WO2011140114A2 - Anti-glucosaminidase passive immunization for staphylococcus aureus infections - Google Patents

Anti-glucosaminidase passive immunization for staphylococcus aureus infections Download PDF

Info

Publication number
WO2011140114A2
WO2011140114A2 PCT/US2011/035033 US2011035033W WO2011140114A2 WO 2011140114 A2 WO2011140114 A2 WO 2011140114A2 US 2011035033 W US2011035033 W US 2011035033W WO 2011140114 A2 WO2011140114 A2 WO 2011140114A2
Authority
WO
WIPO (PCT)
Prior art keywords
monoclonal antibody
seq
aureus
amino acid
administering
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2011/035033
Other languages
English (en)
French (fr)
Other versions
WO2011140114A3 (en
Inventor
Edward M. Schwarz
Mark A. Sullivan
John L. Daiss
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Rochester
Original Assignee
University of Rochester
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to AU2011248209A priority Critical patent/AU2011248209B2/en
Priority to JP2013509186A priority patent/JP6038777B2/ja
Priority to ES11778188.0T priority patent/ES2606017T3/es
Priority to US13/696,019 priority patent/US9737601B2/en
Priority to EP11778188.0A priority patent/EP2566891B1/en
Priority to CA2797121A priority patent/CA2797121C/en
Priority to EP16187268.4A priority patent/EP3150631B1/en
Application filed by University of Rochester filed Critical University of Rochester
Publication of WO2011140114A2 publication Critical patent/WO2011140114A2/en
Anticipated expiration legal-status Critical
Publication of WO2011140114A3 publication Critical patent/WO2011140114A3/en
Priority to US15/662,715 priority patent/US10179170B2/en
Priority to US16/221,442 priority patent/US10653775B2/en
Priority to US16/864,343 priority patent/US11065333B2/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/40Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum bacterial
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61FFILTERS IMPLANTABLE INTO BLOOD VESSELS; PROSTHESES; DEVICES PROVIDING PATENCY TO, OR PREVENTING COLLAPSING OF, TUBULAR STRUCTURES OF THE BODY, e.g. STENTS; ORTHOPAEDIC, NURSING OR CONTRACEPTIVE DEVICES; FOMENTATION; TREATMENT OR PROTECTION OF EYES OR EARS; BANDAGES, DRESSINGS OR ABSORBENT PADS; FIRST-AID KITS
    • A61F2/00Filters implantable into blood vessels; Prostheses, i.e. artificial substitutes or replacements for parts of the body; Appliances for connecting them with the body; Devices providing patency to, or preventing collapsing of, tubular structures of the body, e.g. stents
    • A61F2/02Prostheses implantable into the body
    • A61F2/28Bones
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61FFILTERS IMPLANTABLE INTO BLOOD VESSELS; PROSTHESES; DEVICES PROVIDING PATENCY TO, OR PREVENTING COLLAPSING OF, TUBULAR STRUCTURES OF THE BODY, e.g. STENTS; ORTHOPAEDIC, NURSING OR CONTRACEPTIVE DEVICES; FOMENTATION; TREATMENT OR PROTECTION OF EYES OR EARS; BANDAGES, DRESSINGS OR ABSORBENT PADS; FIRST-AID KITS
    • A61F2/00Filters implantable into blood vessels; Prostheses, i.e. artificial substitutes or replacements for parts of the body; Appliances for connecting them with the body; Devices providing patency to, or preventing collapsing of, tubular structures of the body, e.g. stents
    • A61F2/02Prostheses implantable into the body
    • A61F2/30Joints
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/12Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from bacteria
    • C07K16/1267Gram-positive bacteria
    • C07K16/1271Micrococcaceae (F); Staphylococcaceae (F), e.g. Staphylococcus (G)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding

Definitions

  • the present invention relates to passive immunization against
  • Staphylococcus aureus infection particularly for the prevention or treatment of osteomyelitis and for implantation of an orthopedic implant or graft.
  • Antibodies that bind specifically to S. aureus glucosaminidase and pharmaceutical compositions containing the same can be used for these purposes.
  • osteomyelitis (OM) remains a serious problem and appears to be on the rise from minimally invasive surgery (Mahomed et al,
  • a conditioning layer composed of host-derived adhesins (including fibrinogen, fibronectin, and collagen) forms on the surface of the implant and invites the adherence of free-floating bacteria derived from hematogenous seeding, including spread of infection from a contiguous area (the skin adjacent to a wound), surgical inoculation of bacteria into bone, or trauma coincident with significant disruption of the associated soft tissue bone envelope (Darouiche, "Treatment of Infections Associated With Surgical Implants," N. Engl. J. Med.
  • MSCRAMMs microbial surface components recognizing adhesive matrix molecules
  • these antibodies can also mediate S. aureus clearance by phagocytic cells.
  • S. aureus has many adhesins, such that inhibition of one or more may not be sufficient to prevent bacterial attachment.
  • bacterial clearance by phagocytic cells may be limited in avascular tissue, such that mAb may need additional anti-microbial mechanism of action to significantly reduce the in vivo planktonic growth of S. aureus and prevent the establishment of chronic OM or reinfection during revision total joint replacement surgery.
  • the present invention is directed to overcoming these and other deficiencies in the art.
  • a first aspect of the present invention is directed to a monoclonal antibody or binding portion thereof that binds specifically to a Staphylococcus aureus glucosaminidase and inhibits in vivo growth of S. aureus.
  • the monoclonal antibody or binding portion thereof binds specifically to an epitope lying wholly or partly within an R3 domain of the S. aureus glucosaminidase.
  • a second aspect of present invention relates to a cell line that expresses a monoclonal antibody or binding portion of the present invention.
  • the cell line is a hybridoma cell line.
  • the cell line is a recombinant cell line that expresses the antibody.
  • a third aspect of the present invention relates to a pharmaceutical composition that may include a carrier and one or more monoclonal antibodies or binding portions of the present invention.
  • a fourth aspect of the present invention relates to a method of treating S. aureus infection that may include administering to a patient having a 5 * . aureus infection an effective amount of a monoclonal antibody, binding portion, or pharmaceutical composition of the present invention.
  • a fifth aspect of the present invention relates to a method of treating osteomyelitis that may include administering to a patient having a 5 * . aureus bone or joint infection an effective amount of a monoclonal antibody, binding portion, or pharmaceutical composition of the present invention.
  • a sixth aspect of the present invention relates to a method of introducing an orthopedic implant into a patient that may include administering to a patient in need of an orthopedic implant an effective amount of a monoclonal antibody, binding portion, or pharmaceutical composition of the present invention, and introducing the orthopedic implant into the patient.
  • the monoclonal antibody, binding portion, or pharmaceutical composition acts as a prophylactic agent.
  • this aspect of the invention is directed to preventing OM or S. aureus reinfection during or subsequent to revision total joint replacement surgery.
  • the methods of the present invention aim to disrupt critical steps in the growth cycle of these microorganisms.
  • the present invention also relates to a passive immunization for preventing infections in patients, for example, patients undergoing total joint replacement.
  • the selected target for immunization is the glucosaminidase (Gmd) that S.
  • aureus secretes to facilitate cytokinesis, the separation of cells during mitosis (Oshida et al, "A Staphylococcus aureus Autolysin that has an N-acetylmuramoyl-L-Alanine Amidase Domain and an Endo-beta-N- acetylglucosaminidase Domain: Cloning, Sequence Analysis, and Characterization," Proc Natl Acad Sci USA 92:285-9 (1995); Oshida et al, "Expression Analysis of the Autolysin Gene (atl) of Staphylococcus aureus " Microbiol Immunol 42:655-9 (1998); Sugai et al, "Localized Perforation of the Cell Wall by a Major Autolysin: atl Gene Products and the Onset of Penicillin- induced Lysis of Staphylococcus aureus," J Bacteriol 179:2958-62 (1997); and Yamada e
  • RTQ-PCR real time quantitative-PCR
  • Gmd-His N-terminal His 6
  • the anti-Gmd antibodies can block 5 * . aureus cell division by either directly blocking cell division or by recruiting host effectors such as phagocytes or complement at a vulnerable point in the cycle of cell division.
  • Figures 1A-C show the quantification of osteolysis from implant- associated osteomyelitis.
