity (Castle et al., (2004) Science 304(5674): 1 151 -4; US patents 5,81 1 ,238 and 6,395,547).
  • Artificial DNA (such as but, not limited to plasmids or viral DNA) capable of replication in a host cell and used for introduction of a DNA sequence of interest into a host cell or host organism.
  • Host cells of the invention may be any cell selected from bacterial cells, such as Escherichia coli or Agrobacterium species cells, yeast cells, fungal, algal or cyanobacterial cells or plant cells.
  • the skilled artisan is well aware of the genetic elements that must be present on the genetic construct in order to successfully transform, select and propagate host cells containing the sequence of interest.
  • the sequence of interest is operably linked to one or more control sequences (at least to a promoter) as described herein. Additional regulatory elements may include transcriptional as well as translational enhancers.
  • an intron sequence may also be added to the 5' untranslated region (UTR) or in the coding sequence to increase the amount of the mature message that accumulates in the cytosol, as described in the definitions section.
  • Other control sequences (besides promoter, enhancer, silencer, intron sequences, 3'UTR and/or 5'UTR regions) may be protein and/or RNA stabilizing elements. Such sequences would be known or may readily be obtained by a person skilled in the art.
  • the genetic constructs of the invention may further include an origin of replication sequence that is required for maintenance and/or replication in a specific cell type.
  • an origin of replication sequence that is required for maintenance and/or replication in a specific cell type.
  • Preferred origins of replication include, but are not limited to, the f1 -oh and colE1.
  • the genetic construct may optionally comprise a selectable marker gene.
  • selectable markers are described in more detail in the "definitions" section herein.
  • the marker genes may be removed or excised from the transgenic cell once they are no longer needed. Techniques for marker removal are known in the art, useful techniques are described above in the definitions section.
  • regulatory element control sequence
  • promoter typically refers to a nucleic acid control sequence located upstream from the transcriptional start of a gene and which is involved in recognising and binding of RNA polymerase and other proteins, thereby directing transcription of an operably linked nucleic acid.
  • transcriptional regulatory sequences derived from a classical eukaryotic genomic gene (including the TATA box which is required for accurate transcription initiation, with or without a CCAAT box sequence) and additional regulatory elements (i.e. upstream activating sequences, enhancers and silencers) which alter gene expression in response to developmental and/or external stimuli, or in a tissue-specific manner.
  • additional regulatory elements i.e. upstream activating sequences, enhancers and silencers
  • transcriptional regulatory sequence of a classical prokaryotic gene in which case it may include a -35 box sequence and/or -10 box transcriptional regulatory sequences.
  • regulatory element also encompasses a synthetic fusion molecule or derivative that confers, activates or enhances expression of a nucleic acid molecule in a cell, tissue or organ.
  • a “plant promoter” comprises regulatory elements, which mediate the expression of a coding sequence segment in plant cells. Accordingly, a plant promoter need not be of plant origin, but may originate from viruses or micro-organisms, for example from viruses which attack plant cells. The "plant promoter” can also originate from a plant cell, e.g. from the plant which is transformed with the nucleic acid sequence to be expressed in the inventive process and described herein. This also applies to other “plant” regulatory signals, such as "plant” terminators.
  • the promoters upstream of the nucleotide sequences useful in the methods of the present invention can be modified by one or more nucleotide substitution(s), insertion(s) and/or deletion(s) without interfering with the functionality or activity of either the promoters, the open reading frame (ORF) or the 3'-regulatory region such as terminators or other 3' regulatory regions which are located away from the ORF. It is furthermore possible that the activity of the promoters is increased by modification of their sequence, or that they are replaced completely by more active promoters, even promoters from heterologous organisms.
  • the nucleic acid molecule For expression in plants, the nucleic acid molecule must, as described above, be linked operably to or comprise a suitable promoter which expresses the gene at the right point in time and with the required spatial expression pattern.
  • the promoter strength and/or expression pattern of a candidate promoter may be analysed for example by operably linking the promoter to a reporter gene and assaying the expression level and pattern of the reporter gene in various tissues of the plant.
  • Suitable well-known reporter genes include for example beta-glucuronidase or beta-galactosidase. The promoter activity is assayed by measuring the enzymatic activity of the beta-glucuronidase or beta-galactosidase.
  • promoter strength and/or expression pattern may then be compared to that of a reference promoter (such as the one used in the methods of the present invention).
  • promoter strength may be assayed by quantifying mRNA levels or by comparing mRNA levels of the nucleic acid used in the methods of the present invention, with mRNA levels of housekeeping genes such as 18S rRNA, using methods known in the art, such as Northern blotting with densitometric analysis of autoradiograms, quantitative real-time PCR or RT- PCR (Heid et al., 1996 Genome Methods 6: 986-994).
  • weak promoter is intended a promoter that drives expression of a coding sequence at a low level.
  • low level is intended at levels of about 1/10,000 transcripts to about 1/100,000 transcripts, to about 1/500,0000 transcripts per cell.
  • a strong promoter drives expression of a coding sequence at high level, or at about 1/10 transcripts to about 1/100 transcripts to about 1/1000 transcripts per cell.
  • medium strength promoter is intended a promoter that drives expression of a coding sequence at a lower level than a strong promoter, in particular at a level that is in all instances below that obtained when under the control of a 35S CaMV promoter. Operably linked
  • operably linked refers to a functional linkage between the promoter sequence and the gene of interest, such that the promoter sequence is able to initiate transcription of the gene of interest.
  • constitutive promoter refers to a promoter that is transcriptionally active during most, but not necessarily all, phases of growth and development and under most environmental conditions, in at least one cell, tissue or organ. Table 2a below gives examples of constitutive promoters.
  • a "ubiquitous promoter” is active in substantially all tissues or cells of an organism. Developmentally-regulated promoter
  • a "developmentally-regulated promoter” is active during certain developmental stages or in parts of the plant that undergo developmental changes.
  • inducible promoter has induced or increased transcription initiation in response to a chemical (for a review see Gatz 1997, Annu. Rev. Plant Physiol. Plant Mol. Biol., 48:89- 108), environmental or physical stimulus, or may be "stress-inducible", i.e. activated when a plant is exposed to various stress conditions, or a “pathogen-inducible” i.e. activated when a plant is exposed to exposure to various pathogens.
  • organ-specific or tissue-specific promoter is one that is capable of preferentially initiating transcription in certain organs or tissues, such as the leaves, roots, seed tissue etc.
  • a "root-specific promoter” is a promoter that is transcriptionally active predominantly in plant roots, substantially to the exclusion of any other parts of a plant, whilst still allowing for any leaky expression in these other plant parts. Promoters able to initiate transcription in certain cells only are referred to herein as "cell-specific”.
  • root-specific promoters examples are listed in Table 2b below:
  • ALF5 (Arabidopsis) Diener et al. (2001 , Plant Cell 13:1625)
  • NRT2;1 Np N. Quesada et al. (1997, Plant Mol. Biol. 34:265)
  • seed-specific promoter is transcriptionally active predominantly in seed tissue, but not necessarily exclusively in seed tissue (in cases of leaky expression).
  • the seed-specific promoter may be active during seed development and/or during germination.
  • the seed specific promoter may be endosperm/aleurone/embryo specific. Examples of seed-specific promoters (endosperm/aleurone/embryo specific) are shown in Table 2c to Table 2f below. Further examples of seed-specific promoters are given in Qing Qu and Takaiwa (Plant Biotechnol. J. 2, 1 13-125, 2004), which disclosure is incorporated by reference herein as if fully set forth.
  • a-amylase (Amy32b) Lanahan et al, Plant Cell 4:203-211 , 1992; Skriver et al,
  • green tissue-specific promoter as defined herein is a promoter that is transcriptionally active predominantly in green tissue, substantially to the exclusion of any other parts of a plant, whilst still allowing for any leaky expression in these other plant parts. Examples of green tissue-specific promoters which may be used to perform the methods of the invention are shown in Table 2g below.
  • tissue-specific promoter is a meristem-specific promoter, which is transcriptionally active predominantly in meristematic tissue, substantially to the exclusion of any other parts of a plant, whilst still allowing for any leaky expression in these other plant parts.
  • Examples of green meristem-specific promoters which may be used to perform the methods of the invention are shown in Table 2h below.
  • terminal encompasses a control sequence which is a DNA sequence at the end of a transcriptional unit which signals 3' processing and polyadenylation of a primary transcript and termination of transcription.
  • the terminator can be derived from the natural gene, from a variety of other plant genes, or from T-DNA.
  • the terminator to be added may be derived from, for example, the nopaline synthase or octopine synthase genes, or alternatively from another plant gene, or less preferably from any other eukaryotic gene.
  • “Selectable marker”, “selectable marker gene” or “reporter gene” includes any gene that confers a phenotype on a cell in which it is expressed to facilitate the identification and/or selection of cells that are transfected or transformed with a nucleic acid construct of the invention. These marker genes enable the identification of a successful transfer of the nucleic acid molecules via a series of different principles. Suitable markers may be selected from markers that confer antibiotic or herbicide resistance, that introduce a new metabolic trait or that allow visual selection.
  • selectable marker genes include genes conferring resistance to antibiotics (such as nptll that phosphorylates neomycin and kanamycin, or hpt, phosphorylating hygromycin, or genes conferring resistance to, for example, bleomycin, streptomycin, tetracyclin, chloramphenicol, ampicillin, gentamycin, geneticin (G418), spectinomycin or blasticidin), to herbicides (for example bar which provides resistance to Basta ® ; aroA or gox providing resistance against glyphosate, or the genes conferring resistance to, for example, imidazolinone, phosphinothricin or sulfonylurea), or genes that provide a metabolic trait (such as manA that allows plants to use mannose as sole carbon source or xylose isomerase for the utilisation of xylose, or antinutritive markers such as the resistance to 2-deoxyglucose).
  • antibiotics such as nptll that phospho
  • Visual marker genes results in the formation of colour (for example ⁇ -glucuronidase, GUS or ⁇ - galactosidase with its coloured substrates, for example X-Gal), luminescence (such as the luciferin/luceferase system) or fluorescence (Green Fluorescent Protein, GFP, and derivatives thereof).
  • colour for example ⁇ -glucuronidase, GUS or ⁇ - galactosidase with its coloured substrates, for example X-Gal
  • luminescence such as the luciferin/luceferase system
  • fluorescence Green Fluorescent Protein
  • nucleic acid molecules encoding a selectable marker can be introduced into a host cell on the same vector that comprises the sequence encoding the polypeptides of the invention or used in the methods of the invention, or else in a separate vector. Cells which have been stably transfected with the introduced nucleic acid can be identified for example by selection (for example, cells which have integrated the selectable marker survive whereas the other cells die).
  • the process according to the invention for introducing the nucleic acids advantageously employs techniques which enable the removal or excision of these marker genes.
  • One such a method is what is known as co-transformation.
  • the co- transformation method employs two vectors simultaneously for the transformation, one vector bearing the nucleic acid according to the invention and a second bearing the marker gene(s).
  • a large proportion of transformants receives or, in the case of plants, comprises (up to 40% or more of the transformants), both vectors.
  • the transformants usually receive only a part of the vector, i.e.
  • the marker genes can subsequently be removed from the transformed plant by performing crosses.
  • marker genes integrated into a transposon are used for the transformation together with desired nucleic acid (known as the Ac/Ds technology).
  • the transformants can be crossed with a transposase source or the transformants are transformed with a nucleic acid construct conferring expression of a transposase, transiently or stable.
  • the transposon jumps out of the genome of the host cell once transformation has taken place successfully and is lost.
  • the transposon jumps to a different location. In these cases the marker gene must be eliminated by performing crosses.
  • Cre/lox system Cre1 is a recombinase that removes the sequences located between the loxP sequences. If the marker gene is integrated between the loxP sequences, it is removed once transformation has taken place successfully, by expression of the recombinase.
  • Cre1 is a recombinase that removes the sequences located between the loxP sequences. If the marker gene is integrated between the loxP sequences, it is removed once transformation has taken place successfully, by expression of the recombinase.
  • Further recombination systems are the HIN/HIX, FLP/FRT and REP/STB system (Tribble et al., J. Biol.
  • transgenic means with regard to, for example, a nucleic acid sequence, an expression cassette, gene construct or a vector comprising the nucleic acid sequence or an organism transformed with the nucleic acid sequences, expression cassettes or vectors according to the invention, all those constructions brought about by recombinant methods in which either
  • genetic control sequence(s) which is operably linked with the nucleic acid sequence according to the invention, for example a promoter, or
  • the natural genetic environment is understood as meaning the natural genomic or chromosomal locus in the original plant or the presence in a genomic library.
  • the natural genetic environment of the nucleic acid sequence is preferably retained, at least in part.
  • the environment flanks the nucleic acid sequence at least on one side and has a sequence length of at least 50 bp, preferably at least 500 bp, especially preferably at least 1000 bp, most preferably at least 5000 bp.
  • transgenic plant for the purposes of the invention is thus understood as meaning, as above, that the nucleic acids used in the method of the invention are not present in, or originating from, the genome of said plant, or are present in the genome of said plant but not at their natural locus in the genome of said plant, it being possible for the nucleic acids to be expressed homologously or heterologously.
  • transgenic also means that, while the nucleic acids according to the invention or used in the inventive method are at their natural position in the genome of a plant, the sequence has been modified with regard to the natural sequence, and/or that the regulatory sequences of the natural sequences have been modified.
  • Transgenic is preferably understood as meaning the expression of the nucleic acids according to the invention at an unnatural locus in the genome, i.e. homologous or, preferably, heterologous expression of the nucleic acids takes place.
  • Preferred transgenic plants are mentioned herein.
  • isolated nucleic acid or isolated polypeptide
  • isolated polypeptide may in some instances be considered as a synonym for a "recombinant nucleic acid” or a “recombinant polypeptide”, respectively and refers to a nucleic acid or polypeptide that is not located in its natural genetic environment and/or that has been modified by recombinant methods.
  • an isolated nucleic acid sequence or isolated nucleic acid molecule is one that is not in its native surrounding or its native nucleic acid neighbourhood, yet is physically and functionally connected to other nucleic acid sequences or nucleic acid molecules and is found as part of a nucleic acid construct, vector sequence or chromosome.
  • modulation means in relation to expression or gene expression, a process in which the expression level is changed by said gene expression in comparison to the control plant, the expression level may be increased or decreased.
  • the original, unmodulated expression may be of any kind of expression of a structural RNA (rRNA, tRNA) or mRNA with subsequent translation.
  • the original unmodulated expression may also be absence of any expression.
  • modulating the activity or the term “modulating expression” shall mean any change of the expression of the inventive nucleic acid sequences or encoded proteins, which leads to increased yield and/or increased growth of the plants.
  • the expression can increase from zero (absence of, or immeasurable expression) to a certain amount, or can decrease from a certain amount to immeasurable small amounts or zero.
  • expression means the transcription of a specific gene or specific genes or specific genetic construct.
  • expression in particular means the transcription of a gene or genes or genetic construct into structural RNA (rRNA, tRNA) or mRNA with or without subsequent translation of the latter into a protein. The process includes transcription of DNA and processing of the resulting mRNA product. Increased expression/overexpression
  • the term "increased expression” or “overexpression” as used herein means any form of expression that is additional to the original wild-type expression level.
  • the original wild-type expression level might also be zero, i.e. absence of expression or immeasurable expression.
  • Isolated nucleic acids which serve as promoter or enhancer elements may be introduced in an appropriate position (typically upstream) of a non-heterologous form of a polynucleotide so as to upregulate expression of a nucleic acid encoding the polypeptide of interest.
  • endogenous promoters may be altered in vivo by mutation, deletion, and/or substitution (see, Kmiec, US 5,565,350; Zarling et al., W09322443), or isolated promoters may be introduced into a plant cell in the proper orientation and distance from a gene of the present invention so as to control the expression of the gene.
  • polypeptide expression it is generally desirable to include a polyadenylation region at the 3'-end of a polynucleotide coding region.
  • the polyadenylation region can be derived from the natural gene, from a variety of other plant genes, or from T-DNA.
  • the 3' end sequence to be added may be derived from, for example, the nopaline synthase or octopine synthase genes, or alternatively from another plant gene, or less preferably from any other eukaryotic gene.
  • An intron sequence may also be added to the 5' untranslated region (UTR) or the coding sequence of the partial coding sequence to increase the amount of the mature message that accumulates in the cytosol.
  • UTR 5' untranslated region
  • Reference herein to "decreased expression” or “reduction or substantial elimination” of expression is taken to mean a decrease in endogenous gene expression and/or polypeptide levels and/or polypeptide activity relative to control plants.
  • the reduction or substantial elimination is in increasing order of preference at least 10%, 20%, 30%, 40% or 50%, 60%, 70%, 80%, 85%, 90%, or 95%, 96%, 97%, 98%, 99% or more reduced compared to that of control plants.
  • substantially contiguous nucleotides of a nucleic acid sequence is required. In order to perform gene silencing, this may be as little as 20, 19, 18, 17, 16, 15, 14, 13, 12, 11 , 10 or fewer nucleotides, alternatively this may be as much as the entire gene (including the 5' and/or 3' UTR, either in part or in whole).
  • the stretch of substantially contiguous nucleotides may be derived from the nucleic acid encoding the protein of interest (target gene), or from any nucleic acid capable of encoding an orthologue, paralogue or homologue of the protein of interest.
  • the stretch of substantially contiguous nucleotides is capable of forming hydrogen bonds with the target gene (either sense or antisense strand), more preferably, the stretch of substantially contiguous nucleotides has, in increasing order of preference, 50%, 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 100% sequence identity to the target gene (either sense or antisense strand).
  • a nucleic acid sequence encoding a (functional) polypeptide is not a requirement for the various methods discussed herein for the reduction or substantial elimination of expression of an endogenous gene.
  • a preferred method for the reduction or substantial elimination of endogenous gene expression is by introducing and expressing in a plant a genetic construct into which the nucleic acid (in this case a stretch of substantially contiguous nucleotides derived from the gene of interest, or from any nucleic acid capable of encoding an orthologue, paralogue or homologue of any one of the protein of interest) is cloned as an inverted repeat (in part or completely), separated by a spacer (non-coding DNA).
  • the nucleic acid in this case a stretch of substantially contiguous nucleotides derived from the gene of interest, or from any nucleic acid capable of encoding an orthologue, paralogue or homologue of any one of the protein of interest
  • expression of the endogenous gene is reduced or substantially eliminated through RNA-mediated silencing using an inverted repeat of a nucleic acid or a part thereof (in this case a stretch of substantially contiguous nucleotides derived from the gene of interest, or from any nucleic acid capable of encoding an orthologue, paralogue or homologue of the protein of interest), preferably capable of forming a hairpin structure.
  • the inverted repeat is cloned in an expression vector comprising control sequences.
  • a non- coding DNA nucleic acid sequence (a spacer, for example a matrix attachment region fragment (MAR), an intron, a polylinker, etc.) is located between the two inverted nucleic acids forming the inverted repeat.
  • MAR matrix attachment region fragment
  • a chimeric RNA with a self-complementary structure is formed (partial or complete).
  • This double-stranded RNA structure is referred to as the hairpin RNA (hpRNA).
  • the hpRNA is processed by the plant into siRNAs that are incorporated into an RNA-induced silencing complex (RISC).
  • RISC RNA-induced silencing complex
  • the RISC further cleaves the mRNA transcripts, thereby substantially reducing the number of mRNA transcripts to be translated into polypeptides.
  • RISC RNA-induced silencing complex
  • Performance of the methods of the invention does not rely on introducing and expressing in a plant a genetic construct into which the nucleic acid is cloned as an inverted repeat, but any one or more of several well-known "gene silencing" methods may be used to achieve the same effects.
  • RNA-mediated silencing of gene expression is triggered in a plant by a double stranded RNA sequence (dsRNA) that is substantially similar to the target endogenous gene.
  • dsRNA double stranded RNA sequence
  • This dsRNA is further processed by the plant into about 20 to about 26 nucleotides called short interfering RNAs (siRNAs).
  • the siRNAs are incorporated into an RNA-induced silencing complex (RISC) that cleaves the mRNA transcript of the endogenous target gene, thereby substantially reducing the number of mRNA transcripts to be translated into a polypeptide.
  • RISC RNA-induced silencing complex
