WO2012166951A1 - Novel glp-1 receptor stabilizers and modulators - Google Patents
Novel glp-1 receptor stabilizers and modulators Download PDFInfo
- Publication number
- WO2012166951A1 WO2012166951A1 PCT/US2012/040250 US2012040250W WO2012166951A1 WO 2012166951 A1 WO2012166951 A1 WO 2012166951A1 US 2012040250 W US2012040250 W US 2012040250W WO 2012166951 A1 WO2012166951 A1 WO 2012166951A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- compound
- ring
- independently
- alkyl
- atom
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 CCCC[*@@](C)C(C)=C[C@](C)C=CC(C)(C)N Chemical compound CCCC[*@@](C)C(C)=C[C@](C)C=CC(C)(C)N 0.000 description 3
- QUIOUTAHAOOQIS-UHFFFAOYSA-N CC(C)(C)OC(N(CC(OC)=O)Cc(cc1)ccc1C(NO)=N)=O Chemical compound CC(C)(C)OC(N(CC(OC)=O)Cc(cc1)ccc1C(NO)=N)=O QUIOUTAHAOOQIS-UHFFFAOYSA-N 0.000 description 2
- UEPVBDQJWSGTPI-UHFFFAOYSA-N COC(c1ccc(CC(Nc(cc2)c(C(F)(F)F)cc2OC)=O)cc1)=O Chemical compound COC(c1ccc(CC(Nc(cc2)c(C(F)(F)F)cc2OC)=O)cc1)=O UEPVBDQJWSGTPI-UHFFFAOYSA-N 0.000 description 2
- VLAQEELHMNGFDV-UHFFFAOYSA-N CC(C)(C(O)=O)NC(CN(Cc(cc1)ccc1-c1n[o]c(-c(cc2)ccc2-c2ccc(C)cc2)n1)C(c(cc1)ccc1NC(Cc(cc1)c(C(F)(F)F)cc1OC)=O)=O)=O Chemical compound CC(C)(C(O)=O)NC(CN(Cc(cc1)ccc1-c1n[o]c(-c(cc2)ccc2-c2ccc(C)cc2)n1)C(c(cc1)ccc1NC(Cc(cc1)c(C(F)(F)F)cc1OC)=O)=O)=O VLAQEELHMNGFDV-UHFFFAOYSA-N 0.000 description 1
- MFOCQXOGIHBLAT-UHFFFAOYSA-N CC(C)(C)OC(CN(Cc(cc1)ccc1Br)C(c(cc1)ccc1NC(Cc(cc1)c(C(F)(F)F)cc1OC)=O)=O)=O Chemical compound CC(C)(C)OC(CN(Cc(cc1)ccc1Br)C(c(cc1)ccc1NC(Cc(cc1)c(C(F)(F)F)cc1OC)=O)=O)=O MFOCQXOGIHBLAT-UHFFFAOYSA-N 0.000 description 1
- AFRMJAMJVHTATG-UHFFFAOYSA-N CC(C)(C)OC(CN(Cc(cc1)ccc1C(NNC(c(cc1)ccc1-c1ccc(C)cc1)=O)=O)C(c(cc1)ccc1NC(Cc(c(C(F)(F)F)c1)ccc1OC)=O)=O)=O Chemical compound CC(C)(C)OC(CN(Cc(cc1)ccc1C(NNC(c(cc1)ccc1-c1ccc(C)cc1)=O)=O)C(c(cc1)ccc1NC(Cc(c(C(F)(F)F)c1)ccc1OC)=O)=O)=O AFRMJAMJVHTATG-UHFFFAOYSA-N 0.000 description 1
- USZATBBIZIFMHS-UHFFFAOYSA-N CC(C)(C)OC(CN(Cc(cc1)ccc1C(O)=O)C(c(cc1)ccc1NC(Cc(c(C(F)(F)F)c1)ccc1OC)=O)=O)=O Chemical compound CC(C)(C)OC(CN(Cc(cc1)ccc1C(O)=O)C(c(cc1)ccc1NC(Cc(c(C(F)(F)F)c1)ccc1OC)=O)=O)=O USZATBBIZIFMHS-UHFFFAOYSA-N 0.000 description 1
- PJLNMSZKNZTZHM-UHFFFAOYSA-N CC(C)(C)OC(CN(Cc(cc1)ccc1O)C(c(cc1)ccc1NC(Cc(cc1)ccc1OC)=O)=O)=O Chemical compound CC(C)(C)OC(CN(Cc(cc1)ccc1O)C(c(cc1)ccc1NC(Cc(cc1)ccc1OC)=O)=O)=O PJLNMSZKNZTZHM-UHFFFAOYSA-N 0.000 description 1
- AVTUWASLSTUNTC-UHFFFAOYSA-N CC(C)(C)OC(CN(Cc(cc1)ccc1O)C(c(ccc(NC(Cc(cc1)c(C(F)(F)F)cc1OC)=O)c1)c1OC)=O)=O Chemical compound CC(C)(C)OC(CN(Cc(cc1)ccc1O)C(c(ccc(NC(Cc(cc1)c(C(F)(F)F)cc1OC)=O)c1)c1OC)=O)=O AVTUWASLSTUNTC-UHFFFAOYSA-N 0.000 description 1
- FPZZGVPGWUXBMX-UHFFFAOYSA-N CC(C)(C)OC(CNCc(cc1)ccc1Br)=O Chemical compound CC(C)(C)OC(CNCc(cc1)ccc1Br)=O FPZZGVPGWUXBMX-UHFFFAOYSA-N 0.000 description 1
- XEKQTBWHYNJMDX-UHFFFAOYSA-N CC(C)(C)OC(N(CC(OC)=O)Cc(cc1)ccc1C#N)=O Chemical compound CC(C)(C)OC(N(CC(OC)=O)Cc(cc1)ccc1C#N)=O XEKQTBWHYNJMDX-UHFFFAOYSA-N 0.000 description 1
- KNEASYWJURVEFB-UHFFFAOYSA-N CC(C1)C(CN(CC(O)=O)C(c(cc2)ccc2NC(Cc(cc2)c(C(F)(F)F)cc2OC)=O)=O)=CC=C1OC(c(cc1)cc2c1[o]c(C)c2)=O Chemical compound CC(C1)C(CN(CC(O)=O)C(c(cc2)ccc2NC(Cc(cc2)c(C(F)(F)F)cc2OC)=O)=O)=CC=C1OC(c(cc1)cc2c1[o]c(C)c2)=O KNEASYWJURVEFB-UHFFFAOYSA-N 0.000 description 1
- QMBLSXXTIANALA-UHFFFAOYSA-N CCCCCCCOc(cc1)ccc1C(Oc1ccc(C=O)nc1)=O Chemical compound CCCCCCCOc(cc1)ccc1C(Oc1ccc(C=O)nc1)=O QMBLSXXTIANALA-UHFFFAOYSA-N 0.000 description 1
- RARLHNWMIIHPCJ-UHFFFAOYSA-N CCCCCCCOc(cc1)ccc1C(Oc1ccc(CN(CC(O)=O)C(c(ccc(NC(Cc(cc2)c(C(F)(F)F)cc2OC)=O)c2)c2OC)=O)cc1)=O Chemical compound CCCCCCCOc(cc1)ccc1C(Oc1ccc(CN(CC(O)=O)C(c(ccc(NC(Cc(cc2)c(C(F)(F)F)cc2OC)=O)c2)c2OC)=O)cc1)=O RARLHNWMIIHPCJ-UHFFFAOYSA-N 0.000 description 1
- SMJGQJDIYLSFDS-UHFFFAOYSA-N CCCCCCCOc(cc1)ccc1C(Oc1ccc(CN(CC(OC(C)(C)C)=O)C(c(cc2)ccc2N)=O)cc1)=O Chemical compound CCCCCCCOc(cc1)ccc1C(Oc1ccc(CN(CC(OC(C)(C)C)=O)C(c(cc2)ccc2N)=O)cc1)=O SMJGQJDIYLSFDS-UHFFFAOYSA-N 0.000 description 1
- IWUDYYFPUQAWMA-UHFFFAOYSA-N CCCCCCCOc(cc1)ccc1C(Oc1ccc(CN(CC(OC(C)(C)C)=O)C(c(cc2)ccc2[N+]([O-])=O)=O)cc1)=O Chemical compound CCCCCCCOc(cc1)ccc1C(Oc1ccc(CN(CC(OC(C)(C)C)=O)C(c(cc2)ccc2[N+]([O-])=O)=O)cc1)=O IWUDYYFPUQAWMA-UHFFFAOYSA-N 0.000 description 1
- ISGXFMSKFDLMJY-UHFFFAOYSA-N CCCCCCOc(cc1)ccc1C(Oc1ccc(CN(CC(O)=O)C(c(cc2)ccc2NC(Cc(cc2)ccc2OC)=O)=O)cc1)=O Chemical compound CCCCCCOc(cc1)ccc1C(Oc1ccc(CN(CC(O)=O)C(c(cc2)ccc2NC(Cc(cc2)ccc2OC)=O)=O)cc1)=O ISGXFMSKFDLMJY-UHFFFAOYSA-N 0.000 description 1
- UHUDJKCNXFBBHU-UHFFFAOYSA-N CCOC(c1cnc(N)[o]1)=O Chemical compound CCOC(c1cnc(N)[o]1)=O UHUDJKCNXFBBHU-UHFFFAOYSA-N 0.000 description 1
- DSPYPIZSRFRXMT-UHFFFAOYSA-N CCOC(c1cnc(NC(Cc(cc2)c(C(F)(F)F)cc2OC)=O)[o]1)=O Chemical compound CCOC(c1cnc(NC(Cc(cc2)c(C(F)(F)F)cc2OC)=O)[o]1)=O DSPYPIZSRFRXMT-UHFFFAOYSA-N 0.000 description 1
- TXZVCDJZNRCDKW-UHFFFAOYSA-N COC(c1ccc(CC(O)=O)cc1)=O Chemical compound COC(c1ccc(CC(O)=O)cc1)=O TXZVCDJZNRCDKW-UHFFFAOYSA-N 0.000 description 1
- HIKILRNGPFKUBC-UHFFFAOYSA-N COc(cc1)cc(C(F)(F)F)c1NC(Cc(cc1)ccc1C(O)=O)=O Chemical compound COc(cc1)cc(C(F)(F)F)c1NC(Cc(cc1)ccc1C(O)=O)=O HIKILRNGPFKUBC-UHFFFAOYSA-N 0.000 description 1
- TUTYEYQBVJGDIM-UHFFFAOYSA-N COc1cc(C(F)(F)F)c(CC(Nc(cc2)ccc2C(N(CC(O)=O)CC(C=C2)=CCC2OC(c2cc(OC)ccn2)=O)=O)=O)cc1 Chemical compound COc1cc(C(F)(F)F)c(CC(Nc(cc2)ccc2C(N(CC(O)=O)CC(C=C2)=CCC2OC(c2cc(OC)ccn2)=O)=O)=O)cc1 TUTYEYQBVJGDIM-UHFFFAOYSA-N 0.000 description 1
- ZXPVOOUXZFJJMK-UHFFFAOYSA-N COc1cc(C(F)(F)F)c(CC(Nc(cc2)ccc2C(N(CC(O)=O)Cc(cc2)ccc2OC(c(cc2)cc3c2[nH]cn3)=O)=O)=O)cc1 Chemical compound COc1cc(C(F)(F)F)c(CC(Nc(cc2)ccc2C(N(CC(O)=O)Cc(cc2)ccc2OC(c(cc2)cc3c2[nH]cn3)=O)=O)=O)cc1 ZXPVOOUXZFJJMK-UHFFFAOYSA-N 0.000 description 1
- GTIQFVYQGOFPHN-UHFFFAOYSA-N COc1cc(C(F)(F)F)c(CC(Nc(cc2)ccc2C(N(CC(O)=O)Cc(cc2)ccc2OC(c2cc(-[n]3nccc3)ccc2)=O)=O)=O)cc1 Chemical compound COc1cc(C(F)(F)F)c(CC(Nc(cc2)ccc2C(N(CC(O)=O)Cc(cc2)ccc2OC(c2cc(-[n]3nccc3)ccc2)=O)=O)=O)cc1 GTIQFVYQGOFPHN-UHFFFAOYSA-N 0.000 description 1
- JSEIXFZZUQVHAR-UHFFFAOYSA-N COc1cc(C(F)(F)F)c(CC(Nc(cc2)ccc2C(N(CC(O)=O)Cc(cc2)ccc2OC(c2ccccn2)=O)=O)=O)cc1 Chemical compound COc1cc(C(F)(F)F)c(CC(Nc(cc2)ccc2C(N(CC(O)=O)Cc(cc2)ccc2OC(c2ccccn2)=O)=O)=O)cc1 JSEIXFZZUQVHAR-UHFFFAOYSA-N 0.000 description 1
- GEAVLJCFMBFKKG-UHFFFAOYSA-N C[n](cc1)c(cc2)c1cc2C(Oc1ccc(CN(CC(O)=O)C(c(cc2)ccc2NC(Cc(cc2)c(C(F)(F)F)cc2OC)=O)=O)cc1)=O Chemical compound C[n](cc1)c(cc2)c1cc2C(Oc1ccc(CN(CC(O)=O)C(c(cc2)ccc2NC(Cc(cc2)c(C(F)(F)F)cc2OC)=O)=O)cc1)=O GEAVLJCFMBFKKG-UHFFFAOYSA-N 0.000 description 1
- HXAKXGYHLSQZAT-UHFFFAOYSA-N N#Cc(cc1)ccc1-c1c[o]c(-c(cc2)ccc2Br)n1 Chemical compound N#Cc(cc1)ccc1-c1c[o]c(-c(cc2)ccc2Br)n1 HXAKXGYHLSQZAT-UHFFFAOYSA-N 0.000 description 1
- LJANCPRIUMHGJE-UHFFFAOYSA-N N#Cc(cc1)ccc1C(CBr)=O Chemical compound N#Cc(cc1)ccc1C(CBr)=O LJANCPRIUMHGJE-UHFFFAOYSA-N 0.000 description 1
- NEGDYSVDTFPAIV-UHFFFAOYSA-N O=Cc(cc1)ccc1-c1c[o]c(-c(cc2)ccc2Br)n1 Chemical compound O=Cc(cc1)ccc1-c1c[o]c(-c(cc2)ccc2Br)n1 NEGDYSVDTFPAIV-UHFFFAOYSA-N 0.000 description 1
- AFZGNRUTCINXCH-UHFFFAOYSA-N OC(CN(Cc(cc1)ccc1OC(c(cc1)ccc1N(CC1)CCS1(=O)=O)=O)C(c(cc1)ccc1NC(Cc(cc1)c(C(F)(F)F)cc1O)=O)=O)=O Chemical compound OC(CN(Cc(cc1)ccc1OC(c(cc1)ccc1N(CC1)CCS1(=O)=O)=O)C(c(cc1)ccc1NC(Cc(cc1)c(C(F)(F)F)cc1O)=O)=O)=O AFZGNRUTCINXCH-UHFFFAOYSA-N 0.000 description 1
- HSODMUBHOXGNNQ-UHFFFAOYSA-N Oc1ccc(C=O)nc1 Chemical compound Oc1ccc(C=O)nc1 HSODMUBHOXGNNQ-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/41—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
- A61K31/4245—Oxadiazoles
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/13—Amines
- A61K31/155—Amidines (), e.g. guanidine (H2N—C(=NH)—NH2), isourea (N=C(OH)—NH2), isothiourea (—N=C(SH)—NH2)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/21—Esters, e.g. nitroglycerine, selenocyanates
- A61K31/215—Esters, e.g. nitroglycerine, selenocyanates of carboxylic acids
- A61K31/235—Esters, e.g. nitroglycerine, selenocyanates of carboxylic acids having an aromatic ring attached to a carboxyl group
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/335—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin
- A61K31/34—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having five-membered rings with one oxygen as the only ring hetero atom, e.g. isosorbide
- A61K31/341—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having five-membered rings with one oxygen as the only ring hetero atom, e.g. isosorbide not condensed with another ring, e.g. ranitidine, furosemide, bufetolol, muscarine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/44—Non condensed pyridines; Hydrogenated derivatives thereof
- A61K31/4406—Non condensed pyridines; Hydrogenated derivatives thereof only substituted in position 3, e.g. zimeldine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/44—Non condensed pyridines; Hydrogenated derivatives thereof
- A61K31/4427—Non condensed pyridines; Hydrogenated derivatives thereof containing further heterocyclic ring systems
- A61K31/4439—Non condensed pyridines; Hydrogenated derivatives thereof containing further heterocyclic ring systems containing a five-membered ring with nitrogen as a ring hetero atom, e.g. omeprazole
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/44—Non condensed pyridines; Hydrogenated derivatives thereof
- A61K31/445—Non condensed piperidines, e.g. piperocaine
- A61K31/4465—Non condensed piperidines, e.g. piperocaine only substituted in position 4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/47—Quinolines; Isoquinolines
- A61K31/472—Non-condensed isoquinolines, e.g. papaverine
- A61K31/4725—Non-condensed isoquinolines, e.g. papaverine containing further heterocyclic rings
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/535—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with at least one nitrogen and one oxygen as the ring hetero atoms, e.g. 1,2-oxazines
- A61K31/5375—1,4-Oxazines, e.g. morpholine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/54—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with at least one nitrogen and one sulfur as the ring hetero atoms, e.g. sulthiame
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/26—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/20—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing sulfur, e.g. dimethyl sulfoxide [DMSO], docusate, sodium lauryl sulfate or aminosulfonic acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/26—Carbohydrates, e.g. sugar alcohols, amino sugars, nucleic acids, mono-, di- or oligo-saccharides; Derivatives thereof, e.g. polysorbates, sorbitan fatty acid esters or glycyrrhizin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/30—Macromolecular organic or inorganic compounds, e.g. inorganic polyphosphates
- A61K47/36—Polysaccharides; Derivatives thereof, e.g. gums, starch, alginate, dextrin, hyaluronic acid, chitosan, inulin, agar or pectin
- A61K47/40—Cyclodextrins; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/69—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit
- A61K47/6949—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit inclusion complexes, e.g. clathrates, cavitates or fullerenes
- A61K47/6951—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit inclusion complexes, e.g. clathrates, cavitates or fullerenes using cyclodextrin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0087—Galenical forms not covered by A61K9/02 - A61K9/7023
- A61K9/0095—Drinks; Beverages; Syrups; Compositions for reconstitution thereof, e.g. powders or tablets to be dispersed in a glass of water; Veterinary drenches
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B82—NANOTECHNOLOGY
- B82Y—SPECIFIC USES OR APPLICATIONS OF NANOSTRUCTURES; MEASUREMENT OR ANALYSIS OF NANOSTRUCTURES; MANUFACTURE OR TREATMENT OF NANOSTRUCTURES
- B82Y5/00—Nanobiotechnology or nanomedicine, e.g. protein engineering or drug delivery
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C229/00—Compounds containing amino and carboxyl groups bound to the same carbon skeleton
- C07C229/02—Compounds containing amino and carboxyl groups bound to the same carbon skeleton having amino and carboxyl groups bound to acyclic carbon atoms of the same carbon skeleton
- C07C229/04—Compounds containing amino and carboxyl groups bound to the same carbon skeleton having amino and carboxyl groups bound to acyclic carbon atoms of the same carbon skeleton the carbon skeleton being acyclic and saturated
- C07C229/06—Compounds containing amino and carboxyl groups bound to the same carbon skeleton having amino and carboxyl groups bound to acyclic carbon atoms of the same carbon skeleton the carbon skeleton being acyclic and saturated having only one amino and one carboxyl group bound to the carbon skeleton
- C07C229/10—Compounds containing amino and carboxyl groups bound to the same carbon skeleton having amino and carboxyl groups bound to acyclic carbon atoms of the same carbon skeleton the carbon skeleton being acyclic and saturated having only one amino and one carboxyl group bound to the carbon skeleton the nitrogen atom of the amino group being further bound to acyclic carbon atoms or to carbon atoms of rings other than six-membered aromatic rings
- C07C229/14—Compounds containing amino and carboxyl groups bound to the same carbon skeleton having amino and carboxyl groups bound to acyclic carbon atoms of the same carbon skeleton the carbon skeleton being acyclic and saturated having only one amino and one carboxyl group bound to the carbon skeleton the nitrogen atom of the amino group being further bound to acyclic carbon atoms or to carbon atoms of rings other than six-membered aromatic rings to carbon atoms of carbon skeletons containing rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C233/00—Carboxylic acid amides
- C07C233/01—Carboxylic acid amides having carbon atoms of carboxamide groups bound to hydrogen atoms or to acyclic carbon atoms
- C07C233/45—Carboxylic acid amides having carbon atoms of carboxamide groups bound to hydrogen atoms or to acyclic carbon atoms having the nitrogen atom of at least one of the carboxamide groups bound to a carbon atom of a hydrocarbon radical substituted by carboxyl groups
- C07C233/46—Carboxylic acid amides having carbon atoms of carboxamide groups bound to hydrogen atoms or to acyclic carbon atoms having the nitrogen atom of at least one of the carboxamide groups bound to a carbon atom of a hydrocarbon radical substituted by carboxyl groups with the substituted hydrocarbon radical bound to the nitrogen atom of the carboxamide group by an acyclic carbon atom
- C07C233/47—Carboxylic acid amides having carbon atoms of carboxamide groups bound to hydrogen atoms or to acyclic carbon atoms having the nitrogen atom of at least one of the carboxamide groups bound to a carbon atom of a hydrocarbon radical substituted by carboxyl groups with the substituted hydrocarbon radical bound to the nitrogen atom of the carboxamide group by an acyclic carbon atom having the carbon atom of the carboxamide group bound to a hydrogen atom or to a carbon atom of an acyclic saturated carbon skeleton
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C233/00—Carboxylic acid amides
- C07C233/01—Carboxylic acid amides having carbon atoms of carboxamide groups bound to hydrogen atoms or to acyclic carbon atoms
- C07C233/45—Carboxylic acid amides having carbon atoms of carboxamide groups bound to hydrogen atoms or to acyclic carbon atoms having the nitrogen atom of at least one of the carboxamide groups bound to a carbon atom of a hydrocarbon radical substituted by carboxyl groups
- C07C233/46—Carboxylic acid amides having carbon atoms of carboxamide groups bound to hydrogen atoms or to acyclic carbon atoms having the nitrogen atom of at least one of the carboxamide groups bound to a carbon atom of a hydrocarbon radical substituted by carboxyl groups with the substituted hydrocarbon radical bound to the nitrogen atom of the carboxamide group by an acyclic carbon atom
- C07C233/51—Carboxylic acid amides having carbon atoms of carboxamide groups bound to hydrogen atoms or to acyclic carbon atoms having the nitrogen atom of at least one of the carboxamide groups bound to a carbon atom of a hydrocarbon radical substituted by carboxyl groups with the substituted hydrocarbon radical bound to the nitrogen atom of the carboxamide group by an acyclic carbon atom having the carbon atom of the carboxamide group bound to an acyclic carbon atom of a carbon skeleton containing six-membered aromatic rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C233/00—Carboxylic acid amides
- C07C233/64—Carboxylic acid amides having carbon atoms of carboxamide groups bound to carbon atoms of six-membered aromatic rings
- C07C233/81—Carboxylic acid amides having carbon atoms of carboxamide groups bound to carbon atoms of six-membered aromatic rings having the nitrogen atom of at least one of the carboxamide groups bound to a carbon atom of a hydrocarbon radical substituted by carboxyl groups
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C233/00—Carboxylic acid amides
- C07C233/64—Carboxylic acid amides having carbon atoms of carboxamide groups bound to carbon atoms of six-membered aromatic rings
- C07C233/81—Carboxylic acid amides having carbon atoms of carboxamide groups bound to carbon atoms of six-membered aromatic rings having the nitrogen atom of at least one of the carboxamide groups bound to a carbon atom of a hydrocarbon radical substituted by carboxyl groups
- C07C233/82—Carboxylic acid amides having carbon atoms of carboxamide groups bound to carbon atoms of six-membered aromatic rings having the nitrogen atom of at least one of the carboxamide groups bound to a carbon atom of a hydrocarbon radical substituted by carboxyl groups with the substituted hydrocarbon radical bound to the nitrogen atom of the carboxamide group by an acyclic carbon atom
- C07C233/83—Carboxylic acid amides having carbon atoms of carboxamide groups bound to carbon atoms of six-membered aromatic rings having the nitrogen atom of at least one of the carboxamide groups bound to a carbon atom of a hydrocarbon radical substituted by carboxyl groups with the substituted hydrocarbon radical bound to the nitrogen atom of the carboxamide group by an acyclic carbon atom of an acyclic saturated carbon skeleton
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C235/00—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by oxygen atoms
- C07C235/02—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by oxygen atoms having carbon atoms of carboxamide groups bound to acyclic carbon atoms and singly-bound oxygen atoms bound to the same carbon skeleton
- C07C235/04—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by oxygen atoms having carbon atoms of carboxamide groups bound to acyclic carbon atoms and singly-bound oxygen atoms bound to the same carbon skeleton the carbon skeleton being acyclic and saturated
- C07C235/12—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by oxygen atoms having carbon atoms of carboxamide groups bound to acyclic carbon atoms and singly-bound oxygen atoms bound to the same carbon skeleton the carbon skeleton being acyclic and saturated having the nitrogen atom of at least one of the carboxamide groups bound to an acyclic carbon atom of a hydrocarbon radical substituted by carboxyl groups
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C235/00—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by oxygen atoms
- C07C235/02—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by oxygen atoms having carbon atoms of carboxamide groups bound to acyclic carbon atoms and singly-bound oxygen atoms bound to the same carbon skeleton
- C07C235/32—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by oxygen atoms having carbon atoms of carboxamide groups bound to acyclic carbon atoms and singly-bound oxygen atoms bound to the same carbon skeleton the carbon skeleton containing six-membered aromatic rings
- C07C235/38—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by oxygen atoms having carbon atoms of carboxamide groups bound to acyclic carbon atoms and singly-bound oxygen atoms bound to the same carbon skeleton the carbon skeleton containing six-membered aromatic rings having the nitrogen atom of at least one of the carboxamide groups bound to a carbon atom of a six-membered aromatic ring
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C235/00—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by oxygen atoms
- C07C235/42—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by oxygen atoms having carbon atoms of carboxamide groups bound to carbon atoms of six-membered aromatic rings and singly-bound oxygen atoms bound to the same carbon skeleton
- C07C235/44—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by oxygen atoms having carbon atoms of carboxamide groups bound to carbon atoms of six-membered aromatic rings and singly-bound oxygen atoms bound to the same carbon skeleton with carbon atoms of carboxamide groups and singly-bound oxygen atoms bound to carbon atoms of the same non-condensed six-membered aromatic ring
- C07C235/48—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by oxygen atoms having carbon atoms of carboxamide groups bound to carbon atoms of six-membered aromatic rings and singly-bound oxygen atoms bound to the same carbon skeleton with carbon atoms of carboxamide groups and singly-bound oxygen atoms bound to carbon atoms of the same non-condensed six-membered aromatic ring having the nitrogen atom of at least one of the carboxamide groups bound to an acyclic carbon atom of a hydrocarbon radical substituted by singly-bound oxygen atoms
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C237/00—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by amino groups
- C07C237/02—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by amino groups having the carbon atoms of the carboxamide groups bound to acyclic carbon atoms of the carbon skeleton
- C07C237/22—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by amino groups having the carbon atoms of the carboxamide groups bound to acyclic carbon atoms of the carbon skeleton having nitrogen atoms of amino groups bound to the carbon skeleton of the acid part, further acylated
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C237/00—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by amino groups
- C07C237/28—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by amino groups having the carbon atom of at least one of the carboxamide groups bound to a carbon atom of a non-condensed six-membered aromatic ring of the carbon skeleton
- C07C237/36—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by amino groups having the carbon atom of at least one of the carboxamide groups bound to a carbon atom of a non-condensed six-membered aromatic ring of the carbon skeleton having the nitrogen atom of the carboxamide group bound to an acyclic carbon atom of a hydrocarbon radical substituted by carboxyl groups
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C237/00—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by amino groups
- C07C237/28—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by amino groups having the carbon atom of at least one of the carboxamide groups bound to a carbon atom of a non-condensed six-membered aromatic ring of the carbon skeleton
- C07C237/42—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by amino groups having the carbon atom of at least one of the carboxamide groups bound to a carbon atom of a non-condensed six-membered aromatic ring of the carbon skeleton having nitrogen atoms of amino groups bound to the carbon skeleton of the acid part, further acylated
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C255/00—Carboxylic acid nitriles
- C07C255/49—Carboxylic acid nitriles having cyano groups bound to carbon atoms of six-membered aromatic rings of a carbon skeleton
- C07C255/57—Carboxylic acid nitriles having cyano groups bound to carbon atoms of six-membered aromatic rings of a carbon skeleton containing cyano groups and carboxyl groups, other than cyano groups, bound to the carbon skeleton
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C271/00—Derivatives of carbamic acids, i.e. compounds containing any of the groups, the nitrogen atom not being part of nitro or nitroso groups
- C07C271/06—Esters of carbamic acids
- C07C271/08—Esters of carbamic acids having oxygen atoms of carbamate groups bound to acyclic carbon atoms
- C07C271/26—Esters of carbamic acids having oxygen atoms of carbamate groups bound to acyclic carbon atoms with the nitrogen atom of at least one of the carbamate groups bound to a carbon atom of a six-membered aromatic ring
- C07C271/28—Esters of carbamic acids having oxygen atoms of carbamate groups bound to acyclic carbon atoms with the nitrogen atom of at least one of the carbamate groups bound to a carbon atom of a six-membered aromatic ring to a carbon atom of a non-condensed six-membered aromatic ring
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C275/00—Derivatives of urea, i.e. compounds containing any of the groups, the nitrogen atoms not being part of nitro or nitroso groups
- C07C275/28—Derivatives of urea, i.e. compounds containing any of the groups, the nitrogen atoms not being part of nitro or nitroso groups having nitrogen atoms of urea groups bound to carbon atoms of six-membered aromatic rings of a carbon skeleton
- C07C275/42—Derivatives of urea, i.e. compounds containing any of the groups, the nitrogen atoms not being part of nitro or nitroso groups having nitrogen atoms of urea groups bound to carbon atoms of six-membered aromatic rings of a carbon skeleton being further substituted by carboxyl groups
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C311/00—Amides of sulfonic acids, i.e. compounds having singly-bound oxygen atoms of sulfo groups replaced by nitrogen atoms, not being part of nitro or nitroso groups
- C07C311/01—Sulfonamides having sulfur atoms of sulfonamide groups bound to acyclic carbon atoms
- C07C311/02—Sulfonamides having sulfur atoms of sulfonamide groups bound to acyclic carbon atoms of an acyclic saturated carbon skeleton
- C07C311/08—Sulfonamides having sulfur atoms of sulfonamide groups bound to acyclic carbon atoms of an acyclic saturated carbon skeleton having the nitrogen atom of at least one of the sulfonamide groups bound to a carbon atom of a six-membered aromatic ring
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C311/00—Amides of sulfonic acids, i.e. compounds having singly-bound oxygen atoms of sulfo groups replaced by nitrogen atoms, not being part of nitro or nitroso groups
- C07C311/01—Sulfonamides having sulfur atoms of sulfonamide groups bound to acyclic carbon atoms
- C07C311/12—Sulfonamides having sulfur atoms of sulfonamide groups bound to acyclic carbon atoms of an unsaturated carbon skeleton containing rings
- C07C311/13—Sulfonamides having sulfur atoms of sulfonamide groups bound to acyclic carbon atoms of an unsaturated carbon skeleton containing rings the carbon skeleton containing six-membered aromatic rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C311/00—Amides of sulfonic acids, i.e. compounds having singly-bound oxygen atoms of sulfo groups replaced by nitrogen atoms, not being part of nitro or nitroso groups
- C07C311/15—Sulfonamides having sulfur atoms of sulfonamide groups bound to carbon atoms of six-membered aromatic rings
- C07C311/21—Sulfonamides having sulfur atoms of sulfonamide groups bound to carbon atoms of six-membered aromatic rings having the nitrogen atom of at least one of the sulfonamide groups bound to a carbon atom of a six-membered aromatic ring
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C311/00—Amides of sulfonic acids, i.e. compounds having singly-bound oxygen atoms of sulfo groups replaced by nitrogen atoms, not being part of nitro or nitroso groups
- C07C311/22—Sulfonamides, the carbon skeleton of the acid part being further substituted by singly-bound oxygen atoms
- C07C311/29—Sulfonamides, the carbon skeleton of the acid part being further substituted by singly-bound oxygen atoms having the sulfur atom of at least one of the sulfonamide groups bound to a carbon atom of a six-membered aromatic ring