  • a longitudinal series of X-rays from a representative mouse demonstrate the development of implant-associated osteolysis over time in this model (Figure 1A).
  • Medial views of reconstructed ⁇ (micro-computed tomography) images of representative tibiae from mice (N 5) that received a trans-tibial pin coated with S. aureus and were sacrificed on the indicated day ( Figure IB).
  • Figures 2A-H show the histology of trans-tibial implant-associated OM.
  • H&E Haematoxylin and Eosin stain
  • Figures 2A-C H&E (Haematoxylin and Eosin stain)
  • Figures 2A-C TRAP (Tartrate-Resistant Acid Phosphatase)
  • Figures 2D-F Gram stained sections of histology at the pin site (*) adjacent to the tibial cortex (#), 9 days after implantation of a sterile pin
  • Figures 2B, 2C, 2E, 2F, and 2H Figures 2B, 2C, 2E, 2F, and 2H.
  • Figures 3A-C show the inverse correlation between bacterial load and humoral immunity against 5 * . aureus antigens during the establishment of chronic osteomyelitis.
  • a time course study was performed in which mice were given an infected transcortical pin containing lxlO 6 CFU of S. aureus in their tibia and sacrificed on the indicated day. At sacrifice, DNA was purified from the infected tibia and RTQ-PCR was performed to determine the Ct values for 5 * . aureus nuc. Using a standard curve shown, this number was converted to the recoverable nuc genes per tibia.
  • serum was taken from each mouse in the group that was sacrificed on day 18, before infection (day 0) and on days 4, 7, 1 1, 14 and 18 after infection. This serum was used as the primary antibody in Western blots of total 5 * .
  • Figures 4A-C show that glucosaminidase of S. aureus autolysin is the 56 kDa immuno-dominant antigen.
  • subtractive immunoblot analysis of 2D-SDS- PAGE of whole cell extract was performed with pre-immune and day 14 immune sera.
  • Three 2D gels were run after isoelectric focusing (pH 4.0-10.0). The first was Coomassie blue-stained (Figure 4A).
  • the others were Western blotted with either day 0 ( Figure 4B) or day 14 sera ( Figure 4C).
  • the immune serum detected a specific polypeptide (-53 kDa; pH 9: arrow).
  • the 53kDa spot was removed from the Coomassie gel, digested with trypsin, and analyzed by MALDI, which resolved 70 individual peptide peaks.
  • the amino acid sequence from every peptide was a 100% match with the known sequence of the glucosaminidase of S. aureus autolysin, which is 53.6 kDa and has a pi of 9.66.
  • Figures 5A-B show bioluminescent imaging (BLI) quantification of bacterial growth during the establishment of chronic osteomyelitis.
  • Figure 5A shows BLI levels (p/sec/cm 2 /sr) at the site of infection and was assessed longitudinally in mice that received a sterile trans-tibial pin (Uninfected), or a pin coated with Xen 29 S. aureus (Infected) and were imaged on the indicated day.
  • the circle in the top left image highlights the 1.5 cm diameter region of interest (ROI) that was assessed for BLI in each mouse at each time point.
  • ROI region of interest
  • Figures 6A-B show that functional anti-Gmd ELISA demonstrated the efficacy of recombinant Gmd vaccine.
  • Figure 6A shows serum ELISA in which His- Gmd was used as the antigen to assay anti-Gmd antibody titers in mouse serum which was generated using a known high titer anti-sera from 5 * . aureus infected mice.
  • serial dilution factor (X axis) and absorbance reading at 450nm (Y axis) of the serial 2 -fold diluted sera samples are plotted in the XY plane using GraphPad Prism 4 software.
  • the functional titer (1 :3623) is extrapolated from the inflection point (arrow) of the dilution curve.
  • Figure 6B shows the ELISA used to determine the titers of anti-Gmd antibodies in the sera of mice pre-immunization, pre-boost and pre- challenge with the indicated vaccine. Note that only mice immunized with the His- Gmd vaccine obtained high titers.
  • FIGS 7A-C show that recombinant His-Gmd vaccine protects mice from implant-associated OM.
  • An image of the BLI from a representative mouse in Group 1 & 3 is shown ( Figure 7 A), and the mean +/- SD is presented to show the significant reduction BLI (Figure 7B). This translated into a significant decrease in amplifiable nuc genes (mean +/- SD) on day 1 1 ( Figure 7C).
  • Figure 8 shows the in vitro growth of S. aureus Xen29 in the presence of anti-Gmd monoclonal antibodies (anti-Gmd mAb).
  • anti-Gmd mAb anti-Gmd monoclonal antibodies
  • 100 cfu of Xen29 from a culture in log-phase growth were incubated at 37°C with anti-Gmd monoclonal antibodies 1C1 1, 1E12, 2D11, and 3A8, 50 ⁇ g/mL in LB medium. Growth was monitored by light scattering at both 670 and 490 nm at the indicated intervals.
  • MOPC21 is the isotype-matched control antibody.
  • Figure 9 shows the dose-dependent effect of anti-Gmd mAb 1C1 1 on in vitro S. aureus growth. 100 cfu of Xen29 from a culture in log-phase growth were incubated at 37°C with a range of concentrations of anti-Gmd mAb 1C11 in LB medium. Growth was monitored by light scattering at both 670 and 490 nm at the indicated intervals.
  • Figure 10 shows the effect of Control mAb MOPC21 on in vitro S. aureus growth. 100 cfu of Xen29 from a culture in log-phase growth were incubated at 37°C with a range of concentrations of isoty e-matched control monoclonal antibody MOPC21 in LB medium. Growth was monitored by light scattering at both 670 and 490 nm at the indicated intervals. Note that the slight elevation of the 50 ⁇ g/mL line is due to the use of outside wells on the microtiter plate where
  • Figure 11 shows a ClustalW amino acid sequence alignment of the VH sequences from hybridomas 2D1 1, 3H6, 1E12 and 3A8.
  • Highlighted sequences indicate the putative complementarity determining regions (CDR) in 2D11.
  • a consensus sequence (SEQ ID NO: 31) is derived from these hybridoma sequences.
  • a consensus sequence (SEQ ID NO: 32) is derived from these two hybridoma sequences.
  • a consensus sequence (SEQ ID NO: 6) is derived from these five hybridoma sequences.
  • Figures 14A-B show a ClustalW amino acid sequence alignment of the
  • FIG. 14A shows VL alignment of hybridomas 1E12, 2D1 1, 3A8, 3H6, and 1C11
  • 1E12 V L SEQ ID NO: 10
  • 2D11 V L SEQ ID NO: 8
  • 3A8 V L SEQ ID NO: 1 1
  • 3H6 V L SEQ ID NO: 9
  • 1C11 V L SEQ ID NO: 12).
  • a consensus sequence (SEQ ID NO: 13) is derived from these five hybridoma sequences.
  • a consensus sequence (SEQ ID NO: 33) is derived from these four hybridoma sequences.
  • a consensus sequence (SEQ ID NO: 7) is derived from these two hybridoma sequences.
  • a consensus sequence (SEQ ID NO: 14) is derived from these two hybridoma sequences.
  • Figures 17A illustrates an alignment of the 1C1 1 V H domain (SEQ ID NO:
  • FIG. 17 illustrates an alignment of the 1C11 V L domain (SEQ ID NO: 12) with a homologous amino acid sequence (SEQ ID NO: 20) encoded by the human gene IGVK6D-21 (see Genbank Accession AAA58917 and M29469, each of which is hereby incorporated by reference in its entirety).
  • a consensus sequence for the V L homologs (SEQ ID NO: 35) is shown.
  • Figure 18 shows the inhibition of S. aureus His-Gmd (Gmd) and hen egg lysozyme (HEL) by the five anti-Gmd monoclonal antibodies with MOPC21 as an isotype-matched negative control.
  • concentration of the antibody in ⁇ g/mL is listed on the x-axis; the inhibition of enzyme activity in percentage (%) is listed on the Y-axis.
  • All five anti-Gmd mAbs (1C1 1, 1E12, 2D1 1, 3A8, and 3H6) inhibit Gmd activity, but have no effect on HEL activity, and MOPC21 (negative control) does not inhibit either enzyme.