  • the double stranded RNA sequence corresponds to a target gene.
  • RNA silencing method involves the introduction of nucleic acid sequences or parts thereof (in this case a stretch of substantially contiguous nucleotides derived from the gene of interest, or from any nucleic acid capable of encoding an orthologue, paralogue or homologue of the protein of interest) in a sense orientation into a plant.
  • Sense orientation refers to a DNA sequence that is homologous to an mRNA transcript thereof. Introduced into a plant would therefore be at least one copy of the nucleic acid sequence.
  • the additional nucleic acid sequence will reduce expression of the endogenous gene, giving rise to a phenomenon known as co-suppression. The reduction of gene expression will be more pronounced if several additional copies of a nucleic acid sequence are introduced into the plant, as there is a positive correlation between high transcript levels and the triggering of co-suppression.
  • RNA silencing method involves the use of antisense nucleic acid sequences.
  • An "antisense" nucleic acid sequence comprises a nucleotide sequence that is complementary to a "sense" nucleic acid sequence encoding a protein, i.e. complementary to the coding strand of a double-stranded cDNA molecule or complementary to an mRNA transcript sequence.
  • the antisense nucleic acid sequence is preferably complementary to the endogenous gene to be silenced.
  • the complementarity may be located in the "coding region” and/or in the "non-coding region" of a gene.
  • the term “coding region” refers to a region of the nucleotide sequence comprising codons that are translated into amino acid residues.
  • non-coding region refers to 5' and 3' sequences that flank the coding region that are transcribed but not translated into amino acids (also referred to as 5' and 3' untranslated regions).
  • Antisense nucleic acid sequences can be designed according to the rules of Watson and Crick base pairing.
  • the antisense nucleic acid sequence may be complementary to the entire nucleic acid sequence (in this case a stretch of substantially contiguous nucleotides derived from the gene of interest, or from any nucleic acid capable of encoding an orthologue, paralogue or homologue of the protein of interest), but may also be an oligonucleotide that is antisense to only a part of the nucleic acid sequence (including the mRNA 5' and 3' UTR).
  • the antisense oligonucleotide sequence may be complementary to the region surrounding the translation start site of an mRNA transcript encoding a polypeptide.
  • a suitable antisense oligonucleotide sequence is known in the art and may start from about 50, 45, 40, 35, 30, 25, 20, 15 or 10 nucleotides in length or less.
  • An antisense nucleic acid sequence according to the invention may be constructed using chemical synthesis and enzymatic ligation reactions using methods known in the art.
  • an antisense nucleic acid sequence may be chemically synthesized using naturally occurring nucleotides or variously modified nucleotides designed to increase the biological stability of the molecules or to increase the physical stability of the duplex formed between the antisense and sense nucleic acid sequences, e.g., phosphorothioate derivatives and acridine substituted nucleotides may be used.
  • modified nucleotides that may be used to generate the antisense nucleic acid sequences are well known in the art.
  • nucleotide modifications include methylation, cyclization and 'caps' and substitution of one or more of the naturally occurring nucleotides with an analogue such as inosine.
  • analogue such as inosine.
  • Other modifications of nucleotides are well known in the art.
  • the antisense nucleic acid sequence can be produced biologically using an expression vector into which a nucleic acid sequence has been subcloned in an antisense orientation (i.e., RNA transcribed from the inserted nucleic acid will be of an antisense orientation to a target nucleic acid of interest).
  • an expression vector into which a nucleic acid sequence has been subcloned in an antisense orientation i.e., RNA transcribed from the inserted nucleic acid will be of an antisense orientation to a target nucleic acid of interest.
  • production of antisense nucleic acid sequences in plants occurs by means of a stably integrated nucleic acid construct comprising a promoter, an operably linked antisense oligonucleotide, and a terminator.
  • the nucleic acid molecules used for silencing in the methods of the invention hybridize with or bind to mRNA transcripts and/or genomic DNA encoding a polypeptide to thereby inhibit expression of the protein, e.g., by inhibiting transcription and/or translation.
  • the hybridization can be by conventional nucleotide complementarity to form a stable duplex, or, for example, in the case of an antisense nucleic acid sequence which binds to DNA duplexes, through specific interactions in the major groove of the double helix.
  • Antisense nucleic acid sequences may be introduced into a plant by transformation or direct injection at a specific tissue site.
  • antisense nucleic acid sequences can be modified to target selected cells and then administered systemically.
  • antisense nucleic acid sequences can be modified such that they specifically bind to receptors or antigens expressed on a selected cell surface, e.g., by linking the antisense nucleic acid sequence to peptides or antibodies which bind to cell surface receptors or antigens.
  • the antisense nucleic acid sequences can also be delivered to cells using the vectors described herein.
  • the antisense nucleic acid sequence is an a-anomeric nucleic acid sequence.
  • An a-anomeric nucleic acid sequence forms specific double-stranded hybrids with complementary RNA in which, contrary to the usual b-units, the strands run parallel to each other (Gaultier et al. (1987) Nucl Ac Res 15: 6625-6641 ).
  • the antisense nucleic acid sequence may also comprise a 2'-o-methylribonucleotide (Inoue et al. (1987) Nucl Ac Res 15, 6131 -6148) or a chimeric RNA-DNA analogue (Inoue et al. (1987) FEBS Lett. 215, 327-330).
  • Ribozymes are catalytic RNA molecules with ribonuclease activity that are capable of cleaving a single-stranded nucleic acid sequence, such as an mRNA, to which they have a complementary region.
  • ribozymes e.g., hammerhead ribozymes (described in Haselhoff and Gerlach (1988) Nature 334, 585-591) can be used to catalytically cleave mRNA transcripts encoding a polypeptide, thereby substantially reducing the number of mRNA transcripts to be translated into a polypeptide.
  • a ribozyme having specificity for a nucleic acid sequence can be designed (see for example: Cech et al. U.S. Patent No. 4,987,071 ; and Cech et al. U.S. Patent No. 5,1 16,742).
  • mRNA transcripts corresponding to a nucleic acid sequence can be used to select a catalytic RNA having a specific ribonuclease activity from a pool of RNA molecules (Bartel and Szostak (1993) Science 261 , 1411 -1418).
  • the use of ribozymes for gene silencing in plants is known in the art (e.g., Atkins et al. (1994) WO 94/00012; Lenne et al.
  • Gene silencing may also be achieved by insertion mutagenesis (for example, T-DNA insertion or transposon insertion) or by strategies as described by, among others, Angell and Baulcombe ((1999) Plant J 20(3): 357-62), (Amplicon VIGS WO 98/36083), or Baulcombe (WO 99/15682).
  • Gene silencing may also occur if there is a mutation on an endogenous gene and/or a mutation on an isolated gene/nucleic acid subsequently introduced into a plant.
  • the reduction or substantial elimination may be caused by a non-functional polypeptide.
  • the polypeptide may bind to various interacting proteins; one or more mutation(s) and/or truncation(s) may therefore provide for a polypeptide that is still able to bind interacting proteins (such as receptor proteins) but that cannot exhibit its normal function (such as signalling ligand).
  • a further approach to gene silencing is by targeting nucleic acid sequences complementary to the regulatory region of the gene (e.g., the promoter and/or enhancers) to form triple helical structures that prevent transcription of the gene in target cells.
  • nucleic acid sequences complementary to the regulatory region of the gene e.g., the promoter and/or enhancers
  • Other methods such as the use of antibodies directed to an endogenous polypeptide for inhibiting its function in planta, or interference in the signalling pathway in which a polypeptide is involved, will be well known to the skilled man.
  • manmade molecules may be useful for inhibiting the biological function of a target polypeptide, or for interfering with the signalling pathway in which the target polypeptide is involved.
  • a screening program may be set up to identify in a plant population natural variants of a gene, which variants encode polypeptides with reduced activity.
  • natural variants may also be used for example, to perform homologous recombination.
  • miRNAs Artificial and/or natural microRNAs
  • Endogenous miRNAs are single stranded small RNAs of typically 19-24 nucleotides long. They function primarily to regulate gene expression and/ or mRNA translation.
  • Most plant microRNAs miRNAs
  • Most plant microRNAs have perfect or near-perfect complementarity with their target sequences. However, there are natural targets with up to five mismatches. They are processed from longer non-coding RNAs with characteristic fold-back structures by double-strand specific RNases of the Dicer family. Upon processing, they are incorporated in the RNA-induced silencing complex (RISC) by binding to its main component, an Argonaute protein.
  • RISC RNA-induced silencing complex
  • MiRNAs serve as the specificity components of RISC, since they base-pair to target nucleic acids, mostly mRNAs, in the cytoplasm. Subsequent regulatory events include target mRNA cleavage and destruction and/or translational inhibition. Effects of miRNA overexpression are thus often reflected in decreased mRNA levels of target genes.
  • amiRNAs Artificial microRNAs
  • amiRNAs which are typically 21 nucleotides in length, can be genetically engineered specifically to negatively regulate gene expression of single or multiple genes of interest. Determinants of plant microRNA target selection are well known in the art. Empirical parameters for target recognition have been defined and can be used to aid in the design of specific amiRNAs, (Schwab et al., Dev. Cell 8, 517-527, 2005). Convenient tools for design and generation of amiRNAs and their precursors are also available to the public (Schwab et al., Plant Cell 18, 1 121 -1 133, 2006).
  • the gene silencing techniques used for reducing expression in a plant of an endogenous gene requires the use of nucleic acid sequences from monocotyledonous plants for transformation of monocotyledonous plants, and from dicotyledonous plants for transformation of dicotyledonous plants.
  • a nucleic acid sequence from any given plant species is introduced into that same species.
  • a nucleic acid sequence from rice is transformed into a rice plant.
  • Described above are examples of various methods for the reduction or substantial elimination of expression in a plant of an endogenous gene.
  • a person skilled in the art would readily be able to adapt the aforementioned methods for silencing so as to achieve reduction of expression of an endogenous gene in a whole plant or in parts thereof through the use of an appropriate promoter, for example.
  • introduction or “transformation” as referred to herein encompasses the transfer of an exogenous polynucleotide into a host cell, irrespective of the method used for transfer.
  • Plant tissue capable of subsequent clonal propagation may be transformed with a genetic construct of the present invention and a whole plant regenerated there from.
  • the particular tissue chosen will vary depending on the clonal propagation systems available for, and best suited to, the particular species being transformed.
  • tissue targets include leaf disks, pollen, embryos, cotyledons, hypocotyls, megagametophytes, callus tissue, existing meristematic tissue (e.g., apical meristem, axillary buds, and root meristems), and induced meristem tissue (e.g., cotyledon meristem and hypocotyl meristem).
  • the polynucleotide may be transiently or stably introduced into a host cell and may be maintained non-integrated, for example, as a plasmid. Alternatively, it may be integrated into the host genome.
  • the resulting transformed plant cell may then be used to regenerate a transformed plant in a manner known to persons skilled in the art.
  • a plant cell that cannot be regenerated into a plant may be chosen as host cell, i.e. the resulting transformed plant cell does not have the capacity to regenerate into a (whole) plant.
  • Transformation of plant species is now a fairly routine technique.
  • any of several transformation methods may be used to introduce the gene of interest into a suitable ancestor cell.
  • the methods described for the transformation and regeneration of plants from plant tissues or plant cells may be utilized for transient or for stable transformation. Transformation methods include the use of liposomes, electroporation, chemicals that increase free DNA uptake, injection of the DNA directly into the plant, particle gun bombardment, transformation using viruses or pollen and microprojection. Methods may be selected from the calcium/polyethylene glycol method for protoplasts (Krens, F.A. et al., (1982) Nature 296, 72-74; Negrutiu I et al.
  • Transgenic plants including transgenic crop plants, are preferably produced via Agrobacterium-mediated transformation.
  • An advantageous transformation method is the transformation in planta.
  • agrobacteria it is possible, for example, to allow the agrobacteria to act on plant seeds or to inoculate the plant meristem with agrobacteria. It has proved particularly expedient in accordance with the invention to allow a suspension of transformed agrobacteria to act on the intact plant or at least on the flower primordia. The plant is subsequently grown on until the seeds of the treated plant are obtained (Clough and Bent, Plant J. (1998) 16, 735-743).
  • Methods for Agrobacterium-med ⁇ a .ed transformation of rice include well known methods for rice transformation, such as those described in any of the following: European patent application EP 1198985 A1 , Aldemita and Hodges (Planta 199: 612-617, 1996); Chan et al. (Plant Mol Biol 22 (3): 491 -506, 1993), Hiei et al. (Plant J 6 (2): 271 -282, 1994), which disclosures are incorporated by reference herein as if fully set forth.
  • the preferred method is as described in either Ishida et al. (Nat. Biotechnol 14(6): 745-50, 1996) or Frame et al.
  • the nucleic acids or the construct to be expressed is preferably cloned into a vector, which is suitable for transforming Agrobacterium tumefaciens, for example pBin19 (Bevan et al., Nucl. Acids Res. 12 (1984) 871 1).
  • Agrobacteria transformed by such a vector can then be used in known manner for the transformation of plants, such as plants used as a model, like Arabidopsis (Arabidopsis thaliana is within the scope of the present invention not considered as a crop plant), or crop plants such as, by way of example, tobacco plants, for example by immersing bruised leaves or chopped leaves in an agrobacterial solution and then culturing them in suitable media.
  • the transformation of the chloroplast genome is generally achieved by a process which has been schematically displayed in Klaus et al., 2004 [Nature Biotechnology 22 (2), 225-229]. Briefly the sequences to be transformed are cloned together with a selectable marker gene between flanking sequences homologous to the chloroplast genome. These homologous flanking sequences direct site specific integration into the plastome. Plastidal transformation has been described for many different plant species and an overview is given in Bock (2001) Transgenic plastids in basic research and plant biotechnology. J Mol Biol. 2001 Sep 21 ; 312 (3):425-38 or Maliga, P (2003) Progress towards commercialization of plastid transformation technology. Trends Biotechnol. 21 , 20-28. Further biotechnological progress has recently been reported in form of marker free plastid transformants, which can be produced by a transient co-integrated maker gene (Klaus et al., 2004, Nature Biotechnology 22(2), 225-229).
  • the genetically modified plant cells can be regenerated via all methods with which the skilled worker is familiar. Suitable methods can be found in the abovementioned publications by S.D. Kung and R. Wu, Potrykus or Hofgen and Willmitzer. Alternatively, the genetically modified plant cells are non-regenerable into a whole plant. Generally after transformation, plant cells or cell groupings are selected for the presence of one or more markers which are encoded by plant-expressible genes co-transferred with the gene of interest, following which the transformed material is regenerated into a whole plant. To select transformed plants, the plant material obtained in the transformation is, as a rule, subjected to selective conditions so that transformed plants can be distinguished from untransformed plants.
  • the seeds obtained in the above-described manner can be planted and, after an initial growing period, subjected to a suitable selection by spraying.
  • a further possibility consists in growing the seeds, if appropriate after sterilization, on agar plates using a suitable selection agent so that only the transformed seeds can grow into plants.
  • the transformed plants are screened for the presence of a selectable marker such as the ones described above.
  • putatively transformed plants may also be evaluated, for instance using Southern analysis, for the presence of the gene of interest, copy number and/or genomic organisation.
  • expression levels of the newly introduced DNA may be monitored using Northern and/or Western analysis, both techniques being well known to persons having ordinary skill in the art.
  • the generated transformed plants may be propagated by a variety of means, such as by clonal propagation or classical breeding techniques.
  • a first generation (or T1 ) transformed plant may be selfed and homozygous second-generation (or T2) transformants selected, and the T2 plants may then further be propagated through classical breeding techniques.
  • the generated transformed organisms may take a variety of forms. For example, they may be chimeras of transformed cells and non-transformed cells; clonal transformants (e.g., all cells transformed to contain the expression cassette); grafts of transformed and untransformed tissues (e.g., in plants, a transformed rootstock grafted to an untransformed scion).
  • a plant, plant part, seed or plant cell transformed with - or interchangeably transformed by - a construct or transformed with or by a nucleic acid is to be understood as meaning a plant, plant part, seed or plant cell that carries said construct or said nucleic acid as a transgene due the result of an introduction of said construct or said nucleic acid by biotechnological means.
  • the plant, plant part, seed or plant cell therefore comprises said recombinant construct or said recombinant nucleic acid.
  • null-segregant any plant, plant part, seed or plant cell that no longer contains said recombinant construct or said recombinant nucleic acid after introduction in the past, is termed null-segregant, nullizygote or null control, but is not considered a plant, plant part, seed or plant cell transformed with said construct or with said nucleic acid within the meaning of this application.
  • T-DNA activation tagging involves insertion of T-DNA, usually containing a promoter (may also be a translation enhancer or an intron), in the genomic region of the gene of interest or 10 kb up- or downstream of the coding region of a gene in a configuration such that the promoter directs expression of the targeted gene.
  • a promoter may also be a translation enhancer or an intron
  • regulation of expression of the targeted gene by its natural promoter is disrupted and the gene falls under the control of the newly introduced promoter.
  • the promoter is typically embedded in a T-DNA. This T-DNA is randomly inserted into the plant genome, for example, through Agrobacterium infection and leads to modified expression of genes near the inserted T-DNA.
  • the resulting transgenic plants show dominant phenotypes due to modified expression of genes close to the introduced promoter.
  • TILLING is an abbreviation of "Targeted Induced Local Lesions In Genomes” and refers to a mutagenesis technology useful to generate and/or identify nucleic acids encoding proteins with modified expression and/or activity. TILLING also allows selection of plants carrying such mutant variants. These mutant variants may exhibit modified expression, either in strength or in location or in timing (if the mutations affect the promoter for example). These mutant variants may exhibit higher activity than that exhibited by the gene in its natural form. TILLING combines high-density mutagenesis with high-throughput screening methods.
  • Homologous recombination allows introduction in a genome of a selected nucleic acid at a defined selected position. Homologous recombination is a standard technology used routinely in biological sciences for lower organisms such as yeast or the moss Physcomitrella. Methods for performing homologous recombination in plants have been described not only for model plants (Offringa et al. (1990) EMBO J 9(10): 3077-84) but also for crop plants, for example rice (Terada et al.
  • a "Yield related trait” is a trait or feature which is related to plant yield. Yield-related traits may comprise one or more of the following non-limitative list of features: early flowering time, yield, biomass, seed yield, early vigour, greenness index, growth rate, agronomic traits, such as e.g. tolerance to submergence (which leads to yield in rice), Water Use Efficiency (WUE), Nitrogen Use Efficiency (NUE), etc.
  • WUE Water Use Efficiency
  • NUE Nitrogen Use Efficiency
  • Reference herein to enhanced yield-related traits, relative to of control plants is taken to mean one or more of an increase in early vigour and/or in biomass (weight) of one or more parts of a plant, which may include (i) aboveground parts and preferably aboveground harvestable parts and/or (ii) parts below ground and preferably harvestable below ground.
  • harvestable parts are roots such as taproots, stems, beets, leaves, flowers or seeds, and performance of the methods of the invention results in plants having increased seed yield relative to the seed yield of control plants, and/or increased stem biomass relative to the stem biomass of control plants, and/or increased root biomass relative to the root biomass of control plants and/or increased beet biomass relative to the beet biomass of control plants.
  • the sugar content (in particular the sucrose content) in the above ground parts, particularly stem (in particular of sugar cane plants) and/or in the belowground parts, in particular in roots including taproots, tubers and/or beets (in particular in sugar beets) is increased relative to the sugar content (in particular the sucrose content) in corresponding part(s) of the control plant.
  • such harvestable parts are seeds.
  • yield in general means a measurable produce of economic value, typically related to a specified crop, to an area, and to a period of time. Individual plant parts directly contribute to yield based on their number, size and/or weight, or the actual yield is the yield per square meter for a crop and year, which is determined by dividing total production (includes both harvested and appraised production) by planted square meters.
  • yield of a plant and “plant yield” are used interchangeably herein and are meant to refer to vegetative biomass such as root and/or shoot biomass, to reproductive organs, and/or to propagules such as seeds of that plant.
  • a yield increase in maize may be manifested as one or more of the following: increase in the number of plants established per square meter, an increase in the number of ears per plant, an increase in the number of rows, number of kernels per row, kernel weight, thousand kernel weight, ear length/diameter, increase in the seed filling rate, which is the number of filled florets (i.e. florets containing seed) divided by the total number of florets and multiplied by 100), among others.
  • a yield increase may manifest itself as an increase in one or more of the following: number of plants per square meter, number of panicles per plant, panicle length, number of spikelets per panicle, number of flowers (or florets) per panicle; an increase in the seed filling rate which is the number of filled florets (i.e. florets containing seeds) divided by the total number of florets and multiplied by 100; an increase in thousand kernel weight, among others.