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C311/00—Amides of sulfonic acids, i.e. compounds having singly-bound oxygen atoms of sulfo groups replaced by nitrogen atoms, not being part of nitro or nitroso groups
- C07C311/48—Amides of sulfonic acids, i.e. compounds having singly-bound oxygen atoms of sulfo groups replaced by nitrogen atoms, not being part of nitro or nitroso groups having nitrogen atoms of sulfonamide groups further bound to another hetero atom
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C317/00—Sulfones; Sulfoxides
- C07C317/26—Sulfones; Sulfoxides having sulfone or sulfoxide groups and nitrogen atoms, not being part of nitro or nitroso groups, bound to the same carbon skeleton
- C07C317/28—Sulfones; Sulfoxides having sulfone or sulfoxide groups and nitrogen atoms, not being part of nitro or nitroso groups, bound to the same carbon skeleton with sulfone or sulfoxide groups bound to acyclic carbon atoms of the carbon skeleton
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C317/00—Sulfones; Sulfoxides
- C07C317/44—Sulfones; Sulfoxides having sulfone or sulfoxide groups and carboxyl groups bound to the same carbon skeleton
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C323/00—Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups
- C07C323/50—Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups containing thio groups and carboxyl groups bound to the same carbon skeleton
- C07C323/62—Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups containing thio groups and carboxyl groups bound to the same carbon skeleton having the sulfur atom of at least one of the thio groups bound to a carbon atom of a six-membered aromatic ring of the carbon skeleton
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D207/00—Heterocyclic compounds containing five-membered rings not condensed with other rings, with one nitrogen atom as the only ring hetero atom
- C07D207/02—Heterocyclic compounds containing five-membered rings not condensed with other rings, with one nitrogen atom as the only ring hetero atom with only hydrogen or carbon atoms directly attached to the ring nitrogen atom
- C07D207/18—Heterocyclic compounds containing five-membered rings not condensed with other rings, with one nitrogen atom as the only ring hetero atom with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having one double bond between ring members or between a ring member and a non-ring member
- C07D207/22—Heterocyclic compounds containing five-membered rings not condensed with other rings, with one nitrogen atom as the only ring hetero atom with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having one double bond between ring members or between a ring member and a non-ring member with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
- C07D207/24—Oxygen or sulfur atoms
- C07D207/26—2-Pyrrolidones
- C07D207/263—2-Pyrrolidones with only hydrogen atoms or radicals containing only hydrogen and carbon atoms directly attached to other ring carbon atoms
- C07D207/267—2-Pyrrolidones with only hydrogen atoms or radicals containing only hydrogen and carbon atoms directly attached to other ring carbon atoms with only hydrogen atoms or radicals containing only hydrogen and carbon atoms directly attached to the ring nitrogen atom
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D209/00—Heterocyclic compounds containing five-membered rings, condensed with other rings, with one nitrogen atom as the only ring hetero atom
- C07D209/02—Heterocyclic compounds containing five-membered rings, condensed with other rings, with one nitrogen atom as the only ring hetero atom condensed with one carbocyclic ring
- C07D209/04—Indoles; Hydrogenated indoles
- C07D209/08—Indoles; Hydrogenated indoles with only hydrogen atoms or radicals containing only hydrogen and carbon atoms, directly attached to carbon atoms of the hetero ring
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D211/00—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings
- C07D211/04—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom
- C07D211/06—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having no double bonds between ring members or between ring members and non-ring members
- C07D211/08—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having no double bonds between ring members or between ring members and non-ring members with hydrocarbon or substituted hydrocarbon radicals directly attached to ring carbon atoms
- C07D211/10—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having no double bonds between ring members or between ring members and non-ring members with hydrocarbon or substituted hydrocarbon radicals directly attached to ring carbon atoms with radicals containing only carbon and hydrogen atoms attached to ring carbon atoms
- C07D211/14—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having no double bonds between ring members or between ring members and non-ring members with hydrocarbon or substituted hydrocarbon radicals directly attached to ring carbon atoms with radicals containing only carbon and hydrogen atoms attached to ring carbon atoms with hydrocarbon or substituted hydrocarbon radicals attached to the ring nitrogen atom
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D211/00—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings
- C07D211/04—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom
- C07D211/06—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having no double bonds between ring members or between ring members and non-ring members
- C07D211/08—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having no double bonds between ring members or between ring members and non-ring members with hydrocarbon or substituted hydrocarbon radicals directly attached to ring carbon atoms
- C07D211/18—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having no double bonds between ring members or between ring members and non-ring members with hydrocarbon or substituted hydrocarbon radicals directly attached to ring carbon atoms with substituted hydrocarbon radicals attached to ring carbon atoms
- C07D211/34—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having no double bonds between ring members or between ring members and non-ring members with hydrocarbon or substituted hydrocarbon radicals directly attached to ring carbon atoms with substituted hydrocarbon radicals attached to ring carbon atoms with hydrocarbon radicals, substituted by carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D211/00—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings
- C07D211/04—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom
- C07D211/06—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having no double bonds between ring members or between ring members and non-ring members
- C07D211/36—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having no double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
- C07D211/60—Carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals
- C07D211/62—Carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals attached in position 4
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D213/00—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
- C07D213/02—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
- C07D213/04—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
- C07D213/24—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with substituted hydrocarbon radicals attached to ring carbon atoms
- C07D213/54—Radicals substituted by carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals
- C07D213/55—Acids; Esters
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D213/00—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
- C07D213/02—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
- C07D213/04—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
- C07D213/60—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
- C07D213/62—Oxygen or sulfur atoms
- C07D213/63—One oxygen atom
- C07D213/65—One oxygen atom attached in position 3 or 5
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D213/00—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
- C07D213/02—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
- C07D213/04—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
- C07D213/60—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
- C07D213/78—Carbon atoms having three bonds to hetero atoms, with at the most one bond to halogen, e.g. ester or nitrile radicals
- C07D213/79—Acids; Esters
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D213/00—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
- C07D213/02—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
- C07D213/04—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
- C07D213/60—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
- C07D213/78—Carbon atoms having three bonds to hetero atoms, with at the most one bond to halogen, e.g. ester or nitrile radicals
- C07D213/79—Acids; Esters
- C07D213/80—Acids; Esters in position 3
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D213/00—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
- C07D213/02—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
- C07D213/04—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
- C07D213/60—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
- C07D213/78—Carbon atoms having three bonds to hetero atoms, with at the most one bond to halogen, e.g. ester or nitrile radicals
- C07D213/81—Amides; Imides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D213/00—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
- C07D213/02—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
- C07D213/04—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
- C07D213/60—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
- C07D213/78—Carbon atoms having three bonds to hetero atoms, with at the most one bond to halogen, e.g. ester or nitrile radicals
- C07D213/81—Amides; Imides
- C07D213/82—Amides; Imides in position 3
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D215/00—Heterocyclic compounds containing quinoline or hydrogenated quinoline ring systems
- C07D215/02—Heterocyclic compounds containing quinoline or hydrogenated quinoline ring systems having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen atoms or carbon atoms directly attached to the ring nitrogen atom
- C07D215/16—Heterocyclic compounds containing quinoline or hydrogenated quinoline ring systems having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen atoms or carbon atoms directly attached to the ring nitrogen atom with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
- C07D215/48—Carbon atoms having three bonds to hetero atoms with at the most one bond to halogen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D217/00—Heterocyclic compounds containing isoquinoline or hydrogenated isoquinoline ring systems
- C07D217/02—Heterocyclic compounds containing isoquinoline or hydrogenated isoquinoline ring systems with only hydrogen atoms or radicals containing only carbon and hydrogen atoms, directly attached to carbon atoms of the nitrogen-containing ring; Alkylene-bis-isoquinolines
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D231/00—Heterocyclic compounds containing 1,2-diazole or hydrogenated 1,2-diazole rings
- C07D231/02—Heterocyclic compounds containing 1,2-diazole or hydrogenated 1,2-diazole rings not condensed with other rings
- C07D231/10—Heterocyclic compounds containing 1,2-diazole or hydrogenated 1,2-diazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members
- C07D231/12—Heterocyclic compounds containing 1,2-diazole or hydrogenated 1,2-diazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached to ring carbon atoms
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D233/00—Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings
- C07D233/54—Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings having two double bonds between ring members or between ring members and non-ring members
- C07D233/56—Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings having two double bonds between ring members or between ring members and non-ring members with only hydrogen atoms or radicals containing only hydrogen and carbon atoms, attached to ring carbon atoms
- C07D233/60—Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings having two double bonds between ring members or between ring members and non-ring members with only hydrogen atoms or radicals containing only hydrogen and carbon atoms, attached to ring carbon atoms with hydrocarbon radicals, substituted by oxygen or sulfur atoms, attached to ring nitrogen atoms
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D235/00—Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, condensed with other rings
- C07D235/02—Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, condensed with other rings condensed with carbocyclic rings or ring systems
- C07D235/04—Benzimidazoles; Hydrogenated benzimidazoles
- C07D235/06—Benzimidazoles; Hydrogenated benzimidazoles with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached in position 2
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D235/00—Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, condensed with other rings
- C07D235/02—Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, condensed with other rings condensed with carbocyclic rings or ring systems
- C07D235/04—Benzimidazoles; Hydrogenated benzimidazoles
- C07D235/06—Benzimidazoles; Hydrogenated benzimidazoles with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached in position 2
- C07D235/12—Radicals substituted by oxygen atoms
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D235/00—Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, condensed with other rings
- C07D235/02—Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, condensed with other rings condensed with carbocyclic rings or ring systems
- C07D235/04—Benzimidazoles; Hydrogenated benzimidazoles
- C07D235/18—Benzimidazoles; Hydrogenated benzimidazoles with aryl radicals directly attached in position 2
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D239/00—Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings
- C07D239/02—Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings not condensed with other rings
- C07D239/24—Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings not condensed with other rings having three or more double bonds between ring members or between ring members and non-ring members
- C07D239/26—Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings not condensed with other rings having three or more double bonds between ring members or between ring members and non-ring members with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached to ring carbon atoms
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D239/00—Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings
- C07D239/02—Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings not condensed with other rings
- C07D239/24—Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings not condensed with other rings having three or more double bonds between ring members or between ring members and non-ring members
- C07D239/28—Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings not condensed with other rings having three or more double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, directly attached to ring carbon atoms
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D239/00—Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings
- C07D239/70—Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings condensed with carbocyclic rings or ring systems
- C07D239/72—Quinazolines; Hydrogenated quinazolines
- C07D239/74—Quinazolines; Hydrogenated quinazolines with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, attached to ring carbon atoms of the hetero ring
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D239/00—Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings
- C07D239/70—Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings condensed with carbocyclic rings or ring systems
- C07D239/72—Quinazolines; Hydrogenated quinazolines
- C07D239/86—Quinazolines; Hydrogenated quinazolines with hetero atoms directly attached in position 4
- C07D239/88—Oxygen atoms
- C07D239/91—Oxygen atoms with aryl or aralkyl radicals attached in position 2 or 3
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D241/00—Heterocyclic compounds containing 1,4-diazine or hydrogenated 1,4-diazine rings
- C07D241/36—Heterocyclic compounds containing 1,4-diazine or hydrogenated 1,4-diazine rings condensed with carbocyclic rings or ring systems
- C07D241/38—Heterocyclic compounds containing 1,4-diazine or hydrogenated 1,4-diazine rings condensed with carbocyclic rings or ring systems with only hydrogen or carbon atoms directly attached to the ring nitrogen atoms
- C07D241/40—Benzopyrazines
- C07D241/42—Benzopyrazines with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached to carbon atoms of the hetero ring
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D241/00—Heterocyclic compounds containing 1,4-diazine or hydrogenated 1,4-diazine rings
- C07D241/36—Heterocyclic compounds containing 1,4-diazine or hydrogenated 1,4-diazine rings condensed with carbocyclic rings or ring systems
- C07D241/38—Heterocyclic compounds containing 1,4-diazine or hydrogenated 1,4-diazine rings condensed with carbocyclic rings or ring systems with only hydrogen or carbon atoms directly attached to the ring nitrogen atoms
- C07D241/40—Benzopyrazines
- C07D241/44—Benzopyrazines with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to carbon atoms of the hetero ring
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D249/00—Heterocyclic compounds containing five-membered rings having three nitrogen atoms as the only ring hetero atoms
- C07D249/02—Heterocyclic compounds containing five-membered rings having three nitrogen atoms as the only ring hetero atoms not condensed with other rings
- C07D249/08—1,2,4-Triazoles; Hydrogenated 1,2,4-triazoles
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D257/00—Heterocyclic compounds containing rings having four nitrogen atoms as the only ring hetero atoms
- C07D257/02—Heterocyclic compounds containing rings having four nitrogen atoms as the only ring hetero atoms not condensed with other rings
- C07D257/04—Five-membered rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D261/00—Heterocyclic compounds containing 1,2-oxazole or hydrogenated 1,2-oxazole rings
- C07D261/02—Heterocyclic compounds containing 1,2-oxazole or hydrogenated 1,2-oxazole rings not condensed with other rings
- C07D261/06—Heterocyclic compounds containing 1,2-oxazole or hydrogenated 1,2-oxazole rings not condensed with other rings having two or more double bonds between ring members or between ring members and non-ring members
- C07D261/10—Heterocyclic compounds containing 1,2-oxazole or hydrogenated 1,2-oxazole rings not condensed with other rings having two or more double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
- C07D261/18—Carbon atoms having three bonds to hetero atoms, with at the most one bond to halogen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D263/00—Heterocyclic compounds containing 1,3-oxazole or hydrogenated 1,3-oxazole rings
- C07D263/02—Heterocyclic compounds containing 1,3-oxazole or hydrogenated 1,3-oxazole rings not condensed with other rings
- C07D263/30—Heterocyclic compounds containing 1,3-oxazole or hydrogenated 1,3-oxazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members
- C07D263/32—Heterocyclic compounds containing 1,3-oxazole or hydrogenated 1,3-oxazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached to ring carbon atoms
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D263/00—Heterocyclic compounds containing 1,3-oxazole or hydrogenated 1,3-oxazole rings
- C07D263/02—Heterocyclic compounds containing 1,3-oxazole or hydrogenated 1,3-oxazole rings not condensed with other rings
- C07D263/30—Heterocyclic compounds containing 1,3-oxazole or hydrogenated 1,3-oxazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members
- C07D263/34—Heterocyclic compounds containing 1,3-oxazole or hydrogenated 1,3-oxazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D263/00—Heterocyclic compounds containing 1,3-oxazole or hydrogenated 1,3-oxazole rings
- C07D263/02—Heterocyclic compounds containing 1,3-oxazole or hydrogenated 1,3-oxazole rings not condensed with other rings
- C07D263/30—Heterocyclic compounds containing 1,3-oxazole or hydrogenated 1,3-oxazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members
- C07D263/34—Heterocyclic compounds containing 1,3-oxazole or hydrogenated 1,3-oxazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
- C07D263/48—Nitrogen atoms not forming part of a nitro radical
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D263/00—Heterocyclic compounds containing 1,3-oxazole or hydrogenated 1,3-oxazole rings
- C07D263/52—Heterocyclic compounds containing 1,3-oxazole or hydrogenated 1,3-oxazole rings condensed with carbocyclic rings or ring systems
- C07D263/54—Benzoxazoles; Hydrogenated benzoxazoles
- C07D263/56—Benzoxazoles; Hydrogenated benzoxazoles with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached in position 2
- C07D263/57—Aryl or substituted aryl radicals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D271/00—Heterocyclic compounds containing five-membered rings having two nitrogen atoms and one oxygen atom as the only ring hetero atoms
- C07D271/02—Heterocyclic compounds containing five-membered rings having two nitrogen atoms and one oxygen atom as the only ring hetero atoms not condensed with other rings
- C07D271/06—1,2,4-Oxadiazoles; Hydrogenated 1,2,4-oxadiazoles
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D271/00—Heterocyclic compounds containing five-membered rings having two nitrogen atoms and one oxygen atom as the only ring hetero atoms
- C07D271/02—Heterocyclic compounds containing five-membered rings having two nitrogen atoms and one oxygen atom as the only ring hetero atoms not condensed with other rings
- C07D271/06—1,2,4-Oxadiazoles; Hydrogenated 1,2,4-oxadiazoles
- C07D271/07—1,2,4-Oxadiazoles; Hydrogenated 1,2,4-oxadiazoles with oxygen, sulfur or nitrogen atoms, directly attached to ring carbon atoms, the nitrogen atoms not forming part of a nitro radical
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D271/00—Heterocyclic compounds containing five-membered rings having two nitrogen atoms and one oxygen atom as the only ring hetero atoms
- C07D271/02—Heterocyclic compounds containing five-membered rings having two nitrogen atoms and one oxygen atom as the only ring hetero atoms not condensed with other rings
- C07D271/10—1,3,4-Oxadiazoles; Hydrogenated 1,3,4-oxadiazoles
- C07D271/107—1,3,4-Oxadiazoles; Hydrogenated 1,3,4-oxadiazoles with two aryl or substituted aryl radicals attached in positions 2 and 5
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D277/00—Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings
- C07D277/02—Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings not condensed with other rings
- C07D277/20—Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members
- C07D277/22—Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached to ring carbon atoms
- C07D277/30—Radicals substituted by carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D277/00—Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings
- C07D277/02—Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings not condensed with other rings
- C07D277/20—Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members
- C07D277/32—Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
- C07D277/56—Carbon atoms having three bonds to hetero atoms with at the most one bond to halogen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D277/00—Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings
- C07D277/60—Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings condensed with carbocyclic rings or ring systems
- C07D277/62—Benzothiazoles
- C07D277/64—Benzothiazoles with only hydrocarbon or substituted hydrocarbon radicals attached in position 2
- C07D277/66—Benzothiazoles with only hydrocarbon or substituted hydrocarbon radicals attached in position 2 with aromatic rings or ring systems directly attached in position 2
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D279/00—Heterocyclic compounds containing six-membered rings having one nitrogen atom and one sulfur atom as the only ring hetero atoms
- C07D279/10—1,4-Thiazines; Hydrogenated 1,4-thiazines
- C07D279/12—1,4-Thiazines; Hydrogenated 1,4-thiazines not condensed with other rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D295/00—Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms
- C07D295/04—Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms with substituted hydrocarbon radicals attached to ring nitrogen atoms
- C07D295/14—Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms with substituted hydrocarbon radicals attached to ring nitrogen atoms substituted by carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals
- C07D295/145—Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms with substituted hydrocarbon radicals attached to ring nitrogen atoms substituted by carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals with the ring nitrogen atoms and the carbon atoms with three bonds to hetero atoms attached to the same carbon chain, which is not interrupted by carbocyclic rings
- C07D295/15—Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms with substituted hydrocarbon radicals attached to ring nitrogen atoms substituted by carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals with the ring nitrogen atoms and the carbon atoms with three bonds to hetero atoms attached to the same carbon chain, which is not interrupted by carbocyclic rings to an acyclic saturated chain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D295/00—Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms
- C07D295/04—Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms with substituted hydrocarbon radicals attached to ring nitrogen atoms
- C07D295/14—Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms with substituted hydrocarbon radicals attached to ring nitrogen atoms substituted by carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals
- C07D295/155—Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms with substituted hydrocarbon radicals attached to ring nitrogen atoms substituted by carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals with the ring nitrogen atoms and the carbon atoms with three bonds to hetero atoms separated by carbocyclic rings or by carbon chains interrupted by carbocyclic rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D295/00—Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms
- C07D295/16—Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms acylated on ring nitrogen atoms
- C07D295/20—Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms acylated on ring nitrogen atoms by radicals derived from carbonic acid, or sulfur or nitrogen analogues thereof
- C07D295/205—Radicals derived from carbonic acid
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D295/00—Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms
- C07D295/22—Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms with hetero atoms directly attached to ring nitrogen atoms
- C07D295/24—Oxygen atoms
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D307/00—Heterocyclic compounds containing five-membered rings having one oxygen atom as the only ring hetero atom
- C07D307/02—Heterocyclic compounds containing five-membered rings having one oxygen atom as the only ring hetero atom not condensed with other rings
- C07D307/04—Heterocyclic compounds containing five-membered rings having one oxygen atom as the only ring hetero atom not condensed with other rings having no double bonds between ring members or between ring members and non-ring members
- C07D307/18—Heterocyclic compounds containing five-membered rings having one oxygen atom as the only ring hetero atom not condensed with other rings having no double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