  • Figure 19 shows inhibition of native Gmd by the five anti-His-Gmd mAbs 1 CI 1, 1E12, 2D11, 3A8, and 3H6. Each antibody was added at a concentration of 100 ⁇ g/mL. All five are potent inhibitors and inhibit the native enzyme to about the same degree as they inhibit the recombinant Gmd-His.
  • the isotype-matched (IgGl) antibody control MOPC21 had no effect on Gmd enzymatic activity.
  • Figures 20A-D are scanning electron miscroscopy (SEM) images of S. aureus grown in the absence ( Figures 20A-B) or presence of anti-Gmd monoclonal antibodies of the present invention.
  • Figure 20C shows the effects of 50 ⁇ g/ml mAb 1E12 on Xen29 S. aureus
  • Figure 20D shows the effects of 50 ⁇ g/ml mAb 1C11 on Xen29 S. aureus.
  • Micrographs of representative fields were obtained at 50,000x (A&C), 2,000x (B) and 4,000x (D). Arrows identify sites where lysis has occurred, and document the surprising and unexpected effects of the present invention, as complement and immune effector cell independent lytic activity of an anti-S. aureus mAb has yet to be documented in the literature.
  • FIGs 21A-C show that passive immunization with monoclonal antibody 3A8 inhibits S. aureus growth in vivo and protects mice from implant- associated osteomyelitis.
  • the mice were imaged to assess bioluminescence on days 0, 3, 5, 7, 1 1, and 14, and images with the BLI heat map from a representative animal in each group are shown in Figure 21 A.
  • X-rays from a representative animal in each group obtained on day 14 are shown to illustrate the osteolytic lesion (arrow) in the placebo mouse, which was not present in the anti-Gmd treated animals ( Figure 21 C).
  • FIGs 22A-C show that passive immunization with monoclonal antibody 1C1 1 inhibits S. aureus growth in vivo and protects mice from implant- associated osteomyelitis.
  • the mice were imaged to assess bioluminescence on days 0, 3, 5, 7, 10, and 14, and images with the BLI heat map from a representative animal in each group are shown in ( Figure 22A).
  • the BLI values on day 3 for each mouse in the study are shown with the mean for each group ( Figure 22B).
  • X-rays from a representative animal in each group obtained on day 14 are shown to illustrate the osteolytic lesion (arrow) in the placebo mouse, which was not present in the anti-Gmd treated mouse ( Figure 22C).
  • Figure 23 is a graph comparing the anti-Gmd inhibitory activity of mouse monoclonal 1C11 with the humanized chimeric monoclonal derived from 1 C1 1.
  • the human mouse chimeric IgGl of 1C1 1 (hlCl l) retains the ability to inhibit His-Gmd.
  • the percent inhibition of His-Gmd activity on the Y-axis is displayed as a function of dilution of the antibody preparation on the X-axis.
  • the mouse 1C1 1 concentration was 10 ⁇ g/mL; the concentration for chimeric hlCl 1 was not known for the assay shown.
  • the present invention relates to a monoclonal antibody that binds specifically to a Staphylococcus aureus glucosaminidase and inhibits in vivo growth of S. aureus.
  • the monoclonal antibody of the present invention can be such that it targets S. aureus that is methicillin resistant.
  • antibody is meant to include
  • the monoclonal antibodies of the present invention may exist in or can be isolated in a variety of forms including, for example, substantially pure monoclonal antibodies, antibody fragments or binding portions, chimeric antibodies, and humanized antibodies (Ed Harlow and David Lane, USING ANTIBODIES: A LABORATORY
  • the monoclonal antibodies of the present invention are characterized by specificity for binding to S. aureus glucosaminidase or fragments thereof.
  • the antibody specifically binds to an immuno-dominant epitope in the glucosaminidase (Gmd) sub-unit of S. aureus autolysin (Atl).
  • Gmd glucosaminidase
  • Adl S. aureus autolysin
  • Immuno-dominant antigen is a part of the antigenic determinant that is most easily recognized by the immune system and thus exerts the most influence on the specificity of the induced antibody.
  • An "immuno-dominant epitope” refers to the epitope on an antigen that selectively provokes an immune response in a host organism to the substantial exclusion of other epitopes on that antigen.
  • the antigen likely to carry an immuno-dominant epitope can be identified by selecting antigens on the outer surface of the pathogenic organism. For example, most simple organisms, such as fungi, bacteria and viruses have one or two proteins that are exposed on the outer surface of the pathogenic organism. These outer surface proteins are most likely to carry the appropriate antigen.
  • the proteins most likely to carry an immuno-dominant epitope can be identified in a Western assay in which total protein is run on a gel against serum from an organism infected with the pathogenic organism. Bound antibodies from the serum are identified by labeled anti- antibodies, such as in one of the well-known ELISA techniques.
  • the immunodominant epitope can be identified by examining serum from a host organism infected with the pathogenic organism.
  • the serum is evaluated for its content of antibodies that bind to the identified antigens that are likely to cause an immune response in a host organism. If an immuno -dominant epitope is present in these antigens, substantially all antibodies in the serum will bind to the immuno -dominant epitope, with little binding to other epitopes present in the antigen.
  • Atl is one of the catalytically distinct peptidoglycan hydrolases in S. aureus that is required to digest the cell wall during mitosis (Baba and Schneewind, "Targeting of Muralytic Enzymes to the Cell Division Site of Gram-Positive Bacteria: Repeat Domains Direct Autolysin to the Equatorial Surface Ring of Staphylococcus aureus," EMBO. J. 17(16):4639-46 (1998), which is hereby incorporated by reference in its entirety). In addition to being an essential gene for growth, scanning electron microscopy studies have demonstrated that anti-Atl antibodies bound to S.
  • the Atl enzyme is comprised of an amidase (62kD) and
  • glucosaminidase 53kD
  • Atl precursor protein ATL and Its Processed Proteins in Staphylococcus aureus
  • cleavage process Baba and Schneewind, "Targeting of Muralytic Enzymes to the Cell Division Site of Gram-Positive Bacteria: Repeat Domains Direct Autolysin to the Equatorial Surface Ring of Staphylococcus aureus," Embo. J. 17(16):4639-46 (1998); Komatsuzawa et al, "Subcellular Localization of the Major Autolysin, ATL and Its Processed Proteins in Staphylococcus aureus," Microbiol Immunol.
  • Staphylococcus aureus glucosaminidase contains the amino acid sequence of SEQ ID NO: 36 below.
  • underlined residues correspond to residues 783 to 931 of the encoded autolysin, and represent the R3 domain.
  • the remaining C-terminal residues correspond to the catalytic glucosaminidase domain.
  • the monoclonal antibody of the present invention binds to a conserved epitope of Staphylococcus aureus glucosaminidase with an affinity greater than 10 "9 M.
  • epitope refers to the antigenic determinant of Staphylococcus aureus glucosaminidase that is recognized by the monoclonal antibody.
  • the epitope recognized by the antibody of the present invention may be a linear epitope, i.e. the primary structure of the amino acid sequence of glucosaminidase.
  • the epitope recognized by the antibody of the present invention may be a non-linear or conformational epitope, i.e. the tertiary structure of glucosaminidase.
  • the monoclonal antibodies may bind specifically to the catalytic domain of the Gmd. In other embodiments, the monoclonal antibodies may bind specifically to the R3 domain.
  • Epitopes that are bound by five of the monoclonal antibodies identified herein lie wholly or at least partially within the R3 domain.
  • an epitope bound by mAb 3A8 lies within the region containing residues 776-842;
  • an epitope bound by mAb 1C11 lies within the region containing residues 842-873;
  • an epitope(s) bound by mAbs 2D11 and IE 12 are the same or different and lie within the region containing residues 842-948;
  • an epitope bound by mAb 3H6 lies within the region containing residues 907-948.
  • the monoclonal antibody of the present invention possesses S. aureus Gmd inhibitory activity, whereby the monoclonal antibody inhibits the activity of Gmd by at least 20%, at least 30%, at least 40% or at least 50%. In other embodiments, the monoclonal antibody inhibits the activity of Gmd by at least 60%, at least 70%, or at least 80%.
  • Five monoclonal antibodies described herein possess anti-Gmd inhibitory activity of about 70 to about 80 percent.
