WO2011143482A2 - Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of phenylalanyl-beta-trna synthetases - Google Patents
Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of phenylalanyl-beta-trna synthetases Download PDFInfo
- Publication number
- WO2011143482A2 WO2011143482A2 PCT/US2011/036326 US2011036326W WO2011143482A2 WO 2011143482 A2 WO2011143482 A2 WO 2011143482A2 US 2011036326 W US2011036326 W US 2011036326W WO 2011143482 A2 WO2011143482 A2 WO 2011143482A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- aars
- protein
- polypeptide
- protein fragment
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/53—Ligases (6)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/14—Vasoprotectives; Antihaemorrhoidals; Drugs for varicose therapy; Capillary stabilisers
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/40—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against enzymes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/93—Ligases (6)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/96—Stabilising an enzyme by forming an adduct or a composition; Forming enzyme conjugates
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y601/00—Ligases forming carbon-oxygen bonds (6.1)
- C12Y601/01—Ligases forming aminoacyl-tRNA and related compounds (6.1.1)
- C12Y601/0102—Phenylalanine-tRNA ligase (6.1.1.20)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/573—Immunoassay; Biospecific binding assay; Materials therefor for enzymes or isoenzymes
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/90—Enzymes; Proenzymes
- G01N2333/9015—Ligases (6)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2500/00—Screening for compounds of potential therapeutic value
Definitions
- the present invention relates generally to compositions comprising newly identified protein fragments of aminoacyl-tRNA synthetases and other proteins, polynucleotides that encode them and complements thereof, related agents, and methods of use thereof in diagnostic, drug discovery, research, and therapeutic applications.
- AARSs aminoacyl-tRNA synthetases
- these unexpected activities are not observed in the context of the full-length or parental protein sequences; instead, they are observed following removal or resection of AARS protein fragments from their parental sequences, or by expressing and sufficiently purifying fragment AARS sequences and then testing for novel, non- synthetase related activities.
- resectin refers to a portion of a protein which has been excised or restricted (either by means of proteolysis, alternative splicing, mutagenesis, or recombinant genetic engineering) from the context of its native full-length or parental protein sequence, which often otherwise masks its novel biological activities.
- resectins are not limited to biotherapeutic agents, diagnostic agents, or drug targets in the treatment of various medical conditions, or their potential association with human diseases.
- AARSs As essential housekeeping genes with a known function in mammals that is critical to life, AARSs were neither considered as drug targets in mammals, nor were they parsed out by standard genomic sequencing, bioinformatic, or similar efforts to identify resectins having non-synthetase activities. Standard biochemical research efforts have similarly been directed away from characterizing the biological properties of AARS resectins and their potential therapeutic and diagnostic relevance, mainly due to the previously understood role of their corresponding full-length parental AARSs.
- Figure 1 shows the domain structure of the Phenylalanyl-beta aminoacyl tRNA synthetase overlaid with the relative positions and sizes of the N-terminal AARS polypeptides identified shown schematically.
- Figure 1A representing fragments identified from mass spectrometry analysis
- Figure IB representing the fragments identified from deep sequencing of transcriptomes
- Figure 1C representing fragments identified from bioinformatics analysis.
- Figure 2 shows the domain structure of the Phenylalanyl-beta aminoacyl tRNA synthetase overlaid with the relative positions and sizes of the C-terminal AARS polypeptides identified shown schematically.
- Figure 2A representing fragments identified from mass spectrometry analysis
- Figure 2B representing the fragments identified from deep sequencing of transcriptomes
- Figure 2C representing fragments identified from bioinformatics analysis.
- Figure 3 shows the domain structure of the Phenylalanyl-beta aminoacyl tR A synthetase overlaid with the relative positions and sizes of the Internal AARS polypeptides identified from bioinformatics analysis, shown schematically
- Embodiments of the present invention relate generally to the discovery of protein fragments of aminoacyl-tRNA synthetases (AARSs), which possess non- canonical biological activities, such as extracellular signaling activities, and/or other characteristics of therapeutic and diagnostic relevance.
- AARSs aminoacyl-tRNA synthetases
- the AARSs are universal and essential elements of the protein synthesis machinery found in all organisms, but human AARSs and their associated proteins have naturally-occurring resected variants, with potent cell signaling activities that contribute to normal functioning of humans.
- the activities of these protein fragments are distinct from the protein synthesis activities commonly known for AARSs, and the present invention includes the discovery and development of these resected proteins as new biotherapeutic agents, new discovery research reagents, and as new antigens/targets for directed biologies and diagnostic agents that can be used to potentially treat or diagnose a wide variety of human diseases, such as inflammatory, hematological, neurodegenerative, autoimmune, hematopoietic, cardiovascular, and metabolic diseases or disorders.
- diseases such as inflammatory, hematological, neurodegenerative, autoimmune, hematopoietic, cardiovascular, and metabolic diseases or disorders.
- the AARS protein fragment(s) of the present invention may therefore be referred to as "resectins,” or alternatively as “appendacrines.”
- resectin derives from the process of excising or resecting a given AARS protein fragment from the context of its full-length parent AARS sequence, which typically masks its non-canonical activities.
- the AARS protein fragments and polynucleotides of the present invention were identified through the occurrence of this resection process, whether naturally-occurring (e.g., proteolytic, splice variant), artificially-induced, or predicted.
- appendacrine derives from a combination of "append” (from Latin - appender) and to “separate” or “discern” (from Greek - crines),” and also reflects the separation of one or more appended domains of the AARS protein fragments from their corresponding full-length or parent AARS sequences.
- AARS fragments have been previously shown to have non- synthetase activities, the expression, isolation, purification, and characterization of such fragments for biotherapeutic, discovery, or diagnostic utility is limited, and persons skilled in the art would not have readily appreciated such activities to associate with each member of the entire family of AARSs, or with alternative fragments.
- a methodical approach was utilized to discover and verify AARS protein fragments for the 20 mitochondrial and 20 cytosolic AARSs (and associated proteins) for biotherapeutic discovery and diagnostic utility.
- certain of the present AARS protein fragment(s) and polynucleotides that encode them are identified from biological samples using mass spectrometry (MS), mainly to identify proteolytic fragments, and others were identified by deep sequencing techniques, mainly to identify splice variants.
- MS mass spectrometry
- Other AARS protein fragment(s) are identified using in silico predictions of amino acid sequences, such as by computationally comparing synthetases from humans and lower organisms along with key demarcations ⁇ e.g., protease sites); this approach utilized sequence analysis of the full-length AARS based on specific criteria to discern proteolytic fragments and functional domains possessing non- canonical biological activities.
- Novel resectins of the AARSs are unexpected, and their differential expression is also unexpected. Specific resections are typically seen under different treatments ⁇ e.g., from cells grown in media with or without serum), at different stages of growth ⁇ e.g., adult brain vs. fetal brain) and for different tissue types ⁇ e.g., pancreas vs. liver). The pattern of expression is not the same for all aminoacyl tRNA synthetases despite the fact that the canonical functions for all aminoacyl tRNA synthetases are needed in the same cell locations and in relatively proportional amounts.
- AARS protein fragments can be expressed and purified to sufficiently high purity to discern their biological properties. Previously, fragments were often not of sufficient purity, folding, and stability to enable proper biological characterization of non-synthetase activities. Cell based assays, for instance, are used in conjunction with sufficiently pure, stable, soluble and folded resectins to reveal their important biotherapeutic, discovery or diagnostic activities.
- embodiments of the present invention relate to protein fragments of Phenylalanyl-beta tRNA synthetases, related agents and compositions of biotherapeutic, discovery, or diagnostic utility, and methods of use thereof.
- the compositions of the present invention are useful in a variety of diagnostic, drug discovery, and therapeutic applications, as described herein.
- the AARS proteins and fragments are purified and stored in suitable condition to the extent required for such biotherapeutic, discovery, or diagnostic uses.
- compositions comprising an isolated aminoacyl-tRNA synthetase (AARS) protein fragment of at least about 100, 90, 80, 70, 60, 50 or 40 amino acids that comprises an amino acid sequence as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, and has a solubility of at least about 5 mg/ml, and wherein the composition has a purity of at least about 95% on a protein basis, and less than about 10 EU / mg protein endotoxin.
- the composition is a therapeutic composition.
- the composition is substantially serum free.
- the AARS protein fragment comprises a non- canonical activity.
- the non-canonical biological activity is selected from modulation of extracellular signaling, modulation of cell proliferation, modulation of cell differentiation, modulation of gene transcription, modulation of cytokine production or activity, modulation of cytokine receptor activity, and modulation of inflammation.
- the AARS protein fragment has an EC50 of less than about 1 nM, about 5 nM, about 10 nM, about 50 nM, about 100 nM or about 200 nM for a cell-based non-canonical biological activity.
- the AARS protein fragment is fused to a heterologous polypeptide.
- the AARS fusion protein substantially retains a non-canonical activity of the AARS protein fragment.
- the AARS fusion protein suppresses a non-canonical activity of the AARS protein fragment.
- the heterologous polypeptide is attached to the N- terminus of the AARS protein fragment.
- the heterologous polypeptide is attached to the C-terminus of the AARS protein fragment.
- the heterologous polypeptide is selected from the group consisting of purification tags, epitope tags, targeting sequences, signal peptides, membrane translocating sequences, and PK modifiers.
- the composition comprises an AARS protein fragment at a concentration of least about 10 mg/mL. In certain embodiments the composition comprises an AARS protein fragment which is at least 90% monodisperse. In certain embodiments the composition comprises less than about 3 % high molecular weight aggregated proteins. In certain embodiments the composition exhibits less than 3% aggregation when stored at a concentration of at least 10 mg/ mL in PBS for one week at 4 °C. In certain embodiments the composition exhibits less than 3% aggregation when stored at a concentration of at least 10 mg/ mL in PBS for one week at room temperature.
- compositions comprising an isolated aminoacyl-tRNA synthetase (AARS) protein fragment of at least 35 amino acids that differs from an amino acid sequence set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9 by substitution, deletion, and/or addition of about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acids, wherein the altered protein fragment substantially retains a non-canonical activity of the unaltered protein, or has a dominant negative phenotype in relation to the non-canonical activity, wherein the protein fragment has a solubility of at least about 5 mg/ml, and wherein the composition has a purity of at least about 95% on a protein basis and less than about 10 EU / mg protein endotoxin.
- the composition is substantially serum free.
- compositions comprising an isolated antibody that specifically binds to an isolated aminoacyl-tRNA synthetase (AARS) protein fragment as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, wherein affinity of the antibody for the AARS protein fragment is about 10X stronger than its affinity for a corresponding full-length AARS polypeptide.
- AARS aminoacyl-tRNA synthetase
- One of the surprising aspects of the present invention includes certain resectins possessing "new" surfaces accessible to antibody or other directed biologies, whereas the full length AARS "hides” or covers these surfaces with other sequences or adjacent domains. The process of resecting can also create greater aqueous accessibility for revealing previously unidentified biological activities.
- compositions comprising an isolated antibody that specifically binds to an isolated aminoacyl-tRNA synthetase (AARS) protein fragment as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, wherein the antibody has an affinity of at least about 10 nM for the AARS protein fragment, and an affinity of at least about 100 nM for a corresponding full-length AARS polypeptide.
- the antibody binds to an epitope located within an AARS polypeptide unique splice junction as set forth in any of Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, or to an amino acid sequence C-terminal of this splice site.
- the antibody antagonizes the non-canonical activity of the AARS protein fragment.
- Such antagonists may optionally bind the corresponding parental or full- length AARS.
- bioassay systems comprising a substantially pure aminoacyl-tRNA synthetase (AARS) protein fragment of at least 35 amino acids that comprises an amino acid sequence as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, and a binding partner that binds to the AARS protein fragment.
- the binding partner is selected from the group consisting of a cellular surface receptor protein, nucleic acid, lipid membrane, cell regulatory protein, enzyme, and transcription factor.
- such a receptor may be part of a cell, preferably a cell relevant to the revealed biology of the resectin.
- Certain embodiments include cellular compositions, comprising an isolated aminoacyl-tRNA synthetase (AARS) protein fragment of at least 35 amino acids that comprises an amino acid sequence as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, and an engineered population of cells in which at least one cell comprises a polynucleotide encoding said AARS protein fragment.
- the cells are capable of growing in a serum free medium.
- detection systems comprising a substantially pure aminoacyl-tRNA synthetase (AARS) protein fragment of at least 50 or 100 amino acids that comprises an amino acid sequence as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, a cell that comprises a cell-surface receptor or an extracellular portion thereof that binds to the protein fragment, and a molecule of less than about 2000 daltons, or a second polypeptide, which modulates binding or interaction between the AARS protein fragment and the extracellular receptor.
- AARS aminoacyl-tRNA synthetase
- Particular embodiments include diagnostic systems, comprising a substantially pure aminoacyl-tRNA synthetase (AARS) protein fragment of at least 35 amino acids that comprises an amino acid sequence as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, and a cell that comprises a cell-surface receptor or an extracellular portion thereof that binds to the AARS protein fragment, wherein the system or cell comprises an indicator molecule that allows detection of a change in the levels or activity of the cell-surface receptor or extracellular portion thereof.
- AARS aminoacyl-tRNA synthetase
- Certain embodiments include cellular growth devices, comprising an isolated aminoacyl-tRNA synthetase (AARS) protein fragment of at least 35 amino acids that comprises an amino acid sequence as set forth in Table(s) 1-3, or Table(s) 4- 6, or Table(s) 7-9, an engineered population of cells in which at least one cell comprises a polynucleotide encoding said AARS protein fragment, at least about 10 liters of serum-free cell media, and a sterile container.
- the cells utilized for any of the methods or compositions described herein are capable of growing in serum-free media, optionally with an antibiotic and an inducer.
- RNAi agents comprising a sequence that is targeted against a unique splice junction of an AARS splice variant as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9.
- compositions comprising an isolated aminoacyl-tRNA synthetase (AARS) protein fragment of at least 35 amino acids that comprises an amino acid sequence as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, wherein the protein fragment specifically binds to a binding partner and has a solubility of at least about 5 mg/ml, and wherein the composition has a purity of at least about 95% on a protein basis.
- the composition may have less than 10 EU endotoxin / mg protein.
- compositions comprising an isolated aminoacyl-tRNA synthetase (AARS) protein fragment of at least 35 amino acids that is at least 80%, 85%o, 90%o, 95%), 98%o, or 100% identical to an amino acid sequence set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, wherein the protein fragment has a solubility of at least about 5 mg/ml, and wherein the composition has a purity of at least about 95% on a protein basis and less than 10 EU endotoxin / mg protein.
- AARS isolated aminoacyl-tRNA synthetase
- the compositions may comprise an AARS protein fragment that is at least about 50%, about 60%, about 70%, about 80%, about 90% or about 95% monodisperse with respect to its apparent molecular mass.
- the compositions comprise less than about 10 % (on a protein basis) high molecular weight aggregated proteins, or less than about 5 % high molecular weight aggregated proteins, or less than about 4% high molecular weight aggregated proteins, or less than about 3% high molecular weight aggregated proteins, or less than 2 % high molecular weight aggregated proteins, or less than about 1% high molecular weight aggregated proteins.
- the compositions exhibits less than about 10% aggregation when stored at a concentration of at least 10 mg/ mL in PBS for one week at 4 °C, or less than about 5% aggregation when stored at a concentration of at least 10 mg/ mL in PBS for one week at 4 °C, or less than about 3% aggregation when stored at a concentration of at least 10 mg/ mL in PBS for one week at 4 °C, or less than about 2% aggregation when stored at a concentration of at least 10 mg/ mL in PBS for one week at 4 °C, or less than about 1% aggregation when stored at a concentration of at least 10 mg/ mL in PBS for one week at 4 °C.
- compositions comprising a substantially pure aminoacyl-tRNA synthetase (AARS) protein fragment of at least 35 amino acids that comprises an amino acid sequence as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, and at least one covalently or non-covalently moiety attached thereto.
- the moiety is a detectable label.
- the moiety is a water soluble polymer.
- the moiety is PEG.
- the moiety is attached to the N-terminus of the protein fragment.
- the moiety is attached to the C- terminus of the protein fragment.
- compositions comprising a solid substrate attached to an isolated aminoacyl-tRNA synthetase (AARS) protein fragment of at least 35 amino acids that comprises an amino acid sequence as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, or a biologically active fragment or variant thereof, wherein the protein fragment has a solubility of at least about 5 mg/ml, and the composition has a purity of at least about 95% on a protein basis.
- AARS isolated aminoacyl-tRNA synthetase
- compositions comprising a binding agent that specifically binds to an isolated aminoacyl-tRNA synthetase (AARS) protein fragment as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, wherein the binding agent has an affinity of at least about 1 nM for the protein fragment.
- the binding agent binds to an epitope located within an AARS polypeptide unique splice junction as set forth in any of Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, or to an amino acid sequence C-terminal of this splice site.
- the binding agent antagonizes a non-canonical activity of the AARS polypeptide.
- Certain embodiments include isolated aminoacyl-tRNA synthetase (AARS) polypeptides, comprising an amino acid sequence of an AARS protein fragment as described herein, an amino acid sequence encoded by an AARS polynucleotide as described herein, or a variant or fragment thereof.
- AARS polypeptides comprise an amino acid sequence that is at least 80%>, 85%, 90%>, 95%, 98%, or 100% identical to an AARS reference sequence as disclosed in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, or Table E2.
- AARS polypeptides consist essentially of an amino acid sequence that is at least 80%, 85%, 90%, 95%, 98%, or 100% identical to an AARS reference sequence as disclosed in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, or Table E2.
- the polypeptide comprises a non-canonical biological activity.
- the non-canonical biological activity is selected from modulation of cell signaling (e.g., extracellular signaling), modulation of cell proliferation, modulation of cell migration, modulation of cell differentiation, modulation of apoptosis or cell death, modulation of angiogenesis, modulation of cell binding, modulation of cellular metabolism, modulation of cellular uptake, modulation of gene transcription, or secretion, modulation of cytokine production or activity, modulation of cytokine receptor activity, and modulation of inflammation.
- cell signaling e.g., extracellular signaling
- Other aspects include antibodies and other binding agents that exhibit binding specificity for an isolated AARS polypeptide as described herein, a binding partner of the AARS polypeptide, or the complex of both.
- the affinity of the antibody or binding agent for the AARS polypeptide is about 10X stronger than its affinity for a corresponding full-length AARS polypeptide.
- the binding agent is selected from a peptide, peptide mimetic, an adnectin, an aptamer, and a small molecule.
- the antibody or binding agent antagonizes a non-canonical activity of the AARS polypeptide.
- the antibody or binding agent agonizes a non-canonical activity of the AARS polypeptide.
- Certain embodiments include isolated aminoacyl-tRNA synthetase (AARS) polynucleotides, comprising a nucleotide sequence of an AARS polynucleotide as described herein, a nucleotide sequence that encodes an AARS protein fragment as described herein, or a variant, a fragment, or a complement thereof.
- AARS polynucleotides comprise a nucleotide sequence that is at least 80%, 85%, 90%>, 95%, 98%, or 100% identical to an AARS reference polynucleotide, or a complement thereof, as disclosed in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, or Table E2.
- the nucleotide sequence is codon optimized for bacterial expression.
- the nucleotide sequence is at least 80% identical a polynucleotide sequence disclosed in Table E2.
- Specific AARS polynucleotides consist essentially of a nucleotide sequence that is at least 80%, 85%, 90%, 95%, 98%, or 100% identical to an AARS reference polynucleotide, or a complement thereof, as disclosed in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, or Table E2.
- Other AARS polynucleotides comprise or consist essentially of a nucleotide sequence that specifically hybridizes to an AARS reference polynucleotide, as disclosed in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, or Table E2.
- the polynucleotide is selected from a primer, a probe, and an antisense oligonucleotide.
- the primer, probe, or antisense oligonucleotide is targeted to a specific or unique splice junction, and / or sequence 3' of this splice site within an AARS polynucleotide.
- Certain embodiments include methods of determining presence or levels of an AARS protein fragment in a sample, comprising contacting the sample with one or more binding agents that specifically bind to an AARS protein fragment as described herein, detecting the presence or absence of the binding agent, and thereby determining the presence or levels of the AARS protein fragment.
- Other embodiments include methods of determining presence or levels of an AARS protein fragment in a sample, comprising analyzing the sample with a detector that is capable of specifically identifying a protein fragment as described herein, and thereby determining the presence or levels of the AARS protein fragment.
- the detector is a mass spectrometer (MS), a flow cytometer, a protein imaging device, an enzyme-linked immunosorbent assays (ELISA), or a protein microarray.
- MS mass spectrometer
- ELISA enzyme-linked immunosorbent assays
- Certain embodiments comprise comparing the presence or levels of the AARS protein fragment to a control sample or a predetermined value.
- Certain embodiments comprise characterizing the state of the sample to distinguish it from the control.
- the sample and control comprise a cell or tissue, and the method comprises distinguishing between cells or tissues of different species, cells of different tissues or organs, cells at different cellular developmental states, cells at different cellular differentiation states, cells at different physiological states, or healthy and diseased cells. For instance, selected resectins may be more abundant under conditions such as stress or insult.
- Certain embodiments include discovery methods of, and related compositions for, identifying a compound that specifically binds to an aminoacyl-tRNA synthetase (AARS) polypeptide as described herein, or one or more of its cellular binding partners, comprising a) combining the AARS polypeptide or its cellular binding partner or both with at least one test compound under suitable conditions, and b) detecting binding of the AARS polypeptide or its cellular binding partner or both to the test compound, thereby identifying a compound that specifically binds to the AARS polypeptide or its cellular binding partner or both.
- AARS aminoacyl-tRNA synthetase
- the test compound is a polypeptide or peptide, an antibody or antigen-binding fragment thereof, a peptide mimetic, or a small molecule.
- the test compound agonizes a non-canonical biological activity of the AARS polypeptide or its cellular binding partner.
- the test compound antagonizes a non-canonical biological activity of the AARS polypeptide or its cellular binding partner.
- Certain embodiments include a compound identified by the above-method, such as an agonist (e.g., small molecule, peptide).
- Certain embodiments include methods of determining presence or levels of a polynucleotide sequence of an AARS splice variant in a sample, comprising contacting the sample with one or more oligonucleotides that specifically hybridize to an AARS polynucleotide as described herein, detecting the presence or absence of the oligonucleotides in the sample, and thereby determining the presence or levels of the polynucleotide sequence of the AARS splice variant.
- inventions include methods of determining presence or levels of a polynucleotide sequence of an AARS splice variant in a sample, comprising contacting the sample with at least two oligonucleotides that specifically amplify an AARS polynucleotide as described herein, performing an amplification reaction, detecting the presence or absence of an amplified product, and thereby determining presence or levels of the polynucleotide sequence of the AARS splice variant.
- the oligonucleotide(s) specifically hybridize to or specifically amplify a splice junction that is unique to the AARS splice variant.
- Certain embodiments include comparing the presence or levels of the AARS protein fragment or splice variant to a control sample or a predetermined value. Certain embodiments include characterizing the state of the sample to distinguish it from the control.
- the sample and control comprise a cell or tissue, and the method comprises distinguishing between cells or tissues of different species, cells of different tissues or organs, cells at different cellular developmental states, cells at different cellular differentiation states, or healthy and diseased cells.
- compositions comprising an AARS polynucleotide described herein, an AARS polypeptide described herein, a binding agent as described herein, or a compound identified by the above-method or described herein, and a pharmaceutically acceptable excipient or carrier.
- Certain embodiments include methods of modulating a cellular activity of a cell, comprising contacting the cell with an AARS polynucleotide described herein, an AARS polypeptide described herein, a binding agent described herein, a compound of the above -method or described herein, or a pharmaceutical composition described herein.
- the cellular activity is selected from cell proliferation, cell migration, cell differentiation, apoptosis or cell death, cell signaling, angiogenesis, cell binding, cellular uptake, cell secretion, metabolism, cytokine production or activity, cytokine receptor activity, gene transcription, and inflammation.
- the cell is selected from the group consisting of pre-adipocytes, bone marrow, neutrophils, blood cells, hepatocytes, astrocytes, mesenchymal stem cells, and skeletal muscle cells.
- the cell is in a subject.
- Certain embodiments comprise treating the subject, wherein the subject has a condition associated with a neoplastic disease, an immune system disease or condition, an infectious disease, a metabolic disease, an inflammatory disorder, neuronal/neurological disease, a muscular/cardio vascular disease, a disease associated with aberrant hematopoiesis, a disease associated with aberrant angiogenesis, or a disease associated with aberrant cell survival.
- processes for manufacturing a pharmaceutical compound comprising: a) performing an in vitro screen of one or more candidate compounds in the presence an AARS protein fragment of at least 35 amino acids that comprises an amino acid sequence as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, to identify a compound that specifically binds to the AARS protein fragment; b) performing a cell- based or biochemical or receptor assay with the compound identified in step a), to identify a compound that modulates one or more non-canonical activities of the AARS protein fragment; c) optionally assessing the structure-activity relationship (SAR) of the compound identified in step b), to correlate its structure with modulation of the non- canonical activity, and optionally derivatizing the compound to alter its ability to modulate the non-canonical activity; and d) producing sufficient amounts of the compound identified in step b), or the derivatized compound in step c), for use in humans, thereby manufacturing the pharmaceutical compound.
- SAR structure-activity relationship
- Other embodiments include processes for manufacturing a pharmaceutical compound, comprising: a) performing an in vitro screen of one or more candidate compounds in the presence a cell-surface receptor or an extracellular portion thereof that specifically binds to an AARS protein fragment of Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, to identify a compound that specifically binds to the cell-surface receptor or extracellular portion thereof; b) performing a cell-based or biochemical or receptor assay with the compound identified in step a), to identify a compound that modulates one or more non-canonical activities of the AARS protein fragment; c) optionally assessing the structure-activity relationship (SAR) of the compound identified in step b), to correlate its structure with modulation of the non-canonical activity, and optionally derivatizing the compound to alter its ability to modulate the non-canonical activity; and d) producing sufficient amounts of the compound identified in step b), or the derivatized compound in step c), for use in humans, thereby
- Some embodiments include a cellular composition, comprising an engineered population of cells in which at least one cell comprises a polynucleotide encoding a heterologous full length aminoacyl-tRNA synthetase (AARS) protein, wherein the cells are capable of growing in a serum-free medium.