- C07D307/24—Carbon atoms having three bonds to hetero atoms with at the most one bond to halogen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D307/00—Heterocyclic compounds containing five-membered rings having one oxygen atom as the only ring hetero atom
- C07D307/02—Heterocyclic compounds containing five-membered rings having one oxygen atom as the only ring hetero atom not condensed with other rings
- C07D307/34—Heterocyclic compounds containing five-membered rings having one oxygen atom as the only ring hetero atom not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members
- C07D307/38—Heterocyclic compounds containing five-membered rings having one oxygen atom as the only ring hetero atom not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members with substituted hydrocarbon radicals attached to ring carbon atoms
- C07D307/54—Radicals substituted by carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D307/00—Heterocyclic compounds containing five-membered rings having one oxygen atom as the only ring hetero atom
- C07D307/02—Heterocyclic compounds containing five-membered rings having one oxygen atom as the only ring hetero atom not condensed with other rings
- C07D307/34—Heterocyclic compounds containing five-membered rings having one oxygen atom as the only ring hetero atom not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members
- C07D307/56—Heterocyclic compounds containing five-membered rings having one oxygen atom as the only ring hetero atom not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
- C07D307/68—Carbon atoms having three bonds to hetero atoms with at the most one bond to halogen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D307/00—Heterocyclic compounds containing five-membered rings having one oxygen atom as the only ring hetero atom
- C07D307/77—Heterocyclic compounds containing five-membered rings having one oxygen atom as the only ring hetero atom ortho- or peri-condensed with carbocyclic rings or ring systems
- C07D307/78—Benzo [b] furans; Hydrogenated benzo [b] furans
- C07D307/79—Benzo [b] furans; Hydrogenated benzo [b] furans with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached to carbon atoms of the hetero ring
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D309/00—Heterocyclic compounds containing six-membered rings having one oxygen atom as the only ring hetero atom, not condensed with other rings
- C07D309/02—Heterocyclic compounds containing six-membered rings having one oxygen atom as the only ring hetero atom, not condensed with other rings having no double bonds between ring members or between ring members and non-ring members
- C07D309/04—Heterocyclic compounds containing six-membered rings having one oxygen atom as the only ring hetero atom, not condensed with other rings having no double bonds between ring members or between ring members and non-ring members with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached to ring carbon atoms
- C07D309/06—Radicals substituted by oxygen atoms
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D309/00—Heterocyclic compounds containing six-membered rings having one oxygen atom as the only ring hetero atom, not condensed with other rings
- C07D309/02—Heterocyclic compounds containing six-membered rings having one oxygen atom as the only ring hetero atom, not condensed with other rings having no double bonds between ring members or between ring members and non-ring members
- C07D309/08—Heterocyclic compounds containing six-membered rings having one oxygen atom as the only ring hetero atom, not condensed with other rings having no double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D311/00—Heterocyclic compounds containing six-membered rings having one oxygen atom as the only hetero atom, condensed with other rings
- C07D311/02—Heterocyclic compounds containing six-membered rings having one oxygen atom as the only hetero atom, condensed with other rings ortho- or peri-condensed with carbocyclic rings or ring systems
- C07D311/04—Benzo[b]pyrans, not hydrogenated in the carbocyclic ring
- C07D311/06—Benzo[b]pyrans, not hydrogenated in the carbocyclic ring with oxygen or sulfur atoms directly attached in position 2
- C07D311/08—Benzo[b]pyrans, not hydrogenated in the carbocyclic ring with oxygen or sulfur atoms directly attached in position 2 not hydrogenated in the hetero ring
- C07D311/16—Benzo[b]pyrans, not hydrogenated in the carbocyclic ring with oxygen or sulfur atoms directly attached in position 2 not hydrogenated in the hetero ring substituted in position 7
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D317/00—Heterocyclic compounds containing five-membered rings having two oxygen atoms as the only ring hetero atoms
- C07D317/08—Heterocyclic compounds containing five-membered rings having two oxygen atoms as the only ring hetero atoms having the hetero atoms in positions 1 and 3
- C07D317/44—Heterocyclic compounds containing five-membered rings having two oxygen atoms as the only ring hetero atoms having the hetero atoms in positions 1 and 3 ortho- or peri-condensed with carbocyclic rings or ring systems
- C07D317/46—Heterocyclic compounds containing five-membered rings having two oxygen atoms as the only ring hetero atoms having the hetero atoms in positions 1 and 3 ortho- or peri-condensed with carbocyclic rings or ring systems condensed with one six-membered ring
- C07D317/48—Methylenedioxybenzenes or hydrogenated methylenedioxybenzenes, unsubstituted on the hetero ring
- C07D317/62—Methylenedioxybenzenes or hydrogenated methylenedioxybenzenes, unsubstituted on the hetero ring with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to atoms of the carbocyclic ring
- C07D317/68—Carbon atoms having three bonds to hetero atoms with at the most one bond to halogen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D333/00—Heterocyclic compounds containing five-membered rings having one sulfur atom as the only ring hetero atom
- C07D333/02—Heterocyclic compounds containing five-membered rings having one sulfur atom as the only ring hetero atom not condensed with other rings
- C07D333/04—Heterocyclic compounds containing five-membered rings having one sulfur atom as the only ring hetero atom not condensed with other rings not substituted on the ring sulphur atom
- C07D333/26—Heterocyclic compounds containing five-membered rings having one sulfur atom as the only ring hetero atom not condensed with other rings not substituted on the ring sulphur atom with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
- C07D333/38—Carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D413/00—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
- C07D413/02—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings
- C07D413/04—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings directly linked by a ring-member-to-ring-member bond
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D413/00—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
- C07D413/02—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings
- C07D413/12—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings linked by a chain containing hetero atoms as chain links
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D417/00—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00
- C07D417/02—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing two hetero rings
- C07D417/12—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing two hetero rings linked by a chain containing hetero atoms as chain links
-
- C—CHEMISTRY; METALLURGY
- C08—ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
- C08B—POLYSACCHARIDES; DERIVATIVES THEREOF
- C08B37/00—Preparation of polysaccharides not provided for in groups C08B1/00 - C08B35/00; Derivatives thereof
- C08B37/0006—Homoglycans, i.e. polysaccharides having a main chain consisting of one single sugar, e.g. colominic acid
- C08B37/0009—Homoglycans, i.e. polysaccharides having a main chain consisting of one single sugar, e.g. colominic acid alpha-D-Glucans, e.g. polydextrose, alternan, glycogen; (alpha-1,4)(alpha-1,6)-D-Glucans; (alpha-1,3)(alpha-1,4)-D-Glucans, e.g. isolichenan or nigeran; (alpha-1,4)-D-Glucans; (alpha-1,3)-D-Glucans, e.g. pseudonigeran; Derivatives thereof
- C08B37/0012—Cyclodextrin [CD], e.g. cycle with 6 units (alpha), with 7 units (beta) and with 8 units (gamma), large-ring cyclodextrin or cycloamylose with 9 units or more; Derivatives thereof
- C08B37/0015—Inclusion compounds, i.e. host-guest compounds, e.g. polyrotaxanes
-
- C—CHEMISTRY; METALLURGY
- C08—ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
- C08L—COMPOSITIONS OF MACROMOLECULAR COMPOUNDS
- C08L5/00—Compositions of polysaccharides or of their derivatives not provided for in groups C08L1/00 or C08L3/00
- C08L5/16—Cyclodextrin; Derivatives thereof
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C2601/00—Systems containing only non-condensed rings
- C07C2601/04—Systems containing only non-condensed rings with a four-membered ring
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C2601/00—Systems containing only non-condensed rings
- C07C2601/06—Systems containing only non-condensed rings with a five-membered ring
- C07C2601/08—Systems containing only non-condensed rings with a five-membered ring the ring being saturated
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C2601/00—Systems containing only non-condensed rings
- C07C2601/12—Systems containing only non-condensed rings with a six-membered ring
- C07C2601/14—The ring being saturated
Definitions
- the invention relates to compounds that bind the glucagon-like peptide 1 (GLP-1) receptor, methods of their synthesis, methods of their therapeutic and/or prophylactic use, and methods of their use in stabilizing GLP-1 receptor in vitro for crystallization of the GLP-1 receptor.
- GLP-1 glucagon-like peptide 1
- the invention relates to compounds that are modulators of the GLP-1 receptors and also compounds capable of inducing a stabilizing effect on the receptor for use in structural analyses of the GLP-1 receptor.
- the present invention is directed to compounds adapted to act as stabilizers, modulators or potentiators of certain Class B GPCRs.
- These compounds may have activity with respect to glucagon receptor, GIP receptor, GLP-1 and GLP-2 receptors, and PTH receptor on their own or in the presence of receptor ligands, which include but are not limited to GIP(l-42), PTH(l-34), Glucagon(l-29), GLP-2(l-33), GLP- 1(7-36), GLP-1 (9-36), oxyntomodulin and exendin variants.
- receptor ligands include but are not limited to GIP(l-42), PTH(l-34), Glucagon(l-29), GLP-2(l-33), GLP- 1(7-36), GLP-1 (9-36), oxyntomodulin and exendin variants.
- GLP-1 R Glucagon-like peptide 1 receptor
- GLP-1 R belongs to Family Bl of the seven- transmembrane G protein-coupled receptors, and its natural agonist ligand is the peptide hormone glucagon-like peptide- 1 (GLP-1).
- GLP-1 is a peptide hormone arising by its alternative enzymatic cleavage from proglucagon, the prohormone precursor for GLP-1, which is highly expressed in enteroendocrine cells of the intestine, the alpha cells of the endocrine pancreas (islets of Langerhans), and the brain (Kieffer T. J. and Habener, J. F. Endocrin. Rev.
- GLP-1 receptors couple to the a subunit of G protein, with subsequent activation of adenylate cyclase and increase of cAMP levels, thereby potentiating glucose- stimulated insulin secretion. Therefore, GLP-1 is an attractive therapeutic to lower blood glucose and preserve the ⁇ -cells of the pancreas of diabetic patients.
- Glucagon has been used for decades in medical practice within diabetes and several glucagon-like peptides are being developed for various therapeutic indications. GLP-1 analogs and derivatives are being developed for the treatment for patients suffering from diabetes.
- Structural coordinates can be leveraged as a discovery platform for generating novel chemical leads through virtual ligand screening followed by in vitro screening and chemical optimization of hits for standard drug-like properties and efficacy.
- the present invention is directed to compounds adapted to act as stabilizers, potentiators or modulators of GLP-1 receptor; methods of their preparation and methods of their use, such as in treatment of a malcondition mediated by GLP-1 receptor activation, or when modulation or potentiation of GLP-1 receptor is medically indicated.
- Certain embodiments of the present invention comprise a compound having the structure of Formula III 4 yvi
- each of X 1A , XIB, 2 A , 2B is C, CH or N, provided that no more than one of and XiB is N and no more than one of X 2 A and X 2 B is N;
- each of Xjc, XID, and XIE is CH or N;
- each R4 is independently H, alkyl, alkoxy, or alkyl substituted with one or more R 43 , halogen, perhaloalkyl, perhaloalkoxy, -CN, -ORto, or -NR41R42;
- Wi is -(CR a R b iii-Li-i CR a Rt j i-Ri or R 4 ; or Wj and R 4 taken together comprise a 5- or 6- membered heterocyclic ring fused with the ring to which Wj and R4 are attached and having one, two or three heteroatoms where each such heteroatom is independently selected from O, N, and S, and where any ring atom of such heterocyclic ring may be optionally substituted with one or more-Lr R 13 or R 13 ; or W ⁇ comprises a 5- or 6- membered heterocyclic ring fused with a phenyl ring and having one, two or three heteroatoms where each such heteroatom is independently selected from O, N, and S, and where any ring atom of such fused heterocyclic ring and phenyl ring moiety may be optionally substituted with one or more R 14 ; L ⁇ is -0-, -C(O)-, -OC(O)-, -
- R is R 13 , -O-(CH 2 ) n -R 13 , or R, 0 ;
- each Rio, R i and R 12 is independently H or alkyl
- Ri 3 is cycloalkyl, heterocycloalkyl, aryl, or heteroaryl, or a fused bicycle of any two of such ring moieties, or R 13 and R 10 taken together with the N atom to which they are attached form a heterocyclic ring, where any ring atom of Ri 3 may be optionally substituted with one or more R 14 or R 15 ;
- each R 14 is independently H, alkyl, halo, hydroxy, cyano, alkoxy, perhaloalkyl, and perhaloalkoxy, -ORio, -(CH 2 ) n -COOR 10 , -SR 10 , -SO-R, 0 , -SO ⁇ o, -(CH 2 ) n - NR contextR 12 , -NHCO(CH 2 ) n -R 12 , -N(R, COCCH,),, -R 12 , or -NH(CH 2 ) n -R 12 ;
- R 15 is cycloalkyl, heterocycloalkyl, aryl, or heteroaryl, or a fused bicycle of any two of such ring moieties, where any ring atom of R15 may be optionally substituted with one or more R 14;
- each R 5 is independently H, alkyl, alkoxy, alkyl substituted with one or more R 53 , halogen, perhaloalkyl, perhaloalkoxy, -CN, -OR50, or -NR 51 R 52 ;
- W 2 is -(CR a Rb)i 2 -L 2 -(CRaRb) j 2-R 2 or R 5 ; or W 2 and R 5 taken together comprise a 5- or
- W 2 comprises a 5- or 6- membered heterocyclic ring fused with a phenyl ring and having one, two or three heteroatoms where each such heteroatom is independently selected from O, N, and S, and where any ring atom of such heterocyclic ring may be optionally substituted with one or more -(CR a R )i 2 -L 2 -(CRaRb)j 2 -R 2 or R 2 ; or W 2 comprises a 5- or 6- membered heterocyclic ring fused with a phenyl ring and having one, two or three heteroatoms where each such heteroatom is independently selected from O, N, and S, and where any ring atom of such heterocyclic ring or phenyl ring may be optionally substituted with one or more of R 24 and wherein one ring atom of such fused ring moiety is optionally substituted with L 3 -R 25 ;
- L 2 is -0-, -C(O)-, -OC(O)-, -C(0)0-, -NR20-, -C(O)NR 20 -, -N(R 20 )-C(O)-, -N(R 20 )- S(0 2 )-, -S(O 2 )-NR 20 - -SC-2-, -0(CH 2 ) q CO-, -CO(CH 2 ) q O-, null, oxazolyl, oxadiazolyl, triazolyl, pyrazolyl, or pyrimidinyl;
- Each R a and R b is independently H, hydroxy, methyl, or both R a and R b attached to the same carbon are, taken together, oxo, or cycloalkyl;
- R 2 is R 26 , -0-(CH 2 ) n - R 26 , R 23 or L 4 -R 23 ;
- L 4 is -0-(CH 2 ) n -,-C ⁇ C-, -C(O)NR 20 -(CH 2 ) n -, -N(R 20 )-C(O)-(CH 2 ) n -, -N(R 20 )-S(O 2 )-, - S(0 2 )-NR 2 o-, or cyclopropylene; each R 2 o is independently H or alkyl;
- R 23 is cycloalkyl, heterocycloalkyl, aryl, or heteroaryl, or a fused bicycle of any two of such ring moieties, or R 23 and R 20 taken together with the N atom to which they are attached form a heterocyclic ring optionally fused with aryl or heteroaryl, where any ring atom of R 23 may be optionally substituted with one or more of R 24 and wherein one ring atom of R 23 is optionally substituted with L 3 -R 25 ;
- each R 24 is independently selected from H, halo, alkyl, hydoxy, oxo, cyano, alkoxy, perhaloalkyl, perhaloalkoxy, nitro or amino, -0-(CH 2 ) n -R 21 , - (CH 2 ) n -0-R 2 i, - 0-(CH 2 ) n -0-R 21 , -(CH 2 ) favor-NR 21 R 22 , -(CH 2 ) n -N(R 21 )CO(CH 2 ) n -R 21 , -(C3 ⁇ 4) n - N(R 21 )S0 2 (CH 2 ) n -R 21 , -(CH 2 ) n - S0 2 - N(R 21 )-(CH 2 ) n -R 21 , -(CH 2 ) n -CO(CH 2 ) contend -R 21> -(CH 2 ) m
- each R 21 and R 22 is independently H or alkyl, -(CH 2 ) n -COOH, or two taken together with the nitrogen atom to which they are attached can form a 3- to 7- membered heterocyclic ring;
- null is null, -0-, -(CH 2 ) n -0-(CH 2 ) n -, -(CH 2 ) n - NR 20 -(CH 2 ) n -;
- each R 25 is independently cycloalkyl, heterocycloalkyl, aryl, or heteroaryl, or a fused bicycle of any two of such ring moieties 1, where any ring atom of R 25 may be optionally substituted with one or more of R 24 ;
- each R 2 6 is independently selected from H, alkyl, alkoxy, oxo, hydroxy, and hydroxy substituted alkyl;
- Y is -C(O)-, -CH 2 -, -C(0)-CH 2 -, or -CH 2 -C(0)-;
- Z is -(CR a R b ) admir-C(0)-R 3 , -(CR a R b ) n -R 3 , -R 34 -C(0)-R 3 or H;
- R 3 is -OR 30 , -NR 31 R 32 or - ⁇ CO)NHSO 2 R 30 ; each R 30 is independently H or alkyl; each R 31 and R 32 is independently H or Q-C6 alkyl optionally substituted with one or more R 33 , or two taken together with the N atom to which they are attached can form a 3- to 7-membered heterocyclic ring; each R 33 is independently halo, hydroxyl, alkoxy, perhaloalkyl, perhaloalkoxy, carboxyl, -COO-R 30 , or - OR30; R 34 is cycloalkyl, heterocycloalkyl, aryl, or heteroaryl; where any ring atom of R 34 may be optionally substituted with one or more R 3 ; each R 35 is independently H, alkyl, halo, hydroxy, cyano, alkoxy or perhaloalkyl;
- each R40 and R 50 is independently H or alkyl; each R41 and R42 is independently H or alkyl, -(CH 2 ) n -COO-R 4 o, -CiOJ-Rto, aryl, heteroaryl, or two taken together with the N atom to which they are attached can form a 3- to 7-membered heterocyclic ring; each R51 and R 52 is independently H or alkyl, -(CH 2 ) n -COO- R50, -C(0)-R 5 o, aryl, heteroaryl, or two taken together with the N atom to which they are attached can form a 3- to 7-membered heterocyclic ring; each R43 is independently H, halo, hydroxyl, -NR41R42, or alkoxy, each R53 is independently H, halo, hydroxyl, -NR 5 jRs 2 , or alkoxy;
- k 0, 1, 2, 3 or 4;
- each m is independently 0 or 1 ;
- each n is independently 0, 1 , 2, 3 or 4;
- each q is independently 1 or 2;
- each il , i2, j 1 and j2 is independently 0, 1 , 2, 3 or 4.
- a pharmaceutical composition comprising a compound of the invention together with at least one pharmaceutically acceptable carrier, diluent or excipient is provided.
- a method of use of a compound of the invention comprising preparation of a medicament is provided.
- the invention provides a pharmaceutical combination comprising a compound of the invention and a second medicament.
- the second medicament is an agonist or modulator for glucagon receptor, GIP receptor, GLP-2 receptor, or PTH receptor, or glucagon-like peptide 1 (GLP-1) receptor.
- the second medicament is exenatide, liraglutide, taspoglutide, albiglutide, or lixisenatide or other insulin regulating peptide.
- the second medicament is a DPPIV inhibitor.
- the second medicament is medically indicated for the treatment of type II diabetes.
- the second embodiment is an insulin secretagogue such as a sulfonylurea (e.g., Carbutamide, Acetohexamide, Chlorpropamide, Tolbutamide, Tolazamide, Glipizide, Gliclazide, Glibenclamide (glyburide), Gliquidone, Glyclopyramide, and Glimepiride) or a meglitinide; a hepatic glucose reducer (e.g., metformin); a peroxisome proliferator-activated receptor (PPAR) agonist (e.g., a thiazolidinedione or glitazone) or other insulin sensitizer; a glucose absorption blocker (e.g., alpha-glucosidase inhibitors); incretin mimetics (e.g., GLP1R agonists) or an incretin enhancer or GPR119 agonist.
- a sulfonylurea e.g., Carbutamide, Aceto
- a method of activation, potentiation or agonism of a GLP-1 receptor comprising contacting the receptor with a compound, pharmaceutical composition or pharmaceutical combination of the invention.
- a method for treatment of a malcondition in a subject for which activation, potentiation or agonism of a GLP-1 receptor is medically indicated where such method comprises administering to such subject a compound, pharmaceutical composition or pharmaceutical combination of the invention.
- selective activation, potentiation or agonism of a GLP-1 receptor is medically indicated.
- the malcondition comprises type I diabetes, type II diabetes, gestational diabetes, obesity, excessive appetite, insufficient satiety, or metabolic disorder.
- the invention provides methods for synthesis of certain compounds including compounds of the invention. In certain other embodiments, the invention provides certain intermediate compounds associated with such methods of synthesis.
- compounds for enhancing the stabilization of a GLP-1 receptor are provided.
- methods for enhancing the stabilizing of a GLP-1 receptor in structural biology studies are provided through the use of compounds of the invention.
- Certain embodiments of the present invention comprise a compound having the structure of Formula I, II, III, IV, or V:
- each of XiA, XIB, X2A, X2B is C, CH or N, provided that no more than one of XIA and XIB is N and no more than one of X 2 A and X 2 B is N;
- each of Xic, XID, and XIE is C, CH or N;
- XtF is O or S
- each R4 is independently H, alkyl, alkoxy, or alkyl substituted with one or more R 4 3, halogen, perhaloalkyl, perhaloalkoxy, -CN, -OR 40 , or -NR41R42;
- Wt is - ⁇ CR a Rb)i Li-( or R4; or Wi and R 4 taken together comprise a 5- or 6- membered heterocyclic ring fused with the ring to which Wj and R4 are attached and having one, two or three heteroatoms where each such heteroatom is independently selected from O, N, and S, and where any ring atom of such heterocyclic ring may be optionally substituted with one or more-Li- R 13 or R 13 ; or Wi comprises a 5- or 6- membered heterocyclic ring fused with a phenyl ring and having one, two or three heteroatoms where each such heteroatom is independently selected from O, N, and S, and where any ring atom of such fused heterocyclic ring and phenyl ring moiety may be optionally substituted with one or more Ri 4 ; Lj is -0-, -C(O)-, -OC(O)-, - C(0)0-, -NR 10 - , -C(O)NR 10
- each R 10 , Rn and R 12 is independently H or alkyl
- Ri3 is cycloalkyl, heterocycloalkyl, aryl, or heteroaryl, or a fused bicycle of any two of such ring moieties, or Rj 3 and R 10 taken together with the N atom to which they are attached form a heterocyclic ring, where any ring atom of R 13 may be optionally substituted with one or more Ri 4 or R 15 ;
- each i 4 is independently H, alkyl, halo, hydroxy, cyano, alkoxy, perhaloalkyl, and perhaloalkoxy, -OR 10 , -(CH 2 ) n -COOR ]0 , -SR 10 , -SO-R 10 , -SO 2 Ri 0 , -(CH 2 ) n - NR U R 12 , -NHCO(CH 2 ) n -R 12 , -N(Rn)CO(CH 2 ) n -R 12 , or -NH(CH 2 ) n -R 12 ;
- R 15 is cycloalkyl, heterocycloalkyl, aryl, or heteroaryl, or a fused bicycle of any two of such ring moieties, where any ring atom of R15 may be optionally substituted with one or more R 14;
- each R 5 is independently H, alkyl, alkoxy, alkyl substituted with one or more R 53 , halogen, perhaloalkyl, perhaloalkoxy, -CN, -OR50, or -NR 51 R 52 ;
- W 2 is -(CR a Rb)i2-L 2 -(CR a Rb) j2 -R 2 or R 5 ; or W 2 and R5 taken together comprise a 5- or
- W 2 comprises a 5- or 6- membered heterocyclic ring fused with a phenyl ring and having one, two or three heteroatoms where each such heteroatom is independently selected from O, N, and S, and where any ring atom of such heterocyclic ring may be optionally substituted with one or more - ⁇ CR a Rb)i 2 -L 2 -(CR a Rb)j 2 -R 2 or R 2 ; or W 2 comprises a 5- or 6- membered heterocyclic ring fused with a phenyl ring and having one, two or three heteroatoms where each such heteroatom is independently selected from O, N, and S, and where any ring atom of such heterocyclic ring or phenyl ring may be optionally substituted with one or more of R 24 and wherein one ring atom of such fused ring moiety is optionally substituted with L 3 -R 25 ;
- L 2 is -0-, -C(O)-, -OC(O)-, -C(0)0-, -NR20-, -C(O)NR 20 -, -N(R 20 )-C(O)-, -N(R 20 )- S(0 2 )-, -S(O 2 )-NR 20 -,-SO 2 -, -0(CH 2 ) q CO-, -CO(CH 2 ) q O, null, oxazolyl, oxadiazolyl, triazolyl, pyrazolyl, or pyrimidinyl;
- Each R a and b is independently H, hydroxy, methyl, or both R a and R b attached to the same carbon are, taken together, oxo, or cycloalkyl;
- R 2 is R 26 , -0-(C3 ⁇ 4) compassion- R 26 , R 23 or L 4 -R 23 ;
- L 4 is -0-(CH 2 ) n -,-C ⁇ C-, -C(O)NR 20 -(CH 2 ) n -, -N(R 20 )-C(O)-(CH 2 ) n -, -N(R 20 )-S(O 2 )-, -
- each R 2 o is independently H or alkyl
- R 23 is cycloalkyl, heterocycloalkyl, aryl, or heteroaryl, or a fused bicycle of any two of such ring moieties, or R 23 and R 20 taken together with the N atom to which they are attached form a heterocyclic ring optionally fused with aryl or heteroaryl, where any ring atom of R 23 may be optionally substituted with one or more of R 24 and wherein one ring atom of R 23 is optionally substituted with L3-R25;
- each R 24 is independently selected from H, halo, alkyl, hydoxy, oxo, cyano, alkoxy, perhaloalkyl, perhaloalkoxy, nitro or amino, -0-(CH 2 ) n -R 21 , - (CH 2 ) n -0-R 2 i, - 0-(CH 2 ) n -0-R 2 l , -(CH 2 ) n -NR 21 R 22 , -(CH 2 ) n -N(R 21 )CO(CH 2 ) n -R 21 , -(CH 2 ) n - N(R 21 )S0 2 (CH 2 ) n -R 21 , -(CH 2 ) n - S0 2 - N(R 21 )-(CH 2 ) n -R 21 , -(CH 2 ) n -CO(CH 2 ) n -R 21, -(CH 2
- each R 21 and R 22 is independently H or alkyl, -(CH 2 ) n -COOH, or two taken together with the nitrogen atom to which they are attached can form a 3- to 7- membered heterocyclic ring;
- L 3 is null, -0-, -(CH 2 ) n -0-(CH 2 ) n -, -(CH 2 ) n - NR 20 -(CH 2 ) n -;
- each R 2 5 is independently cycloalkyl, heterocycloalkyl, aryl, or heteroaryl, or a fused bicycle of any two of such ring moieties 1, where any ring atom of R 25 may be optionally substituted with one or more of R 24 ;
- each R 26 is independently selected from H, alkyl, alkoxy, oxo, hydroxy, and hydroxy substituted alkyl;
- Y is -C(O)-, -CH 2 -, -C(0)-CH 2 -, or -CH 2 -C(0)-;
- Z is -(CR a R b ) n -C(0)-R 3 , -(CR a R b ) n -R 3 , -R 34 -C(0)-R 3 or H;
- R 3 is -OR30, -NR 3 iR 32 or - ⁇ CO)NHS0 2 R 3 o; each R 30 is independently H or alkyl; each R 31 and R 32 is independently H or Ci-C ⁇ alkyl optionally substituted with one or more R 33 , or two taken together with the N atom to which they are attached can form a 3- to 7-membered heterocyclic ring; each R 33 is independently halo, hydroxyl, alkoxy, perhaloalkyl, perhaloalkoxy, carboxyl, -COO-R30, or - OR 30 ; R 34 is cycloalkyl, heterocycloalkyl, aryl, or heteroaryl; where any ring atom of R 3 4 may be optionally substituted with one or more R 35 ; each R 35 is independently H, alkyl, halo, hydroxy, cyano, alkoxy or perhaloalkyl;
- each R 4 o and R50 is independently H or alkyl; each R ⁇ and R 42 is independently H or alkyl, -(CH2) n -COO-R4o, -C(O)-R40, aryl, heteroaryl, or two taken together with the N atom to which they are attached can form a 3- to 7-membered heterocyclic ring; each R 51 and R 52 is independently H or alkyl, -(CH 2 ) n -COO- R 50 , -C(0)-R 5 o, aryl, heteroaryl, or two taken together with the N atom to which they are attached can form a 3- to 7-membered heterocyclic ring; each R43 is independently H, halo, hydroxyl, -NR41R42, or alkoxy; each R 53 is independently H, halo, hydroxyl, -NR 5 iR 5 2, or alkoxy;
- k 0, 1, 2, 3 or 4;
- each m is independently 0 or 1 ;
- each n is independently 0, 1, 2, 3 or 4;
- each q is independently 1 or 2;
- each il, i2, jl and j2 is independently 0, 1, 2, 3 or 4.