  • the antibodies of the present invention would bind a purported cell wall binding domain, the R3 domain, rather than a catalytic domain to inhibit enzymatic activity. Without being bound by theory, it is believed that the binding of the antibodies of the present invention to the R3 domain may trigger a conformational or electrostatic change in the catalytic domain of glucosaminidase.
  • Inhibition of Gmd activity can be measured in vitro.
  • Gmd is first pre-titered to determine the concentration that will yield about a 50% reduction in A490 in 60 minutes. Then 50 ⁇ of antibody diluted in PBST is added to each well of a 96-well microtiter plate followed by 50 ⁇ of appropriately diluted Gmd, and the mixture allowed to incubate for 5 or more minutes, and finally 100 of 0.15% mL is added and the initial A490 measured. The plate is incubated at 37 °C and the A490 measured at 30 and 60 minutes. Percent inhibition is calculated as 100 ⁇ (1-( ⁇ 6 ⁇ 49 ⁇ inhibitor/A6oA49o no inhibitor control)).
  • the monoclonal antibody of the present invention possesses an ability to cause clustering or clumping of S. aureus, cell- independent lysis of S. aureus, or both.
  • antibodies that possess an ability to cause clumping of S aureus include, without limitation, monoclonal antibodies 1 CI 1, 1E12, 2D11, 3A8, and 3H6.
  • monoclonal antibody 1C1 1 One example of a lytic antibody is monoclonal antibody 1C1 1. This antibody binds to a unique epitope present in the R3 domain, displays between about 70 to about 80 percent Gmd inhibitory activity, and promotes cell- independent lysis of S. aureus.
  • the monoclonal antibodies of the present invention also inhibit in vivo growth of S. aureus.
  • Inhibition of in vivo growth of S. aureus can be measured according to a number of suitable standards.
  • the in vivo growth of S. aureus can be assessed according to a bioluminescence assay of the type described in the accompanying Examples. Specifically, bioluminescent S. aureus (Xen 29; ATCC 12600) (Francis et al, "Monitoring Bioluminescent Staphylococcus aureus Infections in Living Mice Using a Novel luxABCDE Construct," Infect.
  • mice can be imaged to assess bioluminescence on various days (e.g., 0, 3, 5, 7, 11, and 14) and a comparison of BLI images can be compared to assess whether the antibody inhibits in vivo growth of S. aureus relative to the saline control.
  • the monoclonal antibody of the present invention comprises a V H domain comprising one of the following amino acid sequences:
  • the monoclonal antibody of the present invention comprises a VL domain comprising one of the following amino acid sequences:
  • DIVITQSPAIMSASLGERVTMTCTASSSVSSSYLHWYQQKPGSSPKXWI YSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCHQYHRSPW TFGGGT (SEQ ID NO: 10); or DIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKLLI YWTSTRHTGVPDRFTGSGSGTDFTLTISSVQAKDLALYYCQQHYTTPY TFGGGTKLEIK, (SEQ ID NO: 11); or
  • Antibodies of the present invention may also be synthetic antibodies.
  • a synthetic antibody is an antibody which is generated using recombinant DNA technology, such as, for example, an antibody expressed by a bacteriophage.
  • the synthetic antibody is generated by the synthesis of a DNA molecule encoding and expressing the antibody of the invention or the synthesis of an amino acid specifying the antibody, where the DNA or amino acid sequence has been obtained using synthetic DNA or amino acid sequence technology which is available and well known in the art.
  • the monoclonal antibody of the present invention can be humanized.
  • Humanized antibodies are antibodies that contain minimal sequences from non-human (e.g. murine) antibodies within the variable regions. Such antibodies are used therapeutically to reduce antigenicity and human anti-mouse antibody responses when administered to a human subject. In practice, humanized antibodies are typically human antibodies with minimum to no non-human sequences.
  • a human antibody is an antibody produced by a human or an antibody having an amino acid sequence corresponding to an antibody produced by a human.
  • An antibody can be humanized by substituting the complementarity determining region (CDR) of a human antibody with that of a non-human antibody (e.g. mouse, rat, rabbit, hamster, etc.) having the desired specificity, affinity, and capability (Jones et al, "Replacing the Complementarity-Determining Regions in a Human Antibody With Those From a Mouse," Nature 321 :522-525 (1986);
  • CDR complementarity determining region
  • the humanized antibody can be further modified by the substitution of additional residues either in the Fv framework region and/or within the replaced non-human residues to refine and optimize antibody specificity, affinity, and/or capability.
  • Humanized antibodies can be produced using various techniques known in the art. Immortalized human B lymphocytes immunized in vitro or isolated from an immunized individual that produce an antibody directed against a target antigen can be generated (see e.g. Reisfeld et al, MONOCLONAL ANTIBODIES AND CANCER THERAP 77 (Alan R. Liss ed., 1985) and U.S. Patent No. 5,750,373 to Garrard, which are hereby incorporated by reference in their entirety).
  • the humanized antibody can be selected from a phage library, where that phage library expresses human antibodies (Vaughan et al, "Human Antibodies with Sub- Nanomolar Affinities Isolated from a Large Non-immunized Phage Display Library," Nature Biotechnology, 14:309-314 (1996); Sheets et al, "Efficient Construction of a Large Nonimmune Phage Antibody Library: The Production of High-Affinity Human Single-Chain Antibodies to Protein Antigens," Proc. Nat'l. Acad. Sci. U.S.A.
  • Humanized antibodies can also be made in transgenic mice containing human immunoglobulin loci that are capable upon immunization of producing the full repertoire of human antibodies in the absence of endogenous immunoglobulin production. This approach is described in U.S. Patent Nos. 5,545,807 to Surani et al; 5,545,806 to Lonberg et al; 5,569,825 to Lonberg et al; 5,625, 126 to Lonberg et al; 5,633,425 to Lonberg et al; and 5,661,016 to Lonberg et al, which are hereby incorporated by reference in their entirety.
  • a suitable D region will need to be spliced into the missing domain region. Any one of several candidate D regions can be used (e.g., IGHD5-5, 18 or 12*01).
  • binding portions of such antibodies include the monovalent Fab fragments, Fv fragments (e.g., single-chain antibody, scFv), and single variable VH and VL domains, and the bivalent F(ab')2 fragments, Bis-scFv, diabodies, triabodies, minibodies, etc.
  • antibody fragments can be made by conventional procedures, such as proteolytic fragmentation procedures, as described in James Goding, MONOCLONAL ANTIBODIES PRINCIPLES AND PRACTICE 98-118 (Academic Press, 1983) and Ed Harlow and David Lane, ANTIBODIES: A LABORATORY MANUAL (Cold Spring Harbor Laboratory, 1988); Houston et al, "Protein Engineering of Antibody Binding Sites: Recovery of Specific Activity in an Anti-Digoxin Single- Chain Fv Analogue Produced in Escherichia coli," Proc. Natl. Acad. Sci.
  • Antibody mimics are also suitable for use in accordance with the present invention.
  • a number of antibody mimics are known in the art including, without limitation, those known as monobodies, which are derived from the tenth human fibronectin type III domain ( 10 Fn3) (Koide et al., "The Fibronectin Type III Domain as a Scaffold for Novel Binding Proteins," J. Mol. Biol. 284:1 141-1 151 (1998); Koide et al, "Probing Protein Conformational Changes in Living Cells by Using Designer Binding Proteins: Application to the Estrogen Receptor," Proc. Natl. Acad. Sci.
  • the CDR sequences of the VH and/or VL chains can be grafted into the variable loop regions of these antibody mimics (see Figures 1 1 and 17 for putative CDR domains).
  • the grafting can involve a deletion of at least two amino acid residues up to substantially all but one amino acid residue appearing in a particular loop region along with the substitution of the CDR sequence.
  • Insertions can be, for example, an insertion of the CDR domain at one or more locations of a particular loop region.
  • the antibody mimics of the present invention preferably possess an amino acid sequence which is at least 50 % homologous to the VH and/or VL chains sequences disclosed in the present application.
  • the deletions, insertions, and replacements on the polypeptides can be achieved using recombinant techniques beginning with a known nucleotide sequence (see infra).
  • Methods for monoclonal antibody production may be achieved using the techniques described herein or other well-known in the art (MONOCLONAL ANTIBODIES - PRODUCTION, ENGINEERING AND CLINICAL APPLICATIONS (Mary A. Ritter and Heather M. Ladyman eds., 1995), which is hereby incorporated by reference in its entirety).