  • Plants having an "early flowering time” as used herein are plants which start to flower earlier than control plants. Hence this term refers to plants that show an earlier start of flowering.
  • Flowering time of plants can be assessed by counting the number of days ("time to flower") between sowing and the emergence of a first inflorescence.
  • the "flowering time" of a plant can for instance be determined using the method as described in WO 2007/093444.
  • Early vigour refers to active healthy well-balanced growth especially during early stages of plant growth, and may result from increased plant fitness due to, for example, the plants being better adapted to their environment (i.e. optimizing the use of energy resources and partitioning between shoot and root). Plants having early vigour also show increased seedling survival and a better establishment of the crop, which often results in highly uniform fields (with the crop growing in uniform manner, i.e. with the majority of plants reaching the various stages of development at substantially the same time), and often better and higher yield. Therefore, early vigour may be determined by measuring various factors, such as thousand kernel weight, percentage germination, percentage emergence, seedling growth, seedling height, root length, root and shoot biomass and many more.
  • the increased growth rate may be specific to one or more parts of a plant (including seeds), or may be throughout substantially the whole plant. Plants having an increased growth rate may have a shorter life cycle.
  • the life cycle of a plant may be taken to mean the time needed to grow from a mature seed up to the stage where the plant has produced mature seeds, similar to the starting material. This life cycle may be influenced by factors such as speed of germination, early vigour, growth rate, greenness index, flowering time and speed of seed maturation.
  • the increase in growth rate may take place at one or more stages in the life cycle of a plant or during substantially the whole plant life cycle. Increased growth rate during the early stages in the life cycle of a plant may reflect enhanced vigour.
  • the increase in growth rate may alter the harvest cycle of a plant allowing plants to be sown later and/or harvested sooner than would otherwise be possible (a similar effect may be obtained with earlier flowering time). If the growth rate is sufficiently increased, it may allow for the further sowing of seeds of the same plant species (for example sowing and harvesting of rice plants followed by sowing and harvesting of further rice plants all within one conventional growing period). Similarly, if the growth rate is sufficiently increased, it may allow for the further sowing of seeds of different plants species (for example the sowing and harvesting of corn plants followed by, for example, the sowing and optional harvesting of soybean, potato or any other suitable plant). Harvesting additional times from the same rootstock in the case of some crop plants may also be possible.
  • Altering the harvest cycle of a plant may lead to an increase in annual biomass production per square meter (due to an increase in the number of times (say in a year) that any particular plant may be grown and harvested).
  • An increase in growth rate may also allow for the cultivation of transgenic plants in a wider geographical area than their wild-type counterparts, since the territorial limitations for growing a crop are often determined by adverse environmental conditions either at the time of planting (early season) or at the time of harvesting (late season). Such adverse conditions may be avoided if the harvest cycle is shortened.
  • the growth rate may be determined by deriving various parameters from growth curves, such parameters may be: T-Mid (the time taken for plants to reach 50% of their maximal size) and T-90 (time taken for plants to reach 90% of their maximal size), amongst others.
  • Mild stress in the sense of the invention leads to a reduction in the growth of the stressed plants of less than 40%, 35%, 30% or 25%, more preferably less than 20% or 15% in comparison to the control plant under non-stress conditions. Due to advances in agricultural practices (irrigation, fertilization, pesticide treatments) severe stresses are not often encountered in cultivated crop plants.
  • Abiotic stresses may be due to drought or excess water, anaerobic stress, salt stress, chemical toxicity, oxidative stress and hot, cold or freezing temperatures.
  • Biotic stresses are typically those stresses caused by pathogens, such as bacteria, viruses, fungi, nematodes and insects.
  • the "abiotic stress” may be an osmotic stress caused by a water stress, e.g. due to drought, salt stress, or freezing stress.
  • Abiotic stress may also be an oxidative stress or a cold stress.
  • Freezing stress is intended to refer to stress due to freezing temperatures, i.e. temperatures at which available water molecules freeze and turn into ice.
  • Cold stress also called “chilling stress” is intended to refer to cold temperatures, e.g. temperatures below 10°, or preferably below 5°C, but at which water molecules do not freeze.
  • abiotic stress leads to a series of morphological, physiological, biochemical and molecular changes that adversely affect plant growth and productivity.
  • Drought, salinity, extreme temperatures and oxidative stress are known to be interconnected and may induce growth and cellular damage through similar mechanisms.
  • Rabbani et al. Plant Physiol (2003) 133: 1755-1767
  • drought and/or salinisation are manifested primarily as osmotic stress, resulting in the disruption of homeostasis and ion distribution in the cell.
  • Oxidative stress which frequently accompanies high or low temperature, salinity or drought stress, may cause denaturing of functional and structural proteins.
  • non-stress conditions are those environmental conditions that allow optimal growth of plants. Persons skilled in the art are aware of normal soil conditions and climatic conditions for a given location. Plants with optimal growth conditions, (grown under non-stress conditions) typically yield in increasing order of preference at least 97%, 95%, 92%, 90%, 87%, 85%, 83%, 80%, 77% or 75% of the average production of such plant in a given environment. Average production may be calculated on harvest and/or season basis. Persons skilled in the art are aware of average yield productions of a crop.
  • the methods of the present invention may be performed under non-stress conditions.
  • the methods of the present invention may be performed under non-stress conditions such as mild drought to give plants having increased yield relative to control plants.
  • the methods of the present invention may be performed under stress conditions.
  • the methods of the present invention may be performed under stress conditions such as drought to give plants having increased yield relative to control plants.
  • the methods of the present invention may be performed under stress conditions such as nutrient deficiency to give plants having increased yield relative to control plants.
  • Nutrient deficiency may result from a lack of nutrients such as nitrogen, phosphates and other phosphorous-containing compounds, potassium, calcium, magnesium, manganese, iron and boron, amongst others.
  • the methods of the present invention may be performed under stress conditions such as salt stress to give plants having increased yield relative to control plants.
  • salt stress is not restricted to common salt (NaCI), but may be any one or more of: NaCI, KCI, LiCI, MgC , CaC , amongst others.
  • the methods of the present invention may be performed under stress conditions such as cold stress or freezing stress to give plants having increased yield relative to control plants.
  • Increased seed yield may manifest itself as one or more of the following:
  • TKW thousand kernel weight
  • filled florets and “filled seeds” may be considered synonyms.
  • An increase in seed yield may also be manifested as an increase in seed size and/or seed volume. Furthermore, an increase in seed yield may also manifest itself as an increase in seed area and/or seed length and/or seed width and/or seed perimeter.
  • the "greenness index” as used herein is calculated from digital images of plants. For each pixel belonging to the plant object on the image, the ratio of the green value versus the red value (in the RGB model for encoding color) is calculated. The greenness index is expressed as the percentage of pixels for which the green-to-red ratio exceeds a given threshold. Under normal growth conditions, under salt stress growth conditions, and under reduced nutrient availability growth conditions, the greenness index of plants is measured in the last imaging before flowering. In contrast, under drought stress growth conditions, the greenness index of plants is measured in the first imaging after drought.
  • biomass as used herein is intended to refer to the total weight of a plant. Within the definition of biomass, a distinction may be made between the biomass of one or more parts of a plant, which may include any one or more of the following:
  • - aboveground parts such as but not limited to shoot biomass, seed biomass, leaf biomass, etc.
  • aboveground harvestable parts such as but not limited to shoot biomass, seed biomass, leaf biomass, etc.
  • parts below ground such as but not limited to root biomass, tubers, bulbs, etc.;
  • - harvestable parts below ground such as but not limited to root biomass, tubers, bulbs, etc.;
  • harvestable parts partially below ground such as but not limited to beets and other hypocotyl areas of a plant, rhizomes, stolons or creeping rootstalks;
  • - vegetative biomass such as root biomass, shoot biomass, etc.
  • Such breeding programmes sometimes require introduction of allelic variation by mutagenic treatment of the plants, using for example EMS mutagenesis; alternatively, the programme may start with a collection of allelic variants of so called "natural" origin caused unintentionally. Identification of allelic variants then takes place, for example, by PCR. This is followed by a step for selection of superior allelic variants of the sequence in question and which give increased yield. Selection is typically carried out by monitoring growth performance of plants containing different allelic variants of the sequence in question. Growth performance may be monitored in a greenhouse or in the field. Further optional steps include crossing plants in which the superior allelic variant was identified with another plant. This could be used, for example, to make a combination of interesting phenotypic features.
  • nucleic acids encoding the protein of interest for genetically and physically mapping the genes requires only a nucleic acid sequence of at least 15 nucleotides in length. These nucleic acids may be used as restriction fragment length polymorphism (RFLP) markers. Southern blots (Sambrook J, Fritsch EF and Maniatis T (1989) Molecular Cloning, A Laboratory Manual) of restriction-digested plant genomic DNA may be probed with the nucleic acids encoding the protein of interest. The resulting banding patterns may then be subjected to genetic analyses using computer programs such as MapMaker (Lander et al. (1987) Genomics 1 : 174-181 ) in order to construct a genetic map.
  • MapMaker Large et al. (1987) Genomics 1 : 174-181
  • the nucleic acids may be used to probe Southern blots containing restriction endonuclease-treated genomic DNAs of a set of individuals representing parent and progeny of a defined genetic cross. Segregation of the DNA polymorphisms is noted and used to calculate the position of the nucleic acid encoding the protein of interest in the genetic map previously obtained using this population (Botstein et al. (1980) Am. J. Hum. Genet. 32:314-331 ).
  • the nucleic acid probes may also be used for physical mapping (i.e., placement of sequences on physical maps; see Hoheisel et al. In: Non-mammalian Genomic Analysis: A Practical Guide, Academic press 1996, pp. 319-346, and references cited therein).
  • the nucleic acid probes may be used in direct fluorescence in situ hybridisation (FISH) mapping (Trask (1991 ) Trends Genet. 7:149-154).
  • FISH fluorescence in situ hybridisation
  • nucleic acid amplification-based methods for genetic and physical mapping may be carried out using the nucleic acids. Examples include allele-specific amplification (Kazazian (1989) J. Lab. Clin. Med 11 :95-96), polymorphism of PCR-amplified fragments (CAPS; Sheffield et al. (1993) Genomics 16:325-332), allele-specific ligation (Landegren et al. (1988) Science 241 :1077-1080), nucleotide extension reactions (Sokolov (1990) Nucleic Acid Res. 18:3671), Radiation Hybrid Mapping (Walter et al. (1997) Nat. Genet.
  • plant as used herein encompasses whole plants, ancestors and progeny of the plants and plant parts, including seeds, shoots, stems, leaves, roots (including tubers), flowers, and tissues and organs, wherein each of the aforementioned comprise the gene/nucleic acid of interest.
  • plant also encompasses plant cells, suspension cultures, callus tissue, embryos, meristematic regions, gametophytes, sporophytes, pollen and microspores, again wherein each of the aforementioned comprises the gene/nucleic acid of interest.
  • Plants that are particularly useful in the methods of the invention include all plants which belong to the superfamily Viridiplantae, in particular monocotyledonous and dicotyledonous plants including fodder or forage legumes, ornamental plants, food crops, trees or shrubs selected from the list comprising Acer spp., Actinidia spp., Abelmoschus spp., Agave sisalana, Agropyron spp., Agrostis stolonifera, Allium spp., Amaranthus spp., Ammophila arenaria, Ananas comosus, Annona spp., Apium graveolens, Arachis spp, Artocarpus spp., Asparagus officinalis, Avena spp.
  • Avena sativa e.g. Avena sativa, Avena fatua, Avena byzantina, Avena fatua var. sativa, Avena hybrida
  • Averrhoa carambola e.g. Bambusa sp.
  • Benincasa hispida Bertholletia excelsea
  • Beta vulgaris Brassica spp.
  • Brassica napus e.g. Brassica napus, Brassica rapa ssp.
  • a nucleic acid or a polypeptide sequence of plant origin has the characteristic of a codon usage optimised for expression in plants, and of the use of amino acids and regulatory sites common in plants, respectively.
  • the plant of origin may be any plant, but preferably those plants as described in the previous paragraph.
  • control plants are routine part of an experimental setup and may include corresponding wild type plants or corresponding plants without the gene of interest.
  • the control plant is typically of the same plant species or even of the same variety as the plant to be assessed.
  • the control plant may also be a nullizygote of the plant to be assessed. Nullizygotes (or null control plants) are individuals missing the transgene by segregation.
  • control plants are grown under equal growing conditions to the growing conditions of the plants of the invention, i.e. in the vicinity of, and simultaneously with, the plants of the invention.
  • a "control plant” as used herein refers not only to whole plants, but also to plant parts, including seeds and seed parts.
  • the present invention shows that modulating expression in a plant of a nucleic acid encoding an ELM2-related polypeptide, or a WRKY-related polypeptide, or an EMG1 -like polypeptide, or a GPx-related polypeptide, gives plants having enhanced yield-related traits relative or compared to control plants.
  • the terms "relative to” and “compared to” can be used interchangeably throughout the text of this patent application.
  • the present invention provides a method for enhancing yield-related traits in plants relative to control plants, comprising modulating expression in a plant of a nucleic acid encoding an ELM2-related polypeptide, or a WRKY-related polypeptide, or an EMG1 -like polypeptide, or a GPx-related polypeptide, and optionally selecting for plants having enhanced yield-related traits.
  • the present invention provides a method for producing plants having enhanced yield-related traits relative to control plants, wherein said method comprises the steps of modulating expression in said plant of a nucleic acid encoding an ELM2-related polypeptide, or a WRKY-related polypeptide, or an EMG1-like polypeptide, or a GPx-related polypeptide, as described herein and optionally selecting for plants having enhanced yield-related traits.
  • a preferred method for modulating, preferably increasing, expression of a nucleic acid encoding an ELM2-related polypeptide, or a WRKY-related polypeptide, or an EMG1 -like polypeptide is by introducing and expressing in a plant a nucleic acid encoding an ELM2- related polypeptide, or a WRKY-related polypeptide, or an EMG1 -like polypeptide, respectively.
  • a preferred method for modulating, preferably increasing, expression of a nucleic acid encoding a GPx-related polypeptide is by introducing and expressing in a plant a nucleic acid encoding a GPx-related polypeptide.
  • any reference hereinafter to a "protein useful in the methods of the invention” is taken to mean an ELM2-related polypeptide, or a WRKY-related polypeptide, or an EMG1 -like polypeptide, or a GPx-related polypeptide, as defined herein.
  • Any reference hereinafter to a "nucleic acid useful in the methods of the invention” is taken to mean a nucleic acid capable of encoding such an ELM2-related polypeptide, or a WRKY-related polypeptide, or an EMG1 -like polypeptide, or a GPx-related polypeptide.
  • any reference to a protein or nucleic acid “useful in the methods of the invention” is to be understood to mean proteins or nucleic acids “useful in the methods, constructs, plants, harvestable parts and products of the invention”.
  • the nucleic acid to be introduced into a plant is any nucleic acid encoding the type of protein which will now be described, hereafter also named "ELM2-related nucleic acid”, or “WRKY-related nucleic acid”, or “EMG1-like nucleic acid”, or “GPx-related nucleic acid”, or “ELM2-related gene”, or " WRKY-related gene", or “EMG1-like gene", or “GPx-related gene”.
  • ELM2-related or "ELM2-related polypeptide” as used herein also intends to include homologues as defined hereunder of "ELM2-related polypeptide".
  • An "ELM2-related polypeptide” as defined herein refers to any polypeptide comprising one or more of the following motifs:
  • the ELM2-related polypeptide comprises in increasing order of preference, at least 2, or all 3 motifs.
  • the homologue of an ELM2-related protein has in increasing order of preference at least 9%, 10%, 1 1 %, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21 %, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31 %, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41 %, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51 %, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61 %, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71 %, 72%, 73%, 74%, 75%, 76%
  • sequence identity is determined using a global alignment algorithm, such as the Needleman Wunsch algorithm in the program GAP (GCG Wisconsin Package, Accelrys), preferably with default parameters and preferably with sequences of mature proteins (i.e. without taking into account secretion signals or transit peptides).
  • sequence identity level is determined by comparison of the polypeptide sequences over the entire length of the sequence of SEQ ID NO: 2 or SEQ ID NO: 4.
  • the sequence identity will generally be higher when only motifs are considered.
  • the motifs in an ELM2-related polypeptide have, in increasing order of preference, at least 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to any one or more of the motifs represented by SEQ ID NO: 93 to SEQ ID NO: 95 (Motifs 1 to 3), provided that at least one of the motifs as represented in SEQ ID NO: 93 to SEQ ID NO: 95 (Motifs 1 to 3) is present in the ELM2-related polypeptide.
  • a method wherein said ELM2-related polypeptide comprises a motif with at least 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to any of the motifs starting with amino acid 271 up to amino acid 320 in SEQ ID NO: 2, starting with amino acid 354 up to amino acid 388 in SEQ ID NO: 2 or starting with amino acid 220 up to amino acid 239 in SEQ ID NO: 2, provided the ELM2-related polypeptide comprises any one or more of the motifs as represented in SEQ ID NO: 93 to SEQ ID NO: 95 (Motifs 1 to 3).
  • the WRKY-related polypeptide as used herein comprises a 'WRKYGQK' motif that is invariant in most WRKY domains and the cysteine and histidine residues of the zinc-finger motif that is conserved in WRKY domains.
  • the WRKY-related polypeptide comprises the zinc-finger motif being a C2H2 zinc finger and comprising one or more WRKY motifs, preferably 'WRKYGQK' motif.
  • the WRKY-related polypeptide comprises a basic motif resembling a large T-antigen-type nuclear localization signal (NLS).
  • the basic motif is NLS comprising 'KKAR' motif.
  • the WRKY-related polypeptide also comprises a coiled-coil motif, preferably a WRKY-specific coiled-coil structure, more preferably a putative type II WRKY-specific coiled-coil structure, identified by 'coils' at the N- termini, and bulky hydrophobic residues that form the characteristic heptad repeat pattern of coiled coils.
  • the WRKY-related polypeptide as used herein may also comprise three motifs as described herein above and exemplified in Figure 8.
  • the WRKY domain is a 60 amino acid region that is defined by the conserved amino acid sequence WRKYGQK at its N-terminal end, together with a zinc-finger- like motif.
  • the WRKY domain is found in one or two copies in a superfamily of plant transcription factors involved in the regulation of various physiological programs that are unique to plants, including pathogen defence, senescence, trichome development and the biosynthesis of secondary metabolites.
  • the WRKY domain binds specifically to the DNA sequence motif (T)(T)TGAC(C/T), which is known as the W box.
  • the invariant TGAC core of the W box is essential for function and WRKY binding.
  • WRKY-related polypeptide also intends to include homologues as defined hereunder of "WRKY-related polypeptide”.
  • the homologue of a WRKY-related polypeptide has in increasing order of preference at least 25%, 26%, 27%, 28%, 29%, 30%, 31 %, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41 %, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51 %, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61 %, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or
  • the overall sequence identity is determined using a global alignment algorithm, such as the Needleman Wunsch algorithm in the program GAP (GCG Wisconsin Package, Accelrys), preferably with default parameters and preferably with sequences of mature proteins (i.e. without taking into account secretion signals or transit peptides).
  • the sequence identity level is determined by comparison of the polypeptide sequences over the entire length of the sequence of SEQ ID NO: 103.
  • WRKY-related polypeptide as used herein has DNA-binding activity.
  • Hybridising sequences useful in the methods of the invention encode a WRKY-related polypeptide as defined herein, having substantially the same biological activity as the polypeptide sequences given in Table A2 of the Examples section.
  • the hybridising sequence is capable of hybridising to the complement of any one of the nucleic acids given in Table A2 of the Examples section, or to a portion of any of these sequences, a portion being as defined above, or the hybridising sequence is capable of hybridising to the complement of a nucleic acid encoding an orthologue or paralogue of any one of the amino acid sequences given in Table A2 of the Examples section.
  • the hybridising sequence is capable of hybridising to the complement of a nucleic acid as represented by SEQ ID NO: 102 or to a portion thereof.
  • the hybridization conditions are of medium stringency, preferably of high stringency, as defined above.
  • EMG1 -like polypeptide refers to any polypeptide comprising an InterPro accession IPR005304 EMG1 domain corresponding to PFAM accession number PF03587.
  • the EMG1 -like polypeptide comprises an EMG1 domain having at least 60%, 61 %, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity with the EMG1 domain from amino acid 81 to 276 in SEQ ID NO: 179.
  • EMG1 -like or EMG1 -like polypeptide as used herein also intends to include homologues as defined hereunder of "EMG1 -like polypeptide".
  • EMG1 -like polypeptide further comprises one of the signature sequences or motifs represented by SEQ ID NO: 286, SEQ ID NO: 287 or SEQ ID NO: 288.
  • the EMG1 -like polypeptide comprises in increasing order of preference, at least 2, or all 3 motifs.