- the full length aminoacyl-tRNA synthetase (AARS) protein comprises a heterologous purification or epitope tag to facilitate purification of an AARS protein fragment.
- the full length aminoacyl-tRNA synthetase (AARS) protein comprises a heterologous proteolysis site to enable production of the AARS protein fragment upon cleavage.
- Some embodiments include a method for producing an AARS polypeptide as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, or Table E2 in situ within a cell, comprising; i) expressing a heterologous full length aminoacyl-tRNA synthetase (AARS) protein within the cell, wherein the cell comprises a protease capable of cleaving the heterologous full length aminoacyl-tRNA synthetase (AARS) protein to produce the AARS polypeptide.
- AARS heterologous full length aminoacyl-tRNA synthetase
- Some embodiments include a method for producing an AARS polypeptide as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, or Table E2 comprising contacting an isolated full length aminoacyl-tRNA synthetase (AARS) protein with a protease that is capable of cleaving the full length aminoacyl-tRNA synthetase (AARS) protein and producing an AARS polypeptide.
- AARS aminoacyl-tRNA synthetase
- Some embodiments include an engineered full length aminoacyl-tRNA synthetase (AARS) protein comprising a heterologous proteolysis site to enable the proteolytic generation of an AARS protein fragment as set forth in any of Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9 or Table E2.
- AARS aminoacyl-tRNA synthetase
- Some embodiments include a composition, comprising an isolated full length aminoacyl-tRNA synthetase protein, wherein the composition has a purity of at least about 95% on a protein basis, less than about 10 EU endotoxin / mg protein, and is substantially serum free.
- the full length aminoacyl-tRNA synthetase protein is present at a concentration of at least 10 mg / mL, and is at least 90% monodisperse.
- a further embodiment includes a method of treating a disease or disorder mediated by the dysregulation of the expression, activity or spatiotemporal location of a tRNA synthetase via the administration of an AARS protein fragment, or nucleic acid encoding the ARRS protein fragment, as set forth in any of Table(s) 1-3, or Table(s) 4- 6, or Table(s) 7-9, or Table E2.
- the disease is selected from the group consisting of cancer, neuropathy, diabetes, and inflammatory disorders.
- the current invention is directed, at least in part, to the discovery of novel AARS polypeptides, and methods for their preparation and use, which represent the transformation of native wild type proteins into new forms that exhibit markedly different characteristics compared to the naturally occurring full length Phenylalanyl- beta tRNA synthetase genes.
- AARS polypeptides were identified based on extensive sequence, and mass spectrum analysis of expressed Phenylalanyl-beta tRNA synthetases in different tissues, followed by the systematic production and testing of each potential AARS polypeptide to identify protein sequences that represent stable and soluble protein domains which exhibit novel biological activities, and favorable therapeutic drug characteristics.
- Phenylalanyl-beta RNA synthetase derived AARS polypeptides comprise polypeptide sequences approximately comprising amino acids 1 - 1 16 of the Phenylalanyl-beta tRNA synthetase.
- Phenylalanyl-beta tR A synthetase derived AARS polypeptides comprise polypeptide sequences approximately comprising amino acids 373-589 of Phenylalanyl-beta tRNA synthetase.
- Phenylalanyl-beta tRNA synthetase derived AARS polypeptides comprise polypeptide sequences approximately comprising amino acids 89-304 of the Phenylalanyl-beta tRNA synthetase.
- AARS polypeptide families represent novel, previously unknown protein products which exhibit inter alia i) novel biological activity, ii) favorable protein stability and aggregation characteristics, and iii) the ability to be expressed and produced at high level in prokaryotic expression systems, which are materially different characteristics not found in the intact wild type protein.
- “about” is meant a quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length that varies by as much as 30, 25, 20, 25, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1% to a reference quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length.
- An "agonist” refers to a molecule that intensifies or mimics an activity.
- Agonists may include proteins, nucleic acids, carbohydrates, small molecules, or any other compound or composition that modulates the activity of an AARS either by directly interacting with the AARS or its binding partner, or by acting on components of the biological pathway in which the AARS participates. Included are partial and full agonists.
- amino acid is intended to mean both naturally occurring and non-naturally occurring amino acids as well as amino acid analogs and mimetics.
- Naturally occurring amino acids include the 20 (L)-amino acids utilized during protein biosynthesis as well as others such as 4-hydroxyproline, hydroxylysine, desmosine, isodesmosine, homocysteine, citrulline and ornithine, for example.
- Non- naturally occurring amino acids include, for example, (D)-amino acids, norleucine, norvaline, p-fluorophenylalanine, ethionine and the like, which are known to a person skilled in the art.
- Amino acid analogs include modified forms of naturally and non- naturally occurring amino acids.
- Such modifications can include, for example, substitution or replacement of chemical groups and moieties on the amino acid or by derivitization of the amino acid.
- Amino acid mimetics include, for example, organic structures which exhibit functionally similar properties such as charge and charge spacing characteristic of the reference amino acid. For example, an organic structure which mimics Arginine (Arg or R) would have a positive charge moiety located in similar molecular space and having the same degree of mobility as the e-amino group of the side chain of the naturally occurring Arg amino acid.
- Mimetics also include constrained structures so as to maintain optimal spacing and charge interactions of the amino acid or of the amino acid functional groups. Those skilled in the art know or can determine what structures constitute functionally equivalent amino acid analogs and amino acid mimetics.
- non-natural amino acids can be utilized to modify (e.g., increase) a selected non-canonical activity of an AARS protein fragment, or to alter the in vivo or in vitro half-life of the protein.
- Non-natural amino acids can also be used to facilitate (selective) chemical modifications (e.g., pegylation) of an AARS protein.
- certain non-natural amino acids allow selective attachment of polymers such as PEG to a given protein, and thereby improve their pharmacokinetic properties.
- amino acid analogs and mimetics can be found described in, for example, Roberts and Vellaccio, The Peptides: Analysis, Synthesis, Biology, Eds. Gross and Meinhofer, Vol. 5, p. 341, Academic Press, Inc., New York, N.Y. (1983), the entire volume of which is incorporated herein by reference.
- Other examples include peralkylated amino acids, particularly permethylated amino acids. See, for example, Combinatorial Chemistry, Eds. Wilson and Czarnik, Ch. 11, p. 235, John Wiley & Sons Inc., New York, N.Y. (1997), the entire book of which is incorporated herein by reference.
- Yet other examples include amino acids whose amide portion (and, therefore, the amide backbone of the resulting peptide) has been replaced, for example, by a sugar ring, steroid, benzodiazepine or carbo cycle. See, for instance, Burger's Medicinal Chemistry and Drug Discovery, Ed. Manfred E. Wolff, Ch. 15, pp. 619-620, John Wiley & Sons Inc., New York, N.Y. (1995), the entire book of which is incorporated herein by reference. Methods for synthesizing peptides, polypeptides, peptidomimetics and proteins are well known in the art (see, for example, U.S. Pat. No. 5,420,109; M.
- the AARS polypeptides of the present invention may be composed of naturally occurring and non- naturally occurring amino acids as well as amino acid analogs and mimetics.
- Antagonist refers to a molecule that reduces or attenuates an activity.
- a non-canonical biological activity of an AARS or another protein.
- Antagonists may include proteins such as antibodies, nucleic acids, carbohydrates, small molecules, or any other compound or composition that modulates the activity of an AARS or its binding partner, either by directly interacting with the AARS or its binding partner or by acting on components of the biological pathway in which the AARS participates. Included are partial and full antagonists.
- AARS aminoacyl-tRNA synthetase
- aminoacyl- tRNA synthetases catalyze a two-step reaction: first, they activate their respective amino acid by forming an aminoacyl-adenylate, in which the carboxyl of the amino acid is linked in to the alpha-phosphate of ATP by displacing pyrophosphate, and then, when the correct tRNA is bound, the aminoacyl group of the aminoacyl-adenylate is transferred to the 2' or 3' terminal OH of the tRNA.
- Class I aminoacyl-tRNA synthetases typically have two highly conserved sequence motifs. These enzymes aminoacylate at the 2' -OH of an adenosine nucleotide, and are usually monomeric or dimeric. Class II aminoacyl-tRNA synthetases typically have three highly conserved sequence motifs. These enzymes aminoacylate at the 3' -OH of the same adenosine, and are usually dimeric or tetrameric.
- the active sites of class II enzymes are mainly made up of a seven-stranded anti- parallel ⁇ -sheet flanked by a-helices. Although phenylalanine -tRNA synthetase is class II, it aminoacylates at the 2' -OH.
- AARS polypeptides include sources of mitochondrial and cytoplasmic forms of tyrosyl-tRNA synthetase (TyrRS), a tryptophanyl-tRNA synthetase (TrpRS), a glutaminyl-tRNA synthetase (GlnRS), a glycyl-tRNA synthetase (GlyRS), a histidyl- tRNA synthetase (HisRS), a seryl-tRNA synthetase (SerRS), a phenylalanyl-tRNA synthetase (PheRS), an alanyl-tRNA synthetase (AlaRS), an asparaginyl-tRNA synthetase (AsnRS), an aspartyl-tRNA synthetase (AspRS), a cysteinyl-tRNA synthetase (CysRS),
- coding sequence is meant any nucleic acid sequence that contributes to the code for the polypeptide product of a gene.
- non-coding sequence refers to any nucleic acid sequence that does not contribute to the code for the polypeptide product of a gene.
- endotoxin free or “substantially endotoxin free” relates generally to compositions, solvents, and/or vessels that contain at most trace amounts (e.g., amounts having no clinically adverse physiological effects to a subject) of endotoxin, and preferably undetectable amounts of endotoxin.
- Endotoxins are toxins associated with certain bacteria, typically gram-negative bacteria, although endotoxins may be found in gram-positive bacteria, such as Listeria monocytogenes.
- LPS lipopolysaccharides
- LOS lipo-oligo-saccharides
- a depyrogenation oven may be used for this purpose, as temperatures in excess of 300°C are typically required to break down most endotoxins.
- a glass temperature of 250°C and a holding time of 30 minutes is often sufficient to achieve a 3 log reduction in endotoxin levels.
- Other methods of removing endotoxins are contemplated, including, for example, chromatography and filtration methods, as described herein and known in the art.
- compositions comprising AARS polypeptides represent new formulations which exhibit novel and new biological and therapeutic characteristics not found in AARS polypeptide compositions contaminated with serum or endotoxin which have the potential to bind to and alter the novel biological properties of the AARS polypeptides.
- Endotoxins can be detected using routine techniques known in the art.
- the Limulus Ameobocyte Lysate assay which utilizes blood from the horseshoe crab, is a very sensitive assay for detecting presence of endotoxin, and reagents, kits and instrumentation for the detection of endotoxin based on this assay are commercially available, for example from the Lonza Group.
- very low levels of LPS can cause detectable coagulation of the limulus lysate due a powerful enzymatic cascade that amplifies this reaction.
- Endotoxins can also be quantitated by enzyme-linked immunosorbent assay (ELISA).
- ELISA enzyme-linked immunosorbent assay
- endotoxin levels may be less than about 0.001 , 0.005, 0.01 , 0.02, 0.03, 0.04, 0.05, 0.06, 0.08, 0.09, 0.1 , 0.5, 1.0, 1.5, 2, 2.5, 3, 4, 5, 6, 7, 8, 9, or 10 EU /mg of protein.
- 1 ng lipopolysaccharide (LPS) corresponds to about 1-10 EU.
- the "purity" of any given agent (e.g., AARS protein fragment) in a composition may be specifically defined.
- certain compositions may comprise an agent that is at least 80, 85, 90, 91 , 92, 93, 94, 95, 96, 97, 98, 99, or 100% pure, including all decimals in between, as measured, for example and by no means limiting, by high pressure liquid chromatography (HPLC), a well- known form of column chromatography used frequently in biochemistry and analytical chemistry to separate, identify, and quantify compounds.
- HPLC high pressure liquid chromatography
- gene is meant a unit of inheritance that may occupy a specific locus on a chromosome and consists of transcriptional and/or translational regulatory sequences and/or a coding region and/or non-translated sequences (i.e., introns, 5' and 3' untranslated sequences).
- Homology refers to the percentage number of amino acids that are identical or constitute conservative substitutions. Homology may be determined using sequence comparison programs such as GAP (Deveraux et ah, 1984, Nucleic Acids Research 12, 387-395), which is incorporated herein by reference. In this way sequences of a similar or substantially different length to those cited herein could be compared by insertion of gaps into the alignment, such gaps being determined, for example, by the comparison algorithm used by GAP.
- host cell includes an individual cell or cell culture that can be or has been a recipient of any recombinant vector(s), isolated polynucleotide, or polypeptide of the invention.
- Host cells include progeny of a single host cell, and the progeny may not necessarily be completely identical (in morphology or in total DNA complement) to the original parent cell due to natural, accidental, or deliberate mutation and/or change.
- a host cell includes cells transfected or infected in vivo or in vitro with a recombinant vector or a polynucleotide of the invention.
- a host cell which comprises a recombinant vector of the invention is a recombinant host cell.
- isolated is meant material that is substantially or essentially free from components that normally accompany it in its native state.
- an "isolated polynucleotide,” as used herein, includes a polynucleotide that has been purified from the sequences that flank it in its naturally-occurring state, e.g., a DNA fragment which has been removed from the sequences that are normally adjacent to the fragment.
- an "isolated peptide” or an “isolated polypeptide” and the like, as used herein, includes the in vitro isolation and/or purification of a peptide or polypeptide molecule from its natural cellular environment, and from association with other components of the cell; i.e., it is not significantly associated with in vivo substances.
- mRNA or sometimes refer by "mRNA transcripts" as used herein, include, but not limited to pre-mRNA transcript(s), transcript processing intermediates, mature mRNA(s) ready for translation and transcripts of the gene or genes, or nucleic acids derived from the mRNA transcript(s). Transcript processing may include splicing, editing and degradation.
- a nucleic acid derived from an mRNA transcript refers to a nucleic acid for whose synthesis the mRNA transcript or a subsequence thereof has ultimately served as a template.
- mRNA derived samples include, but are not limited to, mRNA transcripts of the gene or genes, cDNA reverse transcribed from the mRNA, cRNA transcribed from the cDNA, DNA amplified from the genes, RNA transcribed from amplified DNA, and the like.
- Non-canonical activity refers generally to either i) a new activity possessed by an AARS polypeptide of the invention that is not possessed to any significant degree by the intact native full length parental protein, or ii) an activity that was possessed by the by the intact native full length parental protein, where the AARS polypeptide either exhibits a significantly higher (i.e. at least 20% greater) specific activity compared to the intact native full length parental protein, or exhibits the activity in a new context; for example by isolating the activity from other activities possessed by the intact native full length parental protein.
- non-limiting examples of non-canonical activities include extracellular signaling, RNA- binding, amino acid-binding, modulation of cell proliferation, modulation of cell migration, modulation of cell differentiation (e.g., hematopoiesis, neurogenesis, myogenesis, osteogenesis, and adipogenesis), modulation of gene transcription, modulation of apoptosis or other forms of cell death, modulation of cell signaling, modulation of cellular uptake, or secretion, modulation of angiogenesis, modulation of cell binding, modulation of cellular metabolism, modulation of cytokine production or activity, modulation of cytokine receptor activity, modulation of inflammation, and the like.
- EC 50 half maximal effective concentration refers to the concentration of an AARS protein fragment, antibody or other agent described herein at which it induces a response halfway between the baseline and maximum after some specified exposure time; the EC 50 of a graded dose response curve therefore represents the concentration of a compound at which 50% of its maximal effect is observed.
- the EC 50 of an agent provided herein is indicated in relation to a “non-canonical” activity, as noted above.
- EC 50 also represents the plasma concentration required for obtaining 50% of a maximum effect in vivo.
- the “EC 90” refers to the concentration of an agent or composition at which 90% of its maximal effect is observed.
- the "EC90” can be calculated from the “EC50” and the Hill slope, or it can be determined from the data directly, using routine knowledge in the art.
- the EC50 of an AARS protein fragment, antibody, or other agent is less than about 0.01, 0.05, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 40, 50, 60, 70, 80, 90, or 100 nM.
- biotherapeutic composition will have an EC50 value of about InM or less.
- modulating includes “increasing” or “stimulating,” as well as “decreasing” or “reducing,” typically in a statistically significant or a physiologically significant amount as compared to a control.
- a “modulator” may be an agonist, an antagonist, or any mixture thereof depending upon the conditions used.
- An “increased” or “enhanced” amount is typically a “statistically significant” amount, and may include an increase that is 1.1, 1.2, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30 or more times (e.g., 500, 1000 times) (including all integers and decimal points in between and above 1, e.g., 1.5, 1.6, 1.7.
- a "decreased” or reduced amount is typically a "statistically significant” amount, and may include a 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18% , 19%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%), or 100%) decrease in the amount produced by no composition (the absence of an agent or compound) or a control composition, including all integers in between.
- a control in comparing canonical and non-canonical activities could include the AARS protein fragment of interest compared to its corresponding full-length AARS, or a fragment AARS having comparable canonical activity to its corresponding full-length AARS.
- Other examples of "statistically significant" amounts are described herein.
- an AARS sequence of the present invention may be "derived” from the sequence information of an AARS proteolytic fragment or AARS splice variant, or a portion thereof, whether naturally-occurring or artificially generated, and may thus comprise, consist essentially of, or consist of that sequence
- polypeptide and protein are used interchangeably herein to refer to a polymer of amino acid residues and to variants and synthetic and naturally occurring analogues of the same.
- amino acid polymers in which one or more amino acid residues are synthetic non-naturally occurring amino acids, such as a chemical analogue of a corresponding naturally occurring amino acid, as well as to naturally-occurring amino acid polymers and naturally occurring chemical derivatives thereof.
- derivatives include, for example, post-translational modifications and degradation products including pyroglutamyl, iso-aspartyl, proteolytic, phosphorylated, glycosylated, oxidatized, isomerized, and deaminated variants of the AARS reference fragment.
- sequence identity or, for example, comprising a “sequence 50% identical to,” as used herein, refer to the extent that sequences are identical on a nucleotide-by-nucleotide basis or an amino acid-by-amino acid basis over a window of comparison.
- a "percentage of sequence identity” may be calculated by comparing two optimally aligned sequences over the window of comparison, determining the number of positions at which the identical nucleic acid base (e.g., A, T, C, G, I) or the identical amino acid residue (e.g., Ala, Pro, Ser, Thr, Gly, Val, Leu, He, Phe, Tyr, Trp, Lys, Arg, His, Asp, Glu, Asn, Gin, Cys and Met) occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity.
- the identical nucleic acid base e.g., A, T, C, G, I
- the identical amino acid residue e.g., Ala, Pro, Ser, Thr, Gly, Val, Leu, He, Phe, Tyr, Trp, Lys, Arg,
- references to describe sequence relationships between two or more polynucleotides or polypeptides include “reference sequence,” “comparison window,” “sequence identity,” “percentage of sequence identity” and “substantial identity.”
- a “reference sequence” is at least 12 but frequently 15 to 18 and often at least 25 monomer units, inclusive of nucleotides and amino acid residues, in length.
- two polynucleotides may each comprise (1) a sequence (i.e., only a portion of the complete polynucleotide sequence) that is similar between the two polynucleotides, and (2) a sequence that is divergent between the two polynucleotides
- sequence comparisons between two (or more) polynucleotides are typically performed by comparing sequences of the two polynucleotides over a "comparison window" to identify and compare local regions of sequence similarity.
- a “comparison window” refers to a conceptual segment of at least 6 contiguous positions, usually about 50 to about 100, more usually about 100 to about 150 in which a sequence is compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
- the comparison window may comprise additions or deletions (i.e., gaps) of about 20% or less as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences.
- Optimal alignment of sequences for aligning a comparison window may be conducted by computerized implementations of algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package Release 7.0, Genetics Computer Group, 575 Science Drive Madison, WI, USA) or by inspection and the best alignment (i.e., resulting in the highest percentage homology over the comparison window) generated by any of the various methods selected.
- GAP Garnier et al.
- sequence similarity or sequence identity between sequences are performed as follows. To determine the percent identity of two amino acid sequences, or of two nucleic acid sequences, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes).
- the length of a reference sequence aligned for comparison purposes is at least 30%, preferably at least 40%>, more preferably at least 50%, 60%, and even more preferably at least 70%, 80%, 90%, 100% of the length of the reference sequence.
- amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position.
- the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
- the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm.
- the percent identity between two amino acid sequences is determined using the Needleman and Wunsch, (1970, J. Mol. Biol. 48: 444-453) algorithm which has been incorporated into the GAP program in the GCG software package (available at http://www.gcg.com), using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6.
- the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package (available at http://www.gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6.
- a particularly preferred set of parameters are a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frame shift gap penalty of 5.
- the percent identity between two amino acid or nucleotide sequences can be determined using the algorithm of E. Meyers and W. Miller (1989, Cabios, 4: 11-17) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
- nucleic acid and protein sequences described herein can be used as a "query sequence" to perform a search against public databases to, for example, identify other family members or related sequences.
- Such searches can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul, et al, (1990, J. Mol. Biol, 215: 403-10).
- Gapped BLAST can be utilized as described in Altschul et al, (1997, Nucleic Acids Res, 25: 3389-3402).
- the default parameters of the respective programs ⁇ e.g., XBLAST and NBLAST.
- solubility refers to the property of an agent provided herein to dissolve in a liquid solvent and form a homogeneous solution. Solubility is typically expressed as a concentration, either by mass of solute per unit volume of solvent (g of solute per kg of solvent, g per dL (100 mL), mg/ml, etc.), molarity, molality, mole fraction or other similar descriptions of concentration.
- the maximum equilibrium amount of solute that can dissolve per amount of solvent is the solubility of that solute in that solvent under the specified conditions, including temperature, pressure, pH, and the nature of the solvent.
- solubility is measured at physiological pH. In certain embodiments, solubility is measured in water or a physiological buffer such as PBS.
- solubility is measured in a biological fluid (solvent) such as blood or serum.
- the temperature can be about room temperature ⁇ e.g., about 20, 21, 22, 23, 24, 25°C) or about body temperature (37°C).
- an agent such as an AARS protein fragment has a solubility of at least about 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, or 30 mg/ml at room temperature or at 37°C.
- a "splice junction" as used herein includes the region in a mature mRNA transcript or the encoded polypeptide where the 3' end of a first exon joins with the 5' end of a second exon.
- the size of the region may vary, and may include 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100 or more (including all integers in between) nucleotide or amino acid residues on either side of the exact residues where the 3' end of one exon joins with the 5' end of another exon.
- an “exon” refers to a nucleic acid sequence that is represented in the mature form of an RNA molecule after either portions of a precursor RNA (introns) have been removed by cis-splicing or two or more precursor RNA molecules have been ligated by trans-splicing.
- the mature RNA molecule can be a messenger RNA or a functional form of a non-coding RNA such as rRNA or tRNA.
- an exon can refer to the sequence in the DNA or its RNA transcript.
- An "intron” refers to a non-coding nucleic acid region within a gene, which is not translated into a protein. Non-coding intronic sections are transcribed to precursor mRNA (pre-mRNA) and some other RNAs (such as long noncoding RNAs), and subsequently removed by splicing during the processing to mature RNA.
- a "splice variant” refers to a mature mRNA and its encoded protein that are produced by alternative splicing, a process by which the exons of the RNA (a primary gene transcript or pre -mRNA) are reconnected in multiple ways during RNA splicing. The resulting different mRNAs may be translated into different protein isoforms, allowing a single gene to code for multiple proteins.
- a "subject,” as used herein, includes any animal that exhibits a symptom, or is at risk for exhibiting a symptom, which can be treated or diagnosed with an AARS polynucleotide or polypeptide of the invention. Also included are subjects for which it is desirable to profile levels of AARS polypeptides and/or polynucleotides of the invention, for diagnostic or other purposes. Suitable subjects (patients) include laboratory animals (such as mouse, rat, rabbit, or guinea pig), farm animals, and domestic animals or pets (such as a cat or dog). Non-human primates and, preferably, human patients, are included.
- Treatment includes any desirable effect on the symptoms or pathology of a disease or condition that can be effected by the non- canonical activities of an AARS polynucleotide or polypeptide, as described herein, and may include even minimal changes or improvements in one or more measurable markers of the disease or condition being treated. Also included are treatments that relate to non-AARS therapies, in which an AARS sequence described herein provides a clinical marker of treatment. "Treatment” or “treating” does not necessarily indicate complete eradication or cure of the disease or condition, or associated symptoms thereof. The subject receiving this treatment is any subject in need thereof. Exemplary markers of clinical improvement will be apparent to persons skilled in the art.
- Embodiments of the present invention therefore include full length proteins, mature protein isoforms and protein fragments of aminoacyl-tRNA synthetases (AARS), in addition to biologically active variants and fragments thereof.
- the proteins and fragments may arise through endogenous proteolysis, in vitro proteolysis, splice variation, or in silico prediction, among other mechanisms.
- the AARS protein fragments described herein, and variants thereof, may possess at least one "non-canonical" biological activity.
- the AARS protein fragment(s) of the present invention are also referred to herein as "AARS polypeptides" or "AARS reference polypeptides.”
- the AARS polypeptides provided herein comprise or consist essentially of all or a portion of the AARS polypeptide "reference sequence(s)" as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9 below, which represent the amino acid sequence(s) of various fragments of Phenylalanyl-beta tRNA synthetases.