  • the process involves obtaining immune cells (lymphocytes) from the spleen of a mammal which has been previously immunized with the antigen of interest (i.e., S. aureus glucosaminidase or peptide fragments thereof).
  • the antibody-secreting lymphocytes are then fused with myeloma cells or transformed cells, which are capable of replicating indefinitely in cell culture, thereby producing an immortal, immunoglobulin-secreting cell line.
  • Fusion with mammalian myeloma cells or other fusion partners capable of replicating indefinitely in cell culture is achieved by standard and well-known techniques, for example, by using polyethylene glycol (PEG) or other fusing agents (Milstein and Kohler, "Derivation of Specific Antibody-Producing Tissue Culture and Tumor Lines by Cell Fusion," Eur. J. Immunol. 6:51 1 (1976), which is hereby incorporated by reference in its entirety).
  • PEG polyethylene glycol
  • the immortal cell line which is preferably murine, but may also be derived from cells of other mammalian species, is selected to be deficient in enzymes necessary for the utilization of certain nutrients, to be capable of rapid growth, and have good fusion capability.
  • the resulting fused cells, or hybridomas are cultured, and the resulting colonies screened for the production of the desired monoclonal antibodies. Colonies producing such antibodies are cloned, and grown either in vivo or in vitro to produce large quantities of antibody.
  • a second aspect of present invention relates to a cell line that expresses a monoclonal antibody of the present invention.
  • the monoclonal antibody of the present invention is produced by a hybridoma cell line designated as 1C1 1, 1E12, 2D1 1, 3A8, or 3H6.
  • the monoclonal antibody of the present invention (or a binding portion thereof) is produced by a recombinant cell or cell line.
  • monoclonal antibodies can be made using
  • polynucleotides encoding a monoclonal antibody are isolated from mature B-cells or hybridoma cells, for example, by RT-PCR using oligonucleotide primers that specifically amplify the genes encoding the heavy and light chains of the antibody.
  • the isolated polynucleotides encoding a monoclonal antibody are isolated from mature B-cells or hybridoma cells, for example, by RT-PCR using oligonucleotide primers that specifically amplify the genes encoding the heavy and light chains of the antibody.
  • polynucleotides encoding the heavy and light chains are then cloned into suitable expression vectors, which when transfected into host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, generate host cells that express and secrete monoclonal antibodies.
  • host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, generate host cells that express and secrete monoclonal antibodies.
  • recombinant monoclonal antibodies or fragments thereof of the desired species can be isolated from phage display libraries (McCafferty et al, "Phage Antibodies: Filamentous Phage Displaying Antibody Variable Domains," Nature 348:552-554 (1990); Clackson et al, “Making Antibody Fragments using Phage Display Libraries,” Nature 352:624-628 (1991); and Marks et al, "By-Passing Immunization. Human Antibodies from V-Gene Libraries Displayed on Phage," J. Mol. Biol. 222:581-597 (1991), which are hereby incorporated by reference in their entirety).
  • the present invention also includes a nucleic acid molecule encoding a polypeptide of the present invention.
  • the nucleic acid is DNA.
  • Examples of such DNA sequences are those that comprise a VH and/or VL encoding sequence of the present invention.
  • DNA sequence encoding for hybridoma 2D11 VH (closest germ line match: J558.18.108) has the nucleotide sequence (SEQ ID NO: 21) as follows:
  • DNA sequence encoding for hybridoma 3H6 VH has the nucleotide sequence (SEQ ID NO: 23) as follows: GAGGTGCAGCTGCAGGAGTCTGGACCTGTGCTGGTGAAGCCTGGGGCTTCAGTGAAGCTGTCC TGTAAGGCTTCTGGATACACATTCACTGACTACTTTATGAACTGGGTGAAGCAGAGCCATGGA AAGAGCCTTGAGTGGATTGGAGTTATTAATCCTTTCAACGGTGGTAATAGGTACAACCAGAAC TTCAAGGGCAAGGCCACATTGACTGTTGACAAGTCCTCCAGCACAGCCTACATGGAGCTCAAC AGCCTGACATCTGAGGACTCTGCAGTCTATTACTGTGCAAGAGGGGAC TATGACTCCCTGG TTTGATTACTGGGGCCAAGGGACTCTGGTCACTGTCTCTCTGCAGCCAAAACGACACCCATCT GTCTATCCACTGGCCCCTGGATCTGCTGCCCAAAC
  • DNA sequence encoding for hybridoma 1E12 VH (closest germ line match: 7183.46 VH7) has the nucleotide sequence (SEQ ID NO: 25) as follows:
  • DNA sequence encoding for hybridoma 3A8 VH (closest germ line match: VHJ606.4.8.2) has the nucleotide sequence (SEQ ID NO: 27) as follows:
  • DNA sequence encoding for hybridoma 1C11 VH (closest germline match: VH 9-15, DST4-C57B1-6, JH3) has the nucleotide sequence (SEQ ID NO: 29) as follows:
  • DNA sequence encoding for the 2D1 1 VL (closest germ line match: at4) has the nucleotide sequence (SEQ ID NO: 22) as follows:
  • JK1 has the nucleotide sequence (SEQ ID NO: 24) as follows:
  • DNA sequence encoding for the 1E12 VL (closest germ line match: ai4) has the nucleotide sequence (SEQ ID NO: 26) as follows:
  • JK2 has the nucleotide sequence (SEQ ID NO: 28) as follows:
  • JK5 has the nucleotide sequence (SEQ ID NO: 30) as follows:
  • Still a further aspect of the present invention is a DNA construct comprising a DNA molecule that encodes an antibody or binding portion of the present invention, a promoter-effective DNA molecule operably coupled 5' of the DNA molecule, and a transcription termination DNA molecule operably coupled 3 ' of the DNA molecule.
  • the present invention also encompasses an expression vector into which the DNA construct of the present invention is inserted.
  • a synthetic gene for the polypeptides of the present invention can be designed such that it includes convenient restriction sites for ease of mutagenesis and uses specific codons for high- level protein expression (Gribskov et al, "The Codon Preference Plot: Graphic Analysis of Protein Coding Sequences and Prediction of Gene Expression," Nuc. Acids. Res. 12:539-549 (1984), which is hereby incorporated by reference in its entirety).
  • the gene may be assembled as follows: first the gene sequence can be divided into parts with boundaries at designed restriction sites; for each part, a pair of oligonucleotides that code opposite strands and have complementary overlaps of about 15 bases can be synthesized; the two oligonucleotides can be annealed and single strand regions can be filled in using the Klenow fragment of DNA polymerase; the double-stranded oligonucleotide can be cloned into a vector, such as, the pET3a vector (Novagen) using restriction enzyme sites at the termini of the fragment and its sequence can be confirmed by a DNA sequencer; and these steps can be repeated for each of the parts to obtain the whole gene.
  • a vector such as, the pET3a vector (Novagen) using restriction enzyme sites at the termini of the fragment and its sequence can be confirmed by a DNA sequencer; and these steps can be repeated for each of the parts to obtain the whole gene.
  • Desired mutations can be introduced to the polypeptides sequence of the present invention using either cassette mutagenesis, oligonucleotide site-directed mutagenesis techniques (Deng & Nickoloff, "Site-Directed Mutagenesis of Virtually any Plasmid by Eliminating a Unique Site,” Anal. Biochem. 200:81-88 (1992), which is hereby incorporated by reference in its entirety), or Kunkel mutagenesis (Kunkel et al, “Rapid and Efficient Site-Specific Mutagenesis Without Phenotypic Selection," Proc. Natl. Acad. Set USA 82:488-492 (1985); Kunkel et al, “Rapid and Efficient Site-Specific Mutagenesis Without Phenotypic Selection," Methods Enzymol.
  • cassette mutagenesis and site-directed mutagenesis can be used to prepare specifically desired nucleotide coding sequences.
  • Cassette mutagenesis can be performed using the same protocol for gene construction described above and the double-stranded DNA fragment coding a new sequence can be cloned into a suitable expression vector.
  • Many mutations can be made by combining a newly synthesized strand (coding mutations) and an oligonucleotide used for the gene synthesis.
  • sequencing can be performed to confirm that the designed mutations (and no other mutations) were introduced by mutagenesis reactions.