- Certain embodiments of the present invention comprise a compound having the structure of Formula I or a pharmaceutically acceptable isomer, isotope, enantiomer, salt, ester, prodrug, hydrate or solvate thereof. Certain embodiments of the present invention comprise a compound having the structure of Formula II or a pharmaceutically acceptable isomer, isotope, enantiomer, salt, ester, prodrug, hydrate or solvate thereof. Certain embodiments of the present invention comprise a compound having the structure of Formula III or a pharmaceutically acceptable isomer, isotope, enantiomer, salt, ester, prodrug, hydrate or solvate thereof.
- Certain embodiments of the present invention comprise a compound having the structure of Formula IV or a pharmaceutically acceptable isomer, isotope, enantiomer, salt, ester, prodrug, hydrate or solvate thereof. Certain embodiments of the present invention comprise a compound having the structure of Formula V or a pharmaceutically acceptable isomer, isotope, enantiomer, salt, ester, prodrug, hydrate or solvate thereof.
- Wt can be attached to one of XJA, XIB, XIC, XID and XIB- hi certain of such embodiments the ring atom of XJA, XIB, XIC, XID and XIE to which W ⁇ is attached is C.
- Wi is attached to a carbon atom of the 5-membered heteroaryl ring in Formula IV.
- Wj is attached to XIE; and X ⁇ is C.
- Certain embodiments of the present invention comprise a compound having the structure of Formula I
- each of XtA, XIB, 2A, 2B is C, CH or N, provided that no more than one of X ⁇ A and XiB is N and no more than one of X 2 A and X 2 B is N;
- each R4 is independently H, alkyl, alkoxy, or alkyl substituted with one or more R43, halogen, perhaloalkyl, perhaloalkoxy, -CN, -OR40, or -NILHR42;
- Wj is -(CRaRb)ii-Li-( CR a R b i j i-Ri or R4; or Wj and R4 taken together comprise a 5- or 6- membered heterocyclic ring fused with the ring to which W !
- Wj comprises a 5- or 6- membered heterocyclic ring fused with a phenyl ring and having one, two or three heteroatoms where each such heteroatom is independently selected from O, N, and S, and where any ring atom of such fused heterocyclic ring and phenyl ring moiety may be optionally substituted with one or more R 14 ;
- Li is -0-, -C(O)-, -OC(O)-, -C(0)0-, -NR 10 - , -C(O)NR 10 -, -N(R 10 )-C(O)-, -N(R 10 )- (CH 2 ) n -C(0)-, -N(Rio)-C(0 N(R 10 )-, -N(R 10 )-S(O 2 )-, -S(O 2 )-NR 10 -, or - N(S(0 2 )-(CH 2 ) n -
- Ri is R 13 , -0-(CH 2 ) n -R 13 , or R I0 ;
- each Rio, Rn and R 12 is independently H or alkyl
- R 13 is cycloalkyl, heterocycloalkyl, aryl, or heteroaryl, or a fused bicycle of any two of such ring moieties, or R 13 and R 10 taken together with the N atom to which they are attached form a heterocyclic ring, where any ring atom of R13 may be optionally substituted with one or more R 14 or R15;
- each Ri4 is independently H, alkyl, halo, hydroxy, cyano, alkoxy, perhaloalkyl, and perhaloalkoxy, -ORio, -(CH 2 ) complicat -COOR 10 , -SR 10 , -SO-R 10 , -SO 2 Ri 0 , -NR n Ri 2 , - NHCO(CH 2 ) n -R 12 , -N(R intend)CO(CH 2 ) n -R 12 , or -NH(CH 2 ) n -R I2 ;
- Ri 5 is cycloalkyl, heterocycloalkyl, aryl, or heteroaryl, or a fused bicycle of any two of such ring moieties, where any ring atom of R 15 may be optionally substituted with one or more R 14;
- each R 5 is independently H, alkyl, alkoxy, alkyl substituted with one or more R 53 , halogen, perhaloalkyl, perhaloalkoxy, -CN, -OR50, or -NR 51 R 52 ;
- W 2 is - ⁇ CR a Rb)i 2 -L 2 -(CR a R b )j 2 -R 2 or R 5 ; or W 2 and R 5 taken together comprise a 5- or 6- membered heterocyclic ring fused with the ring to which W 2 and R 5 are attached and having one, two or three heteroatoms where each such heteroatom is independently selected from O, N, and S, and where any ring atom of such heterocyclic ring may be optionally substituted with one or more -(CRaRb)i 2 -L 2 -(CR a Rb)j2-R2 or R 2 ; or W 2 comprises a 5- or 6- membered heterocyclic ring fused with a phenyl ring and having one, two or three heteroatoms where each such heteroatom is independently selected from O, N, and S, and where any ring atom of such heterocyclic ring or phenyl ring may be optionally substituted with one or more of R 24 and wherein one ring
- L 2 is - ⁇ -, -C(O)-, -OC(O)-, -C(0)O, -NR 20 -, -C(O)NR 20 -, -N(R 20 )-C(O)-, -N(R 20 )- S(0 2 )-, -S(O 2 )-NR 20 -,-SO 2 -, -0(CH 2 ) q CO-, -CO(CH 2 ) q O-, null, oxazolyl, oxadiazolyl, triazolyl, pyrazolyl, or pyrimidinyl;
- Each R a and Rb is independently H, hydroxy, methyl, or both R a and R b attached to the same carbon are, taken together, oxo or cycloalkyl;
- R 2 is R 26 , -0-(CH 2 ) n - R 26 , R 23 or -0-(CH 2 ) n -R 23 ;
- each R 20 is independently H or alkyl
- R 23 is cycloalkyl, heterocycloalkyl, aryl, or heteroaryl, or a fused bicycle of any two of such ring moieties, or R 23 and R 20 taken together with the N atom to which they are attached form a heterocyclic ring optionally fused with aryl or heteroaryl, where any ring atom of R 2 3 may be optionally substituted with one or more of R 24 and wherein one ring atom of R 2 3 is optionally substituted with L 3 -R 2 5; each R 24 is independently selected from H, halo, alkyl, hydoxy, oxo, cyano, alkoxy, perhaloalkyl, perhaloalkoxy, nitro or amino, -0-(CH 2 ) n -R 21 , - (CH 2 ) n -0-R 21 , -0-(CH 2 ) n -0- 21, -(CH 2 ) contradict-NR 21 R 22 , -(CH 2 )
- each R 21 and R 22 is independently H or alkyl, -(CH 2 ) deliberately-COOH, or two taken together with the nitrogen atom to which they are attached can form a 3- to 7-membered heterocyclic ring;
- L 3 is null, -0-, -(CH 2 ) n -0-(CH 2 ) n -, -(CH 2 ) n - NR 20 -(CH 2 ) n -; each R 25 is independently cycloalkyl, heterocycloalkyl, aryl, or heteroaryl, or a fused bicycle of any two of such ring moieties 1, where any ring atom of R 25 may be optionally substituted with one or more of R 24 ;
- each R 26 is independently selected from H, alkyl, alkoxy, oxo, hydroxy, and hydroxy substituted alkyl;
- Y is -C(O)-, -CH 2 -, -C(0)-CH 2 -, or -CH 2 -C(0)-;
- Z is -(CH 2 ) n -C(0)-R 3 , -(CH 2 ) n -R 3 , -R 34 -C(0)-R 3 or H;
- R 34 is cycloalkyl, heterocycloalkyl, aryl, or heteroaryl; where any ring atom of R 34 may be optionally substituted with one or more R 35 ; each R 35 is independently H, alkyl, halo, hydroxy, cyano, alkoxy or perhaloalkyl;
- R 3 is -OR 30 , or -NR 31 R 32 ; each R 30 is independently H or alkyl;
- each R 31 and R 32 is independently H or C C 6 alkyl optionally substituted with one or more R 33 , or two taken together with the N atom to which they are attached can form a 3- to 7-membered heterocyclic ring;
- each R 33 is independently halo, hydroxyl, alkoxy, perhaloalkyl, perhaloalkoxy, carboxyl, -COO-R 3 o, or -OR 30 ;
- each R 4 0 and R50 is independently H or alkyl; each R41 and R4 2 is independently H or alkyl, -(CH 2 ) n -COO-R4o, -C(0)-R4o, aryl, heteroaryl, or two taken together with the N atom to which they are attached can form a 3- to 7-membered heterocyclic ring;
- each R 51 and R 52 is independently H or alkyl, -(CH 2 ) n -COO-R5 0 , -C(0)-Rso, aryl, heteroaryl, or two taken together with the N atom to which they are attached can form a 3- to 7-membered heterocyclic ring;
- each R43 is independently H, halo, hydroxyl, -NR4iR4 2 , or alkoxy;
- each R53 is independently H, halo, hydroxyl, -NR5iR 52 , or alkoxy;
- k 0, 1, 2, 3 or 4;
- each m is independently 0 or 1 ;
- each n is independently 0, 1, 2, 3 or 4;
- each q is independently 1 or 2;
- each il, i2, jl and j2 is independently 0, 1, 2, 3 or 4.
- Certain embodiments of the present invention comprise a compound having the structure of Formula II
- R ⁇ is R 13 or -0-(CH 2 )n-Ri3 or Ri 0 ; each Ri 0 , Rn and Ri 2 is independently H or alkyl; R 13 is cycloalkyl, heterocycloalkyl, aryl, or heteroaryl, or a fused bicycle of any two of such ring moieties, or R 13 and R 10 taken together with the N atom to which they are attached form a heterocyclic ring, where any ring atom of R 13 may be optionally substituted with one or more R 14 or Ri 5 ; each Ri 4 is independently H, alkyl, halo, hydroxy, cyano, alkoxy, perhaloalkyl, and perhaloalkoxy, -OR 10 , -(CH 2 ) favor -COOR 10 , -SRi 0 , -SO-Rio, -S0 2 Rio, - NR professionRi2, -NHCO(CH 2 ) n -R 12 , -N(
- L 2 is -0-, -C(O)-, -OC(O)-, -C(0)0-, -NR 20 -, -C(O)NR 20 -, -N(R 20 )-C(O)-, -N(R 20 )- S(0 2 )-, -S(O 2 )-NR 20 -,-SO 2 -, -0(CH 2 ) q CO-, -CO(CH 2 ) q O-, null, oxazolyl, oxadiazolyl, triazolyl, pyrazolyl, or pyrimidinyl; each R 20 is independently H or alkyl;
- R 2 is R 26 , -0-(CH 2 ) n - R 26 , R 23 or -0-(CH 2 ) n -R 2 3;
- R23 is cycloalkyl, heterocycloalkyl, aryl, or heteroaryl, or a fused bicycle of any two of such ring moieties, or R 2 3 and R 20 taken together with the N atom to which they are attached form a heterocyclic ring optionally fused with aryl or heteroaryl, where any ring atom of R 23 may be optionally substituted with one or more of R 24 and wherein one ring atom of R 2 3 is optionally substituted with L3-R 25 ; each R 24 is independently selected from H, halo, alkyl, hydoxy, oxo, cyano, alkoxy, perhaloalkyl, perhaloalkoxy, nitro or amino, -0-(CH 2 ) n -R 2 i, - (CH 2 )urgeon
- Z is -(CH 2 ) n -C(0)-R 3 , -(CH 2 ) n -R 3 , -R 3 -C(0)-R 3 or H;
- R 34 is cycloalkyl, heterocycloalkyl, aryl, or heteroaryl; where any ring atom of R 34 may be optionally substituted with one or more R 35 ;
- each R35 is independently H, alkyl, halo, hydroxy, cyano, alkoxy or perhaloalkyl;
- R3 is -OR30, or -NR3iR3 2 ;
- each R 30 is independently H or alkyl;
- each R 31 and R3 2 is independently H or C ⁇ -C alkyl optionally substituted with one or more R33, or two taken together with the N atom to which they are attached can form a 3- to 7-membered heterocyclic ring;
- each R33 is independently halo, hydroxyl, alkoxy, perhal
- Ri may be phenyl substituted with one or more of methyl, ethyl, isopropyl, t-butyl, -CF 3 , methoxy, ethoxy, hydroxyl, -OCF3, or halogen, methylthio, and -S0 2 CH 3 ; in certain of such embodiments R] may be phenyl substituted with one or more of methyl, methoxy, and -CF 3 ; in certain of such embodiments, Ri is
- L 2 is -OC(O)-, -0-, oxazolyl, oxadiazolyl, triazolyl, pyrazolyl, or pyrimidinyl; and in certain such embodiemnts L 2 is -OC(O)-; and in other such embodiments L 2 is oxazolyl, oxadiazolyl, triazolyl, pyrazolyl, or pyrimidinyl.
- R 2 imay be phenyl substituted with butyloxy, pentyloxy, hexyloxy, heptyloxy, or octyloxy; in other such embodiments R 2 is phenyl substituted with methyl, pentyl, hexyl, heptyl, octyl, or nonyl.
- R 2 is biphenyl; and in certian of such embodiments, the distal ring of such biphenyl is substituted with methyl; and in certain of such embodiments the methyl substituent of the biphenyl is at the ortho position of the distal phenyl ring of the biphenyl.
- the invention provides compounds where each of XJA, XIB, X 2 A, and X 2 B is CH. In certain embodiments, the invention provides compounds where one of XiA and is N. In certain of such embodiments, X 2 A, and X 2 B is CH. In certain of such embodiments, one of X 2 A and X 2 B is N. In certain embodiments, the invention provides compounds where both one of XJA and X ⁇ is N and one of X 2 A and X 2 B is N.
- the invention provides compounds where one of Xjc, XID and X E is N. In certain embodiments, the invention provides compounds where XJD is N. In certain embodiments, the invention provides compounds where XJF is O.
- the invention provides compounds where Y is -C(O)-; in certain other embodiments, Y is -CH 2 -; in certain other embodiments, Y is -C(0)-CH 2 -; in certain other embodiments, Y is -CH 2 -C(0)-.
- the invention provides compounds where Z is -(CH 2 ) n -C(0)- R 3 , and in certain of such embodiments such n is 0, 1, or 2; in certain of such embodiments R 3 is -OH.
- R 3 is -NH(CR a Rb) n -C(0)-R 3 ; in certain of such embodiments, both R a and Rb are methyl; in certain of such embodiments, R 3 is -OH.
- the R 3 is -(CO)NHS0 2 R 3 ; in certain of such embodiments, R 3 is -OH.
- the invention provides compounds where Z is -(CH2) regularly-R3, and in certain of such embodiments such n is 0, 1 , or 2.
- the invention provides compounds where Z is -R 3 4-C(0)-R 3 , and in certain of such embodiments, R 3 is - OH.
- the invention provides compounds where Z can be -R34- C(0)OH.
- -C(0)OH is attached in the ortho position of R 34
- others -C(0)OH is attached in the meta position of R 34
- in yet others -C(0)OH is attached in the para position of R 34 .
- R 34 is aryl and in certain of such embodiments R 34 is phenyl.
- the invention provides compounds where k is 1 ; in other embodiments k is zero and in yet other embodiments k is 2.
- the invention provides compounds where W ⁇ is attached in the para position; in certain embodiments, the invention provides compounds where W 2 is attached in the para position; and in certain such embodiments, the invention provides compounds where Wj is attached in the para position and W is attached in the para position.
- the invention provides compounds where Wi can be - (CR a R b )ii-L 1 -( CR a Rt j i-Ri and in certain of such embodiments il is 0, in others il is 1, and in yet others i 1 is 2. In certain of such embodiments j 1 is 0, in others j 1 is 1 , and in yet others j 1 is 2.
- the invention provides compounds where L ⁇ is -NR 10 C(O)- or where Lj is -NR 10 - or where Li is -N(R 10 )SO 2 -. In certain of such embodiments R 10 is -H.
- the invention provides compounds where W ⁇ can be -NH-C(O)- (CH 2 ) n -R 1 . In certain of such embodiments, the invention provides compounds where Wi can be -NH-C(0)-CH 2 -R!.
- Ri is Ri 3 . In certain embodiments, Ri can be -0-(CH 2 ) n -R 13 and in certain of such embodiments -0-R 13 and in certain other such embodiments -0-CH 2 -R 13 . In certain of such embodiments, R 13 can be aryl optionally substituted with one or more R 14 and in certain of such embodiments R 13 is phenyl.
- R 14 can be independently halo, alkoxy, perhaloalkyl, or perhaloalkoxy.
- Ri 4 can be alkoxy and or perhaloalkyl.
- the invention provides compounds where R 13 is cycloalkyl or heterocycloalkyl and in certain of such embodiments Ri 3 is cyclopentyl, cyclohexyl, thiazolyl, tetrahydrofuranyl, oxazolyl, thiophenyl, 1 ,2,4-oxadiazolyl, furanyl, tetrahydro-2H-pyranyl, or piperidinyl.
- the invention provides compounds where Ru is unsubstituted or substituted at one or more ring position with substituents selected from the group consisting of methyl, ethyl, isopropyl, t-butyl, -CF 3 , methoxy, ethoxy, hydroxyl, -OCF 3 , halogen (e.g., F, CI, Br or I), methylthio, and -S0 2 CH 3 .
- the invention provides compounds where Ri 3 is substituted with one or more of methyl, methoxy, F or -CF 3 .
- each R 3 i and R 32 can be independently H, alkyl or alkyl substituted with carboxyl.
- at least one of R 31 and R 32 is can be H.
- the invention provides compounds where Ri may be
- each of R a and R b is H, in other embodiments, at least one of
- R a and R b is methyl; and in yet other embodiments at least one pair of R a and R b is, taken together, oxo or cycloalkyl.
- the invention provides compounds where W 2 can be - (CR a R b )i2-L 2 -( CR a R b ) j2 -R 2 and in certain of such embodiments i 2 is 0, in others i 2 is 1, and in yet others i 2 is 2. In certain of such embodiments j 2 is 0, in others j 2 is 1, and in yet others j 2 is 2.
- the invention provides compounds where L 2 is -0-, -OC(O)-, -C(0)0-, -NR20-, -C(O)NR 20 -, -N(R 20 )-C(O)-, -N(R 20 )-S(O 2 )- or -S(O 2 )-NR 20 -, -CO-, -S0 2 -, -0(CH 2 ) q CO-, -CO(CH 2 ) q O-, null, oxazolyl, oxadiazolyl, triaxolyl, pyrazolyl, or pyrirnidinyl.
- L 2 is -OC(O)-, -0-, oxazolyl, oxadiazolyl, triazolyl, pyrazolyl, or pyrirnidinyl. In certain of such embodiments L 2 is oxadiazolyl.
- the invention provides compounds where W 2 can be attached in the para position. In certain embodiments, the invention provides compounds where W 2 can be -OC(0)-(CH 2 ) n -R 2 . In certain embodiments, the invention provides compounds where W 2 can be -OC(0)-CH 2 -R 2.
- the invention provides compounds where R 2 is phenyl substituted with alkyl, alkoxy, -0-(CH 2 ) n -R 21 , cycloalkyl, hetercycloalkyl, or aryl; in certain such embodiments R 2 is phenyl substituted with -(CH 2 ) t CH 3 where t is 0, 5, 6, 7, 8 or 9; in certain such embodiments R 2 is phenyl substituted with -0(CH 2 ) t CH 3 where t is 4, 5, 6, 7, or 8; in certain such embodiments R 2 is phenyl substituted with -0-(CH 2 ) n -R 2 i where n is 1, 2 or 3 and R 21 is isopropyl; in certain such embodiments R 2 is phenyl substituted with R 25 , where R 25 is phenyl, cyclohexyl, or piperidyl; in certain such embodiments R 25 is substituted with methyl, and in certain of such embodiments the
- the invention provides compounds where W 2 can be - C(0)NH-(CH 2 ) n -R 2. In certain of such embodiments, W 2 can be -C(0)NH-R 2. In certain embodiments, the invention provides compounds where W 2 can be - NHC(0)-(CH 2 ) literal-R 2. In certain of such embodiments, W 2 can be - NHC(0)-R 2 , In certain embodiments, the invention provides compounds where W 2 can be -C(0)-(CH 2 ) n -R 2. In certain of such embodiments, W 2 can be -C(0)-(CH 2 ) -R 2. In certain embodiments, the invention provides compounds where W 2 can be - (CH 2 ) n -R 2.
- W 2 can be -(CH 2 ) 2 -R 2.
- the invention provides compounds where W 2 can be - (CH 2 ) n O-R 2.
- W 2 can be -(CH 2 )0-R 2.
- the invention provides compounds where W 2 can be - NHS0 2 -R 2.
- the invention provides compounds where W 2 can be - S0 2 NH-R 2.
- the invention provides compounds where W 2 can be - (CH 2 ) n -S0 2 R 2 .
- the invention provides compounds where W 2 can be -(CH 2 ) 2 -S0 2 R 2.
- the invention provides compounds where W 2 can be - (CH 2 ) n -NHR 2. In certain of such embodiments, the invention provides compounds where W 2 can be -(CH 2 ) 2 -NHR 2 . In certain embodiments, the invention provides compounds where W 2 can be - NH(CH 2 ) n -R 2 . In certain of such embodiments, the invention provides compounds where W 2 can be -NH(CH 2 ) 2 -R 2. In certain embodiments, the invention provides compounds where W 2 can be - C(0)R 2. In certain embodiments, the invention provides compounds where W 2 can be - OR 2. In certain embodiments, the invention provides compounds where W 2 can be - NHR 2.
- the invention provides compounds where W 2 can be - C(0)(CH 2 ) n O-R 2. In certain of such embodiments, the invention provides compounds where W 2 can be - C(0)(CH 2 )0-R 2. In certain embodiments, the invention provides compounds where W 2 can be - 0(CH 2 ) n C(0)-R 2. In certain of such embodiments, the invention provides compounds where W 2 can be -O(CH 2 )C(0)-R 2.
- the invention provides compounds where R 2 can be alkyl or cycloalkyl . In certain embodiments, the invention provides compounds where R 2 can be heterocycloalkyl optionally substituted with one or more R 24 . In certain embodiments, the invention provides compounds where R 2 can be aryl optionally substituted with one or more R 24 . In certain embodiments, the invention provides compounds where R 2 is biphenyl optionally substituted with one or more alkyl. In certain of such embodiments, the invention provides compounds where R 2 is biphenyl substituted with methyl. In certain embodiments, the invention provides compounds where each R 24 can be independently halo or alkoxy. In certain embodiments, the invention provides compounds where R 2 can be phenyl substituted with at least one R 24 and R 24 can be alkoxy. In certain embodiments, the invention provides compounds where R 2 can be 4-heptyloxy phenyl.