  • the homologue of a EMG1 -like protein has in increasing order of preference at least 25%, 26%, 27%, 28%, 29%, 30%, 31 %, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41 %, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51 %, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61 %, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%
  • the overall sequence identity is determined using a global alignment algorithm, such as the Needleman Wunsch algorithm in the program GAP (GCG Wisconsin Package, Accelrys), preferably with default parameters and preferably with sequences of mature proteins (i.e. without taking into account secretion signals or transit peptides).
  • GAP GCG Wisconsin Package, Accelrys
  • sequence identity level is determined by comparison of the polypeptide sequences over the entire length of the sequence of SEQ ID NO: 179. Compared to overall sequence identity, the sequence identity will generally be higher when only conserved domains or motifs are considered.
  • the motifs in a EMG1 -like polypeptide have, in increasing order of preference, at least 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to any one or more of the motifs represented by SEQ ID NO: 286 to SEQ ID NO: 288 (Motifs 4 to 6).
  • said EMG1 -like polypeptide comprises a conserved motif with at least 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the conserved domain starting with amino acid 92 up to amino acid 141 , amino acid 152 up to amino acid 201 and/or amino acid 232 up to amino acid 281 in SEQ ID NO: 179.
  • a "GPx-related polypeptide” as used and defined herein comprises peroxidase (Px) enzymes, particularly Glutathione peroxidise as described herein under Example 4.
  • the GPx-related polypeptide further comprises thioredoxin-like fold and/or thioredoxin fold protein as described herein under Example 4.
  • “GPx-related polypeptide” as used herein comprises twelve motifs and seven signatures as used and defined herein and further exemplified in Figure 17.
  • a method for improving yield-related traits as provided herein in plants relative to or compared to control plants comprising modulating expression in a plant of a nucleic acid encoding a GPx-related polypeptide as defined herein.
  • the GPx-related polypeptide as used herein comprises one or more of the following signatures 1 to 6:
  • Signature 1 (SEQ ID NO: 373): G[K/R][L/V][I/L]LI[V/E/T]NVA[S/T/A][E/Q/L/Y][C/U]G [L/T]T
  • Signature 4 (SEQ ID NO: 376): VN[T/V]AS[K/R/H/L/Q]C[G/S/A]
  • Signature 5 (SEQ ID NO: 377): LAFPCNQF
  • the GPx-related polypeptide comprises in increasing order of preference, at least 2, at least 3, at least 4, at least 5, or all 6 signatures as defined herein.
  • the GPx-related polypeptide as used herein comprises at least one of the motifs 7, 8 or 9.
  • Motif 8 (SEQ ID NO: 362): L[A/G]FP[S/C]NQF
  • the GPx-related polypeptide as used herein comprises at least one of the motifs represented by Group A comprising motifs 10 to 12:
  • Motif 1 1 (SEQ ID NO: 365):CTRFKAE[Y/F]PIFDKVDVNG[D/N]N[A/T]AP[L/I]YKFLK SSKGG
  • Motif 12 (SEQ ID NO: 366): IKWNF[S/T]KFLVDK[E/D]G[N/H/R]VV[D/E]RYAPTTSPLS
  • the GPx-related polypeptide as used herein comprises at least one of the motifs represented by Group B comprising motifs 13 to 15:
  • Motif 13 (SEQ ID NO: 367): GKVL[L/I]IVNVASQCGLTNSNYT[E/D][L/M][T/S][Q/E]LYE KYKDQG[L/F]EILAFPCNQFGGQEP
  • Motif 14 (SEQ ID NO: 368): CTRFKAE[Y/F]PIFDKVDVNGDN[A/T]AP[L/I]YKFLKSS KGG
  • Motif 15 (SEQ ID NO: 369): FGD[S/G/N]IKWNF[S/T]KFLVDK[E/D]G[N/K/R]VV[D/E]R
  • the GPX-related polypeptide as used herein comprises at least one of the motifs represented by Group C comprising motifs 16 to 18:
  • Motif 16 (SEQ ID NO: 370): FEILAFPCNQFGGQEPGTNEEIVQFACTRFKAEYPIFDK VDVNG Motif 17 (SEQ ID NO: 371):
  • Motif 18 (SEQ ID NO: 372): VHDFTVKDASGKDVDLS[T/V][Y/F]KGKVLLIVNVASQ
  • the GPx-related polypeptide comprises in increasing order of preference, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 1 1 , or all 12 motifs as defined herein.
  • the GPx-related polypeptide or protein has in increasing order of preference at least 25%, 26%, 27%, 28%, 29%, 30%, 31 %, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41 %, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51 %, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61 %, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% overall sequence
  • the overall sequence identity is determined using a global alignment algorithm, such as the Needleman Wunsch algorithm in the program GAP (GCG Wisconsin Package, Accelrys), preferably with default parameters and preferably with sequences of mature proteins (i.e. without taking into account secretion signals or transit peptides).
  • GAP GCG Wisconsin Package, Accelrys
  • sequence identity level is determined by comparison of the polypeptide sequences over the entire length of the sequence of SEQ ID NO: 293, 295 or 297.
  • sequence identity level is determined by comparison of one or more conserved domains or motifs in SEQ ID NO: 293, 295 or 297 with corresponding conserved domains or motifs in other GPx-related polypeptides. Compared to overall sequence identity, the sequence identity will generally be higher when only conserved domains or motifs are considered.
  • the motifs in a GPx-related polypeptide have, in increasing order of preference, at least 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to any one or more of the motifs represented by SEQ ID NO: 361 to SEQ ID NO: 378 (Motifs 7 to 18, Signatures 1 to 6).
  • domain domain
  • signature signature andmotif are defined in the “definitions” section herein.
  • ELM2-related polypeptides the polypeptide sequence which when used in the construction of a phylogenetic tree, such as the one depicted in Figure 4, preferably clusters with the group of ELM2-related polypeptides (in bold) comprising the amino acid sequence represented by SEQ ID NO: 2, indicated as Poptr_ELM2-related, rather than with any other group.
  • ELM2-related polypeptides at least in their native form, typically have transcriptional repression activity, involved in inhibiting chromatin remodeling. Tools and techniques for measuring such activity are well known in the art and e.g. described in Ding et al., Mol. Cell Biol. 2003 Jan; 23(1 ):250-8.
  • ELM2-related polypeptides when expressed in rice according to the methods of the present invention as outlined in Examples 7 and 8, give plants having increased yield related traits, in particular increased biomass and increased seed yield with amongst others increased total weight of seeds, increased number of (filled) seeds, increased fill rate, increased harvest index, increased number of florets.
  • the function of the nucleic acid sequences of the invention is to confer information for synthesis of the ELM2-related polypeptide that increases yield or yield related traits, when such a nucleic acid sequence of the invention is transcribed and translated in a living plant cell.
  • WRKY-related polypeptides when expressed in rice according to the methods of the present invention as outlined in Examples 7 and 8, give plants having increased yield related traits, in particular one or more of emergence vigour (early vigour), total seed yield (Totalwgseeds), fillrate, TKW, number of filled seeds, taller more erect plants (HeightMax), amount of thick roots (RootThickMax).
  • one or more lines showed in one or more parameters an increase of number of florets per panicle on a plant (flowerperpan), increased harvestindex (HI), increased greenness of a plant before flowering (GNbfFlow), increased height of the plant (GravityYMax), increased quick early development (AreaEmer), increased Cycle Time (AreaCycl).
  • the function of the nucleic acid sequences of the invention is to confer information for synthesis of the WRKY-related polypeptide that increases yield or yield related traits, when such a nucleic acid sequence of the invention is transcribed and translated in a living plant cell.
  • EMG1 -like polypeptides the polypeptide sequence which when used in the construction of a phylogenetic tree, such as the one depicted in Figure 13, preferably clusters with the group of EMG1 -like polypeptides comprising the amino acid sequence represented by SEQ ID NO: 179, indicated as P. trichocarpa EMG1 -like, rather than with any other group.
  • EMG1 -like polypeptides at least in their native form, typically have RNA binding activity as e.g. described by Leulliot et al., Nucleic acid Res. 2008, 36(2), 629-39.
  • EMG1 -like polypeptides when expressed in rice according to the methods of the present invention as outlined in Examples 7 and 8, give plants having increased yield related traits, in particular seed yield, such as increased total seed weight, increased harvest index and increased fill rate.
  • the function of the nucleic acid sequences of the invention is to confer information for synthesis of the EMG1 -like polypeptide that increases yield or yield related traits, when such a nucleic acid sequence of the invention is transcribed and translated in a living plant cell.
  • the polypeptide sequence which when used in the construction of a phylogenetic tree, such as the one depicted in Figure 21 preferably clusters with the group of GPx-related polypeptides comprising the amino acid sequence represented by SEQ ID NO: 293, 295 or 297 rather than with any other group.
  • GPx-related polypeptides typically have enzymatic activity, particularly peroxidase activity. Tools and techniques for measuring enzymatic activity, particularly peroxidase activity are known in the art.
  • nucleic acids encoding GPx-related polypeptides when expressed in rice according to the methods of the present invention as outlined in Examples 7 and 8, give plants having increased yield related traits, in particular seed yield, seed size, number total seeds, fillrate, number of filled seeds as well as flowering time.
  • nucleic acid sequences encoding GPx-related polypeptides Another function of the nucleic acid sequences encoding GPx-related polypeptides is to confer information for synthesis of the GPx-related protein that increases yield or yield related traits as described herein, when such a nucleic acid sequence of the invention is transcribed and translated in a living plant cell.
  • ELM2-related polypeptides the present invention is illustrated by transforming plants with the nucleic acid sequence represented by SEQ ID NO: 1 , encoding the polypeptide sequence of SEQ ID NO: 2, and by transforming plants with the nucleic acid sequence represented by SEQ ID NO: 3, encoding the polypeptide sequence of SEQ ID NO: 4.
  • performance of the invention is not restricted to these sequences; the methods of the invention may advantageously be performed using any ELM2-related- encoding nucleic acid or ELM2-related polypeptide as defined herein.
  • Further examples of nucleic acids encoding ELM2-related polypeptides are given in Table A1 of the Examples section herein. Such nucleic acids are useful in performing the methods of the invention.
  • polypeptide sequences given in Table A1 of the Examples section are example sequences of orthologues and paralogues of the ELM2-related polypeptide represented by SEQ ID NO: 2, the terms "orthologues" and “paralogues” being as defined herein. Further orthologues and paralogues may readily be identified by performing a so-called reciprocal blast search as described in the definitions section; where the query sequence is SEQ ID NO: 1 or SEQ ID NO: 2, the second BLAST (back-BLAST) would be against Populus trichocarpa sequences or where the query sequence is SEQ ID NO: 3 or SEQ ID NO: 4, the second BLAST (back-BLAST) would be against Medicago truncatula.
  • said ELM2-related polypeptide comprises an Interpro accession IPR 000949, according to PFAM accession number PF01448 ELM2 domain.
  • said ELM2-related polypeptide comprises an ELM2 domain with at least 30%, 31 %, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41 %, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51 %, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61 %, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the ELM2 domain starting with amino acid
  • nucleic acid encodes the polypeptide represented by any one of SEQ ID NO: 2 or SEQ ID NO: 4 or a homologue thereof which has at least 90% overall sequence identity to SEQ ID NO : 2 or SEQ ID NO: 4.
  • nucleic acid molecule selected from:
  • nucleic acid encoding an ELM2-related polypeptide having in increasing order of preference at least 50%, 51 %, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%,
  • the ELM2-related polypeptide comprises any one or more of the motifs as represented in SEQ ID NO: 93 to SEQ ID NO: 95 (Motifs 1 to 3), and additionally or alternatively comprising one or more motifs having in increasing order of preference at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more sequence identity to any one or more of the
  • nucleic acid molecule which hybridizes with a nucleic acid molecule of (i) to (iii) under high stringency hybridization conditions and preferably confers enhanced yield-related traits relative to control plants.
  • an isolated polypeptide selected from: (i) an amino acid sequence having, in increasing order of preference, at least 50%, 51 %, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61 %, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the polypeptide sequence represented by SEQ ID NO: 2, provided the ELM2-related polypeptide comprises any one or more of the motifs as represented in SEQ ID NO: 93 to SEQ ID NO: 95 (Motifs 1 to 3
  • the present invention is illustrated by transforming plants with the nucleic acid sequence represented by SEQ ID NO: 102, encoding the polypeptide sequence of SEQ ID NO: 103.
  • performance of the invention is not restricted to these sequences; the methods of the invention may advantageously be performed using any WRKY-related polypeptide-encoding nucleic acid or WRKY-related polypeptide as defined herein.
  • nucleic acids encoding WRKY-related polypeptides are given in Table A2 of the Examples section herein. Such nucleic acids are useful in performing the methods of the invention.
  • the polypeptide sequences given in Table A2 of the Examples section are example sequences of orthologues and paralogues of the WRKY-related polypeptide represented by SEQ ID NO: 103, the terms "orthologues” and “paralogues” being as defined herein. Further orthologues and paralogues may readily be identified by performing a so-called reciprocal blast search as described in the definitions section.
  • EMG1 -like polypeptides the present invention is illustrated by transforming plants with the nucleic acid sequence represented by SEQ ID NO: 178, encoding the polypeptide sequence of SEQ ID NO: 179.
  • performance of the invention is not restricted to these sequences; the methods of the invention may advantageously be performed using any EMG1 -like-encoding nucleic acid or EMG1 -like polypeptide as defined herein.
  • nucleic acids encoding EMG1 -like polypeptides are given in Table A3 of the Examples section herein. Such nucleic acids are useful in performing the methods of the invention.
  • the polypeptide acid sequences given in Table A3 of the Examples section are example sequences of orthologues and paralogues of the EMG1 -like polypeptide represented by SEQ ID NO: 179, the terms "orthologues" and "paralogues” being as defined herein.
  • orthologues and paralogues may readily be identified by performing a so-called reciprocal blast search as described in the definitions section; where the query sequence is SEQ ID NO: 178 or SEQ ID NO: 179, the second BLAST (back-BLAST) would be against Populus trichocarpa sequences.
  • the query sequence is SEQ ID NO: 178 or SEQ ID NO: 179
  • the second BLAST back-BLAST
  • GPx-related polypeptides the present invention is illustrated by transforming plants with the nucleic acid sequence represented by SEQ ID NOs 292, 294 and 296 encoding the polypeptide sequence of SEQ ID NO: 293, 295 and 297, respectively.
  • performance of the invention is not restricted to these sequences; the methods of the invention may advantageously be performed using any GPx-related -encoding nucleic acid or GPx-related polypeptide as defined herein.
  • the term "GPx-related” or "GPx-related polypeptide” as used herein also intends to include homologues as defined hereunder of SEQ ID NO: 293, 295 or 297.
  • nucleic acids encoding GPx-related polypeptides are given in Table A4 of the Examples section herein. Such nucleic acids are useful in performing the methods of the invention.
  • the polypeptide sequences given in Table A4 of the Examples section are example sequences of orthologues and paralogues of the GPx-related polypeptide represented by SEQ ID NO: 293, 295 or 297, the terms "orthologues” and “paralogues” being as defined herein. Further orthologues and paralogues may readily be identified by performing a so-called reciprocal blast search as described in the definitions section.
  • the invention also provides hitherto unknown GPx-related-encoding nucleic acids and GPx-related polypeptides useful for conferring enhanced yield-related traits in plants relative to or compared to control plants.
  • Nucleic acid variants may also be useful in practising the methods of the invention.
  • Examples of such variants include nucleic acids encoding homologues and derivatives of any one of the amino acid sequences given in Table A1 to A4 of the Examples section, the terms "homologue” and “derivative” being as defined herein.
  • Also useful in the methods, constructs, plants, harvestable parts and products of the invention are nucleic acids encoding homologues and derivatives of orthologues or paralogues of any one of the amino acid sequences given in Table A1 to A4 of the Examples section.
  • Homologues and derivatives useful in the methods of the present invention have substantially the same biological and functional activity as the unmodified protein from which they are derived.
  • Further variants useful in practising the methods of the invention are variants in which codon usage is optimised or in which miRNA target sites are removed.
  • nucleic acid variants useful in practising the methods of the invention include portions of nucleic acids encoding ELM2-related polypeptides, or WRKY-related polypeptides, or EMG1 -like polypeptides, or GPx-related polypeptides, nucleic acids hybridising to nucleic acids encoding ELM2-related polypeptides, or WRKY-related polypeptides, or EMG1 -like polypeptides, or GPx-related polypeptides, splice variants of nucleic acids encoding ELM2-related polypeptides, or WRKY-related polypeptides, or EMG1 -like polypeptides, or GPx-related polypeptides, allelic variants of nucleic acids encoding ELM2-related polypeptides, or WRKY-related polypeptides, or EMG1-like polypeptides, or GPx-related polypeptides and variants of nucleic acids encoding ELM2-
  • nucleic acids encoding ELM2-related polypeptides, or WRKY-related polypeptides, or EMG1 -like polypeptides, or GPx-related polypeptides need not be full-length nucleic acids, since performance of the methods of the invention does not rely on the use of full-length nucleic acid sequences.
  • a method for enhancing yield-related traits in plants comprising introducing and expressing in a plant a portion of any one of the nucleic acid sequences given in Table A1 to A4 of the Examples section, or a portion of a nucleic acid encoding an orthologue, paralogue or homologue of any of the amino acid sequences given in Table A1 to A4 of the Examples section.
  • a portion of a nucleic acid may be prepared, for example, by making one or more deletions to the nucleic acid.
  • the portions may be used in isolated form or they may be fused to other coding (or non-coding) sequences in order to, for example, produce a protein that combines several activities. When fused to other coding sequences, the resultant polypeptide produced upon translation may be bigger than that predicted for the protein portion.
  • portions useful in the methods, constructs, plants, harvestable parts and products of the invention encode an ELM2-related polypeptide as defined herein, and have substantially the same biological activity as the amino acid sequences given in Table A1 of the Examples section.
  • the portion is a portion of any one of the nucleic acids given in Table A1 of the Examples section, or is a portion of a nucleic acid encoding an orthologue or paralogue of any one of the amino acid sequences given in Table A1 of the Examples section.
  • the portion is at least 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1 100, 1 150, 1200, 1250, 1300, 1350, 1400, 1450, 1500, 1550, 1600, 1650, 1700, 1750, 1800, 1850, 1900, 1950, 2000, 2050, 2100, 2150, 2200, 2250, 2300, 2350, 2400, 2450, 2500, 2550, 2600, 2650, 2700, 2750, 2800, 2850, 2900 consecutive nucleotides in length, the consecutive nucleotides being of any one of the nucleic acid sequences given in Table A1 of the Examples section, or of a nucleic acid encoding an orthologue or paralogue of any one of the amino acid sequences given in Table A1 of the Examples section.
  • the portion is a portion of the nucleic acid of SEQ ID NO: 1 or a portion of the nucleic acid of SEQ ID NO: 3.
  • the portion encodes a fragment of an amino acid sequence which, when used in the construction of a phylogenetic tree, such as the one depicted in Figure 4, clusters with the group of ELM2-related polypeptides as indicated in bold, comprising the amino acid sequences represented by SEQ ID NO: 2 and 4, rather than with any other group, and comprises any one or more of the motifs as represented by SEQ ID NO: 93 to SEQ ID NO: 95, and/or has transcriptional repression biological activity, and/or has at least 9% sequence identity to SEQ ID NO: 2.
  • portions useful in the methods, constructs, plants, harvestable parts and products of the invention encode a WRKY-related polypeptide as defined herein, and have substantially the same biological activity as the amino acid sequences given in Table A2 of the Examples section.
  • the portion is a portion of any one of the nucleic acids given in Table A2 of the Examples section, or is a portion of a nucleic acid encoding an orthologue or paralogue of any one of the amino acid sequences given in Table A2 of the Examples section.
  • the portion is at least 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1 100, 1 150, 1200, 1250, 1300, 1450, 1500, 1550, 1600, 1650, 1700, 1750, 1800, 1850, 1900, 1950, 2000 consecutive nucleotides in length, the consecutive nucleotides being of any one of the nucleic acid sequences given in Table A2 of the Examples section, or of a nucleic acid encoding an orthologue or paralogue of any one of the amino acid sequences given in Table A2 of the Examples section.
  • the portion is a portion of the nucleic acid of SEQ ID NO: 102.
  • portions useful in the methods, constructs, plants, harvestable parts and products of the invention encode a EMG1 -like polypeptide as defined herein, and have substantially the same biological activity as the amino acid sequences given in Table A3 of the Examples section.
  • the portion is a portion of any one of the nucleic acids given in Table A3 of the Examples section, or is a portion of a nucleic acid encoding an orthologue or paralogue of any one of the amino acid sequences given in Table A3 of the Examples section.
  • the portion is at least 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1 100, 1 150, 1200, 1250, 1300, 1350, 1400, 1450, 1500, 1550, 1600 consecutive nucleotides in length, the consecutive nucleotides being of any one of the nucleic acid sequences given in Table A3 of the Examples section, or of a nucleic acid encoding an orthologue or paralogue of any one of the amino acid sequences given in Table A3 of the Examples section. Most preferably the portion is a portion of the nucleic acid of SEQ ID NO: 178.
  • the portion encodes a fragment of an amino acid sequence which, when used in the construction of a phylogenetic tree, such as the one depicted in Figure 13, clusters with the group of EMG1 -like polypeptides comprising the amino acid sequence represented by SEQ ID NO: 179, indicated as P. trichocarpa EMG1 -like, rather than with any other group, and/or comprises any of the motifs 4 to 6, and/or has RNA binding activity, and/or has at least 80% sequence identity to SEQ ID NO: 179.
  • portions useful in the methods, constructs, plants, harvestable parts and products of the invention encode a GPx-related polypeptide as defined herein or at least part thereof, and have substantially the same biological activity as the amino acid sequences given in Table A4 of the Examples section.
  • the portion is a portion of any one of the nucleic acids given in Table A4 of the Examples section, or is a portion of a nucleic acid encoding an orthologue or paralogue of any one of the amino acid sequences given in Table A4 of the Examples section.