- Mouse and human AARS protein sequences are highly related, typically differing by no more than a few amino acids within an entire sequence, a particular domain, or a particular protein fragment.
- N-terminal AARS Polypeptides (Tables 1, 2 & 3)
- Protein / AKIVLDIIVTMFSEHCENQFTVEAVEVVSPNGKSSTFPE SEQ. mouse LPYRKEMVRADLINKKVGIRETPANLAKLLTRMCLK ID. No.
- PheRSbl 12 DNA / AATCAATTTACGGTCGAAGCTGCTGAAG SEQ.
- Protein fragments or the amino acid sequence of protein fragments, such as proteolytic fragments or splice variant fragments, can be characterized, identified, or derived according to a variety of techniques. For instance, splice variants can be identified by techniques such as deep sequencing (see, e.g., Xing et ah, RNA. 14:1470- 1479, 2008; and Zhang et al, Genome Research. 17:503-509, 2007). As a further example, protein fragments such as proteolytic fragments can be identified in vitro, such as by incubating full-length or other AARS polypeptides with selected proteases, or they can be identified endogenous ly ⁇ e.g., in vivo).
- protein fragments such as endogenous proteolytic fragments can be generated or identified, for instance, by recombinantly expressing full-length or other AARS polypeptides in a selected microorganism or eukaryotic cell that has been either modified to contain one or more selected proteases, or that naturally contains one or more proteases that are capable of acting on a selected AARS polypeptide, and isolating and characterizing the endogenously produced protein fragments therefrom.
- protein fragments such as endogenous ⁇ e.g., naturally-occurring) proteolytic fragments can be generated or identified, for instance, from various cellular fractions ⁇ e.g., cytosolic, membrane, nuclear) and/or growth medium of various cell-types, including, for example, immune cells such as monocytes, dendritic cells, macrophages ⁇ e.g., RAW 264.7 macrophages), neutrophils, eosinophils, basophils, and lymphocytes, such as B-cells and T-cells ⁇ e.g., CD4+ helper and CD8+ killer cells), including primary T-cells and T-cell lines such as Jurkat T-cells, as well as natural killer (NK) cells.
- immune cells such as monocytes, dendritic cells, macrophages ⁇ e.g., RAW 264.7 macrophages
- neutrophils neutrophils
- eosinophils basophils
- lymphocytes such as B-cell
- protein fragments such as endogenous proteolytic fragments, however generated, can be identified by techniques such as mass- spectrometry, or equivalent techniques. Once an in vitro or endogenously identified protein fragment has been generated or identified, it can be mapped or sequenced, and, for example, cloned into an expression vector for recombinant production, or produced synthetically.
- proteases can be used to produce, identify, derive, or characterize the sequence of AARS protein fragments such as proteolytic fragments.
- proteases are usually classified according to three major criteria: (i) the reaction catalyzed, (ii) the chemical nature of the catalytic site, and (iii) the evolutionary relationship, as revealed by the structure.
- General examples of proteases or proteinases, as classified by mechanism of catalysis, include aspartic proteases, serine proteases, cysteine proteases, and metalloproteases.
- aspartic proteases belong to the pepsin family. This family includes digestive enzymes, such as pepsin and chymosin, as well as lysosomal cathepsins D and processing enzymes such as renin, and certain fungal proteases (e.g., penicillopepsin, rhizopuspepsin, endothiapepsin).
- a second family of aspartic proteases includes viral proteinases such as the protease from the AIDS virus (HIV), also called retropepsin.
- Serine proteases include two distinct families. First, the chymotrypsin family, which includes the mammalian enzymes such as chymotrypsin, trypsin, elastase, and kallikrein, and second, the substilisin family, which includes the bacterial enzymes such as subtilisin. The general 3D structure between these two families is different, but they have the same active site geometry, and catalysis proceeds via the same mechanism.
- the serine proteases exhibit different substrate specificities, differences which relate mainly to amino acid substitutions in the various enzyme subsites (substrate residue interacting sites). Some serine proteases have an extended interaction site with the substrate whereas others have a specificity that is restricted to the PI substrate residue.
- the cysteine protease family includes the plant proteases such as papain, actinidin, and bromelain, several mammalian lysosomal cathepsins, the cytosolic calpains (calcium-activated), as well as several parasitic proteases (e.g., Trypanosoma, Schistosoma).
- Papain is the archetype and the best studied member of the family. Recent elucidation of the X-ray structure of the Interleukin-l-beta Converting Enzyme has revealed a novel type of fold for cysteine proteinases.
- the metalloproteases are one of the older classes of proteases, found in bacteria, fungi, and higher organisms. They differ widely in their sequences and their 3D structures, but the great majority of enzymes contain a zinc atom that is catalytically active. In some cases, zinc may be replaced by another metal such as cobalt or nickel without loss of proteolytic activity.
- Bacterial thermolysin has been well characterized and its crystallographic structure indicates that zinc is bound by two histidines and one glutamic acid. Many metalloproteases contain the sequence motif HEXXH, which provides two histidine ligands for the zinc. The third ligand is either a glutamic acid (thermolysin, neprilysin, alanyl aminopeptidase) or a histidine (astacin, serralysin).
- Illustrative proteases include, for example, achromopeptidase, aminopeptidase, ancrod, angiotensin converting enzyme, bromelain, calpain, calpain I, calpain II, carboxypeptidase A, carboxypeptidase B, carboxypeptidase G, carboxypeptidase P, carboxypeptidase W, carboxypeptidase Y, caspase 1, caspase 2, caspase 3, caspase 4, caspase 5, caspase 6, caspase 7, caspase 8, caspase 9, caspase 10, caspase 11, caspase 12, caspase 13, cathepsin B, cathepsin C, cathepsin D, cathepsin E, cathepsin G, cathepsin H, cathepsin L, chymopapain , chymase, chymotrypsin, clostripain, collagenase, complement Clr, complement
- protease from Bacillus polymyxa protease from Bacillus sp, protease from Rhizopus sp., protease S, proteasomes, proteinase from Aspergillus oryzae, proteinase 3, proteinase A, proteinase K, protein C, pyroglutamate aminopeptidase, rennin, rennin, streptokinase, subtilisin, thermolysin, thrombin, tissue plasminogen activator, trypsin, tryptase and urokinase.
- AARS polypeptides comprising, consisting essentially of, or consisting of amino acid sequences that have been derived from endogenous, naturally-occurring AARS polypeptide fragments, and pharmaceutical compositions comprising said fragments, and methods of use thereof.
- AARS proteolytic fragments are generated or identified by incubating an AARS polypeptide, such as a full-length AARS polypeptide, with one or more isolated human proteases, mainly those proteases that are endogenous or natural to humans, such as elastase and others described herein and known in the art.
- AARS polypeptides comprising, consisting essentially of, or consisting of amino acid sequences that have been derived from endogenous, naturally-occurring AARS splice variants, and pharmaceutical compositions comprising said fragments, and methods of use thereof.
- AARS protein fragment can be isolated from samples that have been exposed to proteases, whether in vivo or in vitro.
- AARS protein fragments can be identified by techniques such as mass-spectrometry, or equivalent techniques.
- the proteomes from various cell types, tissues, or body fluids from a variety of physiological states ⁇ e.g., hypoxia, diet, age, disease
- the gel lanes cut into bands at fixed intervals; after which the bands may be optionally digested with an appropriate protease, such as trypsin, to release the peptides, which may then be analyzed by ID reverse phase LC-MS/MS.
- the resulting proteomic data may be integrated into so-called peptographs, which plot, in the left panel, sequence coverage for a given protein in the horizontal dimension (N to C terminus, left to right) versus SDS-PAGE migration in the vertical dimension (high to low molecular weight, top to bottom).
- the specific peptide fragments can then be sequenced or mapped.
- the AARS reference fragment may be characterized by its unique molecular weight, as compared, for example, to the molecular weight of the corresponding full-length AARS.
- embodiments of the present invention include the AARS polypeptides set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9. Also included are “variants” of the AARS reference polypeptides.
- the recitation polypeptide "variant” refers to polypeptides that are distinguished from a reference AARS polypeptide by the addition, deletion, and/or substitution of at least one amino acid residue, and which typically retain ⁇ e.g., mimic) or modulate ⁇ e.g., antagonize) one or more non-canonical activities of a reference AARS polypeptide.
- human Phenylalanyl-beta tRNA synthetases include several hundred highly related polymorphic forms, and these are known in the art to be at least partially functionally interchangeable. It would thus be a routine matter to select a naturally occurring variant of Phenylalanyl-beta tRNA synthetase, including, for example the single nucleotide polymorphic forms listed in Table A to create an AARS polypeptide containing one or more amino acid changes based on the sequence of any of the homologues, orthologs, and naturally-occurring isoforms of human as well as other species of Phenylalanyl-beta tRNA synthetase. Table A
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Biomedical Technology (AREA)
- Immunology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Hematology (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Urology & Nephrology (AREA)
- General Engineering & Computer Science (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Diabetes (AREA)
- Cell Biology (AREA)
- Neurology (AREA)
- General Physics & Mathematics (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Pathology (AREA)
- Cardiology (AREA)
- Heart & Thoracic Surgery (AREA)
- Neurosurgery (AREA)
- Gastroenterology & Hepatology (AREA)
Priority Applications (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP11781304.8A EP2568996B1 (en) | 2010-05-14 | 2011-05-12 | Therapeutic, diagnostic, and antibody compositions related to protein fragments of phenylalanyl-beta-trna synthetases |
| US13/697,996 US8945541B2 (en) | 2010-05-14 | 2011-05-12 | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of phenylalanyl-beta-tRNA synthetases |
| AU2011252990A AU2011252990B2 (en) | 2010-05-14 | 2011-05-12 | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of phenylalanyl-beta-tRNA synthetases |
| JP2013510312A JP6396656B2 (ja) | 2010-05-14 | 2011-05-12 | フェニルアラニルβtRNA合成酵素のタンパク質フラグメントに関連した治療用、診断用および抗体組成物の革新的発見 |
| CA2799197A CA2799197C (en) | 2010-05-14 | 2011-05-12 | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of phenylalanyl-beta-trna synthetases |
| CN201180031824.XA CN103200953B (zh) | 2010-05-14 | 2011-05-12 | 与苯丙氨酰‑β‑tRNA合成酶的蛋白片段相关的治疗、诊断和抗体组合物的创新发现 |
| US14/577,510 US9687533B2 (en) | 2010-05-14 | 2014-12-19 | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of phenylalanyl-beta-tRNA synthetases |
| US15/599,183 US10220080B2 (en) | 2010-05-14 | 2017-05-18 | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of phenylalanyl-beta-tRNA synthetases |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US33495610P | 2010-05-14 | 2010-05-14 | |
| US33495710P | 2010-05-14 | 2010-05-14 | |
| US34502010P | 2010-05-14 | 2010-05-14 | |
| US61/345,020 | 2010-05-14 | ||
| US61/334,957 | 2010-05-14 | ||
| US61/334,956 | 2010-05-14 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/697,996 A-371-Of-International US8945541B2 (en) | 2010-05-14 | 2011-05-12 | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of phenylalanyl-beta-tRNA synthetases |
| US14/577,510 Continuation US9687533B2 (en) | 2010-05-14 | 2014-12-19 | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of phenylalanyl-beta-tRNA synthetases |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2011143482A2 true WO2011143482A2 (en) | 2011-11-17 |
| WO2011143482A3 WO2011143482A3 (en) | 2012-04-05 |
Family
ID=44914984
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2011/036326 Ceased WO2011143482A2 (en) | 2010-05-14 | 2011-05-12 | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of phenylalanyl-beta-trna synthetases |
Country Status (7)
| Country | Link |
|---|---|
| US (3) | US8945541B2 (https=) |
| EP (1) | EP2568996B1 (https=) |
| JP (3) | JP6396656B2 (https=) |
| CN (1) | CN103200953B (https=) |
| AU (1) | AU2011252990B2 (https=) |
| CA (1) | CA2799197C (https=) |
| WO (1) | WO2011143482A2 (https=) |
Cited By (28)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8945541B2 (en) | 2010-05-14 | 2015-02-03 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of phenylalanyl-beta-tRNA synthetases |
| US8946157B2 (en) | 2010-05-03 | 2015-02-03 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of seryl-tRNA synthetases |
| US8961960B2 (en) | 2010-04-27 | 2015-02-24 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of isoleucyl tRNA synthetases |
| US8961961B2 (en) | 2010-05-03 | 2015-02-24 | a Tyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related protein fragments of arginyl-tRNA synthetases |
| US8962560B2 (en) | 2010-06-01 | 2015-02-24 | Atyr Pharma Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of Lysyl-tRNA synthetases |
| US8969301B2 (en) | 2010-07-12 | 2015-03-03 | Atyr Pharma Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of aspartyl-tRNA synthetases |
| US8980253B2 (en) | 2010-04-26 | 2015-03-17 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of cysteinyl-tRNA synthetase |
| US8986680B2 (en) | 2010-04-29 | 2015-03-24 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of Asparaginyl tRNA synthetases |
| US8986681B2 (en) | 2010-04-27 | 2015-03-24 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of threonyl-tRNA synthetases |
| US8993723B2 (en) | 2010-04-28 | 2015-03-31 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of alanyl-tRNA synthetases |
| US8999321B2 (en) | 2010-07-12 | 2015-04-07 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of glycyl-tRNA synthetases |
| US9029506B2 (en) | 2010-08-25 | 2015-05-12 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of tyrosyl-tRNA synthetases |
| US9034321B2 (en) | 2010-05-03 | 2015-05-19 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of phenylalanyl-alpha-tRNA synthetases |
| US9034598B2 (en) | 2010-05-17 | 2015-05-19 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of leucyl-tRNA synthetases |
| US9062302B2 (en) | 2010-05-04 | 2015-06-23 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of p38 multi-tRNA synthetase complex |
| US9062301B2 (en) | 2010-05-04 | 2015-06-23 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of glutamyl-prolyl-tRNA synthetases |
| US9068177B2 (en) | 2010-04-29 | 2015-06-30 | Atyr Pharma, Inc | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of glutaminyl-tRNA synthetases |
| US9399770B2 (en) | 2010-10-06 | 2016-07-26 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of tryptophanyl-tRNA synthetases |
| US9422539B2 (en) | 2010-07-12 | 2016-08-23 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of histidyl-tRNA synthetases |
| US9422538B2 (en) | 2010-05-03 | 2016-08-23 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of methionyl-tRNA synthetasis |
| US9556425B2 (en) | 2010-04-29 | 2017-01-31 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of Valyl-tRNA synthetases |
| US9587235B2 (en) | 2013-03-15 | 2017-03-07 | Atyr Pharma, Inc. | Histidyl-tRNA synthetase-Fc conjugates |
| US9688978B2 (en) | 2011-12-29 | 2017-06-27 | Atyr Pharma, Inc. | Aspartyl-tRNA synthetase-Fc conjugates |
| US9714419B2 (en) | 2011-08-09 | 2017-07-25 | Atyr Pharma, Inc. | PEGylated tyrosyl-tRNA synthetase polypeptides |
| US9796972B2 (en) | 2010-07-12 | 2017-10-24 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of glycyl-tRNA synthetases |
| US9816084B2 (en) | 2011-12-06 | 2017-11-14 | Atyr Pharma, Inc. | Aspartyl-tRNA synthetases |
| US9822353B2 (en) | 2011-12-06 | 2017-11-21 | Atyr Pharma, Inc. | PEGylated aspartyl-tRNA synthetase polypeptides |
| US11767520B2 (en) | 2017-04-20 | 2023-09-26 | Atyr Pharma, Inc. | Compositions and methods for treating lung inflammation |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2403864B1 (en) | 2009-02-27 | 2015-08-12 | Atyr Pharma, Inc. | Polypeptide structural motifs associated with cell signaling activity |
| US20160144003A1 (en) * | 2011-05-19 | 2016-05-26 | The Scripps Research Institute | Compositions and methods for treating charcot-marie-tooth diseases and related neuronal diseases |
| WO2025079943A1 (ko) * | 2023-10-10 | 2025-04-17 | 한국생명공학연구원 | 페닐알라닐-tRNA 합성효소, 이의 서브유닛, 이들의 단편 및 변이체의 용도 |
Citations (226)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
| US4483105A (en) | 1983-03-11 | 1984-11-20 | Maschinenfabrik Gehring, Gesellschaft Mit Beschrankter Haftung & Co. Kommanditgesellschaft | Device to hold workpieces for the honing of their axial center bore |
| US4683202A (en) | 1985-03-28 | 1987-07-28 | Cetus Corporation | Process for amplifying nucleic acid sequences |
| US4683195A (en) | 1986-01-30 | 1987-07-28 | Cetus Corporation | Process for amplifying, detecting, and/or-cloning nucleic acid sequences |
| US4800159A (en) | 1986-02-07 | 1989-01-24 | Cetus Corporation | Process for amplifying, detecting, and/or cloning nucleic acid sequences |
| US4873192A (en) | 1987-02-17 | 1989-10-10 | The United States Of America As Represented By The Department Of Health And Human Services | Process for site specific mutagenesis without phenotypic selection |
| US4904584A (en) | 1987-12-23 | 1990-02-27 | Genetics Institute, Inc. | Site-specific homogeneous modification of polypeptides |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| US4965188A (en) | 1986-08-22 | 1990-10-23 | Cetus Corporation | Process for amplifying, detecting, and/or cloning nucleic acid sequences using a thermostable enzyme |
| US5013830A (en) | 1986-09-08 | 1991-05-07 | Ajinomoto Co., Inc. | Compounds for the cleavage at a specific position of RNA, oligomers employed for the formation of said compounds, and starting materials for the synthesis of said oligomers |
| US5034506A (en) | 1985-03-15 | 1991-07-23 | Anti-Gene Development Group | Uncharged morpholino-based polymers having achiral intersubunit linkages |
| US5034229A (en) | 1988-12-13 | 1991-07-23 | Alza Corporation | Dispenser for increasing feed conversion of hog |
| US5091513A (en) | 1987-05-21 | 1992-02-25 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US5110596A (en) | 1988-12-13 | 1992-05-05 | Alza Corporation | Delivery system comprising means for delivering agent to livestock |
| US5130238A (en) | 1988-06-24 | 1992-07-14 | Cangene Corporation | Enhanced nucleic acid amplification process |
| US5132405A (en) | 1987-05-21 | 1992-07-21 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US5142047A (en) | 1985-03-15 | 1992-08-25 | Anti-Gene Development Group | Uncharged polynucleotide-binding polymers |
| US5143854A (en) | 1989-06-07 | 1992-09-01 | Affymax Technologies N.V. | Large scale photolithographic solid phase synthesis of polypeptides and receptor binding screening thereof |
| US5149797A (en) | 1990-02-15 | 1992-09-22 | The Worcester Foundation For Experimental Biology | Method of site-specific alteration of rna and production of encoded polypeptides |
| US5166315A (en) | 1989-12-20 | 1992-11-24 | Anti-Gene Development Group | Sequence-specific binding polymers for duplex nucleic acids |
| EP0519596A1 (en) | 1991-05-17 | 1992-12-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
| US5217866A (en) | 1985-03-15 | 1993-06-08 | Anti-Gene Development Group | Polynucleotide assay reagent and method |
| US5220007A (en) | 1990-02-15 | 1993-06-15 | The Worcester Foundation For Experimental Biology | Method of site-specific alteration of RNA and production of encoded polypeptides |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5256775A (en) | 1989-06-05 | 1993-10-26 | Gilead Sciences, Inc. | Exonuclease-resistant oligonucleotides |
| US5270184A (en) | 1991-11-19 | 1993-12-14 | Becton, Dickinson And Company | Nucleic acid target generation |
| US5293050A (en) | 1993-03-25 | 1994-03-08 | International Business Machines Corporation | Semiconductor quantum dot light emitting/detecting devices |
| US5399491A (en) | 1989-07-11 | 1995-03-21 | Gen-Probe Incorporated | Nucleic acid sequence amplification methods |
| US5399363A (en) | 1991-01-25 | 1995-03-21 | Eastman Kodak Company | Surface modified anticancer nanoparticles |
| US5403711A (en) | 1987-11-30 | 1995-04-04 | University Of Iowa Research Foundation | Nucleic acid hybridization and amplification method for detection of specific sequences in which a complementary labeled nucleic acid probe is cleaved |
| US5412087A (en) | 1992-04-24 | 1995-05-02 | Affymax Technologies N.V. | Spatially-addressable immobilization of oligonucleotides and other biological polymers on surfaces |
| US5420109A (en) | 1993-11-12 | 1995-05-30 | Houghten Pharmaceuticals, Inc. | Cytokine restraining agents |
| US5436327A (en) | 1988-09-21 | 1995-07-25 | Isis Innovation Limited | Support-bound oligonucleotides |
| US5455166A (en) | 1991-01-31 | 1995-10-03 | Becton, Dickinson And Company | Strand displacement amplification |
| US5466468A (en) | 1990-04-03 | 1995-11-14 | Ciba-Geigy Corporation | Parenterally administrable liposome formulation comprising synthetic lipids |