- the invention provides compounds where Wj can be -ORio, - NHCO(CH 2 ) n -Ri, -N(CH 3 )CO(CH 2 ) n -R, or -NH(CH 2 )n-Ri;
- Rn can be cycloalkyl, aryl, or heteroaryl, where any ring atom of R 13 may be optionally substituted with R 14 ;
- each Ri 4 can be independently H, alkyl, halo, alkoxy, perhaloalkyl or perhaloalkoxy;
- W 2 can be -OCO- (CH 2 ) n -R 2 ;
- R 2 can be R 21 , cycloalkyl, -0-R 21 , -0-(CH 2 ) n -0-R 2 i, heteroaryl or aryl, where aryl may be optionally substituted with one or more R 24 ; and each R 24 can be independently halo, alkyl, alkoxy
- the invention provides compounds where W 2 and R5 taken together comprise a 5- or 6-membered heterocyclic ring fused with the ring to which W 2 and R 5 are attached to form a heterobicyclic ring, and in certain such embodiments the heterobicyclic ring moiety has one of the following structures:
- Q is -C(0)-R 23 or R 23 ; and in certain such embodiments, R 23 is phenyl substituted with one or more R 24 ; in cetain of such embodiments R 24 is attached in the para position.
- the invention provides compounds where W 2 is benzoxazolyl, benzothiazolyl, benzimidazolyl, benzo[d]isoxazolyl, or benzo[c]isoxazolyl, where any phenyl ring atom of such fused ring moiety may be substituted with one or more of R.24 and additionally or alternatively where one phenyl ring atom of such fused ring moiety may be substituted with L 3 -R 25 .
- the invention provides one or more of the following compounds 1-515 or any pharmaceutically acceptable salt, ester, prodrug, homolog, tautomer, stereoisomer, isotope, or hydrate, or solvate thereof.
- the invention provides a compound selected from compounds 1, 3, 4, 16, 17, 18, 32, 39, 40, 46, 192, 314, 347, 354, 355, 360, 361, 362, 363, 364, 405, 411, 441, 457, 458, and 496, or any pharmaceutically acceptable salt, ester, prodrug, homolog, tautomer, stereoisomer, isotope, or hydrate, or solvate thereof.
- a pharmaceutical composition comprising an invention compound of Formula I, II, III, IV or V, or any pharmaceutically acceptable salt, ester, prodrug, homolog, tautomer, stereoisomer, isotope, or hydrate, or solvate thereof, together with at least one pharmaceutically acceptable carrier, diluent or excipient is provided.
- a pharmaceutical composition comprising an invention compound of Formula I, II, III, IV or V, or any pharmaceutically acceptable salt, ester, prodrug, homolog, tautomer, stereoisomer, isotope, or hydrate, or solvate thereof, and a second medicament is provided.
- the disclosure provides a method of use of compounds of the invention for preparation of a medicament.
- the invention provides a pharmaceutical combination comprising a compound of the invention and a second medicament.
- the second medicament is an agonist or modulator for glucagon receptor, GIP receptor, GLP-2 receptor, or PTH receptor, or glucagon-like peptide 1 (GLP-1) receptor.
- the second medicament is exenatide, liraglutide, taspoglutide, albiglutide, or lixisenatide or other insulin regulating peptide.
- the second medicament is a DPPFV inhibitor.
- the second medicament is medically indicated for the treatment of type II diabetes.
- the second embodiment is a sulfonylurea (e.g., Carbutamide, Acetohexamide, Chlorpropamide, Tolbutamide, Tolazamide, Glipizide, Gliclazide, Glibenclamide (glyburide), Gliquidone, Glyclopyramide, and Glimepiride), metformin or a peroxisome proliferator- activated receptor (PPAR) agonist (e.g., a thiazolidinedione or glitazone).
- a method for activation, potentiation or agonism of a glucagon-like peptide 1 comprising contacting the receptor with an effective amount of a compound, pharmaceutical composition or pharmaceutical combination of the invention.
- a method for activation, potentiation or agonism of a GLP-1 receptor by contacting the receptor with an effective amount of an invention compound, pharmaceutical composition or pharmaceutical combination, wherein the GLP-1 receptor is disposed within a living mammal; in certain embodiments wherein such mammal is a human.
- a method for treatment of a malcondition in a subject for which activation, potentiation or agonism of a GLP-1 receptor is medically indicated by administering an effective amount of an invention compound to the subject at a frequency and for a duration of time sufficient to provide a beneficial effect to the patient.
- a method for treatment of a malcondition in a patient for which activation, potentiation or agonism of a GLP-1 receptor is medically indicated by administering an effective amount of an invention compound to the patient at a frequency and for a duration of time sufficient to provide a beneficial effect to the patient, wherein the malcondition comprises type I diabetes, type II diabetes, gestational diabetes, obesity, excessive appetite, insufficient satiety, or metabolic disorder.
- the subject is a patient or a human being.
- the human being is afflicted with, or at risk of developing, a disease or condition selected from the group consisting of type I diabetes, type II diabetes, gestational diabetes, obesity, excessive appetite, insufficient satiety, and metabolic disorder.
- a disease or condition selected from the group consisting of type I diabetes, type II diabetes, gestational diabetes, obesity, excessive appetite, insufficient satiety, and metabolic disorder.
- said disease is type I diabetes or type II diabetes.
- the invention provides methods for synthesis of certain compounds including compounds of the invention as more fully illustrated herein. In certain other embodiments, the invention provides certain intermediate compounds associated with such methods of synthesis as illustrated herein.
- compounds for enhancing the stabilization of a GLP-1 receptor are provided.
- methods for enhancing the stabilizing of a GLP-1 receptor in structural biology studies are provided through the use of compounds of the invention.
- a compound of the invention may be combined with a GLP-1 receptor in order to increase its thermal stability and additionally enhance its amenability to forming crystals suitable for use in x-ray crystallographic analysis of the structure of such GLP-1 receptor.
- mammals include, for example, humans; non-human primates, e.g. apes and monkeys; cattle; horses; sheep; and goats.
- Non-mammals include, for example, fish and birds.
- a "receptor”, as is well known in the art, is a biomolecular entity usually comprising a protein that specifically binds a structural class of ligands or a single native ligand in a living organism, the binding of which causes the receptor to transduce the binding signal into another kind of biological action, such as signaling a cell that a binding event has occurred, which causes the cell to alter its function in some manner.
- An example of transduction is receptor binding of a ligand causing alteration of the activity of a "G-protein" in the cytoplasm of a living cell.
- GLP-1 compound or "GLP-1 agonist” or “GLP-1 activator” or “GLP-1 inhibitor” or “GLP-1 antagonist” as the terms are used herein refer to compounds that interact in some way with the GLP-1 receptor. They can be agonist or activators, or they can be antagonists or inhibitors. An "GLP-1 compound” of the invention can be selective for action of the GLP-1 receptor family.
- Substantially as the term is used herein means completely or almost completely; for example, a composition that is "substantially free” of a component either has none of the component or contains such a trace amount that any relevant functional property of the composition is unaffected by the presence of the trace amount, or a compound is "substantially pure” is there are only negligible traces of impurities present.
- Substantially enantiomerically pure means a level of enantiomeric enrichment of one enantiomer with respect to the other enantiomer of at least 90%, 95%, 98%, 99%, 99.5% or 99.9%.
- Treating or “treatment” within the meaning herein refers to an alleviation of symptoms associated with a disorder or disease, or inhibition of further progression or worsening of those symptoms, or prevention or prophylaxis of the disease or disorder.
- the expression "effective amount”, when used to describe use of a compound of the invention in providing therapy to a patient suffering from a disorder or malcondition mediated by GLP-1 refers to the amount of a compound of the invention that is effective to bind to as an agonist, potentiator or as an antagonist a GLP-1 receptor in the individual's tissues, wherein the GLP-1 is implicated in the disorder, wherein such binding occurs to an extent sufficient to produce a beneficial therapeutic effect on the patient.
- an "effective amount” or a “therapeutically effective amount” of a compound of the invention refers to an amount of the compound that alleviates, in whole or in part, symptoms associated with the disorder or condition, or halts or slows further progression or worsening of those symptoms, or prevents or provides prophylaxis for the disorder or condition.
- a “therapeutically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic result by acting as an agonist of GLP-1 activity.
- a therapeutically effective amount is also one in which any toxic or detrimental effects of compounds of the invention are outweighed by the therapeutically beneficial effects.
- a therapeutically effective amount of an GLP-1 receptor agonist of the invention is an amount sufficient to control the malcondition, to mitigate the progress of the malcondition, or to relieve the symptoms of the malcondition.
- examples of malconditions that can be so treated include, but not limited to, type II diabetes.
- the preferred compounds of the present invention have a particular spatial arrangement of substituents on the aromatic rings, which is related to the structure activity relationship demonstrated by the compound class. Often such substitution arrangement is denoted by a numbering system; however, numbering systems are often not consistent between different ring systems. In six-membered aromatic systems, the spatial arrangements are specified by the common nomenclature "para” for 1,4-substitution, "meta” for 1,3 -substitution and "ortho" for 1,2-substitution as shown below.
- substituted refers to an organic group as defined herein in which one or more bonds to a hydrogen atom contained therein are replaced by one or more bonds to a non-hydrogen atom such as, but not limited to, a halogen (i.e., F, CI, Br, and I); an oxygen atom in groups such as hydroxyl groups, alkoxy groups, aryloxy groups, aralkyloxy groups, oxo(carbonyl) groups, carboxyl groups including carboxylic acids, carboxylates, and carboyxlate esters; a sulfur atom in groups such as thiol groups, alkyl and aryl sulfide groups, sulfoxide groups, sulfone groups, sulfonyl groups, and sulfonamide groups; a nitrogen atom in groups such as amines, hydroxylamines, nitriles, nitro groups, N-oxides, hydrazides, azides, and
- Non-limiting examples of substituents that can be bonded to a substituted carbon (or other) atom include F, CI, Br, I, OR', OC(0)N(R') 2 , CN, CF 3 , OCF 3 , R', O, S, C(O), S(O), methylenedioxy, ethylenedioxy, N(R') 2 , SR', SOR ⁇ S0 2 R', S0 2 N(R') 2 , S0 3 R', C(0)R', C(0)C(0)R ⁇ C(0)CH 2 C(0)R', C(S)R', C(0)OR', OC(0)R ⁇ C(0)N(R') 2 , OC(0)N(R , ) 2 , C(S)N(R') 2 , (CH 2 )o -2 NHC(0)R', (CH 2 ) 0- 2 N(R')N(R') 2 , N(R')N(R')C(0)R ⁇ N(R')N
- Substituted alkyl, alkenyl, alkynyl, cycloalkyl, and cycloalkenyl groups as well as other substituted groups also include groups in which one or more bonds to a hydrogen atom are replaced by one or more bonds, including double or triple bonds, to a carbon atom, or to a heteroatom such as, but not limited to, oxygen in carbonyl (oxo), carboxyl, ester, amide, imide, urethane, and urea groups; and nitrogen in imines, hydroxyimines, oximes, hydrazones, amidines, guanidines, and nitriles.
- Substituted ring groups such as substituted aryl, heterocyclyl and heteroaryl groups also include rings and fused ring systems in which a bond to a hydrogen atom is replaced with a bond to a carbon atom. Therefore, substituted aryl, heterocyclyl and heteroaryl groups can also be substituted with alkyl, alkenyl, cycloalkyl, aryl, heteroaryl, and alkynyl groups as defined herein, which can themselves be further substituted.
- heteroatoms refers to non-carbon and non-hydrogen atoms, capable of forming covalent bonds with carbon, and is not otherwise limited. Typical heteroatoms are N, O, and S.
- sulfur (S) When sulfur (S) is referred to, it is understood that the sulfur can be in any of the oxidation states in which it is found, thus including sulfoxides (R-S(O)- R') and sulfones (R-S(0) 2 -R'), unless the oxidation state is specified; thus, the term “sulfone” encompasses only the sulfone form of sulfur; the term “sulfide” encompasses only the sulfide (R-S-R') form of sulfur.
- heteroatoms selected from the group consisting of O, NH, NR' and S or "[variable] is O, S . . .” are used, they are understood to encompass all of the sulfide, sulfoxide and sulfone oxidation states of sulfur.
- Alkyl groups include straight chain and branched alkyl groups and cycloalkyl groups having from 1 to about 20 carbon atoms, and typically from 1 to 12 carbons (C ⁇ -C ⁇ 2 alkyl), or, in some embodiments, from 1 to 8 carbon atoms (Ci-Cg alkyl), or, in some embodiments, from 1 to 4 carbon atoms (Q-C4 alkyl).
- straight chain alkyl groups include, but are not limited to, methyl, ethyl, n-propyl, n-butyl, n-pentyl, n-hexyl, n-heptyl, and n-octyl groups.
- branched alkyl groups include, but are not limited to, isopropyl, iso- butyl, sec-butyl, t-butyl, neopentyl, isopentyl, and 2,2-dimethylpropyl groups.
- Alkyl groups as used herein may optionally include one or more further substituent groups.
- Representative substituted alkyl groups can be substituted one or more times with any of the groups listed above, for example, amino, hydroxy, cyano, carboxy, nitro, thio, alkoxy, and halogen groups.
- Cycloalkyl groups are alkyl groups forming a ring structure, which can be substituted or unsubstituted, wherein the ring is either completely saturated, partially unsaturated, or fully unsaturated, wherein if there is unsaturation, the conjugation of the pi-electrons in the ring do not give rise to aromaticity.
- Examples of cycloalkyl include, but are not limited to, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, and cyclooctyl groups.
- the cycloalkyl group has 3 to 8 ring members, whereas in other embodiments the number of ring carbon atoms range from 3 to 5, 3 to 6, or 3 to 7.
- Cycloalkyl groups further include polycyclic cycloalkyl groups such as, but not limited to, norbornyl, adamantyl, bornyl, camphenyl, isocamphenyl, and carenyl groups, and fused rings such as, but not limited to, decalinyl, and the like. Cycloalkyl groups also include rings that are substituted with straight or branched chain alkyl groups as defined above.
- Representative substituted cycloalkyl groups can be mono-substituted or substituted one or more times with any of the groups listed above, for example, but not limited to, amino, hydroxy, cyano, carboxy, nitro, thio, alkoxy, and halogen groups.
- carbocyclic and “carbocycle” denote a ring structure wherein the atoms of the ring are carbon.
- the carbocycle has 3 to 8 ring members, whereas in other embodiments the number of ring carbon atoms is 4, 5, 6, or 7.
- the carbocyclic ring can be substituted with as many as N substituents wherein N is the size of the carbocyclic ring with for example, amino, hydroxy, cyano, carboxy, nitro, thio, alkoxy, and halogen groups.
- Cycloalkylalkyl groups also denoted cycloalkylalkyl, are alkyl groups as defined above in which a hydrogen or carbon bond of the alkyl group is replaced with a bond to a cycloalkyl group as defined above.
- cycloalkylene refers to a divalent radical formed by the removal of two hydrogen atoms from one or more rings of a cycloalkyl group (a nonaromatic hydrocarbon that includes at least one ring).
- cycloalkylene groups is cyclopropylene
- Alkenyl groups include straight and branched chain and cyclic alkyl groups as defined above, except that at least one double bond exists between two carbon atoms.
- alkenyl groups have from 2 to about 20 carbon atoms, and typically from 2 to 12 carbons or, in some embodiments, from 2 to 8 carbon atoms.
- cycloalkenyl alone or in combination denotes a cyclic alkenyl group wherein at least one double bond is present in the ring structure.
- Cycloalkenyl groups include cycloalkyl groups having at least one double bond between two adjacent carbon atoms.
- cycloalkenyl groups include but are not limited to cyclohexenyl, cyclopentenyl, and cyclohexadienyl groups.
- (Cycloalkenyl)alkyl groups are alkyl groups as defined above in which a hydrogen or carbon bond of the alkyl group is replaced with a bond to a cycloalkenyl group as defined above.
- Alkynyl groups include straight and branched chain alkyl groups, except that at least one triple bond exists between two carbon atoms.
- alkynyl groups have from 2 to about 20 carbon atoms, and typically from 2 to 12 carbons or, in some embodiments, from 2 to 8 carbon atoms. Examples include, but are not limited to -C ⁇ CH, -C ⁇ C(CH 3 ), - C ⁇ C(CH 2 CH 3 ), -CH 2 CsCH, -CH 2 C ⁇ C(CH 3 ), and -CH 2 C ⁇ C(CH 2 CH 3 ), among others.
- Aryl groups are cyclic aromatic hydrocarbons that do not contain heteroatoms.
- aryl groups include, but are not limited to, phenyl, azulenyl, heptalenyl, biphenyl, indacenyl, fluorenyl, phenanthrenyl, triphenylenyl, pyrenyl, naphthacenyl, chrysenyl, biphenylenyl, anthracenyl, and naphthyl groups.
- aryl groups contain 6-14 carbons in the ring portions of the groups.
- aryl groups includes groups containing fused rings, such as fused aromatic-aliphatic ring systems (e.g., indanyl, tetrahydronaphthyl, and the like), and also includes substituted aryl groups that have other groups, including but not limited to alkyl, halo, amino, hydroxy, cyano, carboxy, nitro, thio, or alkoxy groups, bonded to one of the ring atoms.
- Representative substituted aryl groups can be mono-substituted or substituted more than once, such as, but not limited to, 2-, 3-, 4-, 5-, or 6-substituted phenyl or naphthyl groups, which can be substituted with groups including but not limited to those listed above.
- Aralkyl groups are alkyl groups as defined above in which a hydrogen or carbon bond of an alkyl group is replaced with a bond to an aryl group as defined above.
- Representative aralkyl groups include benzyl and phenylethyl groups and fused (cycloalkylaryl)alkyl groups such as 4-ethyl-indanyl.
- the aryl moiety or the alkyl moiety or both are optionally substituted with other groups, including but not limited to alkyl, halo, amino, hydroxy, cyano, carboxy, nitro, thio, or alkoxy groups.
- Aralkenyl group are alkenyl groups as defined above in which a hydrogen or carbon bond of an alkyl group is replaced with a bond to an aryl group as defined above.
- Heterocyclyl or heterocyclic groups include aromatic and non-aromatic ring moieties containing 3 or more ring members, of which one or more is a heteroatom such as, but not limited to, N, O, S, or P.
- heterocyclyl include 3 to 20 ring members, whereas other such groups have 3 to 15 ring members.
- At least one ring contains a heteroatom, but every ring in a polycyclic system need not contain a heteroatom.
- a dioxolanyl ring and a benzdioxolanyl ring system are both heterocyclyl groups within the meaning herein.
- a heterocyclyl group designated as a C 2 -heterocyclyl can be a 5-ring with two carbon atoms and three heteroatoms, a 6-ring with two carbon atoms and four heteroatoms and so forth.
- a C 4 - heterocyclyl can be a 5-ring with one heteroatom, a 6-ring with two heteroatoms, and so forth. The number of carbon atoms plus the number of heteroatoms sums up to equal the total number of ring atoms.
- Heterocyclyl groups also include fused ring species including those having fused aromatic and non-aromatic groups.
- a heterocyclyl group also includes polycyclic ring systems containing a heteroatom such as, but not limited to, quinuclidyl and also includes heterocyclyl groups that have substituents, including but not limited to alkyl, halo, amino, hydroxy, cyano, carboxy, nitro, thio, or alkoxy groups, bonded to one of the ring members.
- a heterocyclyl group as defined herein can be a heteroaryl group or a partially or completely saturated cyclic group including at least one ring heteroatom.
- Heterocyclyl groups include, but are not limited to, pyrrolidinyl, furanyl, tetrahydrofuranyl, dioxolanyl, piperidinyl, piperazinyl, morpholinyl, pyrrolyl, pyrazolyl, triazolyl, tetrazolyl, oxazolyl, isoxazolyl, thiazolyl, pyridinyl, thiophenyl, benzothiophenyl, benzofuranyl, dihydrobenzofuranyl, indolyl, dihydroindolyl, azaindolyl, indazolyl, benzimidazolyl, azabenzimidazolyl, benzoxazolyl, benzothiazolyl, benzothiadiazolyl, imidazopyridinyl, isoxazolopyridinyl, thianaphthalenyl, purinyl, xanthinyl,
- Heterocyclyl groups can be substituted.
- Representative substituted heterocyclyl groups can be mono-substituted or substituted more than once, including but not limited to, rings containing at least one heteroatom which are mono, di, tri, tetra, penta, hexa, or higher-substituted with substituents such as those listed above, including but not limited to alkyl, halo, amino, hydroxy, cyano, carboxy, nitro, thio, and alkoxy groups.
- Heteroaryl groups are aromatic ring moieties containing 5 or more ring members, of which, one or more is a heteroatom such as, but not limited to, N, O, and S.
- a heteroaryl group designated as a C 2 -heteroaryl can be a 5 -ring with two carbon atoms and three heteroatoms, a 6-ring with two carbon atoms and four heteroatoms and so forth.
- a C4-heteroaryl can be a 5 -ring with one heteroatom, a 6-ring with two heteroatoms, and so forth. The number of carbon atoms plus the number of heteroatoms sums up to equal the total number of ring atoms.
- Heteroaryl groups include, but are not limited to, groups such as pyrrolyl, pyrazolyl, pyridinyl, pyridazinyl, pyrimidyl, pyrazyl, pyrazinyl, pyrimidinyl, thienyl, triazolyl, tetrazolyl, triazinyl, thiazolyl, thiophenyl, oxazolyl, isoxazolyl, benzothiophenyl, benzofuranyl, indolyl, azaindolyl, indazolyl, benzimidazolyl, azabenzimidazolyl, benzoxazolyl, benzothiazolyl, benzothiadiazolyl, imidazopyridinyl, isoxazolopyridinyl, thianaphthalenyl, purinyl, xanthinyl, adeninyl, guaninyl, quinolin
- heteroaryl and heteroaryl groups include fused ring compounds such as wherein at least one ring, but not necessarily all rings, are aromatic, including tetrahydroquinolinyl, tetrahydroisoquinolinyl, indolyl and 2,3-dihydro indolyl.
- the term also includes heteroaryl groups that have other groups bonded to one of the ring members, including but not limited to alkyl, halo, amino, hydroxy, cyano, carboxy, nitro, thio, or alkoxy groups.
- Representative substituted heteroaryl groups can be substituted one or more times with groups such as those listed above.
- aryl and heteroaryl groups include but are not limited to phenyl, biphenyl, indenyl, naphthyl (1-naphthyl, 2-naphthyl), N-hydroxytetrazolyl, N- hydroxytriazolyl, N-hydroxyimidazolyl, anthracenyl (1 -anthracenyl, 2-anthracenyl, 3- anthracenyl), thiophenyl (2-thienyl, 3-thienyl), furyl (2-furyl, 3-furyl), indolyl, oxadiazolyl, isoxazolyl, quinazolinyl, fluorenyl, xanthenyl, isoindanyl, benzhydryl, acridinyl, thiazolyl, pyrrolyl (2-pyrrolyl), pyrazolyl (3-pyrazolyl), imidazolyl (1-imidazolyl
- Heterocyclylalkyl groups are alkyl groups as defined above in which a hydrogen or carbon bond of an alkyl group is replaced with a bond to a heterocyclyl group as defined above.
- Representative heterocyclyl alkyl groups include, but are not limited to, furan-2-yl methyl, furan-3-yl methyl, pyridine-2-yl methyl (a-picolyl), pyridine-3-yl methyl ( ⁇ -picolyl), pyridine-4-yl methyl ( ⁇ -picolyl), tetrahydrofuran-2-yl ethyl, and indol-2-yl propyl.
- Heterocyclylalkyl groups can be substituted on the heterocyclyl moiety, the alkyl moiety, or both.
- Heteroarylalkyl groups are alkyl groups as defined above in which a hydrogen or carbon bond of an alkyl group is replaced with a bond to a heteroaryl group as defined above. Heteroarylalkyl groups can be substituted on the heteroaryl moiety, the alkyl moiety, or both.
- ring system as the term is used herein is meant a moiety comprising one, two, three or more rings, which can be substituted with non-ring groups or with other ring systems, or both, which can be fully saturated, partially unsaturated, fully unsaturated, or aromatic, and when the ring system includes more than a single ring, the rings can be fused, bridging, or spirocyclic.
- spirocyclic is meant the class of structures wherein two rings are fused at a single tetrahedral carbon atom, as is well known in the art.
- a "monocyclic, bicyclic or polycyclic, aromatic or partially aromatic ring” as the term is used herein refers to a ring system including an unsaturated ring possessing 4n+2 pi electrons, or a partially reduced (hydrogenated) form thereof.
- the aromatic or partially aromatic ring can include additional fused, bridged, or spiro rings that are not themselves aromatic or partially aromatic.
- naphthalene and tetrahydronaphthalene are both a "monocyclic, bicyclic or polycyclic, aromatic or partially aromatic ring" within the meaning herein.
- a benzo-[2.2.2]-bicyclooctane is also a "monocyclic, bicyclic or polycyclic, aromatic or partially aromatic ring" within the meaning herein, containing a phenyl ring fused to a bridged bicyclic system.
- a fully saturated ring has no double bonds therein, and is carbocyclic or heterocyclic depending on the presence of heteroatoms within the meaning herein.
- One specific example includes the formation of a heterocyclic ring between Rj, the N atom to which it is attached, and an Ri 0 in Formula I, e.g., when Li is - NRio-, and ii and jj is zero, becomes -NR 10 Ri.
- alkoxy refers to an oxygen atom connected to an alkyl group, including a cycloalkyl group, as are defined above.
- linear alkoxy groups include but are not limited to methoxy, ethoxy, n-propoxy, n-butoxy, n-pentyloxy, n-hexyloxy, n-heptyloxy, and the like.
- branched alkoxy include but are not limited to isopropoxy, sec-butoxy, tert-butoxy, isopentyloxy, isohexyloxy, and the like.