  • the portion is at least 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000 consecutive nucleotides in length, the consecutive nucleotides being of any one of the nucleic acid sequences given in Table A4 of the Examples section, or of a nucleic acid encoding an orthologue or paralogue of any one of the amino acid sequences given in Table A4 of the Examples section.
  • the portion is a portion of the nucleic acid of SEQ ID NO: 292, 294 or 296.
  • the portion encodes a fragment of an amino acid sequence which comprises one or more motifs selected from a group consisting of motifs 7 to 18 as defined herein and/or one or more signatures 1 to 6 as defined herein, and/or has biological activity particularly enzymatic activity, more particularly peroxidase activity, and/or has at least 50% sequence identity to SEQ ID NO: 293, 295 or 297.
  • nucleic acid variant useful in the methods, constructs, plants, harvestable parts and products of the invention is a nucleic acid capable of hybridising, under reduced stringency conditions, preferably under stringent conditions, with a nucleic acid encoding an ELM2- related polypeptide, or a WRKY-related polypeptide, or an EMG1 -like polypeptide, or a GPx-related polypeptide, as defined herein, or with a portion as defined herein.
  • a method for enhancing yield-related traits in plants comprising introducing and expressing in a plant a nucleic acid capable of hybridizing to the complement of a nucleic acid encoding any one of the proteins given in Table A1 to A4 of the Examples section, or to the complement of a nucleic acid encoding an orthologue, paralogue or homologue of any one of the proteins given in Table A1 to A4 of the Examples section.
  • Hybridising sequences useful in the methods, constructs, plants, harvestable parts and products of the invention encode an ELM2-related polypeptide, or a WRKY-related polypeptide, or an EMG1 -like polypeptide, or a GPx-related polypeptide, as defined herein, having substantially the same biological activity as the amino acid sequences given in Table A1 to A4 of the Examples section.
  • the hybridising sequence is capable of hybridising to the complement of a nucleic acid encoding any one of the proteins given in Table A1 to A4 of the Examples section, or to a portion of any of these sequences, a portion being as defined herein, or the hybridising sequence is capable of hybridising to the complement of a nucleic acid encoding an orthologue or paralogue of any one of the amino acid sequences given in Table A1 to A4 of the Examples section.
  • the hybridising sequence is most preferably capable of hybridising to the complement of a nucleic acid as represented by SEQ ID NO: 1 or to a portion thereof.
  • the hybridization conditions are of medium stringency, preferably of high stringency, as defined above.
  • the hybridising sequence encodes a polypeptide with an amino acid sequence which, when full-length and used in the construction of a phylogenetic tree, such as the one depicted in Figure 4, clusters with the group of ELM2-related polypeptides as indicated in bold, comprising the amino acid sequences represented by SEQ ID NO: 2 and 4, rather than with any other group, and comprises any one or more of the motifs as represented by SEQ ID NO: 93 to SEQ ID NO: 95, and/or has transcriptional repression biological activity, and/or has at least 9% sequence identity to SEQ ID NO: 2.
  • the hybridising sequence most preferably is capable of hybridising to the complement of a nucleic acid as represented by SEQ ID NO: 102 or to a portion thereof.
  • the hybridization conditions are of medium stringency, preferably of high stringency, as defined above.
  • the hybridising sequence most preferably is capable of hybridising to the complement of a nucleic acid as represented by SEQ ID NO: 178 or to a portion thereof.
  • the hybridization conditions are of medium stringency, preferably of high stringency, as defined above.
  • the hybridising sequence encodes a polypeptide with an amino acid sequence which, when full-length and used in the construction of a phylogenetic tree, such as the one depicted in Figure 13, clusters with the group of EMG1 -like polypeptides comprising the amino acid sequence represented by SEQ ID NO: 179, indicated as P. trichocarpa EMG1 - like, rather than with any other group, and/or comprises any of the motifs 4 to 6, and/or has RNA binding activity, and/or has at least 80% sequence identity to SEQ ID NO: 179.
  • the hybridising sequence is most preferably capable of hybridising to the complement of a nucleic acid encoding the polypeptide as represented by SEQ ID NO: 293, 295 or 297 or to a portion thereof.
  • the hybridization conditions are of medium stringency, preferably of high stringency, as defined herein.
  • the hybridising sequence encodes a polypeptide with an amino acid sequence which comprises one or more motifs selected from a group consisting of motifs 7 to 18 as defined herein and/or one or more signatures 1 to 6 as defined herein, and/or has biological activity particularly enzymatic activity, more particularly peroxidase activity, and/or has at least 50% sequence identity to SEQ ID NO: 293, 295 or 297.
  • nucleic acid variant useful in the methods of the invention is a splice variant encoding an ELM2-related polypeptide, or a WRKY-related polypeptide, or an EMG1 -like polypeptide, or a GPx-related polypeptide, as defined hereinabove, a splice variant being as defined herein.
  • a method for enhancing yield-related traits in plants comprising introducing and expressing in a plant a splice variant of a nucleic acid encoding any one of the proteins given in Table A1 to A4 of the Examples section, or a splice variant of a nucleic acid encoding an orthologue, paralogue or homologue of any of the amino acid sequences given in Table A1 to A4 of the Examples section.
  • preferred splice variants are splice variants of a nucleic acid represented by SEQ ID NO: 1 , or a splice variant of a nucleic acid encoding an orthologue or paralogue of SEQ ID NO: 2.
  • the amino acid sequence encoded by the splice variant when used in the construction of a phylogenetic tree, such as the one depicted in Figure 4, clusters with the group of ELM2-related polypeptides as indicated in bold, comprising the amino acid sequences represented by SEQ ID NO: 2 and 4, rather than with any other group, and comprises any one or more of the motifs as represented by SEQ ID NO: 93 to SEQ ID NO: 95, and/or has transcriptional repression biological activity, and/or has at least 9% sequence identity to SEQ ID NO: 2.
  • preferred splice variants are splice variants of a nucleic acid represented by SEQ ID NO: 102, or a splice variant of a nucleic acid encoding an orthologue or paralogue of SEQ ID NO: 103.
  • preferred splice variants are splice variants of a nucleic acid represented by SEQ ID NO: 178, or a splice variant of a nucleic acid encoding an orthologue or paralogue of SEQ ID NO: 179.
  • the amino acid sequence encoded by the splice variant when used in the construction of a phylogenetic tree, such as the one depicted in Figure 13, clusters with the group of EMG1 -like polypeptides comprising the amino acid sequence represented by SEQ ID NO: 179 rather than with any other group, and/or comprises any of the motifs 4 to 6, and/or has RNA binding activity, and/or has at least 80% sequence identity to SEQ ID NO: 179.
  • preferred splice variants are splice variants of a nucleic acid represented by SEQ ID NO: 292, 294 or 296, or a splice variant of a nucleic acid encoding an orthologue or paralogue of SEQ ID NO: 293.
  • the amino acid sequence encoded by the splice variant comprises one or more motifs selected from a group consisting of motifs 7 to 18 as defined herein and/or one or more signatures 1 to 6 as defined herein, and/or has biological activity particularly enzymatic activity, more particularly peroxidase activity, and/or has at least 50% sequence identity to SEQ ID NO: 293, 295 or 297.
  • nucleic acid variant useful in performing the methods of the invention is an allelic variant of a nucleic acid encoding an ELM2-related polypeptide, or a WRKY-related polypeptide, or an EMG1 -like polypeptide, or a GPx-related polypeptide, as defined hereinabove, an allelic variant being as defined herein.
  • a method for enhancing yield-related traits in plants comprising introducing and expressing in a plant an allelic variant of a nucleic acid encoding any one of the proteins given in Table A1 to A4 of the Examples section, or comprising introducing and expressing in a plant an allelic variant of a nucleic acid encoding an orthologue, paralogue or homologue of any of the amino acid sequences given in Table A1 to A4 of the Examples section.
  • allelic variants useful in the methods of the present invention have substantially the same biological activity as the ELM2-related polypeptide of SEQ ID NO: 2 and any of the amino acids depicted in Table A1 of the Examples section.
  • Allelic variants exist in nature, and encompassed within the methods of the present invention is the use of these natural alleles.
  • the allelic variant is an allelic variant of SEQ ID NO: 1 or an allelic variant of a nucleic acid encoding an orthologue or paralogue of SEQ ID NO: 2.
  • the amino acid sequence encoded by the allelic variant when used in the construction of a phylogenetic tree, such as the one depicted in Figure 4, clusters with the group of ELM2-related polypeptides as indicated in bold, comprising the amino acid sequences represented by SEQ ID NO: 2 and 4, rather than with any other group, and comprises any one or more of the motifs as represented by SEQ ID NO: 93 to SEQ ID NO: 95, and/or has transcriptional repression biological activity, and/or has at least 9% sequence identity to SEQ ID NO: 2.
  • the polypeptides encoded by allelic variants useful in the methods of the present invention have substantially the same biological activity as the WRKY-related polypeptide of SEQ ID NO: 103 and any of the amino acids depicted in Table A2 of the Examples section.
  • Allelic variants exist in nature, and encompassed within the methods of the present invention is the use of these natural alleles.
  • the allelic variant is an allelic variant of SEQ ID NO: 102 or an allelic variant of a nucleic acid encoding an orthologue or paralogue of SEQ ID NO: 103.
  • the polypeptides encoded by allelic variants useful in the methods of the present invention have substantially the same biological activity as the EMG1 -like polypeptide of SEQ ID NO: 179 and any of the amino acids depicted in Table A3 of the Examples section.
  • Allelic variants exist in nature, and encompassed within the methods of the present invention is the use of these natural alleles.
  • the allelic variant is an allelic variant of SEQ ID NO: 178 or an allelic variant of a nucleic acid encoding an orthologue or paralogue of SEQ ID NO: 179.
  • the amino acid sequence encoded by the allelic variant when used in the construction of a phylogenetic tree, such as the one depicted in Figure 13, clusters with the group of EMG1 -like polypeptides comprising the amino acid sequence represented by SEQ ID NO: 179 rather than with any other group, and/or comprises any of the motifs 4 to 6, and/or has RNA binding activity, and/or has at least 80% sequence identity to SEQ ID NO: 179.
  • the polypeptides encoded by allelic variants useful in the methods of the present invention have substantially the same biological activity as the GPx-related polypeptide of SEQ ID NO: 293, 295, or 297 and any of the amino acid sequences depicted in Table A4 of the Examples section.
  • Allelic variants exist in nature, and encompassed within the methods of the present invention is the use of these natural alleles.
  • the allelic variant is an allelic variant of SEQ ID NO: 292, 294 or 296 or an allelic variant of a nucleic acid encoding an orthologue or paralogue of SEQ ID NO: 293, 295, or 297.
  • the amino acid sequence encoded by the allelic variant comprises one or more motifs selected from a group consisting of motifs 7 to 18 as defined herein and/or one or more signatures 1 to 6 as defined herein, and/or has biological activity particularly enzymatic activity, more particularly peroxidase activity, and/or has at least 50% sequence identity to SEQ ID NO: 293, 295, or 297.
  • Gene shuffling or directed evolution may also be used to generate variants of nucleic acids encoding ELM2-related polypeptides, or WRKY-related polypeptides, or EMG1-like polypeptides, or GPx-related polypeptides, as defined above; the term "gene shuffling" being as defined herein.
  • a method for enhancing yield-related traits in plants comprising introducing and expressing in a plant a variant of a nucleic acid encoding any one of the proteins given in Table A1 to A4 of the Examples section, or comprising introducing and expressing in a plant a variant of a nucleic acid encoding an orthologue, paralogue or homologue of any of the amino acid sequences given in Table A1 to A4 of the Examples section, which variant nucleic acid is obtained by gene shuffling.
  • the amino acid sequence encoded by the variant nucleic acid obtained by gene shuffling when used in the construction of a phylogenetic tree such as the one depicted in Figure 4, preferably clusters with the group of ELM2-related polypeptides as indicated in bold, comprising the amino acid sequences represented by SEQ ID NO: 2 and 4, rather than with any other group, and comprises any one or more of the motifs as represented by SEQ ID NO: 93 to SEQ ID NO: 95, and/or has transcriptional repression biological activity, and/or has at least 9% sequence identity to SEQ ID NO: 2.
  • the amino acid sequence encoded by the variant nucleic acid obtained by gene shuffling when used in the construction of a phylogenetic tree, such as the one depicted in Figure 13, preferably clusters with the group of EMG1 -like polypeptides comprising the amino acid sequence represented by SEQ ID NO: 179 rather than with any other group, and/or comprises any of the motifs 4 to 6, and/or has RNA binding activity, and/or has at least 80% sequence identity to SEQ ID NO: 179.
  • the amino acid sequence encoded by the variant nucleic acid obtained by gene shuffling preferably comprises one or more motifs selected from a group consisting of motifs 7 to 18 as defined herein and/or one or more signatures 1 to 6 as defined herein, and/or has biological activity particularly enzymatic activity, more particularly peroxidase activity, and/or has at least 50% sequence identity to SEQ ID NO: 293, 295 or 297.
  • nucleic acid variants may also be obtained by site-directed mutagenesis. Several methods are available to achieve site-directed mutagenesis, the most common being PCR based methods (Current Protocols in Molecular Biology. Wiley Eds.).
  • ELM2-related polypeptides differing from the sequence of SEQ ID NO: 2 by one or several amino acids (substitution(s), insertion(s) and/or deletion(s) as defined above) may equally be useful to increase the yield of plants in the methods and constructs and plants of the invention.
  • Nucleic acids encoding ELM2-related polypeptides may be derived from any natural or artificial source.
  • the nucleic acid may be modified from its native form in composition and/or genomic environment through deliberate human manipulation.
  • the ELM2-related polypeptide-encoding nucleic acid is from a plant, further preferably from a dicotyledonous plant, more preferably from the family Salicaceae, most preferably the nucleic acid is from Populus trichocarpa.
  • the ELM2-related polypeptide-encoding nucleic acid is from the family Fabaceae, most preferably the nucleic acid is from Medicago truncatula.
  • the nucleic acid from Medicago truncatula is as represented by SEQ ID NO: 1.
  • WRKY-related polypeptides differing from the sequence of SEQ ID NO: 103 by one or several amino acids (substitution(s), insertion(s) and/or deletion(s) as defined above) may equally be useful to increase the yield of plants in the methods and constructs and plants of the invention.
  • Nucleic acids encoding WRKY-related polypeptides may be derived from any natural or artificial source. The nucleic acid may be modified from its native form in composition and/or genomic environment through deliberate human manipulation.
  • the WRKY-related polypeptide-encoding nucleic acid is from a plant, preferably from a dicotyledonous plant, further preferably from a leguminous plant, more preferably from the genus Medicago, most preferably from Medicago truncatula.
  • the nucleic acid from Medicago truncatula is as represented by SEQ ID NO: 102.
  • EMG1 -like polypeptides differing from the sequence of SEQ ID NO: 179 by one or several amino acids (substitution(s), insertion(s) and/or deletion(s) as defined above) may equally be useful to increase the yield of plants in the methods and constructs and plants of the invention.
  • Nucleic acids encoding EMG1 -like polypeptides may be derived from any natural or artificial source.
  • the nucleic acid may be modified from its native form in composition and/or genomic environment through deliberate human manipulation.
  • the EMG1 -like polypeptide-encoding nucleic acid is from a plant, further preferably from a dicotyledonous plant, more preferably from the family Salicaceae, most preferably the nucleic acid is from Populus trichocarpa.
  • the nucleic acid from Populus trichocarpa is as represented by SEQ ID NO: 178.
  • GPx-related polypeptides differing from the sequence of SEQ ID NO: 293, 295 or 297 by one or several amino acids (substitution(s), insertion(s) and/or deletion(s) as defined herein) may equally be useful to increase the yield of plants in the methods and constructs and plants of the invention.
  • Nucleic acids encoding GPx-related polypeptides may be derived from any natural or artificial source. The nucleic acid may be modified from its native form in composition and/or genomic environment through deliberate human manipulation.
  • the GPx-related polypeptide-encoding nucleic acid is from a plant, further preferably from a monocotyledonous plant, more preferably from the family Poaceae, most preferably the nucleic acid is from Oryza sativa.
  • the nucleic acid from Oryza sativa is as represented by SEQ ID NO: 292.
  • the GPx-related polypeptide-encoding nucleic acid is from a plant, further preferably from a dicotyledonous plant, more preferably from the family Salicaceae, more preferably from the genus Populus, most preferably the nucleic acid is from Populus trichocarpa.
  • the nucleic acid from Populus trichocarpa is as represented by SEQ ID NO: 294 or 296.
  • the present invention extends to recombinant chromosomal DNA comprising a nucleic acid sequence useful in the methods of the invention, wherein said nucleic acid is present in the chromosomal DNA as a result of recombinant methods, i.e. said nucleic acid is not in the chromosomal DNA in its natural genetic environment.
  • the recombinant chromosomal DNA of the invention is comprised in a plant cell. DNA comprised within a cell, particularly a cell with cell walls like a plant cell, is better protected from degradation than a bare nucleic acid sequence. The same holds true for a DNA construct comprised in a host cell, for example a plant cell.
  • Performance of the methods of the invention gives plants having enhanced yield-related traits.
  • performance of the methods of the invention gives plants having increased early vigour and/or increased yield, especially increased biomass and/or increased seed yield relative to or compared to control plants.
  • the terms “early vigour” “yield” and “seed yield” are described in more detail in the “definitions” section herein.
  • Reference herein to enhanced yield-related traits is taken to mean an increase in early vigour and/or in biomass (weight) of one or more parts of a plant, which may include (i) aboveground parts and preferably aboveground harvestable parts and/or (ii) parts below ground and preferably harvestable below ground.
  • harvestable parts are seeds, and performance of the methods of the invention results in plants having increased seed yield relative to or compared to the seed yield of control plants.
  • harvestable parts are aboveground biomass, and performance of the methods of the invention results in plants having increased biomass relative to or compared to the biomass of control plants.
  • the present invention provides a method for increasing yield-related traits, especially biomass and/or seed yield of plants, relative or compared to control plants, which method comprises modulating expression in a plant of a nucleic acid encoding an ELM2-related polypeptide as defined herein.
  • the terms “relative to” and “compared to” can be used interchangeably.
  • the present invention also provides a method for increasing yield-related traits, especially seed yield of plants, relative to or compared to control plants, which method comprises modulating expression in a plant of a nucleic acid encoding a WRKY-related polypeptide as defined herein.
  • the terms “relative to” and “compared to” can be used interchangeably.
  • the present invention also provides a method for increasing yield-related traits, especially seed yield of plants, relative to control plants, which method comprises modulating expression in a plant of a nucleic acid encoding an EMG1 -like polypeptide as defined herein.
  • the terms “relative to” and “compared to” can be used interchangeably.
  • the present invention also provides a method for increasing yield-related traits, especially biomass and/or seed yield of plants, relative to or compared to control plants, which method comprises modulating expression in a plant of a nucleic acid encoding a GPx-related polypeptide as defined herein.
  • performance of the methods of the invention gives plants having an increased growth rate relative to control plants. Therefore, according to the present invention, there is provided a method for increasing the growth rate of plants, which method comprises modulating expression in a plant of a nucleic acid encoding an ELM2-related polypeptide, or a WRKY-related polypeptide, or an EMG1 -like polypeptide, or a GPx-related polypeptide, as defined herein.
  • Performance of the methods of the invention gives plants grown under non-stress conditions or under mild drought conditions increased yield-related traits relative to control plants grown under comparable conditions. Therefore, according to the present invention, there is provided a method for increasing yield-related traits and/or yield in plants grown under non-stress conditions or under mild drought conditions, which method comprises modulating expression in a plant of a nucleic acid encoding an ELM2-related polypeptide, or a WRKY-related polypeptide, or an EMG1 -like polypeptide, or a GPx-related polypeptide.
  • performance of the methods of the invention gives plants grown under abiotic conditions abiotic stress resistance.
  • Performance of the methods of the invention gives plants grown under conditions of drought, increased yield-related traits relative to control plants grown under comparable conditions. Therefore, according to the present invention, there is provided a method for increasing yield-related traits and/or yield in plants grown under conditions of drought which method comprises modulating expression in a plant of a nucleic acid encoding an ELM2- related polypeptide, or a WRKY-related polypeptide, or an EMG1 -like polypeptide, or a GPx-related polypeptide.
  • Performance of the methods of the invention gives plants grown under conditions of nutrient deficiency, particularly under conditions of nitrogen deficiency, increased yield-related traits relative to control plants grown under comparable conditions. Therefore, according to the present invention, there is provided a method for increasing yield-related traits and/or yield in plants grown under conditions of nutrient deficiency, which method comprises modulating expression in a plant of a nucleic acid encoding an ELM2-related polypeptide, or a WRKY- related polypeptide, or an EMG1 -like polypeptide, or a GPx-related polypeptide.
  • Performance of the methods of the invention gives plants grown under conditions of salt stress, increased yield-related traits relative to control plants grown under comparable conditions. Therefore, according to the present invention, there is provided a method for increasing yield-related traits and/ or yield in plants grown under conditions of salt stress, which method comprises modulating expression in a plant of a nucleic acid encoding an ELM2-related polypeptide, or a WRKY-related polypeptide, or an EMG1 -like polypeptide, or a GPx-related polypeptide.