| EP0684315A1 (en) | 1994-04-18 | 1995-11-29 | Becton, Dickinson and Company | Strand displacement amplification using thermophilic enzymes |
| US5480784A (en) | 1989-07-11 | 1996-01-02 | Gen-Probe Incorporated | Nucleic acid sequence amplification methods |
| US5491133A (en) | 1987-11-30 | 1996-02-13 | University Of Iowa Research Foundation | Methods for blocking the expression of specifically targeted genes |
| US5506337A (en) | 1985-03-15 | 1996-04-09 | Antivirals Inc. | Morpholino-subunit combinatorial library and method |
| US5511355A (en) | 1991-11-15 | 1996-04-30 | Dingler; Gerhard | Construction element |
| US5521063A (en) | 1985-03-15 | 1996-05-28 | Antivirals Inc. | Polynucleotide reagent containing chiral subunits and methods of use |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5539082A (en) | 1993-04-26 | 1996-07-23 | Nielsen; Peter E. | Peptide nucleic acids |
| US5541061A (en) | 1992-04-29 | 1996-07-30 | Affymax Technologies N.V. | Methods for screening factorial chemical libraries |
| US5543508A (en) | 1987-12-15 | 1996-08-06 | Gene Shears Pty. Limited | Ribozymes |
| US5543158A (en) | 1993-07-23 | 1996-08-06 | Massachusetts Institute Of Technology | Biodegradable injectable nanoparticles |
| US5545729A (en) | 1994-12-22 | 1996-08-13 | Hybridon, Inc. | Stabilized ribozyme analogs |
| US5557318A (en) | 1994-07-12 | 1996-09-17 | Koninklijke Ptt Nederland N.V. | Method and apparatus for permitting a viewer to scan through a plurality of video signals provided by a transmitter |
| US5565350A (en) | 1993-12-09 | 1996-10-15 | Thomas Jefferson University | Compounds and methods for site directed mutations in eukaryotic cells |
| US5593839A (en) | 1994-05-24 | 1997-01-14 | Affymetrix, Inc. | Computer-aided engineering system for design of sequence arrays and lithographic masks |
| US5623065A (en) | 1990-08-13 | 1997-04-22 | Isis Pharmaceuticals, Inc. | Gapped 2' modified oligonucleotides |
| US5641515A (en) | 1995-04-04 | 1997-06-24 | Elan Corporation, Plc | Controlled release biodegradable nanoparticles containing insulin |
| US5652356A (en) | 1995-08-17 | 1997-07-29 | Hybridon, Inc. | Inverted chimeric and hybrid oligonucleotides |
| US5652355A (en) | 1992-07-23 | 1997-07-29 | Worcester Foundation For Experimental Biology | Hybrid oligonucleotide phosphorothioates |
| US5652122A (en) | 1989-12-21 | 1997-07-29 | Frankel; Alan | Nucleic acids encoding and methods of making tat-derived transport polypeptides |
| WO1997042507A1 (en) | 1996-05-02 | 1997-11-13 | Isis Innovation Limited | Peptide array and method |
| US5700922A (en) | 1991-12-24 | 1997-12-23 | Isis Pharmaceuticals, Inc. | PNA-DNA-PNA chimeric macromolecules |
| US5714331A (en) | 1991-05-24 | 1998-02-03 | Buchardt, Deceased; Ole | Peptide nucleic acids having enhanced binding affinity, sequence specificity and solubility |
| US5719262A (en) | 1993-11-22 | 1998-02-17 | Buchardt, Deceased; Ole | Peptide nucleic acids having amino acid side chains |
| US5725871A (en) | 1989-08-18 | 1998-03-10 | Danbiosyst Uk Limited | Drug delivery compositions comprising lysophosphoglycerolipid |
| US5728396A (en) | 1996-02-02 | 1998-03-17 | Alza Corporation | Sustained delivery of leuprolide using an implantable system |
| US5733729A (en) | 1995-09-14 | 1998-03-31 | Affymetrix, Inc. | Computer-aided probability base calling for arrays of nucleic acid probes on chips |
| US5756353A (en) | 1991-12-17 | 1998-05-26 | The Regents Of The University Of California | Expression of cloned genes in the lung by aerosol-and liposome-based delivery |
| US5766960A (en) | 1987-07-27 | 1998-06-16 | Australian Membrane And Biotechnology Research Institute | Receptor membranes |
| US5780045A (en) | 1992-05-18 | 1998-07-14 | Minnesota Mining And Manufacturing Company | Transmucosal drug delivery device |
| US5795716A (en) | 1994-10-21 | 1998-08-18 | Chee; Mark S. | Computer-aided visualization and analysis system for sequence evaluation |
| US5800988A (en) | 1992-08-21 | 1998-09-01 | Vrije Universiteit Brussel | Immunoglobulins devoid of light chains |
| US5800992A (en) | 1989-06-07 | 1998-09-01 | Fodor; Stephen P.A. | Method of detecting nucleic acids |
| US5804604A (en) | 1989-12-21 | 1998-09-08 | Biogen, Inc. | Tat-derived transport polypeptides and fusion proteins |
| US5804212A (en) | 1989-11-04 | 1998-09-08 | Danbiosyst Uk Limited | Small particle compositions for intranasal drug delivery |
| US5811387A (en) | 1990-05-15 | 1998-09-22 | Chiron Corporation | Peptoid mixtures |
| US5814454A (en) | 1997-01-15 | 1998-09-29 | Incyte Pharmaceuticals, Inc. | Sets of labeled energy transfer fluorescent primers and their use in multi component analysis |
| US5824784A (en) | 1994-10-12 | 1998-10-20 | Amgen Inc. | N-terminally chemically modified protein compositions and methods |
| US5837196A (en) | 1996-01-26 | 1998-11-17 | The Regents Of The University Of California | High density array fabrication and readout method for a fiber optic biosensor |
| US5836935A (en) | 1994-11-10 | 1998-11-17 | Ashton; Paul | Implantable refillable controlled release device to deliver drugs directly to an internal portion of the body |
| US5843655A (en) | 1995-09-18 | 1998-12-01 | Affymetrix, Inc. | Methods for testing oligonucleotide arrays |
| US5856092A (en) | 1989-02-13 | 1999-01-05 | Geneco Pty Ltd | Detection of a nucleic acid sequence or a change therein |
| US5858659A (en) | 1995-11-29 | 1999-01-12 | Affymetrix, Inc. | Polymorphism detection |
| US5871928A (en) | 1989-06-07 | 1999-02-16 | Fodor; Stephen P. A. | Methods for nucleic acid analysis |
| US5874219A (en) | 1995-06-07 | 1999-02-23 | Affymetrix, Inc. | Methods for concurrently processing multiple biological chip assays |
| US5900461A (en) | 1993-11-12 | 1999-05-04 | Shearwater Polymers, Inc. | Isolatable, water soluble, and hydrolytically stable active sulfones of poly(ethylene glycol) and related polymers for modification of surfaces and molecules |
| US5902723A (en) | 1989-06-07 | 1999-05-11 | Dower; William J. | Analysis of surface immobilized polymers utilizing microfluorescence detection |
| US5925525A (en) | 1989-06-07 | 1999-07-20 | Affymetrix, Inc. | Method of identifying nucleotide differences |
| US5932462A (en) | 1995-01-10 | 1999-08-03 | Shearwater Polymers, Inc. | Multiarmed, monofunctional, polymer for coupling to molecules and surfaces |
| WO1999039210A1 (en) | 1998-01-29 | 1999-08-05 | Miller, Samuel | High density arrays for proteome analysis and methods and compositions therefor |
| US5936731A (en) | 1991-02-22 | 1999-08-10 | Applied Spectral Imaging Ltd. | Method for simultaneous detection of multiple fluorophores for in situ hybridization and chromosome painting |
| WO1999040434A1 (en) | 1998-02-04 | 1999-08-12 | Invitrogen Corporation | Microarrays and uses therefor |
| US5955589A (en) | 1991-12-24 | 1999-09-21 | Isis Pharmaceuticals Inc. | Gapped 2' modified oligonucleotides |
| US5958342A (en) | 1996-05-17 | 1999-09-28 | Incyte Pharmaceuticals, Inc. | Jet droplet device |
| US5976109A (en) | 1996-04-30 | 1999-11-02 | Medtronic, Inc. | Apparatus for drug infusion implanted within a living body |
| US6004755A (en) | 1998-04-07 | 1999-12-21 | Incyte Pharmaceuticals, Inc. | Quantitative microarray hybridizaton assays |
| US6005079A (en) | 1992-08-21 | 1999-12-21 | Vrije Universiteit Brussels | Immunoglobulins devoid of light chains |
| US6013449A (en) | 1997-11-26 | 2000-01-11 | The United States Of America As Represented By The Department Of Health And Human Services | Probe-based analysis of heterozygous mutations using two-color labelling |
| US6020135A (en) | 1998-03-27 | 2000-02-01 | Affymetrix, Inc. | P53-regulated genes |
| US6033860A (en) | 1997-10-31 | 2000-03-07 | Affymetrix, Inc. | Expression profiles in adult and fetal organs |
| US6040138A (en) | 1995-09-15 | 2000-03-21 | Affymetrix, Inc. | Expression monitoring by hybridization to high density oligonucleotide arrays |
| US6045996A (en) | 1993-10-26 | 2000-04-04 | Affymetrix, Inc. | Hybridization assays on oligonucleotide arrays |
| US6054274A (en) | 1997-11-12 | 2000-04-25 | Hewlett-Packard Company | Method of amplifying the signal of target nucleic acid sequence analyte |
| US6083726A (en) | 1998-02-03 | 2000-07-04 | Lucent Technologies, Inc. | Methods for polynucleotide synthesis and articles for polynucleotide hybridization |
| US6090555A (en) | 1997-12-11 | 2000-07-18 | Affymetrix, Inc. | Scanned image alignment systems and methods |
| US6103474A (en) | 1996-10-21 | 2000-08-15 | Agilent Technologies Inc. | Hybridization assay signal enhancement |
| WO2000047774A1 (en) | 1999-02-09 | 2000-08-17 | Nexstar Pharmaceuticals, Inc. | Aptamers as reagents for high throughput screening |
| US6113938A (en) | 1997-12-30 | 2000-09-05 | Alza Corporation | Beneficial agent delivery system with membrane plug and method for controlling delivery of beneficial agents |
| WO2000054046A2 (en) | 1999-03-10 | 2000-09-14 | The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services, The National Institutes Of Health | Universal protein array system |
| WO2000061806A2 (en) | 1999-04-09 | 2000-10-19 | Arcturus Engineering, Inc. | GENERIC cDNA OR PROTEIN ARRAY FOR CUSTOMIZED ASSAYS |
| US6156331A (en) | 1996-02-02 | 2000-12-05 | Alza Corporation | Sustained delivery of an active agent using an implantable system |
| WO2000074701A2 (en) | 1999-06-05 | 2000-12-14 | The Board Of Trustees Of The Leland Stanford Junior University | Method and composition for inhibiting cardiovascular cell proliferation |
| US6171797B1 (en) | 1999-10-20 | 2001-01-09 | Agilent Technologies Inc. | Methods of making polymeric arrays |
| US6177248B1 (en) | 1999-02-24 | 2001-01-23 | Affymetrix, Inc. | Downstream genes of tumor suppressor WT1 |
| US6185561B1 (en) | 1998-09-17 | 2001-02-06 | Affymetrix, Inc. | Method and apparatus for providing and expression data mining database |
| US6188783B1 (en) | 1997-07-25 | 2001-02-13 | Affymetrix, Inc. | Method and system for providing a probe array chip design database |
| US6203989B1 (en) | 1998-09-30 | 2001-03-20 | Affymetrix, Inc. | Methods and compositions for amplifying detectable signals in specific binding assays |
| US6210922B1 (en) | 1998-11-30 | 2001-04-03 | National Research Council Of Canada | Serum free production of recombinant proteins and adenoviral vectors |
| US6214587B1 (en) | 1994-03-16 | 2001-04-10 | Gen-Probe Incorporated | Isothermal strand displacement nucleic acid amplification |
| US6223127B1 (en) | 1997-08-15 | 2001-04-24 | Affymetrix, Inc. | Polymorphism detection utilizing clustering analysis |
| US6228575B1 (en) | 1996-02-08 | 2001-05-08 | Affymetrix, Inc. | Chip-based species identification and phenotypic characterization of microorganisms |
| US6238866B1 (en) | 1996-04-16 | 2001-05-29 | The United States Of America As Represented By The Secretary Of The Army | Detector for nucleic acid typing and methods of using the same |
| US6245518B1 (en) | 1998-12-11 | 2001-06-12 | Hyseq, Inc. | Polynucleotide arrays and methods of making and using the same |
| US6245886B1 (en) | 1995-02-16 | 2001-06-12 | Bayer Corporation | Peptides and peptidomimetics with structural similarity to human P53 that activate P53 function |
| US6251601B1 (en) | 1999-02-02 | 2001-06-26 | Vysis, Inc. | Simultaneous measurement of gene expression and genomic abnormalities using nucleic acid microarrays |
| US6263287B1 (en) | 1998-11-12 | 2001-07-17 | Scios Inc. | Systems for the analysis of gene expression data |
| US6262216B1 (en) | 1998-10-13 | 2001-07-17 | Affymetrix, Inc. | Functionalized silicon compounds and methods for their synthesis and use |
| US6268141B1 (en) | 1999-05-12 | 2001-07-31 | Beckman Coulter, Inc. | Immobilization of unmodified biopolymers to acyl fluoride activated substrates |
| US6268210B1 (en) | 1998-05-27 | 2001-07-31 | Hyseq, Inc. | Sandwich arrays of biological compounds |
| US6267152B1 (en) | 2000-02-18 | 2001-07-31 | Wisconsin Label Corporation | Hang tag and method of applying hang tag to an elongated object |
| WO2001057259A1 (en) | 2000-02-03 | 2001-08-09 | Research Development Foundation | Signaling aptamers that transduce molecular recognition to a differential signal |
| US6280954B1 (en) | 1998-02-02 | 2001-08-28 | Amersham Pharmacia Biotech Ab | Arrayed primer extension technique for nucleic acid analysis |
| US6283949B1 (en) | 1999-12-27 | 2001-09-04 | Advanced Cardiovascular Systems, Inc. | Refillable implantable drug delivery pump |
| US6284460B1 (en) | 1993-06-25 | 2001-09-04 | Affymetrix Inc. | Hybridization and sequencing of nucleic acids using base pair mismatches |
| US6284497B1 (en) | 1998-04-09 | 2001-09-04 | Trustees Of Boston University | Nucleic acid arrays and methods of synthesis |
| US6284465B1 (en) | 1999-04-15 | 2001-09-04 | Agilent Technologies, Inc. | Apparatus, systems and method for locating nucleic acids bound to surfaces |
| US6287850B1 (en) | 1995-06-07 | 2001-09-11 | Affymetrix, Inc. | Bioarray chip reaction apparatus and its manufacture |
| WO2001068671A1 (en) | 2000-03-10 | 2001-09-20 | President And Fellows Of Harvard College | Method of making protein arrays |
| US6300063B1 (en) | 1995-11-29 | 2001-10-09 | Affymetrix, Inc. | Polymorphism detection |
| US6306643B1 (en) | 1998-08-24 | 2001-10-23 | Affymetrix, Inc. | Methods of using an array of pooled probes in genetic analysis |
| US6309822B1 (en) | 1989-06-07 | 2001-10-30 | Affymetrix, Inc. | Method for comparing copy number of nucleic acid sequences |
| US6309824B1 (en) | 1997-01-16 | 2001-10-30 | Hyseq, Inc. | Methods for analyzing a target nucleic acid using immobilized heterogeneous mixtures of oligonucleotide probes |
| US6309828B1 (en) | 1998-11-18 | 2001-10-30 | Agilent Technologies, Inc. | Method and apparatus for fabricating replicate arrays of nucleic acid molecules |
| US6312906B1 (en) | 1999-01-15 | 2001-11-06 | Imperial College Innovations, Ltd. | Immobilized nucleic acid hybridization reagent and method |
| US6316003B1 (en) | 1989-12-21 | 2001-11-13 | Whitehead Institute For Biomedical Research | Tat-derived transport polypeptides |
| US6316193B1 (en) | 1998-10-06 | 2001-11-13 | Origene Technologies, Inc. | Rapid-screen cDNA library panels |
| WO2001088162A2 (en) | 2000-05-16 | 2001-11-22 | Genway Biotech, Inc. | Methods and vectors for generating antibodies in avian species and uses therefor |
| WO2001094946A2 (en) | 2000-06-05 | 2001-12-13 | Chiron Corporation | Microarrays for performing proteomic analyses |
| US6333179B1 (en) | 1997-06-20 | 2001-12-25 | Affymetrix, Inc. | Methods and compositions for multiplex amplification of nucleic acids |
| US6344316B1 (en) | 1996-01-23 | 2002-02-05 | Affymetrix, Inc. | Nucleic acid analysis techniques |
| US6348185B1 (en) | 1998-06-20 | 2002-02-19 | Washington University School Of Medicine | Membrane-permeant peptide complexes for medical imaging, diagnostics, and pharmaceutical therapy |
| US6351712B1 (en) | 1998-12-28 | 2002-02-26 | Rosetta Inpharmatics, Inc. | Statistical combining of cell expression profiles |
| US6361947B1 (en) | 1998-10-27 | 2002-03-26 | Affymetrix, Inc. | Complexity management and analysis of genomic DNA |
| WO2002025288A2 (en) | 2000-09-22 | 2002-03-28 | Clontech Laboratories Inc. | Highly sensitive proteomic analysis methods and kits and systems for practicing the same |
| US6368799B1 (en) | 1997-06-13 | 2002-04-09 | Affymetrix, Inc. | Method to detect gene polymorphisms and monitor allelic expression employing a probe array |
| US6372431B1 (en) | 1999-11-19 | 2002-04-16 | Incyte Genomics, Inc. | Mammalian toxicological response markers |
| WO2002031463A2 (en) | 2000-08-31 | 2002-04-18 | Motorola, Inc. | High density column and row addressable electrode arrays |
| US6375978B1 (en) | 1997-12-22 | 2002-04-23 | Alza Corporation | Rate controlling membranes for controlled drug delivery devices |
| US6376190B1 (en) | 2000-09-22 | 2002-04-23 | Somalogic, Inc. | Modified SELEX processes without purified protein |
| US6376191B1 (en) | 2000-03-22 | 2002-04-23 | Mergen, Ltd. | Microarray-based analysis of polynucleotide sequence variations |
| US6379897B1 (en) | 2000-11-09 | 2002-04-30 | Nanogen, Inc. | Methods for gene expression monitoring on electronic microarrays |
| US6380377B1 (en) | 2000-07-14 | 2002-04-30 | Applied Gene Technologies, Inc. | Nucleic acid hairpin probes and uses thereof |
| US6383749B2 (en) | 1999-12-02 | 2002-05-07 | Clontech Laboratories, Inc. | Methods of labeling nucleic acids for use in array based hybridization assays |
| US6383754B1 (en) | 1999-08-13 | 2002-05-07 | Yale University | Binary encoded sequence tags |
| US6387620B1 (en) | 1999-07-28 | 2002-05-14 | Gilead Sciences, Inc. | Transcription-free selex |
| US6386749B1 (en) | 2000-06-26 | 2002-05-14 | Affymetrix, Inc. | Systems and methods for heating and mixing fluids |
| US6391623B1 (en) | 1996-03-26 | 2002-05-21 | Affymetrix, Inc. | Fluidics station injection needles with distal end and side ports and method of using |
| US6395292B2 (en) | 1996-02-02 | 2002-05-28 | Alza Corporation | Sustained delivery of an active agent using an implantable system |
| US6420108B2 (en) | 1998-02-09 | 2002-07-16 | Affymetrix, Inc. | Computer-aided display for comparative gene expression |
| US6436386B1 (en) | 2000-11-14 | 2002-08-20 | Shearwater Corporation | Hydroxyapatite-targeting poly (ethylene glycol) and related polymers |
| WO2002069930A1 (en) | 2001-02-23 | 2002-09-12 | Cellgate, Inc. | Compositions and methods for enhancing drug delivery across and into epithelial tissues |
| US20020183936A1 (en) | 2001-01-24 | 2002-12-05 | Affymetrix, Inc. | Method, system, and computer software for providing a genomic web portal |
| US20030036069A1 (en) | 2001-07-25 | 2003-02-20 | Affymetrix, Inc. | Complexity Managment of genomic DNA |
| US6525185B1 (en) | 1998-05-07 | 2003-02-25 | Affymetrix, Inc. | Polymorphisms associated with hypertension |
| US20030108532A1 (en) | 2000-04-04 | 2003-06-12 | Enanta Pharmaceuticals | Methods for identifying peptide aptamers capable of altering a cell phenotype |
| WO2003049772A2 (en) | 2001-12-11 | 2003-06-19 | The Board Of Trustees Of The Leland Stanford Junior University | Guanidinium transport reagents and conjugates |
| US6582908B2 (en) | 1990-12-06 | 2003-06-24 | Affymetrix, Inc. | Oligonucleotides |
| US6585602B2 (en) | 2000-02-24 | 2003-07-01 | Gkn Lobro Gmbh | Plunging assembly for a driveshaft |
| US6586802B2 (en) | 1999-01-14 | 2003-07-01 | Mitsubishi Denki Kabushiki Kaisha | Semiconductor device |
| US6589503B1 (en) | 1998-06-20 | 2003-07-08 | Washington University | Membrane-permeant peptide complexes for medical imaging, diagnostics, and pharmaceutical therapy |
| US6596541B2 (en) | 2000-10-31 | 2003-07-22 | Regeneron Pharmaceuticals, Inc. | Methods of modifying eukaryotic cells |
| US6632611B2 (en) | 2001-07-20 | 2003-10-14 | Affymetrix, Inc. | Method of target enrichment and amplification |
| WO2003106491A2 (en) | 2002-06-18 | 2003-12-24 | Cepep Ab | Cell penetrating peptides |
| US6670461B1 (en) | 1997-09-12 | 2003-12-30 | Exiqon A/S | Oligonucleotide analogues |
| US6673901B2 (en) | 1997-06-12 | 2004-01-06 | Research Corporation Technologies, Inc. | Artificial antibody polypeptides |
| US6765087B1 (en) | 1992-08-21 | 2004-07-20 | Vrije Universiteit Brussel | Immunoglobulins devoid of light chains |
| US20040175756A1 (en) | 2001-04-26 | 2004-09-09 | Avidia Research Institute | Methods for using combinatorial libraries of monomer domains |
| US6818394B1 (en) | 1996-11-06 | 2004-11-16 | Sequenom, Inc. | High density immobilization of nucleic acids |
| US20050048512A1 (en) | 2001-04-26 | 2005-03-03 | Avidia Research Institute | Combinatorial libraries of monomer domains |
| US20050053973A1 (en) | 2001-04-26 | 2005-03-10 | Avidia Research Institute | Novel proteins with targeted binding |
| US6881825B1 (en) | 1999-09-01 | 2005-04-19 | University Of Pittsburgh Of The Commonwealth System Of Higher Education | Identication of peptides that facilitate uptake and cytoplasmic and/or nuclear transport of proteins, DNA and virues |
| US20050089932A1 (en) | 2001-04-26 | 2005-04-28 | Avidia Research Institute | Novel proteins with targeted binding |
| US6921642B2 (en) | 2000-06-20 | 2005-07-26 | Qlagen Gmbh | Protein expression profiling |
| US6924103B2 (en) | 2000-08-31 | 2005-08-02 | Canon Kabushiki Kaisha | Screening method for gene variation |
| US6936419B1 (en) | 1999-11-25 | 2005-08-30 | Epigenomics Ag | Oligomer array with PNA and/or DNA oligomers on a surface |
| US20050221384A1 (en) | 2001-04-26 | 2005-10-06 | Avidia Research Institute | Combinatorial libraries of monomer domains |
| US6969766B2 (en) | 2002-04-26 | 2005-11-29 | Panagene, Inc. | PNA monomer and precursor |
| US6982351B2 (en) | 2001-12-07 | 2006-01-03 | Cellgate, Inc. | Cycloalkyl substituted polyamines for cancer therapy and methods of synthesis therefor |
| US20060008822A1 (en) | 2004-04-27 | 2006-01-12 | Alnylam Pharmaceuticals, Inc. | Single-stranded and double-stranded oligonucleotides comprising a 2-arylpropyl moiety |
| US20060035254A1 (en) | 2004-07-21 | 2006-02-16 | Alnylam Pharmaceuticals, Inc. | Oligonucleotides comprising a modified or non-natural nucleobase |
| US7011945B2 (en) | 2001-12-21 | 2006-03-14 | Eastman Kodak Company | Random array of micro-spheres for the analysis of nucleic acids |
| US7011949B2 (en) | 2002-09-30 | 2006-03-14 | Agilent Technologies, Inc. | Methods and compositions for producing labeled probe nucleic acids for use in array based comparative genomic hybridization applications |
| US20060058510A1 (en) | 1997-09-26 | 2006-03-16 | Arne Skerra | Anticalins |
| US7022851B2 (en) | 2002-01-24 | 2006-04-04 | Panagene, Inc. | PNA monomer and precursor |
| US7029872B2 (en) | 2000-06-28 | 2006-04-18 | Glycofi, Inc | Methods for producing modified glycoproteins |
| US7028629B2 (en) | 2003-02-03 | 2006-04-18 | Richard Walcome | Self-sealing port light assembly |
| US7053207B2 (en) | 1999-05-04 | 2006-05-30 | Exiqon A/S | L-ribo-LNA analogues |