  • Kunkel mutagenesis can be utilized to randomly produce a plurality of mutated polypeptide coding sequences which can be used to prepare a combinatorial library of polypeptides for screening.
  • targeted loop regions or C-terminal or N-terminal tail regions
  • NNK codon N denoting a mixture of A, T, G, C, and K denoting a mixture of G and T
  • Kunkel et al "Rapid and Efficient Site-Specific Mutagenesis Without Phenotypic Selection," Methods Enzymol. 154:367-382 (1987), which is hereby incorporated by reference in its entirety).
  • nucleic acid can be incorporated into host cells using conventional recombinant DNA technology.
  • the heterologous DNA molecule is inserted into the expression system or vector in sense orientation and correct reading frame.
  • the vector contains the necessary elements (promoters, suppressers, operators, transcription termination sequences, etc.) for the transcription and translation of the inserted protein-coding sequences.
  • a recombinant gene or DNA construct can be prepared prior to its insertion into an expression vector.
  • a promoter-effective DNA molecule can be operably coupled 5' of a DNA molecule encoding the polypeptide and a transcription termination (i.e., polyadenylation sequence) can be operably coupled 3' thereof.
  • the polynucleotides of the present invention are inserted into an expression system or vector to which the molecule is heterologous.
  • the heterologous nucleic acid molecule is inserted into the expression system or vector in proper sense (5'— >3 ') orientation relative to the promoter and any other 5 ' regulatory molecules, and correct reading frame.
  • the preparation of the nucleic acid constructs can be carried out using standard cloning methods well known in the art as described by SAMBROOK & RUSSELL, MOLECULAR CLONING: A LABORATORY MANUAL (Cold Springs Laboratory Press, 2001), which is hereby incorporated by reference in its entirety.
  • U.S. Patent No. 4,237,224 to Cohen and Boyer which is hereby incorporated by reference in its entirety, also describes the production of expression systems in the form of recombinant plasmids using restriction enzyme cleavage and ligation with DNA ligase.
  • Suitable expression vectors include those which contain replicon and control sequences that are derived from species compatible with the host cell. For example, if E. coli is used as a host cell, plasmids such as pUC19, pUC18 or pBR322 may be used. When using insect host cells, appropriate transfer vectors compatible with insect host cells include, pVL1392, pVL1393, pAcGP67 and pAcSecG2T, which incorporate a secretory signal fused to the desired protein, and pAcGHLT and pAcHLT, which contain GST and 6xHis tags (BD Biosciences, Franklin Lakes, NJ).
  • Viral vectors suitable for use in carrying out this aspect of the invention include, adenoviral vectors, adeno-associated viral vectors, vaccinia viral vectors, nodaviral vectors, and retroviral vectors.
  • Other suitable expression vectors are described in SAMBROOK AND RUSSELL, MOLECULAR CLONING: A LABORATORY MANUAL (Cold Springs Laboratory Press, 2001), which is hereby incorporated by reference in its entirety.
  • Many known techniques and protocols for manipulation of nucleic acids for example in preparation of nucleic acid constructs, mutagenesis, sequencing, introduction of DNA into cells and gene expression, and analysis of proteins, are described in detail in CURRENT PROTOCOLS IN MOLECULAR BIOLOGY (Fred M.
  • RNA transcription and messenger RNA (“mRNA”) translation control many levels of gene expression (e.g., DNA transcription and messenger RNA (“mRNA”) translation) and subsequently the amount of antibodies or antibody fragments that are produced and expressed by the host cell.
  • Transcription of DNA is dependent upon the presence of a promoter, which is a DNA sequence that directs the binding of RNA polymerase, and thereby promotes mRNA synthesis. Promoters vary in their "strength" (i.e. , their ability to promote transcription). For the purposes of expressing a cloned gene, it is desirable to use strong promoters to obtain a high level of transcription and, hence, expression.
  • any one of a number of suitable promoters may be used. For instance, when using E.
  • promoters such as the T7 phage promoter, lac promoter, trp promoter, recA promoter, ribosomal RNA promoter, the PR and PL promoters of coliphage lambda and others, including but not limited, to /acUV5, ompF, bla, Ipp, and the like, may be used to direct high levels of transcription of adjacent DNA segments. Additionally, a hybrid trp-lac JV5 (tac) promoter or other E. coli promoters produced by recombinant DNA or other synthetic DNA techniques may be used to provide for transcription of the inserted gene.
  • promoters such as the T7 phage promoter, lac promoter, trp promoter, recA promoter, ribosomal RNA promoter, the PR and PL promoters of coliphage lambda and others, including but not limited, to /acUV5, ompF, bla, Ipp, and the like, may be used to direct high levels of transcription of
  • suitable baculovirus promoters include late promoters, such as 39K protein promoter or basic protein promoter, and very late promoters, such as the plO and polyhedron promoters. In some cases it may be desirable to use transfer vectors containing multiple baculoviral promoters.
  • Common promoters suitable for directing expression in mammalian cells include, without limitation, SV40, MMTV, metallothionein- 1 , adenovirus Ela, CMV, immediate early, immunoglobulin heavy chain promoter and enhancer, and RSV-LTR.
  • the promoters can be constitutive or, alternatively, tissue-specific or inducible. In addition, in some circumstances inducible (TetOn) promoters can be used.
  • SD Shine- Dalgarno
  • the present invention also includes a host cell transformed with the
  • the host cell can be a prokaryote or a eukaryote.
  • Host cells suitable for expressing the polypeptides of the present invention include any one of the more commonly available gram negative bacteria. Suitable microorganisms include Pseudomonas aeruginosa, Escherichia coli, Salmonella gastroenteritis (typhimirium), S. typhi, S. enteriditis, Shigella flexneri, S. sonnie, S. dysenteriae, Neisseria gonorrhoeae, N. meningitides, Haemophilus influenzae, H. pleuropneumoniae, Pasteurella haemolytica, P.
  • animal cells in particular mammalian and insect cells, yeast cells, fungal cells, plant cells, or algal cells are also suitable host cells for transfection/transformation of the recombinant expression vector carrying an isolated polynucleotide molecule of the present invention.
  • Mammalian cell lines commonly used in the art include Chinese hamster ovary cells, HeLa cells, baby hamster kidney cells, COS cells, and many others.
  • Suitable insect cell lines include those susceptible to baculoviral infection, including Sf9 and Sf21 cells.
  • the transfer vector containing the polynucleotide construct of the present invention is co-transfected with baculovirus DNA, such as AcNPV, to facilitate the production of a recombinant virus.
  • the expressed antibodies, antibody fragments, or antibody mimics of the present invention can be readily purified using standard purification methods known in the art and described in PHILIP L.R. BONNER, PROTEIN PURIFICATION (Routledge 2007), which is hereby incorporated by reference in its entirety.
  • the polynucleotide(s) encoding a monoclonal antibody can further be modified using recombinant DNA technology to generate alternative antibodies.
  • the constant domains of the light and heavy chains of a mouse monoclonal antibody can be substituted for those regions of a human antibody to generate a humanized (or chimeric) antibody, as discussed above.
  • the constant domains of the light and heavy chains of a mouse monoclonal antibody can be substituted for a non-immunoglobulin polypeptide to generate a fusion antibody.
  • the constant regions are truncated or removed to generate the desired antibody fragment of a monoclonal antibody.
  • site-directed or high-density mutagenesis of the variable region can be used to optimize specificity and affinity of a monoclonal antibody.
  • a third aspect of the present invention is related to a pharmaceutical composition
  • a pharmaceutical composition comprising a carrier and one or more monoclonal antibodies or one or more binding portions thereof in accordance with the present invention.
  • This pharmaceutical composition may contain two or more antibodies or binding fragments where all antibodies or binding fragments recognize the same epitope.
  • the pharmaceutical composition may contain an antibody or binding fragment mixture where one or more antibodies or binding fragments recognize one epitope of S. aureus Gmd and one or more antibodies or binding fragments recognize a different epitope of S. aureus Gmd.
  • the mixture may contain one or more antibodies of the present invention that bind specifically to an R3 domain of Staphylococcus aureus glucosaminidase in combination with any other antibody that binds to
  • glucosaminidase such as an antibody that binds to the catalytic domain of glucosaminidase.