- cyclic alkoxy include but are not limited to cyclopropyloxy, cyclobutyloxy, cyclopentyloxy, cyclohexyloxy, and the like.
- aryloxy and arylalkoxy refer to, respectively, an aryl group bonded to an oxygen atom and an aralkyl group bonded to the oxygen atom at the alkyl moiety. Examples include but are not limited to phenoxy, naphthyloxy, and benzyloxy.
- acyl group refers to a group containing a carbonyl moiety wherein the group is bonded via the carbonyl carbon atom.
- the carbonyl carbon atom is also bonded to another carbon atom, which can be part of an alkyl, aryl, aralkyl cycloalkyl, cycloalkylalkyl, heterocyclyl, heterocyclylalkyl, heteroaryl, heteroarylalkyl group or the like.
- the group is a "formyl” group, an acyl group as the term is defined herein.
- An acyl group can include 0 to about 12-20 additional carbon atoms bonded to the carbonyl group.
- An acyl group can include double or triple bonds within the meaning herein.
- An acryloyl group is an example of an acyl group.
- An acyl group can also include heteroatoms within the meaning here.
- a nicotinoyl group (pyridyl-3 -carbonyl) group is an example of an acyl group within the meaning herein.
- Other examples include acetyl, benzoyl, phenylacetyl, pyridylacetyl, cinnamoyl, and acryloyl groups and the like.
- the group containing the carbon atom that is bonded to the carbonyl carbon atom contains a halogen, the group is termed a "haloacyl" group.
- An example is a trifluoroacetyl group.
- amine includes primary, secondary, and tertiary amines having, e.g., the formula N(group) 3 wherein each group can independently be H or non-H, such as alkyl, aryl, and the like.
- Amines include but are not limited to R-NH 2 , for example, alkylamines, arylamines, alkylarylamines; R 2 NH wherein each R is independently selected, such as dialkylamines, diarylamines, aralkylamines, heterocyclylamines and the like; and R 3 N wherein each R is independently selected, such as trialkylamines, dialkylarylamines, alkyldiarylamines, triarylamines, and the like.
- the term "amine” also includes ammonium ions as used herein.
- amino group is a substituent of the form -NH 2 , -NHR, -NR 2 , -NR 3 + , wherein each R is independently selected, and protonated forms of each. Accordingly, any compound substituted with an amino group can be viewed as an amine.
- ammonium ion includes the unsubstituted ammonium ion NH 4 + , but unless otherwise specified, it also includes any protonated or quatemarized forms of amines.
- trimethylammonium hydrochloride and tetramethylammonium chloride are both ammonium ions, and amines, within the meaning herein.
- amide includes C- and N-amide groups, i.e., -C(0)NR 2 , and -NRC(0)R groups, respectively.
- Amide groups therefore include but are not limited to carbamoyl groups (-C(0)NH 2 ) and formamide groups (-NHC(O)H).
- a "carboxamido” group is a group of the formula C(0)NR 2 , wherein R can be H, alkyl, aryl, etc.
- carbonyl refers to a -C(O)- group.
- Halo include fluorine, chlorine, bromine and iodine.
- perhaloalkyl refers to an alkyl group where all of the hydrogen atoms are replaced by halogen atoms.
- Perhaloalkyl groups include, but are not limited to, -CF 3 .
- perhaloalkoxy refers to an alkoxy group where all of the hydrogen atoms are replaced by halogen atoms.
- Perhaloalkoxy groups include, but are not limited to, -OCF 3 .
- a “salt” as is well known in the art includes an organic compound such as a carboxylic acid, a sulfonic acid, or an amine, in ionic form, in combination with a counterion.
- acids in their anionic form can form salts with cations such as metal cations, for example sodium, potassium, and the like; with ammonium salts such as ⁇ 3 ⁇ 4 + or the cations of various amines, including tetraalkyl ammonium salts such as tetramethylammonium, or other cations such as trimethylsulfonium, and the like.
- a “pharmaceutically acceptable” or “pharmacologically acceptable” salt is a salt formed from an ion that has been approved for human consumption and is generally non-toxic, such as a chloride salt or a sodium salt.
- a “zwitterion” is an internal salt such as can be formed in a molecule that has at least two ionizable groups, one forming an anion and the other a cation, which serve to balance each other. For example, amino acids such as glycine can exist in a zwitterionic form.
- a “zwitterion” is a salt within the meaning herein.
- the compounds of the present invention may take the form of salts.
- the term “salts" embraces addition salts of free acids or free bases which are compounds of the invention.
- Salts can be “pharmaceutically-acceptable salts.”
- pharmaceutically-acceptable salt refers to salts which possess toxicity profiles within a range that affords utility in pharmaceutical applications. Pharmaceutically unacceptable salts may nonetheless possess properties such as high crystallinity, which have utility in the practice of the present invention, such as for example utility in process of synthesis, purification or formulation of compounds of the invention.
- Suitable pharmaceutically-acceptable acid addition salts may be prepared from an inorganic acid or from an organic acid.
- inorganic acids include hydrochloric, hydrobromic, hydriodic, nitric, carbonic, sulfuric, and phosphoric acids.
- organic acids may be selected from aliphatic, cycloaliphatic, aromatic, araliphatic, heterocyclic, carboxylic and sulfonic classes of organic acids, examples of which include formic, acetic, propionic, succinic, glycolic, gluconic, lactic, malic, tartaric, citric, ascorbic, glucuronic, maleic, fumaric, pyruvic, aspartic, glutamic, benzoic, anthranilic, 4-hydroxybenzoic, phenylacetic, mandelic, embonic (pamoic), methanesulfonic, ethanesulfonic, benzenesulfonic, pantothenic, trifluoromethanesulfonic, 2-hydroxyethanesulfonic, p-toluenesulfonic, sulfanilic, cyclohexylaminosulfonic, stearic, alginic, ⁇ -hydroxybutyric, sal
- Suitable pharmaceutically acceptable base addition salts of compounds of the invention include, for example, metallic salts including alkali metal, alkaline earth metal and transition metal salts such as, for example, calcium, magnesium, potassium, sodium and zinc salts.
- Pharmaceutically acceptable base addition salts also include organic salts made from basic amines such as, for example, N ⁇ -dibenzylethylenediamine, chloroprocaine, choline, diethanolamine, ethylenediamine, meglumine (N-methylglucamine) and procaine.
- Examples of pharmaceutically unacceptable base addition salts include lithium salts and cyanate salts.
- salts may be useful, for example as intermediates in the synthesis of Formula I or II compounds, for example in their purification by recrystallization. All of these salts may be prepared by conventional means from the corresponding compound according to Formula I or II by reacting, for example, the appropriate acid or base with the compound according to Formula I or II.
- pharmaceutically acceptable salts refers to nontoxic inorganic or organic acid and/or base addition salts, see, for example, Lit et al., Salt Selection for Basic Drugs (1986), IntJ. Pharm., 33, 201-217, incorporated by reference herein.
- a "hydrate” is a compound that exists in a composition with water molecules.
- the composition can include water in stoichiometric quantities, such as a monohydrate or a dihydrate, or can include water in random amounts.
- a "hydrate” refers to a solid form, i.e., a compound in water solution, while it may be hydrated, is not a hydrate as the term is used herein.
- a “solvate” is a similar composition except that a solvent other that water replaces the water.
- a solvent other that water replaces the water.
- methanol or ethanol can form an “alcoholate”, which can again be stoichiometric or non-stoichiometric.
- a “solvate” refers to a solid form, i.e., a compound in solution in a solvent, while it may be solvated, is not a solvate as the term is used herein.
- a "prodrug” as is well known in the art is a substance that can be administered to a patient where the substance is converted in vivo by the action of biochemicals within the patients body, such as enzymes, to the active pharmaceutical ingredient.
- prodrugs include esters of carboxylic acid groups, which can be hydrolyzed by endogenous esterases as are found in the bloodstream of humans and other mammals.
- the GLP-1 compounds, their pharmaceutically acceptable salts or hydrolyzable esters of the present invention may be combined with a pharmaceutically acceptable carrier to provide pharmaceutical compositions useful for treating the biological conditions or disorders noted herein in mammalian species, and more preferably, in humans.
- a pharmaceutically acceptable carrier may vary depending upon the type of administration desired (e.g. intravenous, oral, topical, suppository, or parenteral).
- compositions in oral liquid dosage forms e.g. suspensions, elixirs and solutions
- typical pharmaceutical media such as water, glycols, oils, alcohols, flavoring agents, preservatives, coloring agents and the like
- carriers such as starches, sugars, diluents, granulating agents, lubricants, binders, disintegrating agents and the like can be employed.
- compositions of the compounds of the invention alone or in combination with another GLP-1 agonist or another type of therapeutic agent, or both.
- GLP-1 receptor agonists include exenatide, liraglutide, taspoglutide, albiglutide, lixisenatide, and mixtures thereof.
- the GLP-1 agonist is exenatide (Byetta®) or Byetta LAR®. Exenatide is described, for example, in U.S. Pat. Nos. 5,424,286; 6,902,744; 7,297,761, and others, the contents of each of which is herein incorporated by reference in its entirety.
- the GLP-1 agonist is liraglutide (VICTOZA®) (also called NN- 2211 and [Arg34, Lys26]-(N-epsilon-(gamma-Glu(N-alpha-hexadecanoyl))-GLP-l (7-37)), includes the sequence HAEGTFTSDVSSYLEGQAAKEFIAWKVRGRG and is available from Novo Nordisk (Denmark) or Scios (Fremont, Calif. USA). See, e.g., Elbrond et al., 2002, Diabetes Care. August; 25(8): 1398404; Agerso et al., 2002, Diabetologia. February; 45(2): 195-202).
- the GLP-1 agonist is taspoglutide (CAS Registry No. 275371-94- 3) and is available from Hoffman La-Roche. See, for example, U.S. Pat. No. 7,368,427, the contents of which is herein incorporated by reference in its entirety.
- the GLP-1 agonist is albiglutide (SYNCRIA® from GlaxoSmithKline).
- the GLP-1 agonist is lixisenatide (Lyxumia® from Sanofi- Aventis/Zealand Pharma).
- compounds of the invention include stereoisomers, tautomers, solvates, hydrates, isotopes, esters, salts including pharmaceutically acceptable salts, and mixtures thereof.
- Compositions containing a compound of the invention can be prepared by conventional techniques, e.g. as described in Remington: The Science and Practice of Pharmacy, 19th Ed., 1995, incorporated by reference herein. The compositions can appear in conventional forms, for example capsules, tablets, aerosols, solutions, suspensions or topical applications.
- compositions include a compound of the invention and a pharmaceutically acceptable excipient which can be a carrier or a diluent.
- the active compound will usually be mixed with a carrier, or diluted by a carrier, or enclosed within a carrier which can be in the form of an ampoule, capsule, sachet, paper, or other container.
- the active compound can be solid, semi-solid, or liquid material that acts as a vehicle, excipient, or medium for the active compound.
- the active compound can be adsorbed on a granular solid carrier, for example contained in a sachet.
- suitable carriers are water, salt solutions, alcohols, polyethylene glycols, polyhydroxyethoxylated castor oil, peanut oil, olive oil, gelatin, lactose, terra alba, sucrose, dextrin, magnesium carbonate, sugar, cyclodextrin, amylose, magnesium stearate, talc, gelatin, agar, pectin, acacia, stearic acid or lower alkyl ethers of cellulose, silicic acid, fatty acids, fatty acid amines, fatty acid monoglycerides and diglycerides, pentaerythritol fatty acid esters, polyoxyethylene, hydroxymethylcellulose and polyvinylpyrrolidone.
- the carrier or diluent can include any sustained release material known in the art, such as glyceryl monostearate or glyceryl distearate, alone or mixed with a wax.
- the formulations can be mixed with auxiliary agents which do not deleteriously react with the active compounds.
- auxiliary agents which do not deleteriously react with the active compounds.
- Such additives can include wetting agents, emulsifying and suspending agents, salt for influencing osmotic pressure, buffers and/or coloring substances preserving agents, sweetening agents or flavoring agents.
- the compositions can also be sterilized if desired.
- the route of administration can be any route which effectively transports the active compound of the invention to the appropriate or desired site of action, such as oral, nasal, pulmonary, buccal, subdermal, intradermal, transdermal or parenteral, e.g., rectal, depot, subcutaneous, intravenous, intraurethral, intramuscular, intranasal, ophthalmic solution or an ointment, the oral route being preferred.
- the carrier will typically comprise sterile water, although other ingredients that aid solubility or serve as preservatives can also be included.
- injectable suspensions can also be prepared, in which case appropriate liquid carriers, suspending agents and the like can be employed.
- the compounds of the present invention can be formulated using bland, moisturizing bases such as ointments or creams.
- the preparation can be tabletted, placed in a hard gelatin capsule in powder or pellet form or it can be in the form of a troche or lozenge. If a liquid carrier is used, the preparation can be in the form of a syrup, emulsion, soft gelatin capsule or sterile injectable liquid such as an aqueous or non-aqueous liquid suspension or solution.
- Injectable dosage forms generally include aqueous suspensions or oil suspensions which can be prepared using a suitable dispersant or wetting agent and a suspending agent Injectable forms can be in solution phase or in the form of a suspension, which is prepared with a solvent or diluent.
- Acceptable solvents or vehicles include sterilized water, Ringer's solution, or an isotonic aqueous saline solution.
- sterile oils can be employed as solvents or suspending agents.
- the oil or fatty acid is non-volatile, including natural or synthetic oils, fatty acids, mono-, di- or tri-glycerides.
- the formulation can also be a powder suitable for reconstitution with an appropriate solution as described above. Examples of these include, but are not limited to, freeze dried, rotary dried or spray dried powders, amorphous powders, granules, precipitates, or particulates.
- the formulations can optionally contain stabilizers, pH modifiers, surfactants, bioavailability modifiers and combinations of these.
- the compounds can be formulated for parenteral administration by injection such as by bolus injection or continuous infusion.
- a unit dosage form for injection can be in ampoules or in multi-dose containers.
- the formulations of the invention can be designed to provide quick, sustained, or delayed release of the active ingredient after administration to the patient by employing procedures well known in the art.
- the formulations can also be formulated for controlled release or for slow release.
- compositions contemplated by the present invention can include, for example, micelles or liposomes, or some other encapsulated form, or can be administered in an extended release form to provide a prolonged storage and/or delivery effect. Therefore, the formulations can be compressed into pellets or cylinders and implanted intramuscularly or subcutaneously as depot injections. Such implants can employ known inert materials such as silicones and biodegradable polymers, e.g., polylactide-polyglycolide. Examples of other biodegradable polymers include poly(orthoesters) and poly(anhydrides).
- the preparation can contain a compound of the invention, dissolved or suspended in a liquid carrier, preferably an aqueous carrier, for aerosol application.
- a liquid carrier preferably an aqueous carrier
- the carrier can contain additives such as solubilizing agents, e.g., propylene glycol, surfactants, absorption enhancers such as lecithin (phosphatidylcholine) or cyclodextrin, or preservatives such as parabens.
- injectable solutions or suspensions preferably aqueous solutions with the active compound dissolved in polyhydroxylated castor oil.
- Dosage forms can be administered daily, or more than once a day, such as twice or thrice daily. Alternatively dosage forms can be administered less frequently than daily, such as every other day, or weekly, if found to be advisable by a prescribing physician.
- An embodiment of the invention also encompasses prodrugs of a compound of the invention which on administration undergo chemical conversion by metabolic or other physiological processes before becoming active pharmacological substances. Conversion by metabolic or other physiological processes includes without limitation enzymatic (e.g, specific enzymatically catalyzed) and non-enzymatic (e.g., general or specific acid or base induced) chemical transformation of the prodrug into the active pharmacological substance.
- prodrugs will be functional derivatives of a compound of the invention which are readily convertible in vivo into a compound of the invention. Conventional procedures for the selection and preparation of suitable prodrug derivatives are described, for example, in Design of Prodrugs, ed. H. Bundgaard, Elsevier, 1985.
- compositions of a compound described herein including formulating a compound of the invention with a pharmaceutically acceptable carrier or diluent.
- the pharmaceutically acceptable carrier or diluent is suitable for oral administration.
- the methods can further include the step of formulating the composition into a tablet or capsule.
- the pharmaceutically acceptable carrier or diluent is suitable for parenteral administration.
- the methods further include the step of lyophilizing the composition to form a lyophilized preparation.
- the compounds of the invention can be used therapeutically in combination with i) one or more other GLP-1 modulators and/or ii) one or more other types of therapeutic agents which can be administered orally in the same dosage form, in a separate oral dosage form (e.g., sequentially or non-sequentially) or by injection together or separately (e.g., sequentially or non-sequentially).
- combination therapeutic agents include Sitagliptin (MK-0431,Januvia) an oral antihyperglycemic (antidiabetic drug) of the dipeptidyl peptidase-4 (DPP-4) inhibitor class and Exenatide (Byetta) an incretin mimetic.
- Combinations of the invention include mixtures of compounds from (a) and (b) in a single formulation and compounds from (a) and (b) as separate formulations. Some combinations of the invention can be packaged as separate formulations in a kit. In some embodiments, two or more compounds from (b) are formulated together while a compound of the invention is formulated separately.
- the present invention encompasses compounds that bind with high affinity and specificity to the GLP-1 receptor in an agonist manner or as an activator or a potentiator.
- a compound of the invention acts as a positive allosteric modulator of GLP-1 receptor.
- the present invention provides a method for activating or agonizing (i.e., to have an agonic effect, to act as an agonist) a GLP-1 receptor, with a compound of the invention. The method involves contacting the receptor with a suitable concentration of an inventive compound to bring about activation of the receptor. The contacting can take place in vitro, for example in carrying out an assay to determine the GLP- 1 receptor activation activity of an inventive compound undergoing experimentation related to a submission for regulatory approval.
- the method for activating an GLP-1 receptor can also be carried out in vivo, that is, within the living body of a mammal, such as a human patient or a test animal.
- the inventive compound can be supplied to the living organism via one of the routes as described above, e.g., orally, or can be provided locally within the body tissues. In the presence of the inventive compound, activation of the receptor takes place, and the effect thereof can be studied.
- An embodiment of the present invention provides a method of treatment of a malcondition in a patient for which activation of an GLP-1 receptor is medically indicated, wherein the patient is administered the inventive compound in a dosage, at a frequency, and for a duration to produce a beneficial effect on the patient.
- the inventive compound can be administered by any suitable means, examples of which are described above.
- the present invention is directed to compounds adapted to act as stabilizers, modulators or potentiators of Class B GPCRs. These compounds may have activity on their own or in the presence of receptor ligands.
- Receptors include but are not limited to the glucagon receptor, GIP receptor, GLP-1 and GLP-2 receptors, and PTH receptor.
- Ligands with which compounds of the invention may have activity include, but are not limited to, GIP(l-42), PTH(l-34), Glucagon(l-29), GLP-2(l-33), GLP-l(7-36), GLP-1(9- 36), oxyntomodulin, exendin variants, and other insulin regulating peptides.
- Methods of treatments provided by the invention include adr inistration of a compound of the invention, alone or in combination with another pharmacologically active agent to a subject or patient having a malcondition for which activation, potentiation or agonism of a glucagon-like peptide 1 receptor is medically indicated such as type I diabetes, type II diabetes, gestational diabetes, obesity, excessive appetite, insufficient satiety, or metabolic disorder.
- adr inistration of a compound of the invention alone or in combination with another pharmacologically active agent to a subject or patient having a malcondition for which activation, potentiation or agonism of a glucagon-like peptide 1 receptor is medically indicated such as type I diabetes, type II diabetes, gestational diabetes, obesity, excessive appetite, insufficient satiety, or metabolic disorder.
- Reagents (i) TEA, DCM; (ii) ClCO-(CH 2 ) administrat-R 2 , TEA, DCM; (iii) H 2 , Pd/C, THF; (iv) ClCO-(CH 2 ) n -R ! , TEA, DCM or HOOC-(CH 2 ) administrat-R 1 , HOBt, EDC, TEA, DMF.
- Reagents (i) tert-Butyl 2-bromoacetate, NaH, DMF; (ii) H 2 , Pd/C, THF; (iii) C1CO- (CH 2 ) complicat-R 2 , TEA, DCM or HOOC-(CH 2 ) n -R 2 , HATU, TEA, DMF; (iv) TFA, DCM.
- Reagents (i) ClCO-(CH 2 ) complicat-R 2 , TEA, DCM; (ii) tert-Butyl 2-aminoacetate, Na(OAc) 3 BH, DCM.
- Reagents (i) HNR 31 R 32 , HATU, TEA, DMF.
- Reagents (i) R 4 -Ph/Pyridyl-W 1 -COCl, TEA, DCM or R 4 -P /Pyridyl-Wi-C0 2 H, HOBt, EDC, TEA, DMF or R 4 -PbTyridyl-W 1 -COH, Na(OAc) 3 BH, DCM; (ii) TFA, DCM; (iii) HNR 31 R 32 , HATU, TEA, DMF.
- Scheme 8 :
- Reagents (i) C1C0-(CH 2 ) contend-R 2 , TEA, DCM; (ii) TFA, DCM.
- Reagents (i) NH 2 CH 2 (CH 2 ) complicatCH 2 OH, Na(OAc) 3 BH, DCM; (ii) R 4 -Ph ⁇ yridyl-W 1 - COC1, TEA, DCM or R 4 -Ph/Pyridyl-Wi-C0 2 H, HATU, TEA, DMF; (iii) Dess-Martin periodinane, NaHC0 3 , DCM; (iv) 2-Methylbut-2-ene, sodium dihydrogen phosphate, sodium chlorite, t-BuOH.
- Reagents (i) TEA, HATU, DMF; (ii) Lithium formate, DIEA, acetic anhydride, PdCl 2 (dppf), DMF.
- Reagents (i) Hydrazine hydrate, EtOH; (ii) NaOEt, EtOH; (iii) TFA, DCM.
- Reagents (i) N-Methylmorpholine, isobutyl chloroformate, THF, DMF; (ii) 2-Chloro- 1,3-dimethylimidazolinium chloride, TEA, DCM; (iii) TFA, DCM.
- Reagents (i) BrCH 2 CO-(CH 2 ) awkward-R 2 , TEA, DCM; (ii) TFA, DCM.
- Reagents (i) ClCO-(CH 2 ) n -R 2 , DIEA, dioxane; (ii) TFA, DCM.
- Reagents (i) 4-Bromobenzamide, NMP; (ii) Diisobutylaluminum hydride, DCM; (iii) tert-butyl glycine hydrochloride, tetramethylammonium triacetoxyhydroborate, DCM; (iv) HATU, DIEA, DMF; (v) Na 2 C0 3 , B(OH) 2- (CH 2 ) n -R 2 , PdCl 2 (dppf), THF, acetonitrile; (vi) TFA, DCM.
- Reagents (i) 3,4-Diaminobenzonitrile, trimethylaluminum, THF; (ii) Diisobutylaluminum hydride, THF; (iii) tert-Butyl 2-aminoacetate, Na(OAc) 3 BH, DCM; (iv) HATU, TEA, DMF; (v) TFA, DCM.
- Other bicyclic compounds can be made in a similar fashion as outlined in Scheme 20.
- Reagents (i) aryl or heteroaryl bromide or chloride, e,g 2-chloroquinazoline, Suzuki or other coupling conditions; (ii) TFA, DCM.
- Reagents (i) ClCCHCIfc Ri, TEA, DCM or HOOC-(CH 2 ) n -R 1 , HOBt, EDC, TEA,
- Method I The gradient was 20-100% with mobile phase B over 2.5 min then held at 100% for 2.5 min with a flow rate of 1 mL/min.
- Method 2 5% for 1 min, 5-95% over 9 min, then held at 95% for 5 min, with a flow rate of 1 mL/min.
- System 2 Agilent 1200 LCMS equipped with an Agilent Zorbax Extend RRHT 1.8 ⁇ (4.6 x 30 mm) column using water with 0.1% formic acid as mobile phase A and acetonitrile with 0.1% formic acid as mobile phase B.
- Method 3 The gradient was 5-95% mobile phase B over 3.0 min with a flow rate of 2.5 ml/min, then held at 95% for 0.5 min with an flow rate of 4.5 mL/min.
- Method 4 5-95% over 14 min with a flow rate of 2.5 mL/min, then held at 95% for 0.5 min with a flow rate of 4.5 mL/min.
- System 3 Waters Fractionlynx LCMS system equipped with an Agilent Zorbax Extend RRHT 1.8 ⁇ , (4.6 x 30 mm) column using water with 0.1% formic acid as mobile phase A and acetonitrile with 0.1% formic acid as mobile phase B.
- System 4 Agilent 1260 LCMS equipped with an Agilent Zorbax Extend RRHT 1.8 ⁇ (4.6 x 30 mm) column using water with 0.1% formic acid as mobile phase A and acetonitrile with 0.1% formic acid as mobile phase B.
- Method 5 The gradient was 5-95% mobile phase B over 3.0 min with a flow rate of 2.5 ml/min, then held at 95% for 0.5 min with an flow rate of 4.5 mL/min.
- Method 6 5-95% over 14 min with a flow rate of 2.5 ml/min, then held at 95% for 0.5 min with an flow rate of 4.5 mL/min.
- Method 7 (using System I): 40-95% over 0.5 min, then held at 95% for 6 min, then 95-40% for 0.5 min with a flow rate of 1 mL/min.
- Method 8 (using System 1): The gradient was 20-100% with mobile phase B over 2.5 min then held at 100% for 4.5 min with a flow rate of 1 mL/min.
- Method 9 (using System 4): 5- 95% over 14 min with a flow rate of 2.5 mL/min, then held at 95% for 0.5 min with a flow rate of 4.5 mL/min.
- Method 10 (using System 4): The gradient was 5-95% mobile phase B over 3.0 min with a flow rate of 2.5 ml/min, then held at 95% for 0.5 min with an flow rate of 4.5 mL/min.
- Pyridine, dichloromethane (DCM), tetrahydrofuran (THF), and toluene used in the procedures were from Aldrich Sure-Seal bottles or Acros AcroSeal dry solvent and kept under nitrogen (N 2 ). All reactions were stirred magnetically and temperatures are external reaction temperatures.