| US7060809B2 (en) | 2001-09-04 | 2006-06-13 | Exiqon A/S | LNA compositions and uses thereof |
| US7084125B2 (en) | 1999-03-18 | 2006-08-01 | Exiqon A/S | Xylo-LNA analogues |
| US20060287260A1 (en) | 2004-06-30 | 2006-12-21 | Alnylam Pharmaceuticals, Inc. | Oligonucleotides comprising a non-phosphate backbone linkage |
| US7166697B1 (en) | 1998-03-06 | 2007-01-23 | Diatech Pty. Ltd. | V-like domain binding molecules |
| US20070054279A1 (en) | 2004-08-04 | 2007-03-08 | Alnylam Pharmaceuticals | Oligonucleotides comprising a ligand tethered to a modified or non-natural nucleobase |
| US20070082365A1 (en) | 1998-12-10 | 2007-04-12 | Adnexus Therapeutics, Inc. | Protein scaffolds for antibody mimics and other binding proteins |
| US7211668B2 (en) | 2003-07-28 | 2007-05-01 | Panagene, Inc. | PNA monomer and precursor |
| US7229961B2 (en) | 1999-08-24 | 2007-06-12 | Cellgate, Inc. | Compositions and methods for enhancing drug delivery across and into ocular tissues |
| US7244592B2 (en) | 2002-03-07 | 2007-07-17 | Dyax Corp. | Ligand screening and discovery |
| WO2007106554A2 (en) | 2006-03-14 | 2007-09-20 | Progen Pharmaceuticals, Inc. | Treatment and prevention of vascular hyperplasia using polyamine and polyamine analog compounds |
| WO2007111993A2 (en) | 2006-03-22 | 2007-10-04 | Cellgate, Inc. | Polyamine analogs as therapeutic agents for skin diseases |
| US7279502B2 (en) | 1999-04-30 | 2007-10-09 | Cellgate, Inc. | Polyamine analog conjugates and quinone conjugates as therapies for cancers and prostate diseases |
| US20070275465A1 (en) | 2003-06-13 | 2007-11-29 | Alnylam Pharmaceuticals | Double-Stranded Ribonucleic Acid with Increased Effectiveness in an Organism |
| US7306784B2 (en) | 1998-06-20 | 2007-12-11 | Washington University | Membrane-permeant peptide complexes for medical imaging, diagnostics, and pharmaceutical therapy |
| US7312244B2 (en) | 1999-04-30 | 2007-12-25 | Cellgate, Inc. | Polyamine analog-amino acid conjugates useful as anticancer agents |
| WO2008063113A1 (en) | 2006-11-20 | 2008-05-29 | Cepep Iii Ab | Cell -penetrating peptides and constructs containing them consisting 15-25 amino acids of tumor supressor protein p14arf or p19arf |
| US20080220049A1 (en) | 2003-12-05 | 2008-09-11 | Adnexus, A Bristol-Myers Squibb R&D Company | Compositions and methods for intraocular delivery of fibronectin scaffold domain proteins |
| US7431915B2 (en) | 2003-10-31 | 2008-10-07 | The Regents Of The University Of California | Peptides whose uptake by cells is controllable |
| US20090082274A1 (en) | 2000-09-08 | 2009-03-26 | Universitat Zurich | Collections of repeat proteins comprising repeat modules |
| US7569575B2 (en) | 2002-05-08 | 2009-08-04 | Santaris Pharma A/S | Synthesis of locked nucleic acid derivatives |
| US7572582B2 (en) | 1997-09-12 | 2009-08-11 | Exiqon A/S | Oligonucleotide analogues |
| US7585834B2 (en) | 2001-02-16 | 2009-09-08 | The Board Of Trustees Of The Leland Stanford Junior University | Transporters comprising spaced arginine moieties |
| WO2009158649A1 (en) | 2008-06-26 | 2009-12-30 | Atyr Pharma, Inc. | Compositions and methods comprising glycyl-trna synthetases having non-canonical biological activities |
| US8012804B1 (en) | 2009-12-23 | 2011-09-06 | Western Digital (Fremont), Llc | Method and system for mounting lasers on energy assisted magnetic recording heads |
Family Cites Families (129)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DE9115660U1 (de) * | 1991-12-18 | 1992-07-30 | Aventis Research & Technologies GmbH & Co KG, 65929 Frankfurt | L-Phenylalanyl-tRNA-Synthetase mit erweiterter Substratselektivität aus Mikroorganismen |
| US5759833A (en) | 1994-05-27 | 1998-06-02 | Cubist Pharmaceuticals, Inc. | Human isoleucyl-tRNA synthetase proteins, nucleic acids and tester strains comprising same |
| US5756327A (en) | 1994-09-13 | 1998-05-26 | Cubist Pharmaceuticals, Inc. | Recombinant mycobacterial isoleucyl-tRNA synthetase genes, tester strains and assays |
| US5798240A (en) | 1994-09-13 | 1998-08-25 | Cubist Pharmaceuticals, Inc. | Recombinant mycobacterial methionyl-tRNA synthetase genes and methods of use therefore |
| US5801013A (en) | 1995-05-26 | 1998-09-01 | Cubist Pharmaceuticals, Inc. | Helicobacter aminoacyl-tRNA synthetase proteins, nucleic acids and strains comprising same |
| EP1876241A3 (en) | 1996-01-11 | 2008-07-30 | Corixa Corporation | Compositions and methods for the treatment and diagnosis of breast cancer |
| EP1275720A3 (en) | 1996-01-19 | 2003-04-16 | Smithkline Beecham Plc | Histidyl-trna synthetase of staphylococcus aureus |
| WO1997026344A1 (en) | 1996-01-19 | 1997-07-24 | Smithkline Beecham Plc | ASPARTYL-tRNA SYNTHETASE OF STAPHYLOCOCCUS AUREUS |
| GB9601067D0 (en) | 1996-01-19 | 1996-03-20 | Smithkline Beecham Plc | Novel compounds |
| US5795757A (en) | 1997-01-17 | 1998-08-18 | Smithkline Beecham, P.L.C. | DNA encoding threonyl tRNA synthetase from staphylococcus aureus |
| GB9607991D0 (en) | 1996-04-18 | 1996-06-19 | Smithkline Beecham Plc | Novel compounds |
| GB9607993D0 (en) | 1996-04-18 | 1996-06-19 | Smithkline Beecham Plc | Novel compounds |
| US5795758A (en) | 1997-04-18 | 1998-08-18 | Smithkline Beecham Corporation | DNA encoding histidyl tRNA synthetase variant from Streptococcus pneumoniae |
| KR100203919B1 (ko) | 1996-10-04 | 1999-06-15 | 신동권 | 수용성 단백질을 생산하는 새로운 발현 플라스미드 |
| US5885815A (en) | 1996-11-01 | 1999-03-23 | Cubist Pharmaceuticals, Inc. | Candida isoleucyl-tRNA synthetase proteins, nucleic acids and strains comprising same |
| US5776749A (en) | 1997-01-17 | 1998-07-07 | Smithkline Beecham P.L.C. | DNA encoding cysteinyl tRNA synthetase from Staphylococcus aureus |
| CA2289116A1 (en) | 1997-05-06 | 1998-11-12 | Human Genome Sciences, Inc. | Enterococcus faecalis polynucleotides and polypeptides |
| US5939298A (en) * | 1997-07-23 | 1999-08-17 | Smithkline Beecham Corporation | DNA encoding phenylalanyl tRNA synthetase alpha sub-unit from chlamydi a trachomatis |
| US5882892A (en) | 1997-07-23 | 1999-03-16 | Smithkline Beecham Corporation | Asps |
| US5858720A (en) | 1997-07-23 | 1999-01-12 | Smithkline Beecham Corporation | Hiss |
| CN1292033A (zh) | 1998-03-04 | 2001-04-18 | 昂尼克斯药物公司 | 用于遗传物质高通量表达的杆状病毒表达系统和方法 |
| US6428960B1 (en) | 1998-03-04 | 2002-08-06 | Onyx Pharmaceuticals, Inc. | Selection method for producing recombinant baculovirus |
| CA2319089A1 (en) * | 1998-04-09 | 1999-10-21 | Genset S.A. | 5' ests and encoded human proteins |
| US6255090B1 (en) | 1998-07-15 | 2001-07-03 | E. I. Du Pont De Nemours & Company | Plant aminoacyl-tRNA synthetase |
| US6271441B1 (en) | 1998-07-21 | 2001-08-07 | E. I. Du Pont De Nemours & Company | Plant aminoacyl-tRNA synthetase |
| US6696619B1 (en) | 1998-11-05 | 2004-02-24 | Omolayo O. Famodu | Plant aminoacyl-tRNA synthetases |
| CA2380317A1 (en) | 1999-07-22 | 2001-02-01 | Incyte Genomics, Inc. | Human synthetases |
| WO2001019999A1 (en) | 1999-09-14 | 2001-03-22 | Shanghai Biorigin Gene Development Co. Ltd. | A GENE ENCODING A NOVEL THREONYL-tRNA SYNTHETASE, ITS USES AND THE PREPARING METHODS |
| US6548060B1 (en) | 1999-11-18 | 2003-04-15 | Sunghoon Kim | Anti-apoptotic use of human glutaminyl-tRNA synthetase with two consecutive pro-apoptotic mediators |
| CN1311300A (zh) | 2000-03-02 | 2001-09-05 | 上海博德基因开发有限公司 | 一种新的多肽-人苏氨酰-tRNA合成酶14和编码这种多肽的多核苷酸 |
| WO2001075078A1 (en) | 2000-03-31 | 2001-10-11 | The Scripps Research Institute | HUMAN AMINOACYL-tRNA SYNTHETASE POLYPEPTIDES USEFUL FOR THE REGULATION OF ANGIOGENESIS |
| US6436703B1 (en) | 2000-03-31 | 2002-08-20 | Hyseq, Inc. | Nucleic acids and polypeptides |
| US7144984B2 (en) | 2000-03-31 | 2006-12-05 | The Scripps Research Institute | Human aminoacyl-tRNA synthetase polypeptides useful for the regulation of angiogenesis |
| US7273844B2 (en) | 2000-03-31 | 2007-09-25 | The Scripps Research Institute | Tryptophanyl-tRNA synthetase-derived polypeptides useful for the regulation of angiogenesis |
| US20040181830A1 (en) | 2001-05-07 | 2004-09-16 | Kovalic David K. | Nucleic acid molecules and other molecules associated with plants and uses thereof for plant improvement |
| CN1322818A (zh) | 2000-05-09 | 2001-11-21 | 上海博德基因开发有限公司 | 一种新的多肽——人II类氨酰基-tRNA合成酶10和编码这种多肽的多核苷酸 |
| JP2004512014A (ja) | 2000-05-18 | 2004-04-22 | 学校法人日本大学 | 虚血状態の検査方法 |
| WO2001090330A2 (en) | 2000-05-25 | 2001-11-29 | Incyte Genomics, Inc. | AMINOACYL tRNA SYNTHETASES |
| CN1341727A (zh) | 2000-09-07 | 2002-03-27 | 上海博德基因开发有限公司 | 一种新的多肽——甲硫氨酰tRNA合成酶35.09和编码这种多肽的多核苷酸 |
| CN1341725A (zh) | 2000-09-07 | 2002-03-27 | 上海博德基因开发有限公司 | 一种新的多肽——人苏氨酰-tRNA合成酶48.73和编码这种多肽的多核苷酸 |
| CN1352242A (zh) | 2000-11-02 | 2002-06-05 | 上海博德基因开发有限公司 | 一种新的多肽——人谷氨酰tRNA合成酶12.65和编码这种多肽的多核苷酸 |
| CN1352252A (zh) | 2000-11-06 | 2002-06-05 | 上海博德基因开发有限公司 | 一种新的多肽——人II类氨酰基-tRNA合成酶11.77和编码这种多肽的多核苷酸 |
| AU2002223349A1 (en) | 2000-11-28 | 2002-06-11 | Mcgill University | Incorporation and priming function of trnalys in hiv and related viruses |
| JP2004537270A (ja) | 2000-12-15 | 2004-12-16 | インサイト・ゲノミックス・インコーポレイテッド | アミノアシルtRNA合成酵素 |
| ATE420653T1 (de) | 2001-02-23 | 2009-01-15 | Scripps Research Inst | Von tryptophanyl-trna-synthetase stammende polypeptide zur regulierung der angiogenese |
| US6903189B2 (en) | 2001-03-21 | 2005-06-07 | The Scripps Research Institute | Human aminoacyl-tRNA synthetase polypeptides useful for the regulation of angiogenesis |
| WO2002085923A2 (en) * | 2001-04-19 | 2002-10-31 | The Scripps Research Institute | In vivo incorporation of unnatural amino acids |
| US20030215827A1 (en) | 2001-05-22 | 2003-11-20 | Henry Yue | Aminoacyl trna synthetases |
| KR100405919B1 (ko) | 2001-06-05 | 2003-11-14 | 주식회사 이매진 | p43의 N-말단 펩타이드를 유효성분으로 하는 면역증강용 약학조성물 |
| US20040018505A1 (en) | 2001-06-29 | 2004-01-29 | Lee Ernestine A. | Aminoacyl trna synthetases |
| AU2002332430A1 (en) | 2001-07-26 | 2003-02-17 | Novartis Ag | Methods of treating neuropilin-mediated diseases |
| US7785827B2 (en) | 2001-09-20 | 2010-08-31 | University Of Houston System | Method and composition for leucyl-tRNA synthetases and derivatives thereof that activate and aminoacylate non-leucine amino acid to tRNA adaptor molecules |
| US20040048290A1 (en) | 2001-12-13 | 2004-03-11 | Lee Ernestine A | Aminoacyl trna synthetases |
| AU2003234600A1 (en) | 2002-05-13 | 2003-11-11 | Rigel Pharmaceuticals, Inc. | tRNA SYNTHASE: MODULATORS OF ANGIOGENESIS |
| CA2497338A1 (en) | 2002-08-30 | 2004-03-18 | Japan Science And Technology Corporation | Method of targeted gene disruption, genome of hyperthermostable bacterium and genome chip using the same |
| DK1534830T3 (da) | 2002-09-06 | 2011-02-14 | Isogenica Ltd | In vito-peptid-ekspressionsbibliotek |
| KR100575251B1 (ko) | 2003-03-03 | 2006-05-02 | 재단법인서울대학교산학협력재단 | p38/JTV-1을 유효성분으로 하는 암 치료용 약학적조성물 및 암 치료용 약학적 조성물의 스크리닝 방법 |
| WO2004087875A2 (en) | 2003-03-25 | 2004-10-14 | Incyte Corporation | Nucleic acid-associated proteins |
| US20040224981A1 (en) | 2003-05-01 | 2004-11-11 | Nebojsa Janjic | Antibacterial methods and compositions |
| US20060160175A1 (en) | 2003-07-07 | 2006-07-20 | The Scripps Research Institute | Compositions of orthogonal leucyl-trna and aminoacyl-trna synthetase pairs and uses thereof |
| EP1649004A4 (en) | 2003-07-07 | 2008-04-09 | Scripps Research Inst | COMPOSITIONS WITH PAIRS OF ORTHOGONAL LYSYL-TRNA AND AMINOACYL-TRNA-SYNTHETASE AND USES THEREOF |
| US7741071B2 (en) | 2003-12-18 | 2010-06-22 | The Scripps Research Institute | Selective incorporation of 5-hydroxytryptophan into proteins in mammalian cells |
| KR100599454B1 (ko) | 2004-04-27 | 2006-07-12 | 재단법인서울대학교산학협력재단 | 종양 억제자로 작용하는 aim3의 신규 용도 |
| PT2484365E (pt) | 2004-06-04 | 2013-12-12 | Scripps Research Inst | Composições e métodos para o tratamento de doenças neovasculares |
| US20060079673A1 (en) | 2004-08-02 | 2006-04-13 | Paul Glidden | Polynucleotides encoding tRNA synthetase fragments and uses thereof |
| US20060078553A1 (en) | 2004-10-07 | 2006-04-13 | Paul Glidden | Diverse multi-unit complexes including a tRNA synthetase fragment |
| US8282921B2 (en) | 2004-08-02 | 2012-10-09 | Paul Glidden | tRNA synthetase fragments |
| US20060024288A1 (en) | 2004-08-02 | 2006-02-02 | Pfizer Inc. | tRNA synthetase fragments |
| US7459529B2 (en) | 2004-11-24 | 2008-12-02 | Seoul National University Industry Foundation | AIMP2-DX2 and its uses |
| US8003780B2 (en) | 2004-11-24 | 2011-08-23 | Neomics Co., Ltd. | AIMP2-DX2 gene and SiRNA targeting AIMP2-DX2 |
| EP1836298B1 (en) | 2004-12-22 | 2012-01-18 | Ambrx, Inc. | COMPOSITIONS OF AMINOACYL-tRNA SYNTHETASE AND USES THEREOF |
| BRPI0519430A2 (pt) | 2004-12-22 | 2009-02-10 | Ambrx Inc | hormânio do crescimento humano modificado |
| AU2005335491B2 (en) | 2005-08-18 | 2010-11-25 | Ambrx, Inc. | Compositions of tRNA and uses thereof |
| US7514229B2 (en) | 2005-09-29 | 2009-04-07 | The Board Of Trustees Of The Leland Stanford Junior University | Methods for diagnosing and evaluating treatment of blood disorders |
| US8026088B2 (en) | 2005-12-02 | 2011-09-27 | The Scripps Research Institute | Angiogenic tyrosyl tRNA synthetase compositions and methods |
| AU2007224019A1 (en) | 2006-03-03 | 2007-09-13 | California Institute Of Technology | Site-specific incorporation of amino acids into molecules |
| CA2653752A1 (en) | 2006-05-26 | 2007-12-06 | Vickery Laurence Arcus | Ob fold domains |
| EP2052088A2 (en) | 2006-08-02 | 2009-04-29 | Genizon Biosciences | Genemap of the human genes associated with psoriasis |
| AU2007284651B2 (en) | 2006-08-09 | 2014-03-20 | Institute For Systems Biology | Organ-specific proteins and methods of their use |
| JP2010502221A (ja) | 2006-09-08 | 2010-01-28 | アンブルックス,インコーポレイテッド | 脊椎動物細胞による非天然アミノ酸の部位特異的組み込み |
| DE602007013445D1 (de) | 2006-11-17 | 2011-05-05 | Novartis Ag | Lingo bindende moleküle und pharmazeutische verwendung davon |
| JP2010525362A (ja) | 2007-04-27 | 2010-07-22 | アイマジーン カンパニー リミテッド | 免疫調節剤のスクリーニング方法 |
| JP5265140B2 (ja) | 2007-06-14 | 2013-08-14 | 学校法人日本医科大学 | 卵巣癌の検出方法及び検出用キット |
| JP2009017840A (ja) | 2007-07-13 | 2009-01-29 | Japan Agengy For Marine-Earth Science & Technology | 外来遺伝子を細胞に安定に保持する方法 |
| WO2009059056A2 (en) | 2007-11-02 | 2009-05-07 | The Scripps Research Institute | A genetically encoded boronate amino acid |
| JP5585904B2 (ja) | 2008-02-08 | 2014-09-10 | 独立行政法人理化学研究所 | アミノアシルtRNA合成酵素活性を有するポリペプチド及びその利用 |
| EP2274006A2 (en) | 2008-03-11 | 2011-01-19 | University Of North Carolina At Chapel Hill | Angiostatic compositions comprising truncated tyrosyl-trna synthetase polypeptides and methods of using same |
| WO2009152247A2 (en) * | 2008-06-11 | 2009-12-17 | Atyr Pharma, Inc | Thrombopoietic activity of tyrosyl-trna synthetase polypeptides |
| AU2008360729A1 (en) | 2008-08-18 | 2010-02-25 | Seoul National University Industry Foundation | Method for controlling cancer metastasis or cancer cell migration by modulating the cellular level of lysyl tRNA synthetase |
| KR101067817B1 (ko) | 2008-10-10 | 2011-09-27 | 서울대학교산학협력단 | Aimp1 폴리펩티드에 대한 항체를 포함하는 관절염 진단용 조성물 |
| EP2351575B1 (en) | 2008-10-10 | 2016-12-14 | SNU R & DB Foundation | Grs for use in treating a cancer |
| KR101067815B1 (ko) | 2009-02-05 | 2011-09-27 | 서울대학교산학협력단 | 제1형 당뇨병의 신규한 진단 마커 |
| US20120058133A1 (en) | 2009-02-19 | 2012-03-08 | President And Fellows Of Harvard College | Inhibition of trna synthetases and therapeutic applications thereof |
| EP2403864B1 (en) | 2009-02-27 | 2015-08-12 | Atyr Pharma, Inc. | Polypeptide structural motifs associated with cell signaling activity |
| AU2010226726B8 (en) | 2009-03-16 | 2014-08-14 | Pangu Biopharma Limited | Compositions and methods comprising histidyl-tRNA synthetase splice variants having non-canonical biological activities |
| US20100310576A1 (en) | 2009-03-31 | 2010-12-09 | Adams Ryan A | COMPOSITIONS AND METHODS COMPRISING ASPARTYL-tRNA SYNTHETASES HAVING NON-CANONICAL BIOLOGICAL ACTIVITIES |
| WO2011072266A2 (en) * | 2009-12-11 | 2011-06-16 | Atyr Pharma, Inc. | Aminoacyl trna synthetases for modulating hematopoiesis |
| US8828395B2 (en) | 2009-12-11 | 2014-09-09 | Atyr Pharma, Inc. | Antibodies that bind tyrosyl-tRNA synthetases |
| US9127268B2 (en) * | 2009-12-11 | 2015-09-08 | Atyr Pharma, Inc. | Aminoacyl tRNA synthetases for modulating inflammation |
| US8828685B2 (en) | 2010-02-04 | 2014-09-09 | The Scripps Research Institute | Monomeric forms of human aminoacyl-t-RNA synthetases having non-canonical biological activities |
| CA2797093C (en) | 2010-04-26 | 2019-10-29 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of cysteinyl-trna synthetase |
| EP2563381B1 (en) | 2010-04-27 | 2017-08-09 | aTyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of isoleucyl trna synthetases |
| AU2011248521B2 (en) | 2010-04-27 | 2017-03-16 | Pangu Biopharma Limited | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of threonyl tRNA synthetases |
| CN103097524B (zh) | 2010-04-28 | 2016-08-03 | Atyr医药公司 | 与丙氨酰-tRNA合成酶的蛋白片段相关的治疗、诊断和抗体组合物的创新发现 |
| CA2797374C (en) | 2010-04-29 | 2021-02-16 | Pangu Biopharma Limited | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of asparaginyl trna synthetases |
| EP2563383B1 (en) | 2010-04-29 | 2017-03-01 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of valyl trna synthetases |
| EP2566516B1 (en) | 2010-05-03 | 2019-07-03 | aTyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of seryl-trna synthetases |
| CN103096925A (zh) | 2010-05-03 | 2013-05-08 | Atyr医药公司 | 与精氨酰-tRNA合成酶的蛋白片段相关的治疗、诊断和抗体组合物的创新发现 |
| ES2668207T3 (es) | 2010-05-03 | 2018-05-17 | Atyr Pharma, Inc. | Descubrimiento innovador de composiciones terapéuticas, de diagnóstico y de anticuerpos relacionadas con fragmentos de proteínas de metionil-ARNt sintetasas |
| AU2011248227B2 (en) | 2010-05-03 | 2016-12-01 | Pangu Biopharma Limited | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of phenylalanyl-alpha-tRNA synthetases |
| JP6008844B2 (ja) | 2010-05-04 | 2016-10-19 | エータイアー ファーマ, インコーポレイテッド | p38MULTI−tRNA合成酵素複合体のタンパク質フラグメントに関連した治療用、診断用および抗体組成物の革新的発見 |
| CN103096909A (zh) | 2010-05-04 | 2013-05-08 | Atyr医药公司 | 与谷氨酰-脯氨酰-tRNA合成酶的蛋白片段相关的治疗、诊断和抗体组合物的创新发现 |
| EP2568996B1 (en) | 2010-05-14 | 2017-10-04 | aTyr Pharma, Inc. | Therapeutic, diagnostic, and antibody compositions related to protein fragments of phenylalanyl-beta-trna synthetases |
| US9034598B2 (en) | 2010-05-17 | 2015-05-19 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of leucyl-tRNA synthetases |
| CN103096913B (zh) | 2010-05-27 | 2017-07-18 | Atyr 医药公司 | 与谷氨酰胺酰‑tRNA合成酶的蛋白片段相关的治疗、诊断和抗体组合物的创新发现 |
| CA2800281C (en) | 2010-06-01 | 2021-01-12 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of lysyl-trna synthetases |
| US8999321B2 (en) | 2010-07-12 | 2015-04-07 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of glycyl-tRNA synthetases |
| AU2011289831C1 (en) | 2010-07-12 | 2017-06-15 | Pangu Biopharma Limited | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of glycyl-tRNA synthetases |
| KR20180059575A (ko) | 2010-07-12 | 2018-06-04 | 에이티와이알 파마, 인코포레이티드 | 아스파르틸trna 합성효소의 단백질 단편에 관련된 치료적, 진단적, 및 항체 조성물의 혁신적 발견 |
| KR20130102534A (ko) | 2010-07-12 | 2013-09-17 | 에이티와이알 파마, 인코포레이티드 | 히스티딜trna 합성효소의 단백질 단편에 관련된 치료적, 진단적, 및 항체 조성물의 혁신적 발견 |
| CN103108650A (zh) | 2010-08-25 | 2013-05-15 | Atyr医药公司 | 与酪氨酰-tRNA合成酶的蛋白片段相关的治疗、诊断和抗体组合物的创新发现 |
| CN103118696B (zh) | 2010-10-06 | 2020-02-14 | Atyr 医药公司 | 与色氨酰-tRNA合成酶的蛋白片段相关的治疗、诊断和抗体组合物 |
| US20160144003A1 (en) | 2011-05-19 | 2016-05-26 | The Scripps Research Institute | Compositions and methods for treating charcot-marie-tooth diseases and related neuronal diseases |
| US9714419B2 (en) | 2011-08-09 | 2017-07-25 | Atyr Pharma, Inc. | PEGylated tyrosyl-tRNA synthetase polypeptides |
| WO2013086216A1 (en) | 2011-12-06 | 2013-06-13 | Atyr Pharma, Inc. | Improved aspartyl-trna synthetases |
| WO2013086228A1 (en) | 2011-12-06 | 2013-06-13 | Atyr Pharma, Inc. | Pegylated aspartyl-trna synthetase polypeptides |
| CA2858613A1 (en) | 2011-12-29 | 2013-08-08 | Atyr Pharma, Inc. | Aspartyl-trna synthetase-fc conjugates |
| EP2814514B1 (en) | 2012-02-16 | 2017-09-13 | Atyr Pharma, Inc. | Histidyl-trna synthetases for treating autoimmune and inflammatory diseases |
| US20140066321A1 (en) | 2012-07-23 | 2014-03-06 | Pangu Biopharma Limited | Structures of human histidyl-trna synthetase and methods of use |
-
2011
- 2011-05-12 EP EP11781304.8A patent/EP2568996B1/en active Active
- 2011-05-12 CA CA2799197A patent/CA2799197C/en active Active
- 2011-05-12 AU AU2011252990A patent/AU2011252990B2/en active Active
- 2011-05-12 CN CN201180031824.XA patent/CN103200953B/zh active Active
- 2011-05-12 WO PCT/US2011/036326 patent/WO2011143482A2/en not_active Ceased
- 2011-05-12 JP JP2013510312A patent/JP6396656B2/ja active Active
- 2011-05-12 US US13/697,996 patent/US8945541B2/en active Active
-
2014
- 2014-12-19 US US14/577,510 patent/US9687533B2/en active Active
-
2015
- 2015-10-05 JP JP2015197521A patent/JP2016000060A/ja active Pending
-
2017
- 2017-05-18 US US15/599,183 patent/US10220080B2/en active Active
- 2017-06-06 JP JP2017111559A patent/JP2017165771A/ja active Pending
Patent Citations (265)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
| US4483105A (en) | 1983-03-11 | 1984-11-20 | Maschinenfabrik Gehring, Gesellschaft Mit Beschrankter Haftung & Co. Kommanditgesellschaft | Device to hold workpieces for the honing of their axial center bore |
| US5034506A (en) | 1985-03-15 | 1991-07-23 | Anti-Gene Development Group | Uncharged morpholino-based polymers having achiral intersubunit linkages |
| US5506337A (en) | 1985-03-15 | 1996-04-09 | Antivirals Inc. | Morpholino-subunit combinatorial library and method |
| US5521063A (en) | 1985-03-15 | 1996-05-28 | Antivirals Inc. | Polynucleotide reagent containing chiral subunits and methods of use |
| US5217866A (en) | 1985-03-15 | 1993-06-08 | Anti-Gene Development Group | Polynucleotide assay reagent and method |
| US5698685A (en) | 1985-03-15 | 1997-12-16 | Antivirals Inc. | Morpholino-subunit combinatorial library and method |