  • the pharmaceutical composition of the present invention further contains a pharmaceutically acceptable carrier or other pharmaceutically acceptable components as described infra
  • the pharmaceutical composition includes one or more of mAbs 1C1 1, 2D11, 3H6, 1E12, and 3A8 in a
  • the pharmaceutical composition includes two or more of mAbs 1C1 1, 2D1 1, 3H6, 1E12, and 3A8 in a pharmaceutically acceptable carrier.
  • a pharmaceutical composition containing the monoclonal antibodies of the present invention can be administered to a subject having or at risk of having Staphylococcus infection.
  • Various delivery systems are known and can be used to administer the antibodies of the present invention.
  • Methods of introduction include but are not limited to intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, and oral routes.
  • the therapeutic agent can be administered, for example by infusion or bolus injection, by absorption through epithelial or
  • mucocutaneous linings e.g., oral mucosa, rectal and intestinal mucosa, and the like
  • other biologically active agents such as chemotherapeutic agents, antibiotic agents, or other immunotherapeutic agents.
  • Administration can be systemic or local, i.e., at a site of Staph infection or directly to a surgical or implant site.
  • the pharmaceutical composition of the present invention can further comprise administering a second therapeutic agent to the patient, wherein the second therapeutic agent is an antibiotic agent or immunotherapeutic agent.
  • antibiotic agents include, without limitation, vancomycin, tobramycin, cefazolin, erythromycin, clindamycin, rifampin, gentamycin, fusidic acid, minocycline, co- trimoxazole, clindamycin, linezolid, quinupristin-dalfopristin, daptomycin, tigecycline, dalbavancin, telavancin, oritavancin, ceftobiprole, ceftaroline, iclaprim, the carbapenem CS-023/RO-4908463, and combinations thereof.
  • immunotherapeutic agents include, without limitation, tefibazumab, BSYX-A110, AurexisTM, and combinations thereof.
  • antibiotic agents and immunotherapeutic agents are intended to be non-limiting examples; thus, other antibiotic agents or immunotherapeutic agents are also contemplated.
  • Combinations or mixtures of the second therapeutic agent can also be used for the purposes of the present invention. These agents can be administered contemporaneously or as a single formulation.
  • the pharmaceutical composition typically includes one or more pharmaceutical carriers (e.g., sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like). Water is a more typical carrier when the pharmaceutical composition is administered intravenously. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions.
  • pharmaceutical carriers e.g., sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like.
  • Water is a more typical carrier when the pharmaceutical composition is administered intravenously.
  • Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions.
  • Suitable pharmaceutical excipients include, for example, starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene glycol, water, ethanol, and the like.
  • the composition if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. These compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained- release formulations and the like.
  • the composition can be formulated as a suppository, with traditional binders and carriers such as triglycerides.
  • Oral formulations can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc.
  • compositions will contain a therapeutically effective amount of the nucleic acid or protein, typically in purified form, together with a suitable amount of carrier so as to provide the form for proper administration to the patient.
  • suitable amount of carrier so as to provide the form for proper administration to the patient.
  • the formulations correspond to the mode of administration.
  • Effective doses of the compositions of the present invention, for the treatment of the above described bacterial infections vary depending upon many different factors, including mode of administration, target site, physiological state of the patient, other medications administered, and whether treatment is prophylactic or therapeutic.
  • a relatively low dosage is administered at relatively infrequent intervals over a long period of time. Some patients continue to receive treatment for the rest of their lives.
  • a relatively high dosage at relatively short intervals is sometimes required until progression of the disease is reduced or terminated, and preferably until the patient shows partial or complete amelioration of symptoms of disease. Thereafter, the patient can be administered a prophylactic regime.
  • composition(s) of the present invention can be administered prior to exposure of an individual to the bacteria and that the resulting immune response can inhibit or reduce the severity of the bacterial infection such that the bacteria can be eliminated from the individual.
  • the monoclonal antibody or the pharmaceutical composition can be administered prior to, during, and/or immediately following a surgical procedure, such as joint replacement or any surgery involving a prosthetic implant.
  • the dosage ranges from about 0.0001 to about 100 mg/kg, and more usually about 0.01 to about 5 mg/kg, of the host body weight.
  • dosages can be about 1 mg/kg body weight or about 10 mg/kg body weight, or within the range of about 1 to about 10 mg/kg.
  • An exemplary treatment regime entails administration once per every two weeks or once a month or once every 3 to 6 months.
  • two or more monoclonal antibodies with different binding specificities are administered simultaneously, in which case the dosage of each antibody administered falls within the ranges indicated.
  • Antibody is usually administered on multiple occasions. Intervals between single dosages can be daily, weekly, monthly, or yearly.
  • dosage is adjusted to achieve a plasma antibody concentration of 1-1000 ⁇ g/ml and in some methods 25-300 ⁇ g/ml.
  • antibody can be administered as a sustained release formulation, in which case less frequent administration is required. Dosage and frequency vary depending on the half-life of the antibody in the patient. In general, human antibodies show the longest half life, followed by humanized antibodies, chimeric antibodies, and nonhuman antibodies.
  • a further aspect of the invention relates to an active vaccine (e.g., pharmaceutical composition) that includes a carrier and an antigenic molecule comprising at least a fragment of the S. aureus glucosaminidase.
  • the antigenic molecule can be in the form of (i) a fusion protein that includes the glucosaminidase polypeptide and an adjuvant polypeptide or (ii) an immunogenic conjugate that includes the glucosaminidase polypeptide conjugated to another immunogenic molecule.
  • suitable fusion proteins of the present invention include those containing an adjuvant polypeptide selected from the group of flagellin, human papillomavirus (HPV) LI or L2 proteins, herpes simplex glycoprotein D (gD), complement C4 binding protein, a toll-like receptor-4 (TLR4) ligand, and IL- ⁇ ⁇ .
  • an adjuvant polypeptide selected from the group of flagellin, human papillomavirus (HPV) LI or L2 proteins, herpes simplex glycoprotein D (gD), complement C4 binding protein, a toll-like receptor-4 (TLR4) ligand, and IL- ⁇ ⁇ .
  • the fusion polypeptide or protein of the present invention can be generated using standard techniques known in the art.
  • the fusion polypeptide can be prepared by translation of an in- frame fusion of the polynucleotide sequences of the present invention and the adjuvant, i.e., a hybrid or chimeric gene.
  • the hybrid gene encoding the fusion polypeptide is inserted into an expression vector which is used to transform or transfect a host cell.
  • the polynucleotide sequence encoding the polypeptide of the present invention is inserted into an expression vector in which the polynucleotide encoding the adjuvant is already present.
  • the peptide adjuvant of the fusion protein can be fused to the N-, or preferably, to the C-terminal end of the glucosaminidase polypeptide of the present invention.
  • Fusions between the polypeptides of the present invention and the protein adjuvant may be such that the amino acid sequence of the polypeptide of the present invention is directly contiguous with the amino acid sequence of the adjuvant.
  • the polypeptide portion may be coupled to the adjuvant by way of a short linker sequence.
  • Suitable linker sequences include glycine rich linkers (e.g., GGGS2-3), serine-rich linkers (e.g., GSN), or other flexible immunoglobulin linkers as disclosed in U.S. Patent No. 5,516,637 to Huang et al, which is hereby incorporated by reference in its entirety.
  • Suitable immunogenic conjugates of the present invention include, but are not limited to, those containing an immunogenic carrier molecule covalently or non-covalently bonded to any glucosaminidase polypeptide.
  • Any suitable immunogenic carrier molecule can be used.
  • Exemplary immunogenic carrier molecules include, but are in no way limited to, bovine serum albumin, chicken egg ovalbumin, keyhole limpet hemocyanin, tetanus toxoid, diphtheria toxoid, thyroglobulin, a pneumococcal capsular polysaccharide, CRM 197, and a
  • the pharmaceutical composition in the form of an active vaccine can also include an effective amount of a separate adjuvant.
  • Suitable adjuvants for use in the present invention include, without limitation, aluminum hydroxide, aluminum phosphate, aluminum potassium sulfate, beryllium sulfate, silica, kaolin, carbon, water-in-oil emulsions, oil-in-water emulsions, muramyl dipeptide, bacterial endotoxin, lipid, Quil A, and/or non- infective Bordetella pertussis.