- EA ethyl acetate
- TEA triemylamine
- HOBt N-hydroxybenzotriazole
- EDC l-ethyl-3-(3-dimethylaminopropyl) carbodiimide hydrochloride
- EDC AVV-dimethylformamide
- DMF dimethyl acetamide
- DMA Di-fert-butyl dicarbonate
- Boc 2 0 Di-fert-butyl dicarbonate
- DIEA N,N-Diisopropylethylamine
- acetic acid AcOH
- hydrochloric acid HC1
- 0-(7-azabenzotriazol-l-yl)-NNN'N-tetramemyluronium hexafiuorophosphate HATU
- DMAP 4-dimethylaminopyridine
- t-BuOH sodium hydride
- NaH sodium triacetoxyborohydride
- Compounds 1-2 were prepared from INT-4 using General Procedures 7 then 8.
- Compounds 3-15, 89 and 90 were prepared using General Procedures 2, 3, 7, 5, 6, and 8 sequentially.
- Compounds 91-127 were prepared from INT-4 using General Procedures 6 then 8.
- Compounds 133-165 were prepared from INT-4 using General Procedures 7 then 8.
- Compound 176 was prepared from INT-4 using General Procedure 8.
- Compound 66 was prepared using General Procedures 7, 11, 4, 7, and 8 sequentially.
- Compound 67 was prepared using General Procedures 2, 3, 7, and 8 sequentially.
- Compound 68 was prepared using General Procedures 7, 9, 6, and 8 sequentially.
- Compounds 69-72 were prepared using General Procedures 2, 3, 7, 8, and 6 sequentially.
- Compounds 73-74 were prepared using General Procedures 2, 11, 7, 5, 7, and 8 sequentially.
- Compound 75 was prepared using General Procedures 2, 11, and 7 sequentially.
- Compounds 76-78 were prepared from INT-5 using General Procedures 8 then 6.
- Compound 79 was prepared using General Procedures 7, 9, 4, 6, 1, and 8 sequentially.
- Compounds 80-81 were prepared using General Procedures 2, 11, 7, 4, 5, 7, and 8 sequentially.
- Compounds 82-83 were prepared using General Procedures 4, 6, 2, and 8 sequentially.
- the resulting nitrophenyl carbamate (1 eq) was dissolved in DCM and pyridine (2.0 eq), then added drop wise to a solution of amine (1 eq) in DCM. A catalytic amount of DMAP was added. The reaction mixture was stirred at room temperature or at 50°C for up to 18 h. The crude reaction mixture was diluted with DCM and washed with NaHC0 3 and the organic layer dried was over MgS0 4 . The solvent was concentrated and the final product was purified by chromatography or preparative HPLC. Alternatively, the crude reaction mixture can be concentrated and used in the next step without purification.
- Compound 281 was prepared from INT-9 using General Procedures 14, 8 then 12.
- Compounds 294 and 295 were prepared using INT-4 and General Procedures 14 then 8.
- Compound 296 was prepared using INT-9 and General Procedures 14 then 8.
- Compound 299 was prepared analogous to compound 298 by employing INT-13 and methyl 6-aminonicotinate using General Procedures 6, 10, 6 then 8.
- Compound 300 was prepared analogous to compound 298 by employing INT-13 and methyl 2-fluoro-4- aminobenzoate using General Procedures 6, 9, 6 then 8.
- Compound 301 was prepared analogous to compound 298 by employing INT-13 and methyl 2-hydroxy-4-aminobenzoate using General Procedures 6, 9, 6 then 8.
- Compound 302 was prepared analogous to compound 298 by employing INT-13 and methyl 3-methyl-4-aminobenzoate using General Procedures 7, 9, 6 then 8.
- Compound 303 was prepared analogous to compound 298 by employing INT-13 and methyl 3-fluoro-4-aminobenzoate using General Procedures 7, 9, 6 then 8.
- Compound 304 was prepared analogous to compound 298 by employing INT-13 and methyl 3-hydroxy-4-aminobenzoate using General Procedures 7, 9, 6 then 8.
- Compound 305 was prepared analogous to compound 298 by employing INT-13 and methyl 4-amino-2- methylbenzoate using General Procedures 7, 9, 6 then 8.
- Compound 306 was prepared analogous to compound 298 by employing INT-13 and methyl 4-amino-3- isopropoxybenzoate using General Procedures 7, 9, 6 then 8.
- the aqueous layer was extracted with DCM and the organic layer was dried over MgS0 4 .
- the solvent was concentrated and the final product was purified by chromatography or preparative HPLC.
- the crude reaction mixture can be diluted with DCM, passed through a phase separation cartridge, then concentrated and used in the next step without further purification.
- reaction mixture was diluted with EA (50 mL).
- the organic phase was washed with brine (2 x 100 mL) then pre-absorbed onto silica gel and purified by chromatography (EA / isohexanes.
- the isolated material was taken up into DCM (3 mL) and TFA (2 mL) and stirred at room temperature for 2 h.
- Compound 320 was prepared from INT-12 and INT-18 using General Procedures 12, 7 then 8.
- Compound 321 was prepared from INT-12 using General Procedures 12, 7, 8, 6 then 8.
- Compounds 322 and 323 were prepared using General Procedures 13, 6, 2 then 8.
- Compound 324 was prepared analogous to compound 298 by employing INT-28 and INT-30 using General Procedures 6 then 8.
- Compound 325 was prepared analogous to compound 298 by employing INT-28 and methyl 4-amino-2-chlorobenzoate using General Procedures 6, 10, 6 then 8.
- Compound 326 was prepared analogous to compound 298 by employing INT-28 and methyl 4-amino-2-methylbenzoate using General Procedures 6, 10, 6 then 8.
- Compound 327 was prepared using INT-18 and 4-nitrobenzaldehyde employing General Procedures 12, 6, 5, 10 then 8.
- Compound 328 was prepared using INT-18 and 4- nitrobenzaldehyde employing General Procedures 12, 6, 5, 7 then 8.
- Compound 329 was prepared using INT-18 and 4-nitrobenzaldehyde employing General Procedures 12, 6, 5, 12 then 8.
- Compound 330 was prepared using INT-18 and 4-nitrobenzaldehyde employing General Procedures 12, 6, 5, 6 then 8,
- Compound 331 was prepared using INT-18 and 4- nitrobenzaldehyde employing General Procedures 12, 6, 5, 13, 10 then 8.
- Compound 332 was prepared using INT-18 and 4-nitrobenzaldehyde employing General Procedures 12, 6, 5, 13, 7 then 8.
- Compound 333 was prepared using INT-18 and methyl 4-formylbenzoate employing General Procedures 12, 6, 9, 6 then 8.
- Compound 334 was prepared using INT- 18 and 4-(((4'-methyl-[l,l'-biphenyl]-4-yl)sulfonyl)methyl)benzaldehyde using General Procedures 12, 6 then 8.
- Compound 335 was prepared using INT-18 and 4-(((4'-methyl-[l,l'- biphenyl]-4-yl)oxy)methyl)benzaldehyde using General Procedures 12, 6 then 9.
- Compound 336 was prepared using INT-18 and 4-(((4'-methyl-[l, -biphenyl]-4- yl)amino)methyl)benzaldehyde using General Procedures 12, 6 then 9.
- Compound 340 was prepared using INT-9 and (4'-methyl-[l, -biphenyl]-4-yl)methyl methanesulfonate using General Procedures 13 then 9.
- Compounds 341-348 were prepared using INT-9 and General Procedures 17 then 8.
- Compound 349 was prepared using INT-9 and General Procedures 1 then 8.
- Compound 350 was prepared using INT-9 and 2-bromo-l- (4'-methyl-[l,l'-biphenyl]-4-yl)ethanone employing General Procedures 13 then 8.
- Compound 351 was prepared using INT-18 and 4-(2-(4-bromophenoxy)-l- hydroxyethyl)benzaldehyde using General Procedures 12, 6, 16 then 8.
- Compound 352 was prepared using INT-18 and 4-(2-(4-bromophenoxy)-l- hydroxyethyl)benzaldehyde using General Procedures 12, 6, 16, 18 then 8.
- Compound 353 was prepared using tert-butyl 2-(N-(4-(hydroxy(4'-methyl-[l, -biphenyl]-4- yl)methyl)benzyl)-4-(2-(4-memoxy-2-(trifluoromethyl)phenyl)acetamido)benzamido)acetate and General Procedures 18 then 8.
- Compound 356 was prepared using INT-36 and General Procedures 16 then 8.
- Compound 357 was prepared using INT-37 and N,4'-dimethyl-[l, -biphenyl]-4-amine using General Procedures 6 then 8.
- Compound 358 was prepared using INT-37 and (4'-methyl- [l,l'-biphenyl]-4-yl)boronic acid using General Procedures 17 then 8.
- Compound 359 was prepared using INT-37 and General Procedures 13 then 8.
- Compounds 360 - 363 are derived from INT-37.
- reaction mixture was poured onto citric acid (50 mL, 0.1 N aqueous solution) and extracted with EA (3 x 20 mL). The combined organic extracts were washed successively with NaHC0 3 (20 mL), brine (20 mL) then dried over MgS0 4 and concentrated.
- reaction mixture was allowed to cool to room temperature and acetonitrile (2 mL) was added.
- the reaction mixture was stirred at room temperature for 2 h and the precipitate was collected by filtration and washed with acetonitrile (0.5 mL) and isohexanes (2 mL).
- reaction mixture was added drop wise through a frit to a stirred solution of 4'-methyl-[l,l'- biphenyl]-4-carbohydrazonamide INT-39 (89.0 mg, 0.396 mmol) in DMF (2 mL). After 30 min, the reaction mixture was heated to 120°C for 1 h. The reaction mixture was allowed to cool to room temperature then poured onto water (50 mL) and extracted with DCM (3 x 20 mL). The combined organic extracts were washed successively with citric acid (10 mL, 0.1 M aqueous solution) and NaHC0 3 (10 mL) then dried over MgSC>4 and evaporated.
- reaction mixture was added through a frit to a stirred solution of N-hydroxy-4-memylbenzimidamide (38.8 mg, 0.258 mmol) in DMF (2 mL). After stirring at room temperature for 1 h, the reaction mixture was heated to 120°C for 2 h. The reaction mixture was allowed to cool to room temperature, diluted with DCM (4 mL), washed with NaHC0 3 (10 rnL), split through a hydrophobic frit and evaporated. The crude material was purified by column chromatography (EA / isohexanes). The isolated material was taken up in DCM (2 mL), treated with TFA (2 mL) and allowed to stir for 2 h.
- reaction mixture was added to a stirring solution of 4'-methyl-[l,r-biphenyl]-4-carbohydrazide INT-50 (65.0 mg, 0.29 mmol) in DMF (2 mL). After 2 h, additional 4'-methyl-[l,l'-biphenyl]-4-carbohydrazide INT-50 (12 mg, 0.05 mmol) was added. After stirring at room temperature for 18 h, the reaction mixture was diluted with DCM (4 mL), washed with NaHC0 3 (10 mL) and split though a hydrophobic frit.
- reaction mixture After stirring at room temperature for 16 h, the reaction mixture was warmed to 40°C. After 1 h, additional triethylamine (37.0 ⁇ , 0.26 mmol) was added. After a further 2 h, the reaction mixture was allowed to cool to room temperature then washed with NaHC0 3 (10 mL), split through a hydrophobic frit and evaporated. The crude material was purified by column chromatography (EA / isohexanes). The isolated material was diluted with DCM (2 mL), treated with TFA (2 mL) and allowed to stir for 1 h at room temperature.
- reaction mixture was heated to 120°C for 1 h.
- the reaction mixture was allowed to cool to room temperature then poured onto citric acid (50 mL, 0.1 M aqueous solution) and extracted with EA(2 x 20 mL).
- the combined organic extracts were washed with NaHC0 3 (20 mL), dried over MgS0 4 and the solvents evaporated.
- the crude material was purified by column chromatography (EA / isohexanes). The isolated material was dissolved in DCM (2 mL) and treated with TFA (2 mL).
- reaction mixture was allowed to cool to room temperature, diluted with EA (400 mL) and washed with brine (500 mL).
- the organics were pre-absorbed onto silica gel and purified by chromatography (MeCN/ DCM) to provide 7.35 g (73%) of tert-butyl 2-(N-(4-(5-(4'-methyl-[ 1 , 1 '-biphenyl]-4-yl)- 1 ,2,4-oxadiazol-3-yl)benzyl)-4- nitrobenzamido)acetate INT-58 as a white powder.
- reaction mixture was diluted with EA (40 mL) and washed with brine (60 mL).
- the organic layer was pre-absorbed onto silica gel and purified by chromatography (EA/ hexanes) to afford the intermediate ester as a white powder, which was dissolved in DCM (4 mL) and TFA (3 mL) and stirred at room temperature for 3 h.
- the reaction mixture was concentrated in vacuo and the residue taken up into DMSO (1 mL). Addition of water (30 mL) gave a white precipitate that was isolated by filtration.
- the reaction mixture was diluted with EA (30 mL) and washed with brine (60 mL).
- the organic layer was pre-absorbed onto silica gel and purified by chromatography (acetic acid / EA / hexanes) to afford the intermediate ester as a white powder.
- the intermediate ester was dissolved in DCM (4 mL) and TFA (3 mL) and stirred at room temperature for 3 h.
- the reaction mixture was concentrated and the residue taken up into DMSO (1 mL). Addition of water (30 mL) gave a white precipitate that was isolated by filtration.
- Compound 402 was prepared using INT-59 and 2-(2-fluoro-4-methoxyphenyl)acetic acid using General Procedures 7 then 8.
- Compound 403 was prepared using INT-59 and 2-(4-fluoro-2- methoxyphenyl)acetic acid using General Procedures 7 then 8.
- Compound 404 was prepared using INT-59 and 2-(3,4-dimethoxyphenyl)acetic acid using General Procedures 7 then 8.
- Compound 406 was prepared using INT-59 and 2-(3-methoxyphenyl)acetic acid using General Procedures 7 then 8.
- Compound 407 was prepared using INT-59 and 2-(4- (dimemylamino)-2-(trifluoromethyl)phenyl)acetic acid using General Procedures 7 then 8.
- Compound 408 was prepared using INT-59 and 2-(4-chloro-2-(trifluoromethyl)phenyl)acetic acid using General Procedures 7 then 8.
- Compound 409 was prepared using INT-59 and 2- (2-cyano-4-methoxyphenyl)acetic acid using General Procedures 7 then 8.
- Compound 410 was prepared using INT-59 and 2-(4-methoxy-2-methylphenyl)acetic acid using General Procedures 7 then 8.
- Compound 415 was prepared using INT-59 and 2-(5-fluoro-2- methoxyphenyl)acetic acid using General Procedures 7 then 8.
- Compound 416 was prepared using INT-59 and 2-(2,6-difluorophenyl)acetic acid using General Procedures 7 then 8.
- Compound 417 was prepared using INT-59 and 2-(2-fluoro-6-methoxyphenyl)acetic acid using General Procedures 7 then 8.
- Compound 418 was prepared using INT-59 and 2-(2- fluorophenyl)acetic acid using General Procedures 7 then 8.
- Compound 420 was prepared using INT-59 and 2-(3-fluorophenyl)acetic acid using General Procedures 7 then 8.
- Compound 421 was prepared using INT-59 and 2-(3-(trifluoromethyl)phenyl)acetic acid using General Procedures 7 then 8.
- Compound 423 was prepared using INT-59 and 2-(3- (trifluoromethyl)phenyl)acetic acid using General Procedures 7 then 8.
- Compound 431 was prepared using INT-59 and isobutyryl chloride using General Procedures 7 then 8.
- Compound 433 was prepared using INT-59 and 5-methylthiazole-2-carboxylic acid using General Procedures 7 then 8.
- Compound 437 was prepared using INT-59 and 2-(2,6-difluoro- 4-methoxyphenyl)acetic acid using General Procedures 7 then 8.
- Compound 439 was prepared using INT-59 and 2-(pyrrolidin-l-yl)acetic acid using General Procedures 6 then 8.
- Compound 447 was prepared using INT-59 and 2-(2,5-dimethyloxazol-4-yl)acetic acid using General Procedures 6 then 8.
- Compound 454 was prepared from INT-64 and 2-(2-fluoro-4-methoxyphenyl)acetic acid using General Procedures 6 then 9.
- Compound 456 was prepared from INT-64 and 2- (2-(trifluoromethyl)phenyl)acetic acid using General Procedures 6 then 9.
- reaction mixture was diluted with EA (25 mL) and washed with NaHC0 3 (2 x 25 mL), 1 M HC1 (2 x 25 mL) and brine (25 mL). The organics were dried over MgS0 4 and concentrated in vacuo.
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Epidemiology (AREA)
- Engineering & Computer Science (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Chemical & Material Sciences (AREA)
- Molecular Biology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Diabetes (AREA)
- Oil, Petroleum & Natural Gas (AREA)
- Biochemistry (AREA)
- Polymers & Plastics (AREA)
- Nanotechnology (AREA)
- Emergency Medicine (AREA)
- Endocrinology (AREA)
- Obesity (AREA)
- Hematology (AREA)
- Biotechnology (AREA)
- Zoology (AREA)
- Materials Engineering (AREA)
- General Engineering & Computer Science (AREA)
- Medical Informatics (AREA)
- Crystallography & Structural Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Immunology (AREA)
- Biophysics (AREA)
- Gastroenterology & Hepatology (AREA)
- Inorganic Chemistry (AREA)
- Dermatology (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP12793320.8A EP2713722B1 (en) | 2011-05-31 | 2012-05-31 | Novel glp-1 receptor stabilizers and modulators |
| DK12793320.8T DK2713722T3 (en) | 2011-05-31 | 2012-05-31 | Newly known GLP-1 receptor stabilizers and modulators |
| JP2014513706A JP6007417B2 (ja) | 2011-05-31 | 2012-05-31 | 新規glp−1受容体安定剤および調節剤 |
| ES12793320.8T ES2634716T3 (es) | 2011-05-31 | 2012-05-31 | Nuevos estabilizantes y moduladores del receptor GLP-1 |
| US14/122,176 US9278910B2 (en) | 2011-05-31 | 2012-05-31 | GLP-1 receptor stabilizers and modulators |
| US14/997,364 US9700543B2 (en) | 2011-05-31 | 2016-01-15 | GLP-1 receptor stabilizers and modulators |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201161491446P | 2011-05-31 | 2011-05-31 | |
| US61/491,446 | 2011-05-31 | ||
| US201161535750P | 2011-09-16 | 2011-09-16 | |
| US61/535,750 | 2011-09-16 | ||
| US201161569759P | 2011-12-12 | 2011-12-12 | |
| US61/569,759 | 2011-12-12 |
Related Child Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/122,176 A-371-Of-International US9278910B2 (en) | 2011-05-31 | 2012-05-31 | GLP-1 receptor stabilizers and modulators |
| US14/997,364 Continuation US9700543B2 (en) | 2011-05-31 | 2016-01-15 | GLP-1 receptor stabilizers and modulators |
| US14/997,364 Division US9700543B2 (en) | 2011-05-31 | 2016-01-15 | GLP-1 receptor stabilizers and modulators |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2012166951A1 true WO2012166951A1 (en) | 2012-12-06 |
| WO2012166951A9 WO2012166951A9 (en) | 2013-02-21 |
Family
ID=47259864
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2012/040250 Ceased WO2012166951A1 (en) | 2011-05-31 | 2012-05-31 | Novel glp-1 receptor stabilizers and modulators |
Country Status (7)
| Country | Link |
|---|---|
| US (2) | US9278910B2 (https=) |
| EP (1) | EP2713722B1 (https=) |
| JP (2) | JP6007417B2 (https=) |
| DK (1) | DK2713722T3 (https=) |
| ES (1) | ES2634716T3 (https=) |
| PT (1) | PT2713722T (https=) |
| WO (1) | WO2012166951A1 (https=) |
Cited By (52)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2014049610A2 (en) | 2012-09-26 | 2014-04-03 | Cadila Healthcare Limited | Peptides as gip, glp-1 and glucagon receptors triple-agonist |
| US8778923B2 (en) | 2011-12-12 | 2014-07-15 | Receptos, Inc. | GLP-1 receptor modulators |
| US8816121B2 (en) | 2010-06-09 | 2014-08-26 | Receptos, Inc. | GLP-1 receptor stabilizers and modulators |
| US8829195B2 (en) | 2012-05-15 | 2014-09-09 | Novartis Ag | Compounds and compositions for inhibiting the activity of ABL1, ABL2 and BCR-ABL1 |
| US9260427B2 (en) | 2013-06-11 | 2016-02-16 | Receptos, Inc. | GLP-1 receptor modulators |
| US9278981B2 (en) | 2012-05-15 | 2016-03-08 | Novartis Ag | Compounds and compositions for inhibiting the activity of ABL1, ABL2 and BCR-ABL1 |
| US9315489B2 (en) | 2012-05-15 | 2016-04-19 | Novartis Ag | Compounds and compositions for inhibiting the activity of ABL1, ABL2 and BCR-ABL1 |
| US9340537B2 (en) | 2012-05-15 | 2016-05-17 | Novatis Ag | Benzamide derivatives for inhibiting the activity of ABL1, ABL2 and BCR-ABL1 |
| US9474755B2 (en) | 2014-07-25 | 2016-10-25 | Celgene International Ii Sarl | GLP-1 receptor modulators |
| WO2017108569A1 (en) | 2015-12-22 | 2017-06-29 | Syngenta Participations Ag | Pesticidally active pyrazole derivatives |
| US9700543B2 (en) | 2011-05-31 | 2017-07-11 | Celgene International Ii Sàrl | GLP-1 receptor stabilizers and modulators |
| US9795613B2 (en) | 2014-12-10 | 2017-10-24 | Celgene International Ii Sàrl | GLP-1 receptor modulators |
| US9951069B1 (en) | 2017-01-11 | 2018-04-24 | Rodin Therapeutics, Inc. | Bicyclic inhibitors of histone deacetylase |
| WO2018172852A1 (en) * | 2017-03-21 | 2018-09-27 | Arbutus Biopharma Corporation | Substituted dihydroindene-4-carboxamides and analogs thereof, and methods using same |
| WO2018200833A1 (en) * | 2017-04-28 | 2018-11-01 | Celgene International Ii Sarl | Novel glp-1 receptor modulators |
| US10308644B2 (en) | 2016-12-22 | 2019-06-04 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US10421756B2 (en) | 2015-07-06 | 2019-09-24 | Rodin Therapeutics, Inc. | Heterobicyclic N-aminophenyl-amides as inhibitors of histone deacetylase |
| US10584118B2 (en) | 2015-06-22 | 2020-03-10 | Actelion Pharmaceuticals Ltd | NADPH oxidase 4 inhibitors |
| US10618916B2 (en) | 2018-05-11 | 2020-04-14 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US10647661B2 (en) | 2017-07-11 | 2020-05-12 | Vertex Pharmaceuticals Incorporated | Carboxamides as modulators of sodium channels |
| US10669271B2 (en) | 2018-03-30 | 2020-06-02 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US10752640B2 (en) | 2014-08-01 | 2020-08-25 | Nuevolution A/S | Compounds active towards bromodomains |
| US10793565B2 (en) | 2016-12-22 | 2020-10-06 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US10806785B2 (en) | 2016-12-22 | 2020-10-20 | Incyte Corporation | Immunomodulator compounds and methods of use |
| US10919902B2 (en) | 2015-07-06 | 2021-02-16 | Alkermes, Inc. | Hetero-halo inhibitors of histone deacetylase |
| WO2021210857A1 (en) * | 2020-04-13 | 2021-10-21 | Chong Kun Dang Pharmaceutical Corp. | 1,3,4-oxadiazole derivative compounds as histone deacetylase 6 inhibitor, and the pharmaceutical composition comprising the same |
| US11225475B2 (en) | 2017-08-07 | 2022-01-18 | Alkermes, Inc. | Substituted pyridines as inhibitors of histone deacetylase |
| US11247987B2 (en) | 2017-10-06 | 2022-02-15 | Forma Therapeutics, Inc. | Inhibiting ubiquitin specific peptidase 30 |
| US11401279B2 (en) | 2019-09-30 | 2022-08-02 | Incyte Corporation | Pyrido[3,2-d]pyrimidine compounds as immunomodulators |
| US11407749B2 (en) | 2015-10-19 | 2022-08-09 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US11465981B2 (en) | 2016-12-22 | 2022-10-11 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US11535615B2 (en) | 2015-12-22 | 2022-12-27 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US11535618B2 (en) | 2018-10-05 | 2022-12-27 | Forma Therapeutics, Inc. | Fused pyrrolines which act as ubiquitin-specific protease 30 (USP30) inhibitors |
| US11572366B2 (en) | 2015-11-19 | 2023-02-07 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US11608337B2 (en) | 2016-05-06 | 2023-03-21 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US11613536B2 (en) | 2016-08-29 | 2023-03-28 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US11673883B2 (en) | 2016-05-26 | 2023-06-13 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US11718605B2 (en) | 2016-07-14 | 2023-08-08 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US11753406B2 (en) | 2019-08-09 | 2023-09-12 | Incyte Corporation | Salts of a PD-1/PD-L1 inhibitor |
| US11760756B2 (en) | 2020-11-06 | 2023-09-19 | Incyte Corporation | Crystalline form of a PD-1/PD-L1 inhibitor |