  • the invention also provides genetic constructs and vectors to facilitate introduction and/or expression in plants of nucleic acids encoding ELM2-related polypeptides, or WRKY-related polypeptides, or EMG1 -like polypeptides, or GPx-related polypeptides.
  • the gene constructs may be inserted into vectors, which may be commercially available, suitable for transforming into plants or host cells and suitable for expression of the gene of interest in the transformed cells.
  • the invention also provides use of a gene construct as defined herein in the methods of the invention.
  • the present invention provides a construct comprising:
  • the nucleic acid encoding an ELM2-related polypeptide, or a WRKY-related polypeptide, or an EMG1 -like polypeptide, or a GPx-related polypeptide is as defined above.
  • control sequence and “termination sequence” are as defined herein.
  • the genetic construct of the invention may be comprised in a host cell, plant cell, seed, agricultural product or plant.
  • Plants or host cells are transformed with a genetic construct such as a vector or an expression cassette comprising any of the nucleic acids described above.
  • the invention furthermore provides plants or host cells transformed with a construct as described above.
  • the invention provides plants transformed with a construct as described above, which plants have increased yield-related traits as described herein.
  • the genetic construct of the invention confers increased yield or yield related traits to a plant when it has been introduced into said plant, which plant expresses the nucleic acid encoding the ELM2-related polypeptide, or the WRKY-related polypeptide, or the EMG1 -like polypeptide, or the GPx-related polypeptide, comprised in the genetic construct.
  • the genetic construct of the invention confers increased yield or yield related traits(s) to a plant comprising plant cells in which the construct has been introduced, which plant cells express the nucleic acid encoding the ELM2-related polypeptide, or the WRKY-related polypeptide, or the EMG1 -like polypeptide, or the GPx- related polypeptide, comprised in the genetic construct.
  • the promoter in such a genetic construct may be a non-native promoter to the nucleic acid described above, i.e. a promoter not regulating the expression of said nucleic acid in its native surrounding.
  • the expression cassettes or the genetic construct of the invention may be comprised in a host cell, plant cell, seed, agricultural product or plant.
  • sequence of interest is operably linked to one or more control sequences (at least to a promoter).
  • any type of promoter may be used to drive expression of the nucleic acid sequence, but preferably the promoter is of plant origin.
  • a constitutive promoter is particularly useful in the methods. See the "Definitions" section herein for definitions of the various promoter types. With respect to WRKY-related polypeptides, and GPx-related polypeptides, also useful in the methods of the invention is a root-specific promoter.
  • the constitutive promoter is preferably a ubiquitous constitutive promoter of medium strength. More preferably, it is a plant derived promoter, e.g. a promoter of plant chromosomal origin, such as a GOS2 promoter or a promoter of substantially the same strength and having substantially the same expression pattern (a functionally equivalent promoter), more preferably the promoter is the GOS2 promoter from rice.
  • a plant derived promoter e.g. a promoter of plant chromosomal origin, such as a GOS2 promoter or a promoter of substantially the same strength and having substantially the same expression pattern (a functionally equivalent promoter)
  • the promoter is the GOS2 promoter from rice.
  • the constitutive promoter is represented by a nucleic acid sequence substantially similar to SEQ ID NO: 97, or to SEQ ID NO: 174, or to SEQ ID NO: 289, or to SEQ ID NO: 379, most preferably the constitutive promoter is as represented by SEQ ID NO: 97, or SEQ ID NO: 174, or SEQ ID NO: 289, or SEQ ID NO: 379. See the "Definitions" section herein for further examples of constitutive promoters.
  • the nucleic acid encoding a WRKY-related polypeptide, or a GPx-related polypeptide is operably linked to a root-specific promoter.
  • the root-specific promoter is preferably an RCc3 promoter (Plant Mol Biol.
  • the RCc3 promoter is from rice, further preferably the RCc3 promoter is represented by a nucleic acid sequence substantially similar to SEQ ID NO: 175, or to SEQ ID NO: 380, most preferably the promoter is as represented by SEQ ID NO: 175, or SEQ ID NO: 380. Examples of other root-specific promoters which may also be used to perform the methods of the invention are shown in Table 2b in the "Definitions" section.
  • ELM2-related polypeptides With respect to ELM2-related polypeptides, it should be clear that the applicability of the present invention is not restricted to the ELM2-related polypeptide-encoding nucleic acid represented by SEQ ID NO: 1 or SEQ ID NO: 3, nor is the applicability of the invention restricted to expression of an ELM2-related polypeptide-encoding nucleic acid when driven by a constitutive promoter.
  • one or more terminator sequences may be used in the construct introduced into a plant.
  • the construct comprises an expression cassette comprising a GOS2 promoter, substantially similar to SEQ ID NO: 97, operably linked to the nucleic acid encoding the ELM2-related polypeptide.
  • the construct comprises a zein terminator (t-zein) linked to the 3' end of the ELM2-related coding sequence.
  • the expression cassette comprises a sequence having in increasing order of preference at least 95%, at least 96%, at least 97%, at least 98%, at least 99% identity to the sequence represented by SEQ ID NO: 96 (pPRO::ELM2-related::t-zein sequence).
  • sequences encoding selectable markers may be present on the construct introduced into a plant.
  • the applicability of the present invention is not restricted to the WRKY-related polypeptide-encoding nucleic acid represented by SEQ ID NO: 102, nor is the applicability of the invention restricted to expression of a WRKY-related polypeptide-encoding nucleic acid when driven by a constitutive promoter, or when driven by a root-specific promoter.
  • one or more terminator sequences may be used in the construct introduced into a plant.
  • the construct comprises an expression cassette comprising a GOS2 promoter, substantially similar to SEQ ID NO: 174, operably linked to the nucleic acid encoding WRKY-related polypeptide.
  • the construct comprises a zein terminator (t-zein) linked to the 3' end of the WRKY-related polypeptide coding sequence.
  • t-zein zein terminator
  • one or more sequences encoding selectable markers may be present on the construct introduced into a plant.
  • EMG1 -like polypeptides With respect to EMG1 -like polypeptides, it should be clear that the applicability of the present invention is not restricted to the EMG1 -like polypeptide-encoding nucleic acid represented by SEQ ID NO: 178, nor is the applicability of the invention restricted to expression of a EMG1 -like polypeptide-encoding nucleic acid when driven by a constitutive promoter.
  • one or more terminator sequences may be used in the construct introduced into a plant.
  • the construct comprises an expression cassette comprising a GOS2 promoter, substantially similar to SEQ ID NO: 289, operably linked to the nucleic acid encoding the EMG1 -like polypeptide.
  • the construct comprises a zein terminator (t-zein) linked to the 3' end of the EMG1 -like coding sequence.
  • sequences encoding selectable markers may be present on the construct introduced into a plant.
  • GPx-related polypeptides With respect to GPx-related polypeptides, it should be clear that the applicability of the present invention is not restricted to the GPx-related polypeptide-encoding nucleic acid represented by SEQ ID NO: 292, 294 or 296, nor is the applicability of the invention restricted to the rice GOS2 promoter when expression of a GPx-related polypeptide- encoding nucleic acid is driven by a constitutive promoter, or when driven by a root-specific promoter.
  • one or more terminator sequences may be used in the construct introduced into a plant. Those skilled in the art will be aware of terminator sequences that may be suitable for use in performing the invention.
  • the construct comprises an expression cassette comprising a GOS2 promoter, substantially similar to SEQ ID NO: 379, operably linked to the nucleic acid encoding the GPx-related polypeptide. More preferably, the construct furthermore comprises a zein terminator (t-zein) linked to the 3' end of the GPx- related coding sequence.
  • the modulated expression is increased expression.
  • a preferred method for modulating expression of a nucleic acid encoding an ELM2-related polypeptide, or a WRKY-related polypeptide, or an EMG1 -like polypeptide, or a GPx-related polypeptide is by introducing and expressing in a plant a nucleic acid encoding an ELM2-related polypeptide, or a WRKY-related polypeptide, or an EMG1 -like polypeptide, or a GPx-related polypeptide, respectively; however the effects of performing the method, i.e. enhancing yield-related traits may also be achieved using other well known techniques, including but not limited to T-DNA activation tagging, TILLING, homologous recombination. A description of these techniques is provided in the definitions section.
  • the invention also provides a method for the production of transgenic plants having enhanced yield-related traits relative to control plants, comprising introduction and expression in a plant of any nucleic acid encoding an ELM2-related polypeptide, or a WRKY-related polypeptide, or an EMG1-like polypeptide, or a GPx-related polypeptide, as defined herein.
  • ELM2-related polypeptides the present invention more specifically provides a method for the production of transgenic plants having enhanced yield-related traits, particularly increased yield, more in particular increased biomass and increased seed yield, which method comprises:
  • the nucleic acid of (i) may be any of the nucleic acids capable of encoding an ELM2-related polypeptide as defined herein.
  • the nucleic acid encoding the ELM2-related polypeptide and to be introduced into the plant is an isolated nucleic acid or is comprised in a genetic construct as described above.
  • the present invention more specifically provides a method for the production of transgenic plants having enhanced yield-related traits, particularly increased yield, which method comprises:
  • the nucleic acid of (i) may be any of the nucleic acids capable of encoding a WRKY-related polypeptide as defined herein.
  • the nucleic acid encoding the WRKY-related polypeptide and to be introduced into the plant is an isolated nucleic acid or is comprised in a genetic construct as described above.
  • the present invention more specifically provides a method for the production of transgenic plants having enhanced yield-related traits, particularly increased seed yield, which method comprises:
  • the nucleic acid of (i) may be any of the nucleic acids capable of encoding an EMG1 -like polypeptide as defined herein.
  • the nucleic acid encoding the EMG1 -like polypeptide and to be introduced into the plant is an isolated nucleic acid or is comprised in a genetic construct as described above.
  • the present invention more specifically provides a method for the production of transgenic plants having enhanced yield-related traits, particularly increased (seed) yield, which method comprises:
  • the nucleic acid of (i) may be any of the nucleic acids capable of encoding a GPx-related polypeptide as defined herein.
  • the nucleic acid encoding the GPx-related polypeptide and to be introduced into the plant is an isolated nucleic acid or is comprised in a genetic construct as described above.
  • the plant cell transformed by the method according to the invention is regenerable into a transformed plant.
  • the plant cell transformed by the method according to the invention is not regenerable into a transformed plant, i.e. cells that are not capable to regenerate into a plant using cell culture techniques known in the art. While plants cells generally have the characteristic of totipotency, some plant cells can not be used to regenerate or propagate intact plants from said cells. In one embodiment of the invention the plant cells of the invention are such cells.
  • the plant cells of the invention are plant cells that do not sustain themselves in an autotrophic way, such plant cells are not deemed to represent a plant variety.
  • the plant cells of the invention are non- plant variety and non-propagative.
  • the nucleic acid may be introduced directly into a plant cell or into the plant itself (including introduction into a tissue, organ or any other part of a plant).
  • the nucleic acid is preferably introduced into a plant or plant cell by transformation.
  • transformation is described in more detail in the "definitions" section herein.
  • the present invention extends to any plant cell or plant produced by any of the methods described herein, and to all plant parts and propagules thereof.
  • the present invention encompasses plants or parts thereof (including seeds) obtainable by the methods according to the present invention.
  • the plants or plant parts or plant cells comprise a nucleic acid transgene encoding an ELM2-related polypeptide, or a WRKY- related polypeptide, or an EMG1 -like polypeptide, or a GPx-related polypeptide as defined above, preferably in a genetic construct such as an expression cassette.
  • the present invention extends further to encompass the progeny of a primary transformed or transfected cell, tissue, organ or whole plant that has been produced by any of the aforementioned methods, the only requirement being that progeny exhibit the same genotypic and/or phenotypic characteristic(s) as those produced by the parent in the methods according to the invention.
  • the invention extends to seeds recombinantly comprising the expression cassettes of the invention, the genetic constructs of the invention, or the nucleic acids encoding the ELM2-related polypeptide, or WRKY-related polypeptide, or EMG1 -like polypeptide, or GPx-related polypeptide, and/or the ELM2-related polypeptides, or the WRKY-related polypeptides, or the EMG1-like polypeptides, or the GPx-related polypeptides respectively, as described above.
  • the invention also includes host cells containing an isolated nucleic acid encoding an ELM2-related polypeptide, or a WRKY-related polypeptide, or an EMG1 -like polypeptide, or a GPx-related polypeptide, as defined above.
  • host cells according to the invention are plant cells, yeasts, bacteria or fungi.
  • Host plants for the nucleic acids, construct, expression cassette or the vector used in the method according to the invention are, in principle, advantageously all plants which are capable of synthesizing the polypeptides used in the inventive method.
  • the plant cells of the invention overexpress the nucleic acid molecule of the invention.
  • Plants that are particularly useful in the methods of the invention include all plants which belong to the superfamily Viridiplantae, in particular monocotyledonous and dicotyledonous plants including fodder or forage legumes, ornamental plants, food crops, trees or shrubs.
  • the plant is a crop plant.
  • crop plants include but are not limited to chicory, carrot, cassava, trefoil, soybean, beet, sugar beet, sunflower, canola, alfalfa, rapeseed, linseed, cotton, tomato, potato and tobacco.
  • the plant is a monocotyledonous plant.
  • monocotyledonous plants include sugarcane.
  • the plant is a cereal.
  • cereals include rice, maize, wheat, barley, millet, rye, triticale, sorghum, emmer, spelt, einkorn, teff, milo and oats.
  • the plants of the invention or used in the methods of the invention are selected from the group consisting of maize, wheat, rice, soybean, cotton, oilseed rape including canola, sugarcane, sugar beet and alfalfa.
  • the methods of the invention are more efficient than the known methods, because the plants of the invention have increased yield and/or tolerance to an environmental stress compared to control plants used in comparable methods.
  • the invention also extends to harvestable parts of a plant such as, but not limited to seeds, leaves, fruits, flowers, stems, roots, rhizomes, tubers and bulbs, which harvestable parts comprise a recombinant nucleic acid encoding an ELM2-related polypeptide, or a WRKY- related polypeptide, or an EMG1 -like polypeptide, or a GPx-related polypeptide.
  • the invention furthermore relates to products derived or produced, preferably directly derived or directly produced, from a harvestable part of such a plant, such as dry pellets, meal or powders, oil, fat and fatty acids, starch or proteins.
  • the product comprises a recombinant nucleic acid encoding an ELM2-related polypeptide, or a WRKY- related polypeptide, or an EMG1-like polypeptide, or a GPx-related polypeptide, and/or a recombinant an ELM2-related polypeptide, or WRKY-related polypeptide, or EMG1 -like polypeptide, or GPx-related polypeptide, for example as an indicator of the particular quality of the product.
  • the invention also includes methods for manufacturing a product comprising a) growing the plants of the invention and b) producing said product from or by the plants of the invention or parts thereof, including seeds.
  • the methods comprise the steps of a) growing the plants of the invention, b) removing the harvestable parts as described herein from the plants and c) producing said product from, or with the harvestable parts of plants according to the invention.
  • the products produced by the methods of the invention are plant products such as, but not limited to, a foodstuff, feedstuff, a food supplement, feed supplement, fiber, cosmetic or pharmaceutical.
  • the methods for production are used to make agricultural products such as, but not limited to, plant extracts, proteins, amino acids, carbohydrates, fats, oils, polymers, vitamins, and the like.
  • the polynucleotides or the polypeptides of the invention are comprised in an agricultural product.
  • the nucleic acid sequences and protein sequences of the invention may be used as product markers, for example where an agricultural product was produced by the methods of the invention.
  • Such a marker can be used to identify a product to have been produced by an advantageous process resulting not only in a greater efficiency of the process but also improved quality of the product due to increased quality of the plant material and harvestable parts used in the process.
  • markers can be detected by a variety of methods known in the art, for example but not limited to PCR based methods for nucleic acid detection or antibody based methods for protein detection.
  • the present invention also encompasses use of nucleic acids encoding ELM2-related polypeptides, or WRKY-related polypeptides, or EMG1 -like polypeptides, or GPx-related polypeptides, as described herein and use of these ELM2-related polypeptides, or WRKY- related polypeptides, or EMG1 -like polypeptides, or GPx-related polypeptides, in enhancing any of the aforementioned yield-related traits in plants.
  • nucleic acids encoding the ELM2-related polypeptides, or the WRKY-related polypeptides, or the EMG1 -like polypeptides, or the GPx-related polypeptides, themselves, may find use in breeding programmes in which a DNA marker is identified which may be genetically linked to above described polypeptide-encoding gene.
  • the nucleic acids/genes, or the ELM2-related polypeptides, or the WRKY-related polypeptides, or the EMG1 -like polypeptides, or the GPx-related polypeptides, themselves may be used to define a molecular marker.
  • This DNA or protein marker may then be used in breeding programmes to select plants having enhanced yield-related traits as defined herein in the methods of the invention.
  • allelic variants of a nucleic acid/gene encoding an ELM2-related polypeptide, or a WRKY-related polypeptide, or an EMG1 -like polypeptide, or a GPx-related polypeptide may find use in marker-assisted breeding programmes.
  • Nucleic acids encoding ELM2- related polypeptides, or WRKY-related polypeptides, or EMG1 -like polypeptides, or GPx- related polypeptides may also be used as probes for genetically and physically mapping the genes that they are a part of, and as markers for traits linked to those genes. Such information may be useful in plant breeding in order to develop lines with desired phenotypes.
  • a method for enhancing yield-related traits in plants relative to control plants comprising modulating expression in a plant of a nucleic acid encoding an ELM2- related poly-peptide, wherein said ELM2-related polypeptide comprises an Interpro accession IPR 000949, according to PFAM accession number PF01448 ELM2 domain.
  • ELM2-related polypeptide comprises one or more motifs having at least 80% sequence identity with one or more of the following motifs:
  • x can be any amino acid.
  • nucleic acid encoding an ELM2-related polypeptide is of plant origin, preferably from a dicotyledonous plant, further preferably from the family Salicaceae, more preferably from the genus Populus, most preferably from Populus trichocarpa.
  • nucleic acid encoding an ELM2-related polypeptide is of plant origin, preferably from a dicotyledonous plant, further preferably from the family Fabaceae, more preferably from the genus Medicago, most preferably from Medicago truncatula.
  • nucleic acid encoding an ELM2-related encodes any one of the polypeptides listed in Table A1 or is a portion of such a nucleic acid, or a nucleic acid capable of hybridising with such a nucleic acid.
  • nucleic acid encodes the polypeptide represented by any one of SEQ ID NO: 2 or SEQ ID NO: 4 or a homologue thereof which has at least 90% overall sequence identity to SEQ ID NO : 2 or SEQ ID NO: 4.
  • nucleic acid is operably linked to a constitutive promoter, preferably to a medium strength constitutive promoter, preferably to a plant promoter, more preferably to a GOS2 promoter, most preferably to a GOS2 promoter from rice.
  • Plant, plant part thereof, including seeds, or plant cell obtainable by a method according to any one of embodiments 1 to 12, wherein said plant, plant part or plant cell comprises a recombinant nucleic acid encoding an ELM2-related polypeptide as defined in any of embodiments 1 and 6 to 11.
  • nucleic acid encoding an ELM2-related polypeptide as defined in any of embodiments 1 and 6 to 1 1 ;
  • one of said control sequences is a constitutive promoter, preferably a medium strength constitutive promoter, preferably to a plant promoter, more preferably a GOS2 promoter, most preferably a GOS2 promoter from rice.
  • Transgenic plant having enhanced yield-related traits relative to control plants, preferably increased yield relative to control plants, and more preferably increased seed yield and/or increased biomass, resulting from modulated expression of a nucleic acid encoding an ELM2-related polypeptide as defined in any of embodiments 1 and 6 to 1 1 or a transgenic plant cell derived from said transgenic plant.
  • Transgenic plant according to embodiment 13, 17 or 19, or a transgenic plant cell derived therefrom, wherein said plant is a crop plant, such as beet, sugarbeet or alfalfa; or a monocotyledonous plant such as sugarcane; or a cereal, such as rice, maize, wheat, barley, millet, rye, triticale, sorghum, emmer, spelt, einkorn, teff, milo or oats.
  • a crop plant such as beet, sugarbeet or alfalfa
  • a monocotyledonous plant such as sugarcane
  • a cereal such as rice, maize, wheat, barley, millet, rye, triticale, sorghum, emmer, spelt, einkorn, teff, milo or oats.
  • nucleic acid encoding an ELM2-related polypeptide as defined in any of embodiments 1 and 6 to 1 1 for enhancing yield-related traits in plants relative to control plants, preferably for increasing yield, and more preferably for increasing seed yield and/or for increasing biomass in plants relative to control plants.
  • a method for manufacturing a product comprising the steps of growing the plants according to embodiment 13, 17, 20 or 21 and producing said product from or by said plants; or parts thereof, including seeds.
  • Construct according to embodiment 14 or 15 comprised in a plant cell.
  • a method of growing a transgenic plant comprising:
  • the present invention moreover relates to the following specific embodiments:
  • a method for enhancing yield in plants relative to or compared to control plants comprising modulating expression in a plant of a nucleic acid molecule encoding a WRKY-related polypeptide, preferably comprising one or more motifs selected from a group consisting of WRKYGQ motif, basic motif, coiled coil motif as defined herein.
  • nucleic acid molecule comprising a nucleic acid molecule selected from the group consisting of:
  • nucleic acid encoding the polypeptide as represented by SEQ ID NO: 103, preferably as a result of the degeneracy of the genetic code, said isolated nucleic acid can be deduced from a polypeptide sequence as represented by SEQ ID NO: 103 and further preferably confers enhanced yield-related traits relative to or compared to control plants;
  • nucleic acid having, in increasing order of preference at least 30 %, 31 %, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41 %, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51 %, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61 %, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity with the nucleic acid sequence of SEQ ID NO: 102, and
  • a first nucleic acid molecule which hybridizes with a second nucleic acid molecule of (i) to (iv) under stringent hybridization conditions and preferably confers enhanced yield-related traits relative to or compared to control plants, wherein the first nucleic acid encodes a polypeptide that is not the polypeptide of any of the polypeptide sequence as represented by SEQ ID NO: 103;
  • nucleic acid encoding said polypeptide having, in increasing order of preference, at least 50%, 51 %, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61 %, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence represented by SEQ ID NO: 103 and preferably conferring enhanced yield-related traits relative to or compared to control plants; or
  • a nucleic acid comprising any combination(s) of features of (i) to (vi) above.
  • said enhanced yield-related traits comprise one or more of increased yield, preferably increase of emergence vigour, total seed yield, fill rate, TKW, number of filled seeds, taller more erect plants, amount of thick roots, number of florets per panicle on a plant, increased harvest index, increased greenness of a plant before flowering, increased height of the plant, increased quick early development, increased cycle time relative to or compared to control plants. 5.
  • Method according to any one of embodiments 1 to 4 wherein said enhanced yield- related traits are obtained under non-stress conditions.
  • nucleic acid is operably linked to a constitutive promoter, preferably to a GOS2 promoter, most preferably to a GOS2 promoter from rice.
  • nucleic acid molecule or said polypeptide, respectively is of plant origin, preferably from a dicotyledonous plant, further preferably from a leguminous plant, more preferably from the genus Medicago, most preferably from Medicago truncatula..
  • Plant or part thereof including seeds, obtainable by a method according to any one of embodiments 1 to 8, wherein said plant or part thereof comprises a recombinant nucleic acid encoding said polypeptide as defined in any one of embodiments 1 , 3 or
  • nucleic acid encoding said polypeptide as defined in any one of embodiments 1 , 3 or 8;
  • control sequences capable of driving expression of the nucleic acid sequence of (a);
  • one of said control sequences is a constitutive promoter, preferably a GOS2 promoter, most preferably a GOS2 promoter from rice.
  • a method for the production of a product comprising the steps of growing the plants of the invention and producing said product from or by
  • a dicot such as sugar beet, alfalfa, trefoil, chicory, carrot, cassava, cotton, soybean, canola
  • a monocot such as sugarcane
  • a cereal such as rice, maize, wheat, barley, millet, rye, triticale, sorghum emmer, spelt, secale, ein
  • nucleic acid encoding a polypeptide as defined in any one of embodiments 1 , 3 or 8 in increasing yield, particularly seed yield and/or shoot biomass relative to or compared to control plants.
  • Construct according to embodiment 10 or 11 comprised in a plant cell.
  • Recombinant chromosomal DNA comprising the construct according to embodiment 10 or 1 1.
  • the present invention moreover relates to the following specific embodiments:
  • a method for enhancing yield-related traits in plants relative to control plants comprising modulating expression in a plant of a nucleic acid encoding an EMG1 -like polypeptide, wherein said EMG1-like polypeptide comprises an InterPro accession IPR005304 EMG1 domain corresponding to PFAM accession number PF03587.
  • EMG1 -like polypeptide comprises an EMG1 domain having at least 60% sequence identity with the EMG1 domain from amino acid 81 to 276 in SEQ ID NO: 179.
  • EMG1 -like polypeptide further comprises one of the motifs represented by SEQ ID NO: 286, SEQ ID NO: 287 or SEQ ID NO: 288.
  • nucleic acid encoding an EMG1 -like is of plant origin, preferably from a dicotyledonous plant, further preferably from the family Salicaceae, more preferably from the genus Populus, most preferably from Populus trichocarpa.
  • nucleic acid encoding an EMG1 -like polypeptide encodes any one of the polypeptides listed in Table A3 or is a portion of such a nucleic acid, or a nucleic acid capable of hybridising with such a nucleic acid.
  • nucleic acid sequence encodes an orthologue or paralogue of any of the polypeptides given in Table A3.
  • nucleic acid is operably linked to a constitutive promoter, preferably to a medium strength constitutive promoter, preferably to a plant promoter, more preferably to a GOS2 promoter, most preferably to a GOS2 promoter from rice.
  • Plant, plant part thereof, including seeds, or plant cell obtainable by a method according to any one of embodiments 1 to 12, wherein said plant, plant part or plant cell comprises a recombinant nucleic acid encoding an EMG1 -like polypeptide as defined in any of embodiments 1 to 3 and 8 to 12.
  • nucleic acid encoding an EMG1 -like as defined in any of embodiments 1 to 3 and 8 to 12;
  • one of said control sequences is a constitutive promoter, preferably a medium strength constitutive promoter, preferably to a plant promoter, more preferably a GOS2 promoter, most preferably a GOS2 promoter from rice.
  • Transgenic plant having enhanced yield-related traits relative to control plants, preferably increased yield relative to control plants, and more preferably increased seed yield and/or increased biomass, resulting from modulated expression of a nucleic acid encoding an EMG1-like polypeptide as defined in any of embodiments 1 to 3 and 8 to 12 or a transgenic plant cell derived from said transgenic plant.
  • Transgenic plant according to embodiment 13, 17 or 19, or a transgenic plant cell derived therefrom, wherein said plant is a crop plant, such as beet, sugarbeet or alfalfa; or a monocotyledonous plant such as sugarcane; or a cereal, such as rice, maize, wheat, barley, millet, rye, triticale, sorghum, emmer, spelt, einkorn, teff, milo or oats.
  • a crop plant such as beet, sugarbeet or alfalfa
  • a monocotyledonous plant such as sugarcane
  • a cereal such as rice, maize, wheat, barley, millet, rye, triticale, sorghum, emmer, spelt, einkorn, teff, milo or oats.
  • nucleic acid encoding an EMG1 -like polypeptide as defined in any of embodiments 1 to 3 and 8 to 12 for enhancing yield-related traits in plants relative to control plants, preferably for increasing yield, and more preferably for increasing seed yield and/or for increasing biomass in plants relative to control plants.
  • a method for manufacturing a product comprising the steps of growing the plants according to embodiment 13, 17, 19 or 20 and producing said product from or by said plants; or parts thereof, including seeds.
  • the present invention moreover relates to the following specific embodiments:
  • a method for enhancing yield-related traits in plants relative to or compared to control plants comprising modulating expression in a plant of a nucleic acid encoding a GPx- related polypeptide, wherein said GPx-related polypeptide comprises one or more motifs and/or signatures having at least 80% sequence identity with a motif and/or signature selected from a group consisting of motifs 7 to 18, represented in SEQ ID
  • nucleic acid encoding the polypeptide as represented by any one of SEQ ID NO: 293, 295, 297, preferably as a result of the degeneracy of the genetic code, said isolated nucleic acid can be deduced from a polypeptide sequence as represented by any one of SEQ ID NO: 293, 295, 297 and further preferably confers enhanced yield-related traits relative to or compared to control plants;
  • nucleic acid having, in increasing order of preference at least 30 %, 31 %, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41 %, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51 %, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61 %, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity with any of the nucleic acid sequences of SEQ ID NO: 29
  • a first nucleic acid molecule which hybridizes with a second nucleic acid molecule of (i) to (iv) under stringent hybridization conditions and preferably confers enhanced yield-related traits relative to or compared to control plants, wherein the first nucleic acid encodes a polypeptide that is not the polypeptide of any of the polypeptide sequence as represented by any one of SEQ ID NO: 293,
  • nucleic acid encoding said polypeptide having, in increasing order of preference, at least 50%, 51 %, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61 %, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence represented by any one of SEQ ID NO: 293, 295, 297 and preferably conferring enhanced yield-related traits relative to or compared to control plants; or
  • nucleic acid comprising any combination(s) of features of (i) to (vi) above.
  • Method to any one of embodiments 1 to 3, wherein said enhanced seed yield traits relative or compared to control plants comprise one or more of increased seed yield, increased seed size, increased total weight of seeds, increased number of total seeds, increased fill rate, increased number of filled seeds, number of florets per panicle on a plant, increased height of the plant, increased quick early development, harvest index, increased cycle time relative to or compared to control plants.
  • Method according to any one of embodiments 1 to 4, wherein said increase in seed yield comprises an increase of at least 5 % in said plant when compared to control plants for at least one of said parameters.
  • nucleic acid encoding a GPx-related polypeptide is of plant origin, preferably from a dicotyledonous plant, further preferably from the family Poaceae, more preferably from the genus Oryza, most preferably from Oryza sativa.
  • Table A4 or is a portion of such a nucleic acid, or a nucleic acid capable of hybridising with such a nucleic acid.
  • nucleic acid is operably linked to a constitutive promoter of plant origin, preferably to a medium strength constitutive promoter of plant origin, more preferably to a GOS2 promoter, most preferably to a GOS2 promoter from rice.
  • Plant, or part thereof, or plant cell obtainable by a method according to any one of embodiments 1 to 14, wherein said plant, plant part or plant cell comprises a recombinant nucleic acid encoding a GPx-related polypeptide as defined in any one of embodiments 1 to 14.
  • nucleic acid encoding an GPx-related polypeptide as defined in any one of embodiments 1 to 14;
  • one of said control sequences is a constitutive promoter of plant origin, preferably to a medium strength constitutive promoter of plant origin, more preferably to a GOS2 promoter, most preferably to a
  • a construct according to embodiment 16 or 17 in a method for making plants having enhanced yield-related traits, preferably increased yield relative to or compared to control plants, and more preferably increased seed yield and/or increased biomass relative to or compared to control plants.
  • Transgenic plant having enhanced yield-related traits relative to or compared to control plants, preferably increased yield relative to or compared to control plants, and more preferably increased seed yield and/or increased biomass, resulting from modulated expression of a nucleic acid encoding a GPx-related polypeptide as defined in any one of embodiments 1 to 14 or a transgenic plant cell derived from said transgenic plant.
  • Transgenic plant according to embodiment 15, 19 or 21 , or a transgenic plant cell derived therefrom, wherein said plant is a crop plant, such as beet, sugarbeet or alfalfa; or a monocotyledonous plant such as sugarcane; or a cereal, such as rice, maize, wheat, barley, millet, rye, triticale, sorghum, emmer, spelt, einkorn, teff, milo or oats.
  • a crop plant such as beet, sugarbeet or alfalfa
  • a monocotyledonous plant such as sugarcane
  • a cereal such as rice, maize, wheat, barley, millet, rye, triticale, sorghum, emmer, spelt, einkorn, teff, milo or oats.
  • nucleic acid encoding an GPx-related polypeptide as defined in any one of embodiments 1 to 14 for enhancing yield-related traits in plants relative to or compared to control plants, preferably for increasing yield, and more preferably for increasing seed yield and/or for increasing biomass in plants relative to or compared to control plants.
  • a method for manufacturing a product comprising the steps of growing the plants according to embodiment 15, 19 or 21 and producing said product from or by said plants; or parts thereof, including seeds.
  • Figure 1 represents the domain structure of SEQ ID NO: 2 with conserved ELM2-related domain and the three MEME motifs.
  • Figure 2 represents the domain structure of SEQ ID NO: 4 with conserved ELM2-related domain and the three MEME motifs.
  • Figure 3 represents a multiple alignment of various ELM2-related polypeptides. These alignments can be used for defining further motifs or signature sequences, when using conserved amino acids.
  • Figure 4 shows a phylogenetic tree of ELM2-related polypeptides, as described in example
  • Figure 5 shows the MATGAT table of Example 3 of the full length sequences of Table A1 .
  • Figure 6 shows the MATGAT table of Example 3 of the conserved ELM2-domain in the sequences of Table A1 .
  • Figure 7 represents the binary vector used for increased expression in Oryza sativa of an ELM2-related-encoding nucleic acid under the control of a rice GOS2 promoter (pGOS2).
  • Figure 8 shows the domain structure of WRKY-related polypeptide as represented by SEQ ID NO: 2.
  • Coiled coil sequence is represented by amino acids LMNLYF (indicated in bold, underlined); basic motif as NLS is represented by KKAR (indicated in bold, italic, underlined); C2H2 zinc finger (represented by amino acids CCHH (bold, underlined)) containing the WRKY motif (WRKYGQK motif (bold, underlined)) represented by amino acid sequence indicated in bold.
  • Figure 9 represents the binary vector used for increased expression in Oryza sativa of WRKY-related polypeptide-encoding nucleic acid under the control of a rice GOS2 promoter (pGOS2).
  • Figure 10 shows the MATGAT table of Example 3.
  • Figure 1 1 represents the domain structure of SEQ ID NO: 179 with conserved motifs 4, 5 and 6 and the EMG1 domain.
  • Figure 12 represents a multiple alignment of various EMG1 -like polypeptides. These alignments can be used for defining further motifs or signature sequences, when using conserved amino acids.
  • Figure 13 shows a phylogenetic tree of EMG1 -like polypeptides, as described in Example 2.
  • Figure 14 shows the MATGAT table of Example 3 over the full length of the sequences of Table A3.
  • Figure 5 shows the MATGAT table of Example 3 over the EMG1 -like domain of the sequences of Table A3.
  • Figure 16 represents the binary vector used for increased expression in Oryza sativa of an EMG1 -like-encoding nucleic acid under the control of a rice GOS2 promoter (pGOS2).
  • Figure 17 represents the domain structure of SEQ ID NO: 293 with conserved motifs.
  • Figure 18 represents the binary vector used for increased expression in Oryza sativa of a GPx-related -encoding nucleic acid under the control of a rice GOS2 promoter (pGOS2).
  • Figure 19 shows the MATGAT table of Example 3.
  • Figure 20 represents a multiple alignment of various GPx-related polypeptides.
  • the asterisks indicate identical amino acids among the various protein sequences, colons represent highly conserved amino acid substitutions, and the dots represent less conserved amino acid substitution; on other positions there is no sequence conservation. These alignments can be used for defining further motifs or signature sequences, when using conserved amino acids.
  • Figure 21 shows phylogenetic tree of GPx-related polypeptides.
  • SEQ ID NO: 293 as used and described herein is Oryza_sativa_OsGPx03 gene from Oryza sativa and indicated by an arrow in the tree.
  • SEQ ID NO: 295 as used and described herein is Populus_trichocarpa_PtGPx06 gene from Populus trichocarpa and indicated by an arrow in the tree.
  • SEQ ID NO: 297 as used and described herein is Populus_trichocarpa_GPx gene from Populus trichocarpa and indicated by an arrow in the tree.
  • the present invention will now be described with reference to the following examples, which are by way of illustration only. The following examples are not intended to limit the scope of the invention. Unless otherwise indicated, the present invention employs conventional techniques and methods of plant biology, molecular biology, bioinformatics and plant breedings.
  • Example 1 Identification of sequences related to the nucleic acid sequence used in the methods of intervention
  • Sequences (full length cDNA, ESTs or genomic) related to SEQ ID NO: 1 and SEQ ID NO: 2 were identified amongst those maintained in the Entrez Nucleotides database at the National Center for Biotechnology Information (NCBI) using database sequence search tools, such as the Basic Local Alignment Tool (BLAST) (Altschul et al. (1990) J. Mol. Biol. 215:403-410; and Altschul et al. (1997) Nucleic Acids Res. 25:3389-3402). The program is used to find regions of local similarity between sequences by comparing nucleic acid or polypeptide sequences to sequence databases and by calculating the statistical significance of matches.
  • BLAST Basic Local Alignment Tool
  • the polypeptide encoded by the nucleic acid of SEQ ID NO: 1 was used for the TBLASTN algorithm, with default settings and the filter to ignore low complexity sequences set off.
  • the output of the analysis was viewed by pairwise comparison, and ranked according to the probability score (E-value), where the score reflect the probability that a particular alignment occurs by chance (the lower the E-value, the more significant the hit).
  • E-value probability score
  • comparisons were also scored by percentage identity. Percentage identity refers to the number of identical nucleotides (or amino acids) between the two compared nucleic acid (or polypeptide) sequences over a particular length.
  • the default parameters may be adjusted to modify the stringency of the search. For example the E-value may be increased to show less stringent matches. This way, short nearly exact matches may be identified.
  • Table A1 provides a list of nucleic acid and polypeptide sequences related to SEQ ID NO: 1 and SEQ ID NO: 2.
  • Table A1 Examples of ELM2-related nucleic acids and polypeptides:
  • Sequences (full length cDNA, ESTs or genomic) related to SEQ ID NO: 102 and SEQ ID NO: 103 were identified amongst those maintained in the Entrez Nucleotides database at the National Center for Biotechnology Information (NCBI) using database sequence search tools, such as the Basic Local Alignment Tool (BLAST) (Altschul et al. (1990) J. Mol. Biol. 215:403-410; and Altschul et al. (1997) Nucleic Acids Res. 25:3389-3402). The program is used to find regions of local similarity between sequences by comparing nucleic acid or polypeptide sequences to sequence databases and by calculating the statistical significance of matches.
  • BLAST Basic Local Alignment Tool
  • the program is used to find regions of local similarity between sequences by comparing nucleic acid or polypeptide sequences to sequence databases and by calculating the statistical significance of matches.
  • the polypeptide encoded by the nucleic acid of SEQ ID NO: 102 was used for the TBLASTN algorithm, with default settings and the filter to ignore low complexity sequences set off.
  • the output of the analysis was viewed by pairwise comparison, and ranked according to the probability score (E-value), where the score reflect the probability that a particular alignment occurs by chance (the lower the E-value, the more significant the hit).
  • E-value probability score
  • comparisons were also scored by percentage identity. Percentage identity refers to the number of identical nucleotides (or amino acids) between the two compared nucleic acid (or polypeptide) sequences over a particular length.
  • the default parameters may be adjusted to modify the stringency of the search. For example the E-value may be increased to show less stringent matches. This way, short nearly exact matches may be identified.
  • Table A2 provides a list of nucleic acid and polypeptide sequences related to SEQ ID NO: 102 and SEQ ID NO: 103.
  • Table A2 Examples of WRKY-related polypeptide nucleic acids and polypeptides:
  • Sequences (full length cDNA, ESTs or genomic) related to SEQ ID NO: 178 and SEQ ID NO: 179 were identified amongst those maintained in the Entrez Nucleotides database at the National Center for Biotechnology Information (NCBI) using database sequence search tools, such as the Basic Local Alignment Tool (BLAST) (Altschul et al. (1990) J. Mol. Biol. 215:403-410; and Altschul et al. (1997) Nucleic Acids Res. 25:3389-3402). The program is used to find regions of local similarity between sequences by comparing nucleic acid or polypeptide sequences to sequence databases and by calculating the statistical significance of matches.
  • BLAST Basic Local Alignment Tool
  • the program is used to find regions of local similarity between sequences by comparing nucleic acid or polypeptide sequences to sequence databases and by calculating the statistical significance of matches.
  • the polypeptide encoded by the nucleic acid of SEQ ID NO: 178 was used for the TBLASTN algorithm, with default settings and the filter to ignore low complexity sequences set off.
  • the output of the analysis was viewed by pairwise comparison, and ranked according to the probability score (E-value), where the score reflect the probability that a particular alignment occurs by chance (the lower the E-value, the more significant the hit).
  • E-value probability score
  • comparisons were also scored by percentage identity. Percentage identity refers to the number of identical nucleotides (or amino acids) between the two compared nucleic acid (or polypeptide) sequences over a particular length.
  • the default parameters may be adjusted to modify the stringency of the search. For example the E-value may be increased to show less stringent matches. This way, short nearly exact matches may be identified.
  • Table A3 provides a list of nucleic acid and protein sequences related to SEQ ID NO: 178 and SEQ ID NO: 179.
  • Sequences (full length cDNA, ESTs or genomic) related to SEQ ID NOs: 292 to 297 were identified amongst those maintained in the Entrez Nucleotides database at the National Center for Biotechnology Information (NCBI) using database sequence search tools, such as the Basic Local Alignment Tool (BLAST) (Altschul et al. (1990) J. Mol. Biol. 215:403-410; and Altschul et al. (1997) Nucleic Acids Res. 25:3389-3402). The program is used to find regions of local similarity between sequences by comparing nucleic acid or polypeptide sequences to sequence databases and by calculating the statistical significance of matches.
  • BLAST Basic Local Alignment Tool
  • the program is used to find regions of local similarity between sequences by comparing nucleic acid or polypeptide sequences to sequence databases and by calculating the statistical significance of matches.
  • the polypeptide encoded by the nucleic acid of SEQ ID NO: 292 was used for the TBLASTN algorithm, with default settings and the filter to ignore low complexity sequences set off.
  • the output of the analysis was viewed by pairwise comparison, and ranked according to the probability score (E-value), where the score reflect the probability that a particular alignment occurs by chance (the lower the E-value, the more significant the hit).
  • E-value probability score
  • comparisons were also scored by percentage identity. Percentage identity refers to the number of identical nucleotides (or amino acids) between the two compared nucleic acid (or polypeptide) sequences over a particular length.
  • the default parameters may be adjusted to modify the stringency of the search. For example the E-value may be increased to show less stringent matches. This way, short nearly exact matches may be identified.
  • Table A4 provides a list of nucleic acid and polypeptide sequences related to SEQ ID NOs: 293 to 297.
  • Hordeum_vulgare_HvGPx06 320 321 Hordeum_vulgare_HvGPx03 322 323