| US5142047A (en) | 1985-03-15 | 1992-08-25 | Anti-Gene Development Group | Uncharged polynucleotide-binding polymers |
| US4683202B1 (https=) | 1985-03-28 | 1990-11-27 | Cetus Corp | |
| US4683202A (en) | 1985-03-28 | 1987-07-28 | Cetus Corporation | Process for amplifying nucleic acid sequences |
| US4683195B1 (https=) | 1986-01-30 | 1990-11-27 | Cetus Corp | |
| US4683195A (en) | 1986-01-30 | 1987-07-28 | Cetus Corporation | Process for amplifying, detecting, and/or-cloning nucleic acid sequences |
| US4800159A (en) | 1986-02-07 | 1989-01-24 | Cetus Corporation | Process for amplifying, detecting, and/or cloning nucleic acid sequences |
| US4965188A (en) | 1986-08-22 | 1990-10-23 | Cetus Corporation | Process for amplifying, detecting, and/or cloning nucleic acid sequences using a thermostable enzyme |
| US5013830A (en) | 1986-09-08 | 1991-05-07 | Ajinomoto Co., Inc. | Compounds for the cleavage at a specific position of RNA, oligomers employed for the formation of said compounds, and starting materials for the synthesis of said oligomers |
| US4873192A (en) | 1987-02-17 | 1989-10-10 | The United States Of America As Represented By The Department Of Health And Human Services | Process for site specific mutagenesis without phenotypic selection |
| US5091513A (en) | 1987-05-21 | 1992-02-25 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US5132405A (en) | 1987-05-21 | 1992-07-21 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US5766960A (en) | 1987-07-27 | 1998-06-16 | Australian Membrane And Biotechnology Research Institute | Receptor membranes |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| US5491133A (en) | 1987-11-30 | 1996-02-13 | University Of Iowa Research Foundation | Methods for blocking the expression of specifically targeted genes |
| US5403711A (en) | 1987-11-30 | 1995-04-04 | University Of Iowa Research Foundation | Nucleic acid hybridization and amplification method for detection of specific sequences in which a complementary labeled nucleic acid probe is cleaved |
| US5543508A (en) | 1987-12-15 | 1996-08-06 | Gene Shears Pty. Limited | Ribozymes |
| US4904584A (en) | 1987-12-23 | 1990-02-27 | Genetics Institute, Inc. | Site-specific homogeneous modification of polypeptides |
| US5130238A (en) | 1988-06-24 | 1992-07-14 | Cangene Corporation | Enhanced nucleic acid amplification process |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5436327A (en) | 1988-09-21 | 1995-07-25 | Isis Innovation Limited | Support-bound oligonucleotides |
| US5110596A (en) | 1988-12-13 | 1992-05-05 | Alza Corporation | Delivery system comprising means for delivering agent to livestock |
| US5034229A (en) | 1988-12-13 | 1991-07-23 | Alza Corporation | Dispenser for increasing feed conversion of hog |
| US6180370B1 (en) | 1988-12-28 | 2001-01-30 | Protein Design Labs, Inc. | Humanized immunoglobulins and methods of making the same |
| US7022500B1 (en) | 1988-12-28 | 2006-04-04 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5693762A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5856092A (en) | 1989-02-13 | 1999-01-05 | Geneco Pty Ltd | Detection of a nucleic acid sequence or a change therein |
| US5256775A (en) | 1989-06-05 | 1993-10-26 | Gilead Sciences, Inc. | Exonuclease-resistant oligonucleotides |
| US5405783A (en) | 1989-06-07 | 1995-04-11 | Affymax Technologies N.V. | Large scale photolithographic solid phase synthesis of an array of polymers |
| US6197506B1 (en) | 1989-06-07 | 2001-03-06 | Affymetrix, Inc. | Method of detecting nucleic acids |
| US5143854A (en) | 1989-06-07 | 1992-09-01 | Affymax Technologies N.V. | Large scale photolithographic solid phase synthesis of polypeptides and receptor binding screening thereof |
| US5902723A (en) | 1989-06-07 | 1999-05-11 | Dower; William J. | Analysis of surface immobilized polymers utilizing microfluorescence detection |
| US5800992A (en) | 1989-06-07 | 1998-09-01 | Fodor; Stephen P.A. | Method of detecting nucleic acids |
| US5871928A (en) | 1989-06-07 | 1999-02-16 | Fodor; Stephen P. A. | Methods for nucleic acid analysis |
| US6309822B1 (en) | 1989-06-07 | 2001-10-30 | Affymetrix, Inc. | Method for comparing copy number of nucleic acid sequences |
| US5925525A (en) | 1989-06-07 | 1999-07-20 | Affymetrix, Inc. | Method of identifying nucleotide differences |
| US5480784A (en) | 1989-07-11 | 1996-01-02 | Gen-Probe Incorporated | Nucleic acid sequence amplification methods |
| US5399491A (en) | 1989-07-11 | 1995-03-21 | Gen-Probe Incorporated | Nucleic acid sequence amplification methods |
| US5725871A (en) | 1989-08-18 | 1998-03-10 | Danbiosyst Uk Limited | Drug delivery compositions comprising lysophosphoglycerolipid |
| US5804212A (en) | 1989-11-04 | 1998-09-08 | Danbiosyst Uk Limited | Small particle compositions for intranasal drug delivery |
| US5166315A (en) | 1989-12-20 | 1992-11-24 | Anti-Gene Development Group | Sequence-specific binding polymers for duplex nucleic acids |
| US5670617A (en) | 1989-12-21 | 1997-09-23 | Biogen Inc | Nucleic acid conjugates of tat-derived transport polypeptides |
| US5674980A (en) | 1989-12-21 | 1997-10-07 | Biogen Inc | Fusion protein comprising tat-derived transport moiety |
| US6316003B1 (en) | 1989-12-21 | 2001-11-13 | Whitehead Institute For Biomedical Research | Tat-derived transport polypeptides |
| US5747641A (en) | 1989-12-21 | 1998-05-05 | Biogen Inc | Tat-derived transport polypeptide conjugates |
| US5804604A (en) | 1989-12-21 | 1998-09-08 | Biogen, Inc. | Tat-derived transport polypeptides and fusion proteins |
| US5652122A (en) | 1989-12-21 | 1997-07-29 | Frankel; Alan | Nucleic acids encoding and methods of making tat-derived transport polypeptides |
| US5220007A (en) | 1990-02-15 | 1993-06-15 | The Worcester Foundation For Experimental Biology | Method of site-specific alteration of RNA and production of encoded polypeptides |
| US5149797A (en) | 1990-02-15 | 1992-09-22 | The Worcester Foundation For Experimental Biology | Method of site-specific alteration of rna and production of encoded polypeptides |
| US5366878A (en) | 1990-02-15 | 1994-11-22 | The Worcester Foundation For Experimental Biology | Method of site-specific alteration of RNA and production of encoded polypeptides |
| US5466468A (en) | 1990-04-03 | 1995-11-14 | Ciba-Geigy Corporation | Parenterally administrable liposome formulation comprising synthetic lipids |
| US5811387A (en) | 1990-05-15 | 1998-09-22 | Chiron Corporation | Peptoid mixtures |
| US5623065A (en) | 1990-08-13 | 1997-04-22 | Isis Pharmaceuticals, Inc. | Gapped 2' modified oligonucleotides |
| US6582908B2 (en) | 1990-12-06 | 2003-06-24 | Affymetrix, Inc. | Oligonucleotides |
| US5399363A (en) | 1991-01-25 | 1995-03-21 | Eastman Kodak Company | Surface modified anticancer nanoparticles |
| US5455166A (en) | 1991-01-31 | 1995-10-03 | Becton, Dickinson And Company | Strand displacement amplification |
| US5936731A (en) | 1991-02-22 | 1999-08-10 | Applied Spectral Imaging Ltd. | Method for simultaneous detection of multiple fluorophores for in situ hybridization and chromosome painting |
| EP0519596A1 (en) | 1991-05-17 | 1992-12-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
| US5714331A (en) | 1991-05-24 | 1998-02-03 | Buchardt, Deceased; Ole | Peptide nucleic acids having enhanced binding affinity, sequence specificity and solubility |
| US5511355A (en) | 1991-11-15 | 1996-04-30 | Dingler; Gerhard | Construction element |
| US5270184A (en) | 1991-11-19 | 1993-12-14 | Becton, Dickinson And Company | Nucleic acid target generation |
| US5756353A (en) | 1991-12-17 | 1998-05-26 | The Regents Of The University Of California | Expression of cloned genes in the lung by aerosol-and liposome-based delivery |
| US5955589A (en) | 1991-12-24 | 1999-09-21 | Isis Pharmaceuticals Inc. | Gapped 2' modified oligonucleotides |
| US5700922A (en) | 1991-12-24 | 1997-12-23 | Isis Pharmaceuticals, Inc. | PNA-DNA-PNA chimeric macromolecules |
| US5412087A (en) | 1992-04-24 | 1995-05-02 | Affymax Technologies N.V. | Spatially-addressable immobilization of oligonucleotides and other biological polymers on surfaces |
| US5541061A (en) | 1992-04-29 | 1996-07-30 | Affymax Technologies N.V. | Methods for screening factorial chemical libraries |
| US5780045A (en) | 1992-05-18 | 1998-07-14 | Minnesota Mining And Manufacturing Company | Transmucosal drug delivery device |
| US5652355A (en) | 1992-07-23 | 1997-07-29 | Worcester Foundation For Experimental Biology | Hybrid oligonucleotide phosphorothioates |
| US5874541A (en) | 1992-08-21 | 1999-02-23 | Vrije Universiteit | Immunoglobulins devoid of light chains |
| US5840526A (en) | 1992-08-21 | 1998-11-24 | Vrije Universiteit Brussel | Immunoglobulins devoid of light chains |
| US6005079A (en) | 1992-08-21 | 1999-12-21 | Vrije Universiteit Brussels | Immunoglobulins devoid of light chains |
| US6015695A (en) | 1992-08-21 | 2000-01-18 | Vrije Universiteit Brussel | Immunoglobulins devoid of light chains |
| US6765087B1 (en) | 1992-08-21 | 2004-07-20 | Vrije Universiteit Brussel | Immunoglobulins devoid of light chains |
| US5800988A (en) | 1992-08-21 | 1998-09-01 | Vrije Universiteit Brussel | Immunoglobulins devoid of light chains |
| US5293050A (en) | 1993-03-25 | 1994-03-08 | International Business Machines Corporation | Semiconductor quantum dot light emitting/detecting devices |
| US5354707A (en) | 1993-03-25 | 1994-10-11 | International Business Machines Corporation | Method of making semiconductor quantum dot light emitting/detecting devices |
| US5539082A (en) | 1993-04-26 | 1996-07-23 | Nielsen; Peter E. | Peptide nucleic acids |
| US6284460B1 (en) | 1993-06-25 | 2001-09-04 | Affymetrix Inc. | Hybridization and sequencing of nucleic acids using base pair mismatches |
| US5543158A (en) | 1993-07-23 | 1996-08-06 | Massachusetts Institute Of Technology | Biodegradable injectable nanoparticles |
| US6045996A (en) | 1993-10-26 | 2000-04-04 | Affymetrix, Inc. | Hybridization assays on oligonucleotide arrays |
| US5900461A (en) | 1993-11-12 | 1999-05-04 | Shearwater Polymers, Inc. | Isolatable, water soluble, and hydrolytically stable active sulfones of poly(ethylene glycol) and related polymers for modification of surfaces and molecules |
| US5420109A (en) | 1993-11-12 | 1995-05-30 | Houghten Pharmaceuticals, Inc. | Cytokine restraining agents |
| US5719262A (en) | 1993-11-22 | 1998-02-17 | Buchardt, Deceased; Ole | Peptide nucleic acids having amino acid side chains |
| US5565350A (en) | 1993-12-09 | 1996-10-15 | Thomas Jefferson University | Compounds and methods for site directed mutations in eukaryotic cells |
| US6214587B1 (en) | 1994-03-16 | 2001-04-10 | Gen-Probe Incorporated | Isothermal strand displacement nucleic acid amplification |
| EP0684315A1 (en) | 1994-04-18 | 1995-11-29 | Becton, Dickinson and Company | Strand displacement amplification using thermophilic enzymes |
| US5593839A (en) | 1994-05-24 | 1997-01-14 | Affymetrix, Inc. | Computer-aided engineering system for design of sequence arrays and lithographic masks |
| US5557318A (en) | 1994-07-12 | 1996-09-17 | Koninklijke Ptt Nederland N.V. | Method and apparatus for permitting a viewer to scan through a plurality of video signals provided by a transmitter |
| US5824784A (en) | 1994-10-12 | 1998-10-20 | Amgen Inc. | N-terminally chemically modified protein compositions and methods |
| US5795716A (en) | 1994-10-21 | 1998-08-18 | Chee; Mark S. | Computer-aided visualization and analysis system for sequence evaluation |
| US5974164A (en) | 1994-10-21 | 1999-10-26 | Affymetrix, Inc. | Computer-aided visualization and analysis system for sequence evaluation |
| US5836935A (en) | 1994-11-10 | 1998-11-17 | Ashton; Paul | Implantable refillable controlled release device to deliver drugs directly to an internal portion of the body |
| US5545729A (en) | 1994-12-22 | 1996-08-13 | Hybridon, Inc. | Stabilized ribozyme analogs |
| US5932462A (en) | 1995-01-10 | 1999-08-03 | Shearwater Polymers, Inc. | Multiarmed, monofunctional, polymer for coupling to molecules and surfaces |
| US6245886B1 (en) | 1995-02-16 | 2001-06-12 | Bayer Corporation | Peptides and peptidomimetics with structural similarity to human P53 that activate P53 function |
| US5641515A (en) | 1995-04-04 | 1997-06-24 | Elan Corporation, Plc | Controlled release biodegradable nanoparticles containing insulin |
| US6287850B1 (en) | 1995-06-07 | 2001-09-11 | Affymetrix, Inc. | Bioarray chip reaction apparatus and its manufacture |
| US5874219A (en) | 1995-06-07 | 1999-02-23 | Affymetrix, Inc. | Methods for concurrently processing multiple biological chip assays |
| US5652356A (en) | 1995-08-17 | 1997-07-29 | Hybridon, Inc. | Inverted chimeric and hybrid oligonucleotides |
| US5733729A (en) | 1995-09-14 | 1998-03-31 | Affymetrix, Inc. | Computer-aided probability base calling for arrays of nucleic acid probes on chips |
| US6066454A (en) | 1995-09-14 | 2000-05-23 | Affymetrix, Inc. | Computer-aided probability base calling for arrays of nucleic acid probes on chips |
| US6040138A (en) | 1995-09-15 | 2000-03-21 | Affymetrix, Inc. | Expression monitoring by hybridization to high density oligonucleotide arrays |
| US6927032B2 (en) | 1995-09-15 | 2005-08-09 | Affymetrix, Inc. | Expression monitoring by hybridization to high density oligonucleotide arrays |
| US5843655A (en) | 1995-09-18 | 1998-12-01 | Affymetrix, Inc. | Methods for testing oligonucleotide arrays |
| US5858659A (en) | 1995-11-29 | 1999-01-12 | Affymetrix, Inc. | Polymorphism detection |
| US6300063B1 (en) | 1995-11-29 | 2001-10-09 | Affymetrix, Inc. | Polymorphism detection |
| US6344316B1 (en) | 1996-01-23 | 2002-02-05 | Affymetrix, Inc. | Nucleic acid analysis techniques |
| US5837196A (en) | 1996-01-26 | 1998-11-17 | The Regents Of The University Of California | High density array fabrication and readout method for a fiber optic biosensor |
| US6395292B2 (en) | 1996-02-02 | 2002-05-28 | Alza Corporation | Sustained delivery of an active agent using an implantable system |
| US5728396A (en) | 1996-02-02 | 1998-03-17 | Alza Corporation | Sustained delivery of leuprolide using an implantable system |
| US5985305A (en) | 1996-02-02 | 1999-11-16 | Alza Corporation | Sustained delivery of an active agent using an implantable system |
| US6156331A (en) | 1996-02-02 | 2000-12-05 | Alza Corporation | Sustained delivery of an active agent using an implantable system |
| US6228575B1 (en) | 1996-02-08 | 2001-05-08 | Affymetrix, Inc. | Chip-based species identification and phenotypic characterization of microorganisms |
| US6391623B1 (en) | 1996-03-26 | 2002-05-21 | Affymetrix, Inc. | Fluidics station injection needles with distal end and side ports and method of using |
| US6238866B1 (en) | 1996-04-16 | 2001-05-29 | The United States Of America As Represented By The Secretary Of The Army | Detector for nucleic acid typing and methods of using the same |
| US5976109A (en) | 1996-04-30 | 1999-11-02 | Medtronic, Inc. | Apparatus for drug infusion implanted within a living body |
| WO1997042507A1 (en) | 1996-05-02 | 1997-11-13 | Isis Innovation Limited | Peptide array and method |
| US5958342A (en) | 1996-05-17 | 1999-09-28 | Incyte Pharmaceuticals, Inc. | Jet droplet device |
| US6001309A (en) | 1996-05-17 | 1999-12-14 | Incyte Pharmaceuticals, Inc. | Jet droplet device |
| US6103474A (en) | 1996-10-21 | 2000-08-15 | Agilent Technologies Inc. | Hybridization assay signal enhancement |
| US6818394B1 (en) | 1996-11-06 | 2004-11-16 | Sequenom, Inc. | High density immobilization of nucleic acids |
| US5952180A (en) | 1997-01-15 | 1999-09-14 | Incyte Pharmaceuticals, Inc. | Sets of labeled energy transfer fluorescent primers and their use in multi component analysis |
| US5814454A (en) | 1997-01-15 | 1998-09-29 | Incyte Pharmaceuticals, Inc. | Sets of labeled energy transfer fluorescent primers and their use in multi component analysis |
| US6309824B1 (en) | 1997-01-16 | 2001-10-30 | Hyseq, Inc. | Methods for analyzing a target nucleic acid using immobilized heterogeneous mixtures of oligonucleotide probes |
| US6673901B2 (en) | 1997-06-12 | 2004-01-06 | Research Corporation Technologies, Inc. | Artificial antibody polypeptides |
| US6368799B1 (en) | 1997-06-13 | 2002-04-09 | Affymetrix, Inc. | Method to detect gene polymorphisms and monitor allelic expression employing a probe array |
| US6333179B1 (en) | 1997-06-20 | 2001-12-25 | Affymetrix, Inc. | Methods and compositions for multiplex amplification of nucleic acids |
| US6673579B2 (en) | 1997-06-20 | 2004-01-06 | Affymetrix, Inc. | Methods and compositions for multiplex amplification of nucleic acids |
| US6188783B1 (en) | 1997-07-25 | 2001-02-13 | Affymetrix, Inc. | Method and system for providing a probe array chip design database |
| US6229911B1 (en) | 1997-07-25 | 2001-05-08 | Affymetrix, Inc. | Method and apparatus for providing a bioinformatics database |
| US6308170B1 (en) | 1997-07-25 | 2001-10-23 | Affymetrix Inc. | Gene expression and evaluation system |
| US6223127B1 (en) | 1997-08-15 | 2001-04-24 | Affymetrix, Inc. | Polymorphism detection utilizing clustering analysis |
| US6670461B1 (en) | 1997-09-12 | 2003-12-30 | Exiqon A/S | Oligonucleotide analogues |
| US6794499B2 (en) | 1997-09-12 | 2004-09-21 | Exiqon A/S | Oligonucleotide analogues |
| US7572582B2 (en) | 1997-09-12 | 2009-08-11 | Exiqon A/S | Oligonucleotide analogues |
| US7034133B2 (en) | 1997-09-12 | 2006-04-25 | Exiqon A/S | Oligonucleotide analogues |
| US20060058510A1 (en) | 1997-09-26 | 2006-03-16 | Arne Skerra | Anticalins |
| US6033860A (en) | 1997-10-31 | 2000-03-07 | Affymetrix, Inc. | Expression profiles in adult and fetal organs |
| US6054274A (en) | 1997-11-12 | 2000-04-25 | Hewlett-Packard Company | Method of amplifying the signal of target nucleic acid sequence analyte |
| US6013449A (en) | 1997-11-26 | 2000-01-11 | The United States Of America As Represented By The Department Of Health And Human Services | Probe-based analysis of heterozygous mutations using two-color labelling |
| US6090555A (en) | 1997-12-11 | 2000-07-18 | Affymetrix, Inc. | Scanned image alignment systems and methods |
| US6375978B1 (en) | 1997-12-22 | 2002-04-23 | Alza Corporation | Rate controlling membranes for controlled drug delivery devices |
| US6113938A (en) | 1997-12-30 | 2000-09-05 | Alza Corporation | Beneficial agent delivery system with membrane plug and method for controlling delivery of beneficial agents |
| WO1999039210A1 (en) | 1998-01-29 | 1999-08-05 | Miller, Samuel | High density arrays for proteome analysis and methods and compositions therefor |
| US6280954B1 (en) | 1998-02-02 | 2001-08-28 | Amersham Pharmacia Biotech Ab | Arrayed primer extension technique for nucleic acid analysis |
| US6083726A (en) | 1998-02-03 | 2000-07-04 | Lucent Technologies, Inc. | Methods for polynucleotide synthesis and articles for polynucleotide hybridization |
| WO1999040434A1 (en) | 1998-02-04 | 1999-08-12 | Invitrogen Corporation | Microarrays and uses therefor |
| US6420108B2 (en) | 1998-02-09 | 2002-07-16 | Affymetrix, Inc. | Computer-aided display for comparative gene expression |
| US7166697B1 (en) | 1998-03-06 | 2007-01-23 | Diatech Pty. Ltd. | V-like domain binding molecules |
| US6020135A (en) | 1998-03-27 | 2000-02-01 | Affymetrix, Inc. | P53-regulated genes |
| US6004755A (en) | 1998-04-07 | 1999-12-21 | Incyte Pharmaceuticals, Inc. | Quantitative microarray hybridizaton assays |
| US6284497B1 (en) | 1998-04-09 | 2001-09-04 | Trustees Of Boston University | Nucleic acid arrays and methods of synthesis |
| US6525185B1 (en) | 1998-05-07 | 2003-02-25 | Affymetrix, Inc. | Polymorphisms associated with hypertension |
| US6268210B1 (en) | 1998-05-27 | 2001-07-31 | Hyseq, Inc. | Sandwich arrays of biological compounds |
| US6348185B1 (en) | 1998-06-20 | 2002-02-19 | Washington University School Of Medicine | Membrane-permeant peptide complexes for medical imaging, diagnostics, and pharmaceutical therapy |
| US7306784B2 (en) | 1998-06-20 | 2007-12-11 | Washington University | Membrane-permeant peptide complexes for medical imaging, diagnostics, and pharmaceutical therapy |
| US7306783B2 (en) | 1998-06-20 | 2007-12-11 | Washington University | Membrane-permeant peptide complexes for medical imaging, diagnostics, and pharmaceutical therapy |
| US6589503B1 (en) | 1998-06-20 | 2003-07-08 | Washington University | Membrane-permeant peptide complexes for medical imaging, diagnostics, and pharmaceutical therapy |
| US6306643B1 (en) | 1998-08-24 | 2001-10-23 | Affymetrix, Inc. | Methods of using an array of pooled probes in genetic analysis |
| US6185561B1 (en) | 1998-09-17 | 2001-02-06 | Affymetrix, Inc. | Method and apparatus for providing and expression data mining database |
| US6203989B1 (en) | 1998-09-30 | 2001-03-20 | Affymetrix, Inc. | Methods and compositions for amplifying detectable signals in specific binding assays |
| US6316193B1 (en) | 1998-10-06 | 2001-11-13 | Origene Technologies, Inc. | Rapid-screen cDNA library panels |
| US6262216B1 (en) | 1998-10-13 | 2001-07-17 | Affymetrix, Inc. | Functionalized silicon compounds and methods for their synthesis and use |
| US6361947B1 (en) | 1998-10-27 | 2002-03-26 | Affymetrix, Inc. | Complexity management and analysis of genomic DNA |
| US6263287B1 (en) | 1998-11-12 | 2001-07-17 | Scios Inc. | Systems for the analysis of gene expression data |
| US6309828B1 (en) | 1998-11-18 | 2001-10-30 | Agilent Technologies, Inc. | Method and apparatus for fabricating replicate arrays of nucleic acid molecules |
| US6210922B1 (en) | 1998-11-30 | 2001-04-03 | National Research Council Of Canada | Serum free production of recombinant proteins and adenoviral vectors |
| US20080139791A1 (en) | 1998-12-10 | 2008-06-12 | Adnexus Therapeutics, Inc. | Pharmaceutically acceptable Fn3 Polypeptides for human treatments |