| US11780836B2 (en) | 2020-11-06 | 2023-10-10 | Incyte Corporation | Process of preparing a PD-1/PD-L1 inhibitor |
| US11827627B2 (en) | 2021-06-04 | 2023-11-28 | Vertex Pharmaceuticals Incorporated | N-(hydroxyalkyl (hetero)aryl) tetrahydrofuran carboxamides as modulators of sodium channels |
| US11834441B2 (en) | 2019-12-06 | 2023-12-05 | Vertex Pharmaceuticals Incorporated | Substituted tetrahydrofurans as modulators of sodium channels |
| US11851428B2 (en) | 2016-12-15 | 2023-12-26 | Ono Pharmaceutical Co., Ltd. | Activator of TREK (TWIK RElated K+channels) channels |
| US11866434B2 (en) | 2020-11-06 | 2024-01-09 | Incyte Corporation | Process for making a PD-1/PD-L1 inhibitor and salts and crystalline forms thereof |
| US11866451B2 (en) | 2019-11-11 | 2024-01-09 | Incyte Corporation | Salts and crystalline forms of a PD-1/PD-L1 inhibitor |
| US11873309B2 (en) | 2016-06-20 | 2024-01-16 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US12049466B2 (en) | 2018-05-17 | 2024-07-30 | Forma Therapeutics, Inc. | Fused bicyclic compounds useful as ubiquitin-specific peptidase 30 inhibitors |
| US12441703B2 (en) | 2019-01-10 | 2025-10-14 | Vertex Pharmaceuticals Incorporated | Carboxamides as modulators of sodium channels |
| US12440481B2 (en) | 2019-01-10 | 2025-10-14 | Vertex Pharmaceuticals Incorporated | Esters and carbamates as modulators of sodium channels |
| US12466822B2 (en) | 2016-12-22 | 2025-11-11 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US12516044B2 (en) | 2015-12-17 | 2026-01-06 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
Families Citing this family (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2015054662A1 (en) | 2013-10-10 | 2015-04-16 | Eastern Virginia Medical School | 4-((2-hydroxy-3-methoxybenzyl)amino) benzenesulfonamide derivatives as 12-lipoxygenase inhibitors |
| RU2017107558A (ru) | 2014-09-15 | 2018-10-18 | Руджен Холдингс (Кайман) Лимитед | Производные пирролопиримидина в качестве антагонистов nmda-рецептора nr2b |
| US10221182B2 (en) | 2015-02-04 | 2019-03-05 | Rugen Holdings (Cayman) Limited | 3,3-difluoro-piperidine derivatives as NR2B NMDA receptor antagonists |
| KR102613179B1 (ko) * | 2015-06-01 | 2023-12-14 | 뤼겐 홀딩스 (케이맨) 리미티드 | Nr2b nmda 수용체 길항제로서의 3,3-디플루오로피페리딘 카바메이트 헤테로사이클릭 화합물 |
| EP3101007A1 (en) * | 2015-06-05 | 2016-12-07 | Lead Pharma Cel Models IP B.V. | Ror gamma (rory) modulators |
| SI3356358T1 (sl) | 2015-10-02 | 2020-09-30 | Syngenta Participations Ag | Mikrobiocidni derivati oksadiazola |
| US11000526B2 (en) | 2016-11-22 | 2021-05-11 | Rugen Holdings (Cayman) Limited | Treatment of autism spectrum disorders, obsessive-compulsive disorder and anxiety disorders |
| CA3121202A1 (en) | 2018-11-30 | 2020-06-04 | Nuvation Bio Inc. | Pyrrole and pyrazole compounds and methods of use thereof |
| CN112812077B (zh) * | 2019-11-18 | 2023-08-22 | 中国科学院上海药物研究所 | 苯甲酰胺类化合物及其制备方法、药物组合物和用途 |
| EP4118081A1 (en) | 2020-03-27 | 2023-01-18 | Landos Biopharma, Inc. | Plxdc2 ligands |
| CN120903919B (zh) * | 2025-10-11 | 2025-12-23 | 河北鼎瓷电子科技股份有限公司 | 绝缘氧化铝多层陶瓷基板及其制备方法 |
Citations (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4067726A (en) | 1974-05-15 | 1978-01-10 | Bayer Aktiengesellschaft | 3-Ureido phenylacetamide herbicides |
| US6174905B1 (en) | 1996-09-30 | 2001-01-16 | Mitsui Chemicals, Inc. | Cell differentiation inducer |
| US6191171B1 (en) | 1997-11-20 | 2001-02-20 | Merck & Co., Inc. | Para-aminomethylaryl carboxamide derivatives |
| US20010031772A1 (en) | 2000-03-07 | 2001-10-18 | Karl Schoenafinger | Substituted 3-phenyl-5-alkoxy-1,3,4-oxadiazol-2-ones, their preparation and their use as pharmaceuticals |
| WO2003048158A1 (en) | 2001-12-04 | 2003-06-12 | Bristol-Myers Squibb Company | Glycinamides as factor xa inhibitors |
| US20080300193A1 (en) | 2007-03-13 | 2008-12-04 | Board Of Regents, The University Of Texas System | Composition and Method for the Treatment of Diseases Affected by a Peptide Receptor |
| US7825139B2 (en) | 2005-05-25 | 2010-11-02 | Forest Laboratories Holdings Limited (BM) | Compounds and methods for selective inhibition of dipeptidyl peptidase-IV |
| US20100292143A1 (en) | 2007-06-08 | 2010-11-18 | Advinus Therapeutics Private Limited | Pyrrole-2-carboxamide derivatives as glucokinase activators, their process and pharmaceutical application |
Family Cites Families (27)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| IT1062206B (it) | 1974-02-01 | 1983-09-20 | Rotta Research Lab S P A A S | Derivati della tirosina attivi sulla muscolatura liscia |
| US5424286A (en) | 1993-05-24 | 1995-06-13 | Eng; John | Exendin-3 and exendin-4 polypeptides, and pharmaceutical compositions comprising same |
| DE122007000044I2 (de) | 1997-01-07 | 2011-05-05 | Amylin Pharmaceuticals Inc | Verwendung von exedinen und deren antagonisten zur verminderung der lebensmittelaufnahme |
| US6583139B1 (en) | 1997-07-31 | 2003-06-24 | Eugene D. Thorsett | Compounds which inhibit leukocyte adhesion mediated by VLA-4 |
| PL338457A1 (en) | 1997-07-31 | 2000-11-06 | Elan Pharm Inc | Sulphonylated dipeptidic compounds capable to inhibit adhesion of leucocytes through the mediation of vla-4 |
| EP1005445B1 (en) | 1997-08-22 | 2004-05-26 | F. Hoffmann-La Roche Ag | N-alkanoylphenylalanine derivatives |
| EP1992641A3 (en) | 1998-12-07 | 2009-07-29 | Ipsen Pharma | GLP-1 analogues |
| US6902744B1 (en) | 1999-01-14 | 2005-06-07 | Amylin Pharmaceuticals, Inc. | Exendin agonist formulations and methods of administration thereof |
| TWI302149B (en) | 1999-09-22 | 2008-10-21 | Bristol Myers Squibb Co | Substituted acid derivatives useful as antiodiabetic and antiobesity agents and method |
| EP1477482B1 (en) | 2002-02-20 | 2010-04-14 | Ajinomoto Co., Inc. | Novel phenylalanine derivative |
| US20070276034A1 (en) | 2002-05-31 | 2007-11-29 | Luke Esposito | Compounds, compositions and methods for the treatment of synucleinopathies |
| MXPA05002571A (es) | 2002-09-04 | 2005-09-08 | Schering Corp | Pirazolopirimidinas como inhibidores de cinasa dependientes de ciclina. |
| PL224879B1 (pl) * | 2002-09-04 | 2017-02-28 | Pharmacopeia Drug Discovery Inc | Pirazolo [1,5-a] pirymidynowy związek, jego zastosowanie do wytwarzania leku oraz zawierająca go farmaceutyczna kompozycja |
| US20040152750A1 (en) * | 2002-12-20 | 2004-08-05 | Kodra Janos Tibor | Novel glucagon antagonists |
| EP1644321B1 (en) | 2003-06-13 | 2011-02-09 | Laboratorios S.A.L.V.A.T., S.A. | New benzamides as ppaty modulators |
| US7345049B2 (en) | 2003-12-22 | 2008-03-18 | Ajinomoto Co., Inc. | Phenylalanine derivatives |
| CA2555594A1 (en) | 2004-02-10 | 2005-08-25 | Janssen Pharmaceutica N.V. | Pyridazinones as antagonists of a4 integrins |
| WO2006117743A1 (en) | 2005-05-03 | 2006-11-09 | Ranbaxy Laboratories Limited | Substituted aromatic compounds as antidiabetic agents |
| EP1899304A1 (en) * | 2005-05-23 | 2008-03-19 | Arena Pharmaceuticals, Inc. | 5-amino-1h-pyrazole-3-carboxylic acid derivatives as agonists for the g-protein coupled receptor (gpcr) rup38 for the treatment of metabolic-related disorders thereof |
| EP1878730A1 (en) | 2006-07-12 | 2008-01-16 | Bayer Schering Pharma Aktiengesellschaft | Substituted isoxazolines, pharmaceutical compositions containing the same, methods of preparing the same, and uses of the same |
| JP2010148234A (ja) | 2008-12-18 | 2010-07-01 | Seiko Epson Corp | 残留電荷放電回路および電源用半導体装置 |
| WO2011094890A1 (en) | 2010-02-02 | 2011-08-11 | Argusina Inc. | Phenylalanine derivatives and their use as non-peptide glp-1 receptor modulators |
| JP2013530963A (ja) | 2010-06-09 | 2013-08-01 | レセプトス インコーポレイテッド | 新規のglp−1受容体安定化薬および調節薬 |
| JP6007417B2 (ja) | 2011-05-31 | 2016-10-12 | レセプトス エルエルシー | 新規glp−1受容体安定剤および調節剤 |
| BR112014013925B1 (pt) | 2011-12-12 | 2022-02-22 | Receptos Llc | Compostos moduladores do receptor de glp-1 e composição e combinação farmacêutica compreendendo os ditos compostos |
| CN109867630A (zh) | 2013-06-11 | 2019-06-11 | 赛尔基因第二国际有限公司 | 新型glp-1受体调节剂 |
| CA2955836C (en) | 2014-07-25 | 2023-02-14 | Celgene International Ii Sarl | Glp-1 receptor modulators |
-
2012
- 2012-05-31 JP JP2014513706A patent/JP6007417B2/ja not_active Expired - Fee Related
- 2012-05-31 EP EP12793320.8A patent/EP2713722B1/en active Active
- 2012-05-31 PT PT127933208T patent/PT2713722T/pt unknown
- 2012-05-31 US US14/122,176 patent/US9278910B2/en not_active Expired - Fee Related
- 2012-05-31 WO PCT/US2012/040250 patent/WO2012166951A1/en not_active Ceased
- 2012-05-31 ES ES12793320.8T patent/ES2634716T3/es active Active
- 2012-05-31 DK DK12793320.8T patent/DK2713722T3/en active
-
2016
- 2016-01-15 US US14/997,364 patent/US9700543B2/en active Active
- 2016-03-25 JP JP2016061862A patent/JP2016128509A/ja active Pending
Patent Citations (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4067726A (en) | 1974-05-15 | 1978-01-10 | Bayer Aktiengesellschaft | 3-Ureido phenylacetamide herbicides |
| US6174905B1 (en) | 1996-09-30 | 2001-01-16 | Mitsui Chemicals, Inc. | Cell differentiation inducer |
| US6191171B1 (en) | 1997-11-20 | 2001-02-20 | Merck & Co., Inc. | Para-aminomethylaryl carboxamide derivatives |
| US20010031772A1 (en) | 2000-03-07 | 2001-10-18 | Karl Schoenafinger | Substituted 3-phenyl-5-alkoxy-1,3,4-oxadiazol-2-ones, their preparation and their use as pharmaceuticals |
| WO2003048158A1 (en) | 2001-12-04 | 2003-06-12 | Bristol-Myers Squibb Company | Glycinamides as factor xa inhibitors |
| US7825139B2 (en) | 2005-05-25 | 2010-11-02 | Forest Laboratories Holdings Limited (BM) | Compounds and methods for selective inhibition of dipeptidyl peptidase-IV |
| US20080300193A1 (en) | 2007-03-13 | 2008-12-04 | Board Of Regents, The University Of Texas System | Composition and Method for the Treatment of Diseases Affected by a Peptide Receptor |
| US20100292143A1 (en) | 2007-06-08 | 2010-11-18 | Advinus Therapeutics Private Limited | Pyrrole-2-carboxamide derivatives as glucokinase activators, their process and pharmaceutical application |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP2713722A4 |
Cited By (88)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8816121B2 (en) | 2010-06-09 | 2014-08-26 | Receptos, Inc. | GLP-1 receptor stabilizers and modulators |
| US9700543B2 (en) | 2011-05-31 | 2017-07-11 | Celgene International Ii Sàrl | GLP-1 receptor stabilizers and modulators |
| US8778923B2 (en) | 2011-12-12 | 2014-07-15 | Receptos, Inc. | GLP-1 receptor modulators |
| US9315489B2 (en) | 2012-05-15 | 2016-04-19 | Novartis Ag | Compounds and compositions for inhibiting the activity of ABL1, ABL2 and BCR-ABL1 |
| US9278981B2 (en) | 2012-05-15 | 2016-03-08 | Novartis Ag | Compounds and compositions for inhibiting the activity of ABL1, ABL2 and BCR-ABL1 |
| US9340537B2 (en) | 2012-05-15 | 2016-05-17 | Novatis Ag | Benzamide derivatives for inhibiting the activity of ABL1, ABL2 and BCR-ABL1 |
| US9458112B2 (en) | 2012-05-15 | 2016-10-04 | Novartis Ag | Compounds and compositions for inhibiting the activity of ABL1, ABL2 and BCR-ABL1 |
| US8829195B2 (en) | 2012-05-15 | 2014-09-09 | Novartis Ag | Compounds and compositions for inhibiting the activity of ABL1, ABL2 and BCR-ABL1 |
| US9896444B2 (en) | 2012-05-15 | 2018-02-20 | Novartis Ag | Benzamide derivatives for inhibiting the activity of ABL1, ABL2 and BCR-ABL1 |
| WO2014049610A2 (en) | 2012-09-26 | 2014-04-03 | Cadila Healthcare Limited | Peptides as gip, glp-1 and glucagon receptors triple-agonist |
| US9260427B2 (en) | 2013-06-11 | 2016-02-16 | Receptos, Inc. | GLP-1 receptor modulators |
| US10259823B2 (en) | 2013-06-11 | 2019-04-16 | Celgene International Ii Sàrl | GLP-1 receptor modulators |
| US9474755B2 (en) | 2014-07-25 | 2016-10-25 | Celgene International Ii Sarl | GLP-1 receptor modulators |
| US9839664B2 (en) | 2014-07-25 | 2017-12-12 | Celgene International Ii Sàrl | GLP-1 receptor modulators |
| US10752640B2 (en) | 2014-08-01 | 2020-08-25 | Nuevolution A/S | Compounds active towards bromodomains |
| US10034886B2 (en) | 2014-12-10 | 2018-07-31 | Celgene International Ii Sàrl | GLP-1 receptor modulators |
| US9795613B2 (en) | 2014-12-10 | 2017-10-24 | Celgene International Ii Sàrl | GLP-1 receptor modulators |
| US11136317B2 (en) | 2015-06-22 | 2021-10-05 | Actelion Pharmaceuticals Ltd | NADPH oxidase 4 inhibitors |
| US10584118B2 (en) | 2015-06-22 | 2020-03-10 | Actelion Pharmaceuticals Ltd | NADPH oxidase 4 inhibitors |
| US10919902B2 (en) | 2015-07-06 | 2021-02-16 | Alkermes, Inc. | Hetero-halo inhibitors of histone deacetylase |
| US11858939B2 (en) | 2015-07-06 | 2024-01-02 | Alkermes, Inc. | Hetero-halo inhibitors of histone deacetylase |
| US10421756B2 (en) | 2015-07-06 | 2019-09-24 | Rodin Therapeutics, Inc. | Heterobicyclic N-aminophenyl-amides as inhibitors of histone deacetylase |
| US11407749B2 (en) | 2015-10-19 | 2022-08-09 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US11572366B2 (en) | 2015-11-19 | 2023-02-07 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US12516044B2 (en) | 2015-12-17 | 2026-01-06 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| WO2017108569A1 (en) | 2015-12-22 | 2017-06-29 | Syngenta Participations Ag | Pesticidally active pyrazole derivatives |
| US11535615B2 (en) | 2015-12-22 | 2022-12-27 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US11866435B2 (en) | 2015-12-22 | 2024-01-09 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US11608337B2 (en) | 2016-05-06 | 2023-03-21 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US11673883B2 (en) | 2016-05-26 | 2023-06-13 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US11873309B2 (en) | 2016-06-20 | 2024-01-16 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US11718605B2 (en) | 2016-07-14 | 2023-08-08 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US11613536B2 (en) | 2016-08-29 | 2023-03-28 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US11851428B2 (en) | 2016-12-15 | 2023-12-26 | Ono Pharmaceutical Co., Ltd. | Activator of TREK (TWIK RElated K+channels) channels |
| US11339149B2 (en) | 2016-12-22 | 2022-05-24 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US10793565B2 (en) | 2016-12-22 | 2020-10-06 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US10308644B2 (en) | 2016-12-22 | 2019-06-04 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US10806785B2 (en) | 2016-12-22 | 2020-10-20 | Incyte Corporation | Immunomodulator compounds and methods of use |
| US12466822B2 (en) | 2016-12-22 | 2025-11-11 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US11787793B2 (en) | 2016-12-22 | 2023-10-17 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US11465981B2 (en) | 2016-12-22 | 2022-10-11 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US10800768B2 (en) | 2016-12-22 | 2020-10-13 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US11225479B2 (en) | 2017-01-11 | 2022-01-18 | Alkermes, Inc. | Bicyclic inhibitors of histone deacetylase |
| US10793567B2 (en) | 2017-01-11 | 2020-10-06 | Rodin Therapeutics, Inc. | Bicyclic inhibitors of histone deacetylase |
| US10519149B2 (en) | 2017-01-11 | 2019-12-31 | Rodin Therapeutics, Inc. | Bicyclic inhibitors of histone deacetylase |
| US10696673B2 (en) | 2017-01-11 | 2020-06-30 | Rodin Therapeutics, Inc. | Bicyclic inhibitors of histone deacetylase |
| US11987580B2 (en) | 2017-01-11 | 2024-05-21 | Alkermes, Inc. | Bicyclic inhibitors of histone deacetylase |
| US11286256B2 (en) | 2017-01-11 | 2022-03-29 | Alkermes, Inc. | Bicyclic inhibitors of histone deacetylase |
| US9951069B1 (en) | 2017-01-11 | 2018-04-24 | Rodin Therapeutics, Inc. | Bicyclic inhibitors of histone deacetylase |
| US11098010B2 (en) | 2017-03-21 | 2021-08-24 | Arbutus Biopharma Corporation | Substituted dihydroindene-4-carboxamides and analogs thereof, and methods using same |
| WO2018172852A1 (en) * | 2017-03-21 | 2018-09-27 | Arbutus Biopharma Corporation | Substituted dihydroindene-4-carboxamides and analogs thereof, and methods using same |
| US11530205B2 (en) | 2017-04-28 | 2022-12-20 | Receptos Llc | GLP-1 receptor modulators |
| WO2018200833A1 (en) * | 2017-04-28 | 2018-11-01 | Celgene International Ii Sarl | Novel glp-1 receptor modulators |
| AU2018260686B2 (en) * | 2017-04-28 | 2022-03-17 | Receptos Llc | Novel GLP-1 receptor modulators |
| US12281057B2 (en) | 2017-07-11 | 2025-04-22 | Vertex Pharmaceuticals Incorporated | Carboxamides as modulators of sodium channels |
| US11603351B2 (en) | 2017-07-11 | 2023-03-14 | Vertex Pharmaceuticals Incorporated | Carboxamides as modulators of sodium channels |
| US10647661B2 (en) | 2017-07-11 | 2020-05-12 | Vertex Pharmaceuticals Incorporated | Carboxamides as modulators of sodium channels |
| US11912702B2 (en) | 2017-08-07 | 2024-02-27 | Alkermes, Inc. | Substituted pyridines as inhibitors of histone deacetylase |
| US11225475B2 (en) | 2017-08-07 | 2022-01-18 | Alkermes, Inc. | Substituted pyridines as inhibitors of histone deacetylase |
| US11247987B2 (en) | 2017-10-06 | 2022-02-15 | Forma Therapeutics, Inc. | Inhibiting ubiquitin specific peptidase 30 |
| US10669271B2 (en) | 2018-03-30 | 2020-06-02 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US11124511B2 (en) | 2018-03-30 | 2021-09-21 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US12247026B2 (en) | 2018-03-30 | 2025-03-11 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US10906920B2 (en) | 2018-05-11 | 2021-02-02 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US10618916B2 (en) | 2018-05-11 | 2020-04-14 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US12187743B2 (en) | 2018-05-11 | 2025-01-07 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US11414433B2 (en) | 2018-05-11 | 2022-08-16 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US12049466B2 (en) | 2018-05-17 | 2024-07-30 | Forma Therapeutics, Inc. | Fused bicyclic compounds useful as ubiquitin-specific peptidase 30 inhibitors |
| US11814386B2 (en) | 2018-10-05 | 2023-11-14 | Forma Therapeutics, Inc. | Fused pyrrolines which act as ubiquitin-specific protease 30 (USP30) inhibitors |
| US11535618B2 (en) | 2018-10-05 | 2022-12-27 | Forma Therapeutics, Inc. | Fused pyrrolines which act as ubiquitin-specific protease 30 (USP30) inhibitors |
| US12440481B2 (en) | 2019-01-10 | 2025-10-14 | Vertex Pharmaceuticals Incorporated | Esters and carbamates as modulators of sodium channels |
| US12441703B2 (en) | 2019-01-10 | 2025-10-14 | Vertex Pharmaceuticals Incorporated | Carboxamides as modulators of sodium channels |
| US11753406B2 (en) | 2019-08-09 | 2023-09-12 | Incyte Corporation | Salts of a PD-1/PD-L1 inhibitor |
| US11401279B2 (en) | 2019-09-30 | 2022-08-02 | Incyte Corporation | Pyrido[3,2-d]pyrimidine compounds as immunomodulators |
| US12247038B2 (en) | 2019-09-30 | 2025-03-11 | Incyte Corporation | Pyrido[3,2-d]pyrimidine compounds as immunomodulators |
| US11866451B2 (en) | 2019-11-11 | 2024-01-09 | Incyte Corporation | Salts and crystalline forms of a PD-1/PD-L1 inhibitor |
| US11919887B2 (en) | 2019-12-06 | 2024-03-05 | Vertex Pharmaceuticals Incorporated | Substituted tetrahydrofurans as modulators of sodium channels |
| US11834441B2 (en) | 2019-12-06 | 2023-12-05 | Vertex Pharmaceuticals Incorporated | Substituted tetrahydrofurans as modulators of sodium channels |
| US12247021B2 (en) | 2019-12-06 | 2025-03-11 | Vertex Pharmaceuticals Incorporated | Substituted tetrahydrofurans as modulators of sodium channels |
| WO2021210857A1 (en) * | 2020-04-13 | 2021-10-21 | Chong Kun Dang Pharmaceutical Corp. | 1,3,4-oxadiazole derivative compounds as histone deacetylase 6 inhibitor, and the pharmaceutical composition comprising the same |
| TWI807300B (zh) * | 2020-04-13 | 2023-07-01 | 南韓商鍾根堂股份有限公司 | 二唑衍生物化合物及包含其的藥物組合物 |
| US12084443B2 (en) | 2020-11-06 | 2024-09-10 | Incyte Corporation | Process of preparing a PD-1/PD-L1 inhibitor |
| US11760756B2 (en) | 2020-11-06 | 2023-09-19 | Incyte Corporation | Crystalline form of a PD-1/PD-L1 inhibitor |
| US12404272B2 (en) | 2020-11-06 | 2025-09-02 | Incyte Corporation | Process for making a PD-1/PD-L1 inhibitor and salts and crystalline forms thereof |
| US11780836B2 (en) | 2020-11-06 | 2023-10-10 | Incyte Corporation | Process of preparing a PD-1/PD-L1 inhibitor |
| US11866434B2 (en) | 2020-11-06 | 2024-01-09 | Incyte Corporation | Process for making a PD-1/PD-L1 inhibitor and salts and crystalline forms thereof |
| US12258333B2 (en) | 2021-06-04 | 2025-03-25 | Vertex Pharmaceuticals Incorporated | N-(hydroxyalkyl (hetero)aryl) tetrahydrofuran carboxamides as modulators of sodium channels |
| US11827627B2 (en) | 2021-06-04 | 2023-11-28 | Vertex Pharmaceuticals Incorporated | N-(hydroxyalkyl (hetero)aryl) tetrahydrofuran carboxamides as modulators of sodium channels |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2016128509A (ja) | 2016-07-14 |
| JP2014527027A (ja) | 2014-10-09 |
| US9700543B2 (en) | 2017-07-11 |
| PT2713722T (pt) | 2017-06-27 |
| ES2634716T3 (es) | 2017-09-28 |
| US20160310471A1 (en) | 2016-10-27 |
| DK2713722T3 (en) | 2017-07-03 |
| US20140336185A1 (en) | 2014-11-13 |
| JP6007417B2 (ja) | 2016-10-12 |
| EP2713722B1 (en) | 2017-03-15 |
| WO2012166951A9 (en) | 2013-02-21 |
| EP2713722A1 (en) | 2014-04-09 |
| EP2713722A4 (en) | 2014-11-26 |
| US9278910B2 (en) | 2016-03-08 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP2713722B1 (en) | Novel glp-1 receptor stabilizers and modulators | |
| CA2857197C (en) | Novel glp-1 receptor modulators | |
| US8501982B2 (en) | GLP-1 receptor stabilizers and modulators | |
| EP3008056B1 (en) | Novel glp-1 receptor modulators | |
| HK1194919A (en) | Novel glp-1 receptor stabilizers and modulators | |
| HK1194919B (en) | Novel glp-1 receptor stabilizers and modulators | |
| HK1202864B (en) | Carboxylic acid derivatives comprising four cycles acting as glp-1 receptor modulators for therapy of diseases such as diabetes | |
| NZ626122B2 (en) | Carboxylic acid derivatives comprising four cycles acting as glp-1 receptor modulators for therapy of diseases such as diabetes | |
| NZ715006B2 (en) | Novel glp-1 receptor modulators |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 12793320 Country of ref document: EP Kind code of ref document: A1 |
|
| DPE1 | Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101) | ||
| ENP | Entry into the national phase |
Ref document number: 2014513706 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REEP | Request for entry into the european phase |
Ref document number: 2012793320 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2012793320 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14122176 Country of ref document: US |