Landscapes

  • Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Molecular Biology (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Biomedical Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Microbiology (AREA)
  • Biophysics (AREA)
  • Cell Biology (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Medicinal Chemistry (AREA)
  • Botany (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
PCT/IB2012/054595 2011-09-16 2012-09-06 Plants having enhanced yield-related traits and methods for making the same Ceased WO2013038303A1 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
AU2012310202A AU2012310202A1 (en) 2011-09-16 2012-09-06 Plants having enhanced yield-related traits and methods for making the same
EP12831119.8A EP2755465A4 (en) 2011-09-16 2012-09-06 PLANTS WITH IMPROVED PERFORMANCE CHARACTERISTICS AND METHOD FOR THE PRODUCTION THEREOF
CA2847079A CA2847079A1 (en) 2011-09-16 2012-09-06 Plants having enhanced yield-related traits and methods for making the same
BR112014006096A BR112014006096A2 (pt) 2011-09-16 2012-09-06 plantas que possuem características relativas a rendimento aprimoradas e métodos de sua fabricação.
MX2014003005A MX2014003005A (es) 2011-09-16 2012-09-06 Plantas que tienen mejores rasgos relacionados con el rendimiento y un metodo para producirlas.
DE112012003842.8T DE112012003842T5 (de) 2011-09-16 2012-09-06 Pflanzen mit gesteigerten Ertragsmerkmalen und Verfahren zu deren Herstellung
IN1936CHN2014 IN2014CN01936A (https=) 2011-09-16 2012-09-06
US14/344,923 US20150322449A1 (en) 2011-09-16 2012-09-06 Plants Having Enhanced Yield-Related Traits And Methods For Making The Same
CN201280056096.2A CN103929947A (zh) 2011-09-16 2012-09-06 具有增强的产量相关性状的植物和用于产生该植物的方法
PH12014500550A PH12014500550A1 (en) 2011-09-16 2014-03-11 Plants having enhanced yield-related traits and a method for making the same

Applications Claiming Priority (16)

Application Number Priority Date Filing Date Title
US201161535420P 2011-09-16 2011-09-16
EP11181691 2011-09-16
EP11181691.4 2011-09-16
US61/535,420 2011-09-16
US201161537081P 2011-09-21 2011-09-21
US61/537,081 2011-09-21
EP11182171 2011-09-21
EP11182171.6 2011-09-21
US201161549778P 2011-10-21 2011-10-21
US61/549,778 2011-10-21
EP11186199.3 2011-10-21
EP11186199 2011-10-21
US201161563563P 2011-11-24 2011-11-24
EP11190546 2011-11-24
US61/563,563 2011-11-24
EP11190546.9 2011-11-24

Publications (1)

Publication Number Publication Date
WO2013038303A1 true WO2013038303A1 (en) 2013-03-21

Family

ID=47882685

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2012/054595 Ceased WO2013038303A1 (en) 2011-09-16 2012-09-06 Plants having enhanced yield-related traits and methods for making the same

Country Status (12)

Country Link
US (1) US20150322449A1 (https=)
EP (1) EP2755465A4 (https=)
CN (1) CN103929947A (https=)
AR (1) AR090030A1 (https=)
AU (1) AU2012310202A1 (https=)
BR (1) BR112014006096A2 (https=)
CA (1) CA2847079A1 (https=)
DE (1) DE112012003842T5 (https=)
IN (1) IN2014CN01936A (https=)
MX (1) MX2014003005A (https=)
PH (1) PH12014500550A1 (https=)
WO (1) WO2013038303A1 (https=)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN104004773A (zh) * 2014-06-19 2014-08-27 天津农学院 一种小麦wrky转录因子基因及其在改变拟南芥根系发育中的应用
CN107056911A (zh) * 2017-06-30 2017-08-18 沈阳农业大学 一种促进植物提前开花的草莓转录因子及其应用
CN109182348A (zh) * 2018-09-12 2019-01-11 华南农业大学 白叶枯病抗性相关基因OsPRX30的应用

Families Citing this family (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN104450740B (zh) * 2014-12-16 2016-06-15 中国农业科学院北京畜牧兽医研究所 一种紫花苜蓿MsWRKY33转录因子及其编码蛋白、制备方法和应用
GB2599369B (en) * 2020-09-25 2024-08-21 B Hive Innovations Ltd A crop scanning system, parts thereof, and associated methods
CN114621975B (zh) * 2020-12-11 2023-05-02 华南农业大学 稻瘟病抗性相关基因OsWRKY5的应用
CN112931213B (zh) * 2021-03-29 2022-05-27 东北林业大学 一种杨树外植体脱毒试剂、脱毒方法及应用
CN115976040B (zh) * 2022-09-09 2025-03-25 中国农业科学院植物保护研究所 本氏烟NbTSG101基因在调控植物抗病毒中的应用及转基因植物培育方法

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20070124833A1 (en) * 2005-05-10 2007-05-31 Abad Mark S Genes and uses for plant improvement

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090144849A1 (en) * 2002-02-11 2009-06-04 Lutfiyya Linda L Nucleic acid molecules and other molecules associated with transcription in plants
JP2005185101A (ja) * 2002-05-30 2005-07-14 National Institute Of Agrobiological Sciences 植物の全長cDNAおよびその利用

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20070124833A1 (en) * 2005-05-10 2007-05-31 Abad Mark S Genes and uses for plant improvement

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN104004773A (zh) * 2014-06-19 2014-08-27 天津农学院 一种小麦wrky转录因子基因及其在改变拟南芥根系发育中的应用
CN104004773B (zh) * 2014-06-19 2015-11-04 天津农学院 一种小麦wrky转录因子基因在改变拟南芥根系发育中的应用
CN107056911A (zh) * 2017-06-30 2017-08-18 沈阳农业大学 一种促进植物提前开花的草莓转录因子及其应用
CN109182348A (zh) * 2018-09-12 2019-01-11 华南农业大学 白叶枯病抗性相关基因OsPRX30的应用
CN109182348B (zh) * 2018-09-12 2020-07-31 华南农业大学 白叶枯病抗性相关基因OsPRX30的应用

Also Published As

Publication number Publication date
US20150322449A1 (en) 2015-11-12
EP2755465A4 (en) 2015-07-08
EP2755465A1 (en) 2014-07-23
AU2012310202A1 (en) 2014-04-24
PH12014500550A1 (en) 2015-03-30
MX2014003005A (es) 2014-05-28
CN103929947A (zh) 2014-07-16
AR090030A1 (es) 2014-10-15
BR112014006096A2 (pt) 2017-07-11
DE112012003842T5 (de) 2014-07-24
IN2014CN01936A (https=) 2015-05-29
CA2847079A1 (en) 2013-03-21

Similar Documents

Publication Publication Date Title
WO2013072832A1 (en) Plants having enhanced yield-related traits and a method for making the same
US20180291393A1 (en) Plants having enhanced yield-related traits and producing methods thereof
WO2011161617A1 (en) Plants having enhanced yield-related traits and method for making the same
US20140053298A1 (en) Plants Having Enhanced Yield-Related Traits and Method for Making the Same
US20150322449A1 (en) Plants Having Enhanced Yield-Related Traits And Methods For Making The Same
US20140123344A1 (en) Plants Having Enhanced Yield-Related Traits and Method for Making the Same
US20140325708A1 (en) Plants having enhanced yield-related traits and method for making the same
US20140298545A1 (en) Plants Having Enhanced Yield-Related Traits and a Method for Making the Same
EP2706836A1 (en) Plants having enhanced yield-related traits and method for making the same
US20150007367A1 (en) Plants having enhanced yield-related traits and method for making the same
US20140304858A1 (en) Plants having enhanced yield-related traits and producing methods thereof
US20160076049A1 (en) Plants having enhanced yield-related traits and method for making thereof
US20140165229A1 (en) Plants Having Enhanced Yield-Related Traits and a Method for Making the Same
US20140250548A1 (en) Plants Having Enhanced Yield-Related Traits and a Method for Making the Same
EP2947981A1 (en) Plants having enhanced yield-related traits and method for making the same

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12831119

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2012831119

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2847079

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 12014500550

Country of ref document: PH

WWE Wipo information: entry into national phase

Ref document number: MX/A/2014/003005

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 1120120038428

Country of ref document: DE

Ref document number: 112012003842

Country of ref document: DE

ENP Entry into the national phase

Ref document number: 2012310202

Country of ref document: AU

Date of ref document: 20120906

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 14344923

Country of ref document: US

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112014006096

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112014006096

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20140314