| US20070082365A1 (en) | 1998-12-10 | 2007-04-12 | Adnexus Therapeutics, Inc. | Protein scaffolds for antibody mimics and other binding proteins |
| US6245518B1 (en) | 1998-12-11 | 2001-06-12 | Hyseq, Inc. | Polynucleotide arrays and methods of making and using the same |
| US6351712B1 (en) | 1998-12-28 | 2002-02-26 | Rosetta Inpharmatics, Inc. | Statistical combining of cell expression profiles |
| US6586802B2 (en) | 1999-01-14 | 2003-07-01 | Mitsubishi Denki Kabushiki Kaisha | Semiconductor device |
| US6312906B1 (en) | 1999-01-15 | 2001-11-06 | Imperial College Innovations, Ltd. | Immobilized nucleic acid hybridization reagent and method |
| US6251601B1 (en) | 1999-02-02 | 2001-06-26 | Vysis, Inc. | Simultaneous measurement of gene expression and genomic abnormalities using nucleic acid microarrays |
| WO2000047774A1 (en) | 1999-02-09 | 2000-08-17 | Nexstar Pharmaceuticals, Inc. | Aptamers as reagents for high throughput screening |
| US6177248B1 (en) | 1999-02-24 | 2001-01-23 | Affymetrix, Inc. | Downstream genes of tumor suppressor WT1 |
| WO2000054046A2 (en) | 1999-03-10 | 2000-09-14 | The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services, The National Institutes Of Health | Universal protein array system |
| US7084125B2 (en) | 1999-03-18 | 2006-08-01 | Exiqon A/S | Xylo-LNA analogues |
| WO2000061806A2 (en) | 1999-04-09 | 2000-10-19 | Arcturus Engineering, Inc. | GENERIC cDNA OR PROTEIN ARRAY FOR CUSTOMIZED ASSAYS |
| US6284465B1 (en) | 1999-04-15 | 2001-09-04 | Agilent Technologies, Inc. | Apparatus, systems and method for locating nucleic acids bound to surfaces |
| US7279502B2 (en) | 1999-04-30 | 2007-10-09 | Cellgate, Inc. | Polyamine analog conjugates and quinone conjugates as therapies for cancers and prostate diseases |
| US7312244B2 (en) | 1999-04-30 | 2007-12-25 | Cellgate, Inc. | Polyamine analog-amino acid conjugates useful as anticancer agents |
| US7053207B2 (en) | 1999-05-04 | 2006-05-30 | Exiqon A/S | L-ribo-LNA analogues |
| US6268141B1 (en) | 1999-05-12 | 2001-07-31 | Beckman Coulter, Inc. | Immobilization of unmodified biopolymers to acyl fluoride activated substrates |
| US6605115B1 (en) | 1999-06-05 | 2003-08-12 | Board Of Trustees Of The Leland Stanford Junior University | Method and composition for inhibiting cardiovascular cell proliferation |
| WO2000074701A2 (en) | 1999-06-05 | 2000-12-14 | The Board Of Trustees Of The Leland Stanford Junior University | Method and composition for inhibiting cardiovascular cell proliferation |
| US6387620B1 (en) | 1999-07-28 | 2002-05-14 | Gilead Sciences, Inc. | Transcription-free selex |
| US6383754B1 (en) | 1999-08-13 | 2002-05-07 | Yale University | Binary encoded sequence tags |
| US7229961B2 (en) | 1999-08-24 | 2007-06-12 | Cellgate, Inc. | Compositions and methods for enhancing drug delivery across and into ocular tissues |
| US6881825B1 (en) | 1999-09-01 | 2005-04-19 | University Of Pittsburgh Of The Commonwealth System Of Higher Education | Identication of peptides that facilitate uptake and cytoplasmic and/or nuclear transport of proteins, DNA and virues |
| US6171797B1 (en) | 1999-10-20 | 2001-01-09 | Agilent Technologies Inc. | Methods of making polymeric arrays |
| US6372431B1 (en) | 1999-11-19 | 2002-04-16 | Incyte Genomics, Inc. | Mammalian toxicological response markers |
| US6936419B1 (en) | 1999-11-25 | 2005-08-30 | Epigenomics Ag | Oligomer array with PNA and/or DNA oligomers on a surface |
| US6383749B2 (en) | 1999-12-02 | 2002-05-07 | Clontech Laboratories, Inc. | Methods of labeling nucleic acids for use in array based hybridization assays |
| US6283949B1 (en) | 1999-12-27 | 2001-09-04 | Advanced Cardiovascular Systems, Inc. | Refillable implantable drug delivery pump |
| WO2001057259A1 (en) | 2000-02-03 | 2001-08-09 | Research Development Foundation | Signaling aptamers that transduce molecular recognition to a differential signal |
| US6267152B1 (en) | 2000-02-18 | 2001-07-31 | Wisconsin Label Corporation | Hang tag and method of applying hang tag to an elongated object |
| US6585602B2 (en) | 2000-02-24 | 2003-07-01 | Gkn Lobro Gmbh | Plunging assembly for a driveshaft |
| WO2001068671A1 (en) | 2000-03-10 | 2001-09-20 | President And Fellows Of Harvard College | Method of making protein arrays |
| US6376191B1 (en) | 2000-03-22 | 2002-04-23 | Mergen, Ltd. | Microarray-based analysis of polynucleotide sequence variations |
| US20030108532A1 (en) | 2000-04-04 | 2003-06-12 | Enanta Pharmaceuticals | Methods for identifying peptide aptamers capable of altering a cell phenotype |
| WO2001088162A2 (en) | 2000-05-16 | 2001-11-22 | Genway Biotech, Inc. | Methods and vectors for generating antibodies in avian species and uses therefor |
| WO2001094946A2 (en) | 2000-06-05 | 2001-12-13 | Chiron Corporation | Microarrays for performing proteomic analyses |
| US6921642B2 (en) | 2000-06-20 | 2005-07-26 | Qlagen Gmbh | Protein expression profiling |
| US6386749B1 (en) | 2000-06-26 | 2002-05-14 | Affymetrix, Inc. | Systems and methods for heating and mixing fluids |
| US7629163B2 (en) | 2000-06-28 | 2009-12-08 | Glycofi, Inc. | Methods for producing modified glycoproteins |
| US7326681B2 (en) | 2000-06-28 | 2008-02-05 | Glycofi, Inc. | Methods for producing modified glycoproteins |
| US7029872B2 (en) | 2000-06-28 | 2006-04-18 | Glycofi, Inc | Methods for producing modified glycoproteins |
| US6380377B1 (en) | 2000-07-14 | 2002-04-30 | Applied Gene Technologies, Inc. | Nucleic acid hairpin probes and uses thereof |
| US6924103B2 (en) | 2000-08-31 | 2005-08-02 | Canon Kabushiki Kaisha | Screening method for gene variation |
| WO2002031463A2 (en) | 2000-08-31 | 2002-04-18 | Motorola, Inc. | High density column and row addressable electrode arrays |
| US20090082274A1 (en) | 2000-09-08 | 2009-03-26 | Universitat Zurich | Collections of repeat proteins comprising repeat modules |
| US6376190B1 (en) | 2000-09-22 | 2002-04-23 | Somalogic, Inc. | Modified SELEX processes without purified protein |
| WO2002025288A2 (en) | 2000-09-22 | 2002-03-28 | Clontech Laboratories Inc. | Highly sensitive proteomic analysis methods and kits and systems for practicing the same |
| US6596541B2 (en) | 2000-10-31 | 2003-07-22 | Regeneron Pharmaceuticals, Inc. | Methods of modifying eukaryotic cells |
| US6379897B1 (en) | 2000-11-09 | 2002-04-30 | Nanogen, Inc. | Methods for gene expression monitoring on electronic microarrays |
| US6436386B1 (en) | 2000-11-14 | 2002-08-20 | Shearwater Corporation | Hydroxyapatite-targeting poly (ethylene glycol) and related polymers |
| US20020183936A1 (en) | 2001-01-24 | 2002-12-05 | Affymetrix, Inc. | Method, system, and computer software for providing a genomic web portal |
| US7585834B2 (en) | 2001-02-16 | 2009-09-08 | The Board Of Trustees Of The Leland Stanford Junior University | Transporters comprising spaced arginine moieties |
| WO2002069930A1 (en) | 2001-02-23 | 2002-09-12 | Cellgate, Inc. | Compositions and methods for enhancing drug delivery across and into epithelial tissues |
| US20050089932A1 (en) | 2001-04-26 | 2005-04-28 | Avidia Research Institute | Novel proteins with targeted binding |
| US20050053973A1 (en) | 2001-04-26 | 2005-03-10 | Avidia Research Institute | Novel proteins with targeted binding |
| US20050048512A1 (en) | 2001-04-26 | 2005-03-03 | Avidia Research Institute | Combinatorial libraries of monomer domains |
| US20050221384A1 (en) | 2001-04-26 | 2005-10-06 | Avidia Research Institute | Combinatorial libraries of monomer domains |
| US20040175756A1 (en) | 2001-04-26 | 2004-09-09 | Avidia Research Institute | Methods for using combinatorial libraries of monomer domains |
| US6632611B2 (en) | 2001-07-20 | 2003-10-14 | Affymetrix, Inc. | Method of target enrichment and amplification |
| US20030036069A1 (en) | 2001-07-25 | 2003-02-20 | Affymetrix, Inc. | Complexity Managment of genomic DNA |
| US7060809B2 (en) | 2001-09-04 | 2006-06-13 | Exiqon A/S | LNA compositions and uses thereof |
| US7235695B2 (en) | 2001-12-07 | 2007-06-26 | Benjamin Frydman | Cycloalkyl substituted polyamines for cancer therapy and methods of synthesis therefor |
| US7453011B2 (en) | 2001-12-07 | 2008-11-18 | Progen Pharmaceuticals, Inc. | Cycloalkyl substituted polyamines for cancer therapy and methods of synthesis therefor |
| US6982351B2 (en) | 2001-12-07 | 2006-01-03 | Cellgate, Inc. | Cycloalkyl substituted polyamines for cancer therapy and methods of synthesis therefor |
| US7169814B2 (en) | 2001-12-11 | 2007-01-30 | The Board Of Trustees Of The Leland Stanford Junior University | Guanidinium transport reagents and conjugates |
| WO2003049772A2 (en) | 2001-12-11 | 2003-06-19 | The Board Of Trustees Of The Leland Stanford Junior University | Guanidinium transport reagents and conjugates |
| US7011945B2 (en) | 2001-12-21 | 2006-03-14 | Eastman Kodak Company | Random array of micro-spheres for the analysis of nucleic acids |
| US7022851B2 (en) | 2002-01-24 | 2006-04-04 | Panagene, Inc. | PNA monomer and precursor |
| US7244592B2 (en) | 2002-03-07 | 2007-07-17 | Dyax Corp. | Ligand screening and discovery |
| US7179896B2 (en) | 2002-04-26 | 2007-02-20 | Panagene, Inc. | Method of making PNA oligomers |
| US6969766B2 (en) | 2002-04-26 | 2005-11-29 | Panagene, Inc. | PNA monomer and precursor |
| US7145006B2 (en) | 2002-04-26 | 2006-12-05 | Panagene, Inc. | PNA monomer and precursor |
| US7125994B2 (en) | 2002-04-26 | 2006-10-24 | Panagene, Inc. | PNA monomer and precursor |
| US7569575B2 (en) | 2002-05-08 | 2009-08-04 | Santaris Pharma A/S | Synthesis of locked nucleic acid derivatives |
| WO2003106491A2 (en) | 2002-06-18 | 2003-12-24 | Cepep Ab | Cell penetrating peptides |
| US7011949B2 (en) | 2002-09-30 | 2006-03-14 | Agilent Technologies, Inc. | Methods and compositions for producing labeled probe nucleic acids for use in array based comparative genomic hybridization applications |
| US7028629B2 (en) | 2003-02-03 | 2006-04-18 | Richard Walcome | Self-sealing port light assembly |
| US20070275465A1 (en) | 2003-06-13 | 2007-11-29 | Alnylam Pharmaceuticals | Double-Stranded Ribonucleic Acid with Increased Effectiveness in an Organism |
| US7211668B2 (en) | 2003-07-28 | 2007-05-01 | Panagene, Inc. | PNA monomer and precursor |
| US7431915B2 (en) | 2003-10-31 | 2008-10-07 | The Regents Of The University Of California | Peptides whose uptake by cells is controllable |
| US20080220049A1 (en) | 2003-12-05 | 2008-09-11 | Adnexus, A Bristol-Myers Squibb R&D Company | Compositions and methods for intraocular delivery of fibronectin scaffold domain proteins |
| US20060008822A1 (en) | 2004-04-27 | 2006-01-12 | Alnylam Pharmaceuticals, Inc. | Single-stranded and double-stranded oligonucleotides comprising a 2-arylpropyl moiety |
| US20060287260A1 (en) | 2004-06-30 | 2006-12-21 | Alnylam Pharmaceuticals, Inc. | Oligonucleotides comprising a non-phosphate backbone linkage |
| US20060035254A1 (en) | 2004-07-21 | 2006-02-16 | Alnylam Pharmaceuticals, Inc. | Oligonucleotides comprising a modified or non-natural nucleobase |
| US20070054279A1 (en) | 2004-08-04 | 2007-03-08 | Alnylam Pharmaceuticals | Oligonucleotides comprising a ligand tethered to a modified or non-natural nucleobase |
| WO2007106554A2 (en) | 2006-03-14 | 2007-09-20 | Progen Pharmaceuticals, Inc. | Treatment and prevention of vascular hyperplasia using polyamine and polyamine analog compounds |
| WO2007111993A2 (en) | 2006-03-22 | 2007-10-04 | Cellgate, Inc. | Polyamine analogs as therapeutic agents for skin diseases |
| WO2008063113A1 (en) | 2006-11-20 | 2008-05-29 | Cepep Iii Ab | Cell -penetrating peptides and constructs containing them consisting 15-25 amino acids of tumor supressor protein p14arf or p19arf |
| WO2009158649A1 (en) | 2008-06-26 | 2009-12-30 | Atyr Pharma, Inc. | Compositions and methods comprising glycyl-trna synthetases having non-canonical biological activities |
| US8012804B1 (en) | 2009-12-23 | 2011-09-06 | Western Digital (Fremont), Llc | Method and system for mounting lasers on energy assisted magnetic recording heads |
Non-Patent Citations (257)
| Title |
|---|
| "32", ACCOUNTS OF CHEM. RESEARCH, 1999, pages 301 |
| "Avery's Drug Treatment: Principles and Practice of Clinical Pharmacology and Therapeutics, 3rd ed.", 1987, ADIS PRESS, LTD., WILLIAMS AND WILKINS |
| "Methods in Enzymology", ACADEMIC PRESS, article "Methods of Enzymology: DNA Structure Part A: Synthesis and Physical Analysis of DNA" |
| "Remington: The Science and Practice of Pharmacy, 20th ed.", 2000, MACK PUBLISHING COMPANY, ISBN: 0683306472 |
| "Remington's Pharmaceutical Sciences, 15th ed.", pages: 1035 - 1038,157 |
| ADVANCED DRUG DELIVERY REVIEWS, vol. 42, pages 29 - 64 |
| ALLEN ET AL., BIOLOGICALS, vol. 24, 1996, pages 255 - 275 |
| ALTSCHUL ET AL., J. MOL. BIOL, vol. 215, 1990, pages 403 - 10 |
| ALTSCHUL ET AL., NUCL. ACIDS RES., vol. 25, 1997, pages 3389 |
| ALTSCHUL ET AL., NUCLEIC ACIDS RES, vol. 25, 1997, pages 3389 - 3402 |
| ANICETTI ET AL., TRENDS IN BIOTECHNOLOGY., vol. 7, 1989, pages 342 - 349 |
| ARKIN; YOURVAN, PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 7811 - 7815 |
| AUSUBEL ET AL., CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, 1989 |
| AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1989, GREEN PUBLISHING ASSOCIATES AND WILEY INTERSCIENCE |
| AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1994, JOHN WILEY & SONS INC, article "Chapter 15" |
| AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 2001, GREENE PUBL. ASSOC. INC. & JOHN WILEY & SONS, INC. |
| AUSUBEL, F. M ET AL.: "Current Protocols in Molecular Biology", 1987, GREENE PUBL. ASSOC. & WILEY-INTERSCIENCES |
| B. HAMES & S. HIGGINS: "Nucleic Acid Hybridization", 1985 |
| B. HAMES & S. HIGGINS: "Transcription and Translation", 1984 |
| B. PERBAL: "A Practical Guide to Molecular Cloning, 3rd ed.", 2010 |
| BAO, P. ET AL., ANAL CHEM, vol. 74, 2002, pages 1792 - 1797 |
| BARNES,C; BALASUBRAMANIAN, S., CURR. OPIN. CHEM. BIOL., vol. 4, 2000, pages 346 - 350 |
| BATORI ET AL., PROTEIN ENG., vol. 15, 2002, pages 1015 - 20 |
| BERGER; KIMMEL: "Guide to Molecular Cloning Techniques", vol. 152, ACADEMIC PRESS, INC., article "Methods in Enzymology" |
| BERKOW ET AL.: "The Merck Manual, 16th ed.", 1992, MERCK AND CO. |
| BERNSTEIN ET AL., NATURE, vol. 409, 2001, pages 363 - 366 |
| BIOORGANIC MEDICINAL CHEMISTRY, vol. 16, 2008, pages 9230 |
| BOHM, H. J; STAHL, M., CURR. OPIN. CHEM. BIOL., vol. 4, 2000, pages 283 - 286 |
| BORDIGNON, C ET AL.: "Cell Therapy: Achievements and Perspectives", HAEMATOLOGICA, vol. 84, 1999, pages 1110 - 1149 |
| BOXEM ET AL., CELL, vol. 134, 2008, pages 534 - 545 |
| BRENNER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 97, no. 4, 2000, pages 1665 - 1670 |
| BROGLIE ET AL., SCIENCE, vol. 224, 1984, pages 838 - 843 |
| BROWN ET AL., CANCER RES., vol. 47, 1987, pages 3577 - 3583 |
| BRUNER ET AL., JOURNAL OF PHARMACEUTICAL AND BIOMEDICAL ANALYSIS, vol. 15, 1997, pages 1929 - 1935 |
| BURGESS-BROWN ET AL., PROTEIN EXPR PURIF., vol. 59, 2008, pages 94 - 102 |
| BURGIN ET AL., BIOCHEMISTRY, vol. 35, 1996, pages 14090 |
| BUTCHER ET AL., HUM MOL GENET., vol. 14, no. 10, 2005, pages 1315 - 25 |
| BUZAYAN ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 83, 1986, pages 8859 |
| BUZDIN AND LUKYANOV: "Nucleic Acid Hybridization: Modern Applications", 2009 |
| CABILLY, S., MOL. BIOTECHNOL., vol. 12, 1999, pages 143 - 148 |
| CANE ET AL., SCIENCE, vol. 282, 1998, pages 63 - 68 |
| CHAI ET AL., J. CLIN. LAB ANAL., vol. 19, no. 5, 2005, pages 182 - 188 |
| CHAO ET AL., NATURE PROTOCOLS., vol. 1, 2006, pages 755 - 768 |
| CHIEN ET AL., PNAS USA, vol. 88, 1991, pages 9578 - 9582 |
| COLBERE-GARAPIN ET AL., J. MOL. BIOL., vol. 150, 1981, pages 1 - 14 |
| COLIGAN ET AL.: "Current Protocols in Protein Science", 1995, JOHN WILEY & SONS, INC., article "in particular Chapters 1, 5 and 6" |
| CONRATH ET AL., JBC, vol. 276, 2001, pages 7346 - 7350 |
| CORUZZI ET AL., EMBO J., vol. 3, 1984, pages 1671 - 1680 |
| CREIGHTON: "Proteins: Structures and Molecular Principles", 1983, W. H. FREEMAN & CO., pages: 34 - 49 |
| CROOKE ET AL., J. PHARMACOL. EXP. THER., vol. 277, 1996, pages 923 |
| CZARNICK, A. W.; KEENE, J. D, CURR. BIOL., vol. 8, 1998, pages R705 - R707 |
| D. GLOVER: "DNA Cloning: A Practical Approach", vol. I, II |
| DAVIES ET AL., ANNUAL REV. BIOCHEM., vol. 59, 1990, pages 439 - 473 |
| DAYHOFF ET AL., A MODEL OF EVOLUTIONARY CHANGE IN PROTEINS, 1978 |
| DAYHOFF ET AL.: "Atlas of Protein Sequence and Structure", 1978, NATL. BIOMED. RES. FOUND. |
| DELGRAVE ET AL., PROTEIN ENGINEERING, vol. 6, 1993, pages 327 - 331 |
| DEVERAUX ET AL., NUCLEIC ACIDS RESEARCH, vol. 12, 1984, pages 387 - 395 |
| DI ET AL., BIOINFORMATICS., vol. 21, 2005, pages 1958 |
| DOLLE, R. E, J. COMB. CHEM., vol. 2, 2000, pages 383 - 433 |
| DOLLE, R. E., MOL. DIVERS., vol. 4, 1998, pages 233 - 256 |
| DOLLE, R. E.; NELSON, K. H, J. COMB. CHEM., vol. 1, 1999, pages 235 - 282 |
| E. MEYERS; W. MILLER, CABIOS, vol. 4, 1989, pages 11 - 17 |
| EBADI: "Pharmacology", 1985, LITTLE, BROWN AND CO. |
| ED HARLOW, DAVID LANE: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY PRESS |
| EDWARD HARLOW; DAVID LANE; ED HARLOW: "Using Antibodies: A Laboratory Manual: Portable Protocol NO. I", 1999, COLD SPRING HARBOR LABORATORY PRESS, ISBN: 0-87969-544-7 |
| EHRLICH ET AL., BIOCHEM, vol. 19, 1980, pages 4091 - 4096 |
| ELLINGTON ET AL., NATURE, vol. 346, 1990, pages 818 - 22 |
| ENGELHARD ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 91, 1994, pages 3224 - 3227 |
| ERMOLAEVA MD, CURR. ISS. MOL. BIOL., vol. 3, no. 4, 2001, pages 91 - 7 |
| EVANS ET AL., J. MED. CHEM., vol. 30, 1987, pages 229 |
| FARRELL, R.: "RNA Methodologies: A Laboratory Guide for Isolation and Characterization, 3rd ed.", 2005 |
| FAUCHERE, J., ADV. DRUG RES., vol. 15, 1986, pages 29 |
| FINNIN; MORGAN, J. PHARM. SCI., vol. 88, no. 10, 1999, pages 955 - 958 |
| FLOYD, C D. ET AL., PROG. MED. CHEM., vol. 36, 1999, pages 91 - 168 |
| FORSTER ET AL., CELL, vol. 50, 1987, pages 9 |
| FRESHNEY, R.I.: "Culture of Animal Cells, a Manual of Basic Technique, 5th ed.", 2005, JOHN WILEY & SONS |
| FU ET AL., BRAIN RES., vol. 1352, 2010, pages 208 - 13 |
| GERNGROSS ET AL., NATURE-BIOTECHNOLOGY, vol. 22, 2004, pages 1409 - 1414 |
| GONNET ET AL., SCIENCE, vol. 256, 1992, pages 14430 - 1445 |
| GOODMAN ET AL.: "Goodman and Gilman's The Pharmacological Basis of Therapeutics, 10th ed.", 2001, PERGAMON PRESS, INC. |
| GOODMAN S., ANN INTERN MED, vol. 130, 1999, pages 1005 - 13 |
| GRAHAM ET AL., J. GEN VIROL., vol. 36, 1977, pages 59 |
| GRANT ET AL., METHODS ENZYMOL., vol. 153, 1987, pages 516 - 544 |
| GUATELLI, J. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 87, 1990, pages 1874 - 1878 |
| HALL, D. G., NAT. BIOTECHNOL., vol. 18, 2000, pages 262 - 262 |
| HAMES ET AL.: "Nucleic Acid Hybridization", 1985, IRL PRESS, pages: 107 - 108 |
| HAMILTON ET AL., SCIENCE, vol. 301, 2003, pages 1244 |
| HAMILTON ET AL., SCIENCE, vol. 313, 2006, pages 1441 - 1443 |
| HAMPTON ET AL.: "Serological Methods, a Laboratory Manual", 1990 |
| HAN, M. ET AL., NAT BIOTECHNOL, vol. 19, 2001, pages 631 - 635 |
| HARLOW; LANE: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY |
| HARTMAN; MULLIGAN, PROC. NATL. ACAD. SCI. U.S.A., vol. 85, 1988, pages 8047 - 51 |
| HAUGLAND: "Handbook of Fluorescent Probes, 9th ed.", 2002, MOLEC. PROBES, INC. |
| HAUGLAND: "The Handbook: A Guide to Fluorescent Probes and Labeling Technologies, 10th ed.", 2005, INVITROGEN |
| HELLER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 94, 1997, pages 2150 - 55 |
| HOBBS: "Yearbook of Science and Technology", 1992, pages: 191 - 196 |
| HOCHMAN ET AL., BIOCHEM, vol. 15, 1976, pages 2706 - 2710 |
| HOFFMAN AS, ANN. N.Y. ACAD. SCI., vol. 944, 2001, pages 62 - 73 |
| HOOK ET AL., RNA, vol. 11, 2005, pages 227 - 233 |
| HOUGHTEN, R. A., ANN. REV. PHARMACOL. TOXICOL., vol. 40, 2000, pages 273 - 282 |
| HU ET AL., CANCER RES., vol. 65, no. 7, 2005, pages 2542 - 6 |
| HUC, I.; NGUYEN, R., COMB. CHEM. HIGH THROUGHPUT SCREEN, vol. 4, 2001, pages 53 - 74 |
| HUSTON ET AL., PNAS USA., vol. 85, no. 16, 1988, pages 5879 - 5883 |
| INBAR ET AL., PROC. NAT. ACAD. SCI. USA, vol. 69, 1972, pages 2659 - 2662 |
| INNIS ET AL.: "PCR Protocols: A Guide to Methods and Applications", 1990, ACADEMIC PRESS, INC |
| INNIS, M ET AL.: "PCR Protocols. A Guide to Methods and Applications", 1990, ACADEMIC PRESS |
| JANE ROSKAMS AND LINDA RODGERS: "Lab Ref: A Handbook of Recipes, Reagents, and Other Reference Tools for Use at the Bench", 2002, COLD SPRING HARBOR LABORATORY, ISBN: 0-87969-630-3 |
| JOACHIM GRANTE, ANGEW. CHEM. INT. ED. ENGL., vol. 33, 1994, pages 1699 - 1720 |
| JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525 |
| KABANOV ET AL., FEBS LETT., vol. 259, 1990, pages 327 |
| KAMEDA ET AL., BIOCHEM. BIOPHYS. RES. COMMUN, vol. 349, no. 4, 2006, pages 1269 - 1277 |
| KATZUNG: "Basic and Clinical Pharmacology", 1992, APPLETON AND LANGE |
| KELLY ET AL., BIOCHIM BIOPHYS ACTA, vol. 1751, 2005, pages 119 - 139 |
| KENNEDY ET AL., NAT. BIOTECH., vol. 21, 2003, pages 1233 - 1237 |
| KINGSTON: "Current Protocols in Molecular Biology", 2002, GREENE PUBL. ASSOC. INC. & JOHN WILEY & SONS, INC. |
| KLEIN ET AL., SCIENCE, vol. 308, no. 5720, 2005, pages 385 - 9 |
| KOBAYASHI, S., CURR. OPIN. CHEM. BIOL., vol. 4, 2000, pages 338 - 345 |
| KOCHENDOERFER, CURRENT OPINION IN CHEMICAL BIOLOGY, vol. 9, 2005, pages 555 - 560 |
| KOHLER; MILSTEIN, EUR. J. IMMUNOL., vol. 6, 1976, pages 511 - 519 |
| KOPYLOV, A. M.; SPIRIDONOVA, V. A., MOL. BIOL. (MOSK, vol. 34, 2000, pages 1097 - 1113 |
| KUMAR ET AL.: "Robbins Basic Pathology, 8th ed.", 2009, ELSEVIER |
| KUNDU, B. ET AL., PROG. DRUG RES., vol. 53, 1999, pages 89 - 156 |
| KUNKEL ET AL., METHODS IN ENZYMOL, vol. 154, 1987, pages 367 - 382 |
| KUNKEL, PROC. NATL. ACAD. SCI. USA., vol. 82, 1985, pages 488 - 492 |
| KWOH, D. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 1173 - 1177 |
| KWON ET AL., BMC BIOTECHNOL., vol. 9, 2009, pages 72 |