  • an adjuvant depends on the stability of the immunogenic formulation containing the adjuvant, the route of administration, the dosing schedule, the efficacy of the adjuvant for the species being vaccinated, and, in humans, a pharmaceutically acceptable adjuvant is one that has been approved or is approvable for human administration by pertinent regulatory bodies.
  • alum, MPL or Incomplete Freund's adjuvant (Chang et al, Advanced Drug Delivery Reviews 32: 173- 186 (1998), which is hereby incorporated by reference in its entirety) alone or optionally all combinations thereof are suitable for human administration.
  • compositions containing the immunogenic glucosaminidase polypeptides are administered to a patient susceptible to, or otherwise at risk of, the bacterial infection in an amount sufficient to eliminate or reduce the risk, lessen the severity, or delay the outset of the disease, including biochemical, histologic and/or behavioral symptoms of the disease, its complications and intermediate pathological phenotypes presented during
  • compositions containing a monoclonal antibody or binding fragment according to the present invention are administered to a patient suspected of, or already suffering from, such a disease in an amount sufficient to cure, or at least partially arrest, the symptoms of the disease (biochemical, histologic and/or behavioral), including its complications and intermediate pathological phenotypes in development of the disease.
  • An amount adequate to accomplish therapeutic or prophylactic treatment is defined as a therapeutically- or prophylactically-effective dose, which is identified supra.
  • agents are usually administered in several dosages until a sufficient response has been achieved. Typically, the response is monitored and repeated dosages are given if the response starts to wane.
  • Treatment dosages should be titrated to optimize safety and efficacy.
  • the amount of immunogen depends on whether adjuvant is also administered, with higher dosages being required in the absence of adjuvant.
  • the amount of an immunogen for administration sometimes varies from 1-500 ⁇ g per patient and more usually from 5-500 ⁇ g per injection for human administration. Occasionally, a higher dose of 1-2 mg per injection is used. Typically about 10, 20, 50, or 100 ⁇ g is used for each human injection.
  • the mass of immunogen also depends on the mass ratio of immunogenic epitope within the immunogen to the mass of immunogen as a whole. Typically, 10 "3 to 10 "5 micromoles of immunogenic epitope are used for each microgram of immunogen.
  • the timing of injections can vary significantly from once a day, to once a year, to once a decade.
  • the dosage is greater than 1 ⁇ g/patient and usually greater than 10 ⁇ g/patient if adjuvant is also administered, and greater than 10 ⁇ g/patient and usually greater than 100 ⁇ g/patient in the absence of adjuvant.
  • a typical regimen consists of an immunization followed by booster injections at time intervals, such as 6 week intervals.
  • Another regimen consists of an immunization followed by booster injections 1, 2, and 12 months later.
  • booster injections can be provided on a regular or irregular basis, as indicated by monitoring of immune response.
  • a fourth aspect the present invention relates to a method of treating an
  • S. aureus infection that includes administering to a patient having an 5 * . aureus infection an effective amount of a monoclonal antibody or binding fragment thereof or a pharmaceutical composition of the present invention.
  • the method of treating 5 * . aureus infection further comprises repeating said administering.
  • the method of treating 5 * . aureus infection can be such that the administering is carried out systemically or carried out directly to a site of the S. aureus infection.
  • the method of treating 5 * . aureus infection can be used to treat 5 * . aureus infection at sites which include, without limitation, infection of the skin, muscle, cardiac, respiratory tract, gastrointestinal tract, eye, kidney and urinary tract, and bone or joint infections.
  • this method is carried out to treat osteomyelitis by administering an effective amount of the monoclonal antibody or binding fragment thereof or the pharmaceutical composition of the present invention to a patient having an 5 * . aureus bone or joint infection.
  • Administration of these agents or compositions can be carried out using any of the routes described supra; however, administration directly to the site of the bone or joint infection is preferred.
  • a sixth aspect of the present invention relates to a method of introducing an orthopedic implant into a patient that includes administering to a patient in need of an orthopedic implant an effective amount of a monoclonal antibody, binding portion, or pharmaceutical composition of the present invention, and introducing the orthopedic implant into the patient.
  • the method of introducing an orthopedic implant includes administering to the patient in need of the orthopedic implant an effective amount of a monoclonal antibody or binding fragment or a pharmaceutical composition containing the same, directly to the site of implantation.
  • the orthopedic implant can be coated or treated with the monoclonal antibody or binding fragment or a pharmaceutical composition containing the same before, during, or immediately after implantation thereof at the implant site.
  • the orthopedic implant can be a joint prosthesis, graft or synthetic implant.
  • exemplary joint prosthetics includes, without limitation, a knee prosthetic, hip prosthetic, finger prosthetic, elbow prosthetic, shoulder prosthetic,
  • exemplary grafts or synthetic implants include, without limitation, an artificial intervertebral disk, meniscal implant, or a synthetic or allograft anterior cruciate ligament, medial collateral ligament, lateral collateral ligament, posterior cruciate ligament, Achilles tendon, and rotator cuff. Other grafts or implants can also be used.
  • the method of introducing an orthopedic implant is intended to encompass the process of installing a revision total joint replacement.
  • infection particularly Staph infection of an original joint replacement occurs
  • the only viable treatment is a revision total joint replacement.
  • the infected joint prosthesis is first removed and then the patient is treated for the underlying infection. Treatment of the infection occurs over an extended period of time (i.e. 6 months), during which time the patient is immobile (or has only limited mobility) and receives high doses of antibiotics to treat the underlying infection and optionally one or more monoclonal antibodies or binding portions, or pharmaceutical compositions of the present invention.
  • the new joint prosthesis is installed.
  • the patient is administered one or more monoclonal antibodies or binding portions, or pharmaceutical compositions of the present invention.
  • This treatment can be repeated one or more times during the post-installation period.
  • Antibiotic treatment may be administered in combination with or concurrently with the one or more monoclonal antibodies or binding portions, or pharmaceutical compositions of the present invention.
  • the methods of treatment according to the present invention can be used to treat any patient in need, however, the methods are particularly useful for immuno-compromised patients of any age, as well as patients that are older than 50 years of age.
  • Example 1 A Murine Transtibial Model of Implant-associated Osteomyelitis
  • Orthopedic implant-associated OM occurs for both intramedullary devices (i.e. joint prostheses) and transcortical implants (i.e. external fixation devices, Figure 1A). Although the infection rate of fixation devices is 2.5 times greater, and has an incidence of over 8-times that of total joint prostheses, it is not considered to be as serious because the revision surgery is much simpler (Darouiche, "Treatment of Infections Associated With Surgical Implants," N. Engl. J. Med. 350(14): 1422-9 (2004), which is hereby incorporated by reference in its entirety).
  • Figures 2A-H demonstrate that the tibial transcortical pin model contains all of the salient features of chronic OM including: sequestrum and involucrum formation, osteoclastic resorption of the cortical bone and Gram stained extracellular bacteria and biofilm that reside in the necrotic bone surrounding the implant. None of the negative controls, including heat killed S. aureus and non-pathogenic E. coli, demonstrated these features.
  • RTQ-PCR for the S. awrews-specific nuc gene can be performed using primers 5'- GCGATTGATGGTGATACGGTT -3' (SEQ ID NO: 15) and 5'- AGCCAAGCCTTGACGAACTAA -3' (SEQ ID NO: 16) that amplify a previously described 269-bp product (Hein et al, "Comparison of Different Approaches to Quantify Staphylococcus aureus Cells by Real-Time Quantitative PCR and
  • the reactions can be carried out in a final volume of 20 ⁇ consisting of 0.3 ⁇ primers, lx Sybr Green PCR Super Mix (BioRad, Hercules, CA), and 2 ⁇ of the purified tibia DNA template.
  • the samples can be assayed using a Rotor-Gene RG 3000 (Corbett Research, Sydney, AU).
  • RTQ-PCR can also be performed for the mouse ⁇ -actin gene that detects a 124-bp product using primers 5 '-AGATGTGAATCAGCAAGCAG-3 ' (SEQ ID NO: 17) and 5'-GCGCAAGTTAGGTTTTGTCA-3' (SEQ ID NO: 18).
  • primers 5 '-AGATGTGAATCAGCAAGCAG-3