| LAZO, J. S.; WIPF, P., J. PHARMACOL. EXP. THER., vol. 293, 2000, pages 705 - 709 |
| LEE ET AL., THE JOURNAL OF PHARMACOLOGY, vol. 281, 1997, pages 1431 - 1439 |
| LEPRE, ENJALBAL, C ET AL., MASS SEPTROM REV., vol. 19, 2000, pages 139 - 161 |
| LEPRE,C A, DRUG DISCOV. TODAY, vol. 6, 2001, pages 133 - 140 |
| LETSINGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 6553 |
| LI ET AL., NATURE BIOTECHNOLOGY, vol. 24, 2006, pages 210 - 215 |
| LIN ET AL., METHODS MOL BIOL., vol. 498, 2009, pages 129 - 41 |
| LIU ET AL., BIOINFORMATICS, vol. 19, 2003, pages 2397 - 2403 |
| LIZARDI, P. ET AL., BIOTECHNOL., vol. 6, 1988, pages 1197 - 1202 |
| LOBUGLIO ET AL., PROC. NAT. ACAD. SCI. USA, vol. 86, 1989, pages 4220 - 4224 |
| LOGAN; SHENK, PROC. NATL. ACAD. SCI. U.S.A., vol. 81, 1984, pages 3655 - 3659 |
| LONBERG ET AL., HANDBOOK OF EXPERIMENTAL PHARMACOLOGY, vol. 113, 1994, pages 49 - 101 |
| LONBERG ET AL., INTERNAL REVIEW OF IMMUNOLOGY, vol. 13, 1995, pages 65 - 93 |
| LOWE, G., NAT. PROD. REP., vol. 16, 1999, pages 641 - 651 |
| LOWY ET AL., CELL, vol. 22, 1990, pages 817 - 823 |
| LUTHMAN ET AL.: "A Textbook of Drug Design and Development, 2nd ed.", vol. 14, 1996, HARWOOD ACADEMIC PUBLISHERS, pages: 386 - 406 |
| M. BODANZSKY: "Principles of Peptide Synthesis (1st ed. & 2d rev. ed.)", 1984, SPRINGER-VERLAG, article "Chapter 7" |
| M. O. DAYHOFF: "Atlas of protein sequence and structure", vol. 5, NATIONAL BIOMEDICAL RESEARCH FOUNDATION, pages: 345 - 358 |
| MADDOX ET AL., J. EXP. MED., vol. 158, 1983, pages 1211 - 1216 |
| MANFRED E. WOLFF: "Burger's Medicinal Chemistry and Drug Discovery", 1995, JOHN WILEY & SONS INC., article "Chapter 15", pages: 619 - 620 |
| MANIATIS ET AL.: "Molecular Cloning", 1982, COLD SPRING HARBOR LABORATORY |
| MANIATIS ET AL.: "Molecular Cloning: A Laboratory Manual, 2nd ed.", 1989, COLD SPRING HARBOR |
| MANOHARAN ET AL., ANN. N.Y. ACAD. SCI., vol. 660, 1992, pages 306 |
| MANOHARAN ET AL., BIOORG. MED. CHEM. LET., vol. 3, 1993, pages 2765 |
| MANOHARAN ET AL., BIOORG. MED. CHEM. LETT., vol. 4, 1994, pages 1053 |
| MANOHARAN ET AL., NUCLEOSIDES & NUCLEOTIDES, vol. 14, 1995, pages 969 |
| MANOHARAN ET AL., TETRAHEDRON LETT., vol. 36, 1995, pages 3651 |
| MANTYH ET AL., PNAS, vol. 92, 1995, pages 2662 - 2666 |
| MANTYH ET AL., PROT. EXP. & PURIF., vol. 6, 1995, pages 124 |
| MATHER ET AL., ANNALS N.Y. ACAD. SCI., vol. 383, 1982, pages 44 - 68 |
| MATHER, BIOL. REPROD., vol. 23, 1980, pages 243 - 251 |
| MATSUZAKI ET AL., GEN. RES., vol. 14, 2004, pages 414 - 425 |
| MATSUZAKI ET AL., NATURE METHODS, vol. 1, 2004, pages 109 - 111 |
| MAXWELL ET AL., PROTEIN SCI, vol. 8, 1999, pages 1908 - 11 |
| MEAGHER ET AL., J. BIOL. CHEM., vol. 273, 1998, pages 23283 - 89 |
| MERRIFIELD, J. AM. CHEM. SOC., vol. 85, 1963, pages 2149 - 2154 |
| MILLER, LM, PATHOLOGY LECTURE NOTES |
| MISHRA ET AL., BIOCHIM. BIOPHYS. ACTA, vol. 1264, 1995, pages 229 |
| MITRA ET AL., CANCER RES., vol. 64, no. 21, 2004, pages 8116 - 25 |
| MIYADA C.G; WALLACE R.B.: "Oligonucleotide hybridization techniques", METHODS ENZYMOL., vol. 154, 1987, pages 94 - 107 |
| MURPHY; PIWNICA-WORMS: "Curr Protoc Protein Sci", 2001, article "Chapter 5:Unit5.4" |
| MYERS, P. L., CURR. OPIN. BIOTECHNOL., vol. 8, 1997, pages 701 - 707 |
| N. GAIT: "Oligonucleotide Synthesis", 1984 |
| NAGAMINE ET AL., BIOTECHNOLOGY AND BIOENGINEERING, vol. 96, 2006, pages 1008 - 1013 |
| NAKAMURA ET AL., NUC. ACID. RES., vol. 28, no. 1, 2000, pages 292 |
| NATURE GENET., vol. 21, no. 1, 1999, pages 1 - 60 |
| NATURE METHODS, vol. 5, 2008, pages 135 - 146 |
| NEEDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 444 - 453 |
| NELSON ET AL., PROC NATL ACAD SCI U S A, vol. 99, 2002, pages 11890 - 11895 |
| NEUBERGER ET AL., NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 826 |
| NIELSEN ET AL., SCIENCE, vol. 254, 1991, pages 1497 |
| OBERHAUSER ET AL., NUCL. ACIDS RES., vol. 20, 1992, pages 533 |
| OBIKA ET AL., TETRAHEDRON LETTERS, vol. 38, 1997, pages 8735 |
| OSBORN ET AL., EUR. J. PHARMACOL., vol. 456, no. 1-3, 2002, pages 149 - 158 |
| OSOLCI AL.: "Remington's Pharmaceutical Sciences, 18th ed.", 1990, MACK PUBLISHING CO. |
| OUELETTE; BZEVANIS: "Bioinformatics: A Practical Guide for Analysis of Gene and Proteins, 2nd ed.", 2001, WILEY & SONS, INC. |
| P. HERDEWIJN: "Oligonucleotide Synthesis: Methods and Applications", 2004 |
| PASUT ET AL., EXPERT OPINION. THER. PATENTS, vol. 14, no. 6, 2004, pages 859 - 894 |
| PENG, S. X., BIOMED. CHROMATOGR., vol. 14, 2000, pages 430 - 441 |
| PERSING, DAVID H. ET AL.: "Diagnostic Medical Microbiology: Principles and Applications", 1993, AMERICAN SOCIETY FOR MICROBIOLOGY, article "In Vitro Nucleic Acid Amplification Techniques", pages: 51 - 87 |
| PETRIV ET AL., PNAS, 2010 |
| PLUCKTHUN, A.; CORTESE, R., BIOL. CHEM., vol. 378, 1997, pages 443 |
| QING ET AL., NATURE BIOTECHNOLOGY, vol. 22, 2004, pages 877 - 882 |
| R. FRESHNEY: "Animal Cell Culture", 1986 |
| RAMAKRISHNA SEETHALA, PRABHAVATHI B. FERNANDES: "Handbook of Drug Screening", 2001, MARCEL DEKKER, ISBN: 0-8247-0562-9 |
| RASHIDI; BUEHLER: "Bioinformatics Basics: Application in Biological Science and Medicine", 2000, CRC PRESS |
| RHODES ET AL., METHODS MOL. BIOL., vol. 55, 1995, pages 121 - 131 |
| RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 327 |
| ROBERTS; VELLACCIO: "The Peptides: Analysis, Synthesis, Biology", vol. 5, 1983, ACADEMIC PRESS, INC., pages: 341 |
| ROBINSON ET AL., NATURE MEDICINE, vol. 8, no. 3, 2002, pages 295 - 301 |
| ROSSER ET AL., PROTEIN EXPR. PURIF., vol. 40, 2005, pages 237 - 43 |
| ROSWALL ET AL., BIOLOGICALS, vol. 24, 1996, pages 25 - 39 |
| SAISON-BEHMOARAS ET AL., EMBO J., vol. 10, 1991, pages 111 |
| SALZBERG, SEARLES, KASIF: "Computational Methods in Molecular Biology", 1998, ELSEVIER |
| SAMBROOK ET AL.: "Molecular Cloning, 2nd ed.", 1989, COLD SPRING HARBOR LABORATORY |
| SAMBROOK ET AL.: "Molecular Cloning, A Laboratory Manual", 1989 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual, 3rd ed.", 2000 |
| SAMBROOK, J ET AL.: "Molecular Cloning: A Laboratory Manual, 2.sup.nd ed.", vol. 1-3, 1989, COLD SPRING HARBOR PRESS |
| SCHARF ET AL., RESULTS PROBL. CELL DIFFER., vol. 20, 1994, pages 125 - 162 |
| SCHENA ET AL., PROC. NATL. ACAD. SCI. USA, vol. 93, 1996, pages 10614 - 19 |
| SCHENA: "DNA Microarrays: A Practical Approach (Practical Approach Series", 1999, OXFORD UNIVERSITY PRESS |
| SCHENA: "Microarray Biochip: Tools and Technology", 2000, EATON PUBLISHING COMPANY/BIOTECHNIQUES BOOKS DIVISION |
| See also references of EP2568996A4 |
| SETUBAL; MEIDANIS ET AL.: "Introduction to Computational Biology Methods", 1997, PWS PUBLISHING COMPANY |
| SHAW ET AL., J IMMUNOL., vol. 138, 1987, pages 4534 - 4538 |
| SHEA ET AL., NUCL. ACIDS RES., vol. 18, 1990, pages 3777 |
| SHIMP ET AL., PROTEIN EXPR PURIF., vol. 50, 2006, pages 58 - 67 |
| SILVERMAN ET AL., NATURE BIOTECHNOLOGY, vol. 23, 2005, pages 1556 - 1561 |
| SIMON ET AL., PNAS USA, vol. 89, 1992, pages 9367 - 9371 |
| SITARAMAN ET AL., METHODS MOL BIOL., vol. 498, 2009, pages 229 - 44 |
| SKERRA, FEBS J., vol. 275, 2008, pages 2677 - 83 |
| SMALES AND JAMES: "Therapeutic Proteins: Methods and Protocols", vol. 308, 2005, HUMANA PRESS INC. |
| STENVALL ET AL., BIOCHIM BIOPHYS ACTA, vol. 1752, 2005, pages 6 - 10 |
| STEWART; YOUNG: "Solid Phase Peptide Synthesis, 2nd ed.", 1984, PIERCE CHEMICAL CO. |
| STUMPP ET AL., CURR OPIN DRUG DISCOV DEVEL, vol. 10, 2007, pages 153 - 159 |
| SVINARCHUK ET AL., BIOCHIMIE, vol. 75, 1993, pages 49 |
| TAKAMATSU, EMBO J., vol. 6, 1987, pages 307 - 311 |
| TETRAHEDRON, vol. 54, 1998, pages 3607 |
| THACH ET AL., J. IMMUNOL. METHODS, vol. 283, no. 1-2, December 2003 (2003-12-01), pages 269 - 279 |
| TUERK ET AL., SCIENCE, vol. 249, 1990, pages 505 - 10 |
| TUTEJA R; TUTEJA N., BIOESSAYS., vol. 26, no. 8, August 2004 (2004-08-01), pages 916 - 22 |
| ULUDAG ET AL., TECHNOLOGY OF MAMMALIAN CELL ENCAPSULATION, 2000 |
| URLAUB ET AL., PNAS USA, vol. 77, 1980, pages 4216 |
| V. AMBROS ET AL., CURRENT BIOLOGY, vol. 13, 2003, pages 807 |
| VAN HEEKE; SCHUSTER, J. BIOL. CHEM., vol. 264, 1989, pages 5503 - 5509 |
| VEBER; FREIDINGER, TINS, 1985, pages 392 |
| VELCULESCU, V. E. ET AL., TRENDS GENET, vol. 16, 2000, pages 423 - 425 |
| VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536 |
| VERONESE; HARRIS, ADVANCED DRUG DELIVERY REVIEWS, vol. 54, 2002, pages 453 - 456 |
| VON ZONS ET AL., CLIN DIAGN LAB IMMUNOL., vol. 4, 1997, pages 202 - 207 |
| WALKER, G. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 392 - 396 |
| WATSON, J. D. ET AL.: "Molecular Biology of the Gene, 4th ed.", 1987, BENJAMIN/CUMMINGS |
| WEBER, L., CURR. OPIN. CHEM. BIOL., vol. 4, 2000, pages 295 - 302 |
| WEISS, SCIENCE, vol. 254, 1991, pages 1292 |
| WELCH ET AL., PLOS ONE, vol. 4, no. 9, pages E7007 |
| WENGEL ET AL., CHEMICAL COMMUNICATIONS, 1998, pages 455 |
| WIGLER ET AL., CELL, vol. 11, 1977, pages 223 - 232 |
| WIGLER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 77, 1980, pages 3567 - 70 |
| WIGLEY ET AL., NATURE BIOTECHNOLOGY, vol. 19, 2001, pages 131 - 136 |
| WILDT ET AL., NATURE REVIEWS MICROBIOL., vol. 3, 2005, pages 119 - 28 |
| WILSON AND CZARNIK: "Combinatorial Chemistry", 1997, JOHN WILEY & SONS INC., article "Chapter 11", pages: 235 |
| WINTER ET AL., NATURE, vol. 349, 1991, pages 293 - 299 |
| WINTER ET AL., RESULTS PROBL. CELL DIFFER., vol. 77, 1991, pages 85 - 105 |
| WOJCIK ET AL., NAT STRUCT MOL BIOL., 2010 |
| XING ET AL., RNA, vol. 14, 2008, pages 1470 - 1479 |
| YAZAKI; WU: "Methods in Molecular Biology", vol. 248, 2003, HUMANA PRESS, pages: 255 - 268 |
| YOUNG; DAVIS, PNAS, vol. 80, 1983, pages 1194 |
| YU ET AL., SCIENCE, vol. 322, 2008, pages 10 - 110 |
| ZHANG ET AL., GENOME RESEARCH., vol. 17, 2007, pages 503 - 509 |
| ZUBAY, G.: "Biochemistry, 3rd ed.", 1993, WM.C. BROWN PUBLISHERS |
| ZUKER M., NUCL. ACID RES, vol. 31, no. 13, 2003, pages 3406 - 3415 |
Cited By (62)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9540629B2 (en) | 2010-04-26 | 2017-01-10 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of Cysteinyl-tRNA synthetase |
| US10717786B2 (en) | 2010-04-26 | 2020-07-21 | aTye Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of Cysteinyl-tRNA synthetase |
| US8980253B2 (en) | 2010-04-26 | 2015-03-17 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of cysteinyl-tRNA synthetase |
| US10030077B2 (en) | 2010-04-26 | 2018-07-24 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of cysteinyl-tRNA synthetase |
| US10150958B2 (en) | 2010-04-27 | 2018-12-11 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of threonyl-tRNA synthetases |
| US8961960B2 (en) | 2010-04-27 | 2015-02-24 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of isoleucyl tRNA synthetases |
| US9580706B2 (en) | 2010-04-27 | 2017-02-28 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of threonyl-tRNA synthetases |
| US10563192B2 (en) | 2010-04-27 | 2020-02-18 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of threonyl-tRNA synthetases |
| US9528103B2 (en) | 2010-04-27 | 2016-12-27 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of isoleucyl tRNA synthetases |
| US8986681B2 (en) | 2010-04-27 | 2015-03-24 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of threonyl-tRNA synthetases |
| US9896515B2 (en) | 2010-04-27 | 2018-02-20 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of isoleucyl tRNA synthetases |
| US9320782B2 (en) | 2010-04-28 | 2016-04-26 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of alanyl tRNA synthetases |
| US8993723B2 (en) | 2010-04-28 | 2015-03-31 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of alanyl-tRNA synthetases |
| US8986680B2 (en) | 2010-04-29 | 2015-03-24 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of Asparaginyl tRNA synthetases |
| US10189911B2 (en) | 2010-04-29 | 2019-01-29 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of Valyl-tRNA synthetases |
| US9068177B2 (en) | 2010-04-29 | 2015-06-30 | Atyr Pharma, Inc | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of glutaminyl-tRNA synthetases |
| US9623093B2 (en) | 2010-04-29 | 2017-04-18 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of asparaginyl tRNA synthetases |
| US9556425B2 (en) | 2010-04-29 | 2017-01-31 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of Valyl-tRNA synthetases |
| US10179906B2 (en) | 2010-05-03 | 2019-01-15 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of phenylalanyl-alpha-tRNA synthetases |
| US9034321B2 (en) | 2010-05-03 | 2015-05-19 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of phenylalanyl-alpha-tRNA synthetases |
| US9593322B2 (en) | 2010-05-03 | 2017-03-14 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of arginyl-trna synthetases |
| US9340780B2 (en) | 2010-05-03 | 2016-05-17 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of seryl-tRNA synthetases |
| US8961961B2 (en) | 2010-05-03 | 2015-02-24 | a Tyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related protein fragments of arginyl-tRNA synthetases |
| US8946157B2 (en) | 2010-05-03 | 2015-02-03 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of seryl-tRNA synthetases |
| US9422538B2 (en) | 2010-05-03 | 2016-08-23 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of methionyl-tRNA synthetasis |
| US9574187B2 (en) | 2010-05-04 | 2017-02-21 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of glutamyl-prolyl-tRNA synthetases |
| US10160814B2 (en) | 2010-05-04 | 2018-12-25 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of glutamyl-prolyl-tRNA synthetases |
| US9062302B2 (en) | 2010-05-04 | 2015-06-23 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of p38 multi-tRNA synthetase complex |
| US9062301B2 (en) | 2010-05-04 | 2015-06-23 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of glutamyl-prolyl-tRNA synthetases |
| US9687533B2 (en) | 2010-05-14 | 2017-06-27 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of phenylalanyl-beta-tRNA synthetases |
| US8945541B2 (en) | 2010-05-14 | 2015-02-03 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of phenylalanyl-beta-tRNA synthetases |
| US10220080B2 (en) | 2010-05-14 | 2019-03-05 | aTyr Pharam, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of phenylalanyl-beta-tRNA synthetases |
| US9034598B2 (en) | 2010-05-17 | 2015-05-19 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of leucyl-tRNA synthetases |
| US10179908B2 (en) | 2010-05-17 | 2019-01-15 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of leucyl-tRNA synthetases |
| US9790482B2 (en) | 2010-05-17 | 2017-10-17 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of leucyl-tRNA synthetases |
| US9347053B2 (en) | 2010-05-27 | 2016-05-24 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of glutaminyl-tRNA synthetases |
| US8962560B2 (en) | 2010-06-01 | 2015-02-24 | Atyr Pharma Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of Lysyl-tRNA synthetases |
| US9322009B2 (en) | 2010-06-01 | 2016-04-26 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of Lysyl-tRNA synthetases |
| US10196628B2 (en) | 2010-07-12 | 2019-02-05 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of histidyl-tRNA synthetases |
| US9637730B2 (en) | 2010-07-12 | 2017-05-02 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of histidyl-tRNA synthetases |
| US9796972B2 (en) | 2010-07-12 | 2017-10-24 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of glycyl-tRNA synthetases |
| US10196629B2 (en) | 2010-07-12 | 2019-02-05 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of glycyl-tRNA synthetases |
| US8999321B2 (en) | 2010-07-12 | 2015-04-07 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of glycyl-tRNA synthetases |
| US9315794B2 (en) | 2010-07-12 | 2016-04-19 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of aspartyl-tRNA synthetases |
| US8969301B2 (en) | 2010-07-12 | 2015-03-03 | Atyr Pharma Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of aspartyl-tRNA synthetases |
| US10669533B2 (en) | 2010-07-12 | 2020-06-02 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of Histidyl-tRNA synthetases |
| US9422539B2 (en) | 2010-07-12 | 2016-08-23 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of histidyl-tRNA synthetases |
| US9029506B2 (en) | 2010-08-25 | 2015-05-12 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of tyrosyl-tRNA synthetases |
| US9428743B2 (en) | 2010-08-25 | 2016-08-30 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of tyrosyl-trna synthetases |
| US9399770B2 (en) | 2010-10-06 | 2016-07-26 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of tryptophanyl-tRNA synthetases |
| US10563191B2 (en) | 2010-10-06 | 2020-02-18 | Atyr Pharma, Inc. | Innovative discovery of therapeutic, diagnostic, and antibody compositions related protein fragments of tryptophanyl tRNA synthetases |
| US9714419B2 (en) | 2011-08-09 | 2017-07-25 | Atyr Pharma, Inc. | PEGylated tyrosyl-tRNA synthetase polypeptides |
| US9822353B2 (en) | 2011-12-06 | 2017-11-21 | Atyr Pharma, Inc. | PEGylated aspartyl-tRNA synthetase polypeptides |
| US9816084B2 (en) | 2011-12-06 | 2017-11-14 | Atyr Pharma, Inc. | Aspartyl-tRNA synthetases |
| US9688978B2 (en) | 2011-12-29 | 2017-06-27 | Atyr Pharma, Inc. | Aspartyl-tRNA synthetase-Fc conjugates |
| US10093915B2 (en) | 2013-03-15 | 2018-10-09 | Atyr Pharma Inc. | Histidyl-tRNA synthetase-Fc conjugates |
| US10472618B2 (en) | 2013-03-15 | 2019-11-12 | Atyr Pharma, Inc. | Histidyl-tRNA synthetase-Fc conjugates |
| US10711260B2 (en) | 2013-03-15 | 2020-07-14 | Atyr Pharma, Inc. | Histidyl-tRNA synthetase-Fc conjugates |
| US9587235B2 (en) | 2013-03-15 | 2017-03-07 | Atyr Pharma, Inc. | Histidyl-tRNA synthetase-Fc conjugates |
| US11072787B2 (en) | 2013-03-15 | 2021-07-27 | Atyr Pharma Inc. | Histidyl-tRNA synthetase-Fc conjugates |
| US12492392B2 (en) | 2013-03-15 | 2025-12-09 | Atyr Pharma, Inc. | Histidyl-tRNA synthetase-Fc conjugates and therapeutics using the same |
| US11767520B2 (en) | 2017-04-20 | 2023-09-26 | Atyr Pharma, Inc. | Compositions and methods for treating lung inflammation |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2011143482A3 (en) | 2012-04-05 |
| EP2568996A4 (en) | 2013-11-20 |
| EP2568996A2 (en) | 2013-03-20 |
| JP2016000060A (ja) | 2016-01-07 |
| US20180008683A1 (en) | 2018-01-11 |
| CN103200953B (zh) | 2017-02-15 |
| JP2013534807A (ja) | 2013-09-09 |
| US8945541B2 (en) | 2015-02-03 |
| US20150231214A1 (en) | 2015-08-20 |
| US10220080B2 (en) | 2019-03-05 |
| CN103200953A (zh) | 2013-07-10 |
| CA2799197C (en) | 2019-10-29 |
| US20130202575A1 (en) | 2013-08-08 |
| JP6396656B2 (ja) | 2018-09-26 |
| US9687533B2 (en) | 2017-06-27 |
| CA2799197A1 (en) | 2011-11-17 |
| JP2017165771A (ja) | 2017-09-21 |
| EP2568996B1 (en) | 2017-10-04 |
| AU2011252990B2 (en) | 2017-04-20 |
| AU2011252990A1 (en) | 2012-12-20 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CA2797977C (en) | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of phenylalanyl-alpha-trna synthetases | |
| CA2797277C (en) | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of arginyl-trna synthetases | |
| WO2011143482A2 (en) | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of phenylalanyl-beta-trna synthetases | |
| WO2012009289A2 (en) | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of aspartyl-trna synthetases | |
| WO2011139714A2 (en) | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of cysteinyl-trna synthetase | |
| EP2624857A2 (en) | Innovative discovery of therapeutic, diagnostic, and antibody compositions related protein fragments of tryptophanyl trna synthetases | |
| EP2566496A2 (en) | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of methionyl-trna synthetases | |
| WO2011139801A2 (en) | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of threonyl trna synthetases | |
| WO2011146410A2 (en) | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of leucyl-trna synthetases | |
| AU2011256366A1 (en) | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of leucyl-tRNA synthetases | |
| EP2593126A2 (en) | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of histidyl-trna synthetases | |
| AU2011248357A1 (en) | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of seryl-tRNA synthetases | |
| EP2563381A2 (en) | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of isoleucyl trna synthetases | |
| EP2563911A2 (en) | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of alanyl trna synthetases | |
| EP2575856A2 (en) | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of glutaminyl-trna synthetases | |
| EP2566492A2 (en) | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of glutamyl-prolyl-trna synthetases | |
| WO2012027611A2 (en) | INNOVATIVE DISCOVERY OF THERAPEUTIC, DIAGNOSTIC, AND ANTIBODY COMPOSITIONS RELATED TO PROTEIN FRAGMENTS OF TYROSYL-tRNA SYNTHETASES | |
| WO2011140267A2 (en) | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of p38 multi-trna synthetase complex | |
| AU2011248457A1 (en) | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of valyl tRNA synthetases | |
| EP2593125A2 (en) | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of glycyl-trna synthetases | |
| EP2571513A2 (en) | Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of leucyl-trna synthetases |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 11781304 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2013510312 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2799197 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REEP | Request for entry into the european phase |
Ref document number: 2011781304 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 10250/CHENP/2012 Country of ref document: IN Ref document number: 2011781304 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2011252990 Country of ref document: AU Date of ref document: 20110512 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 13697996 Country of ref document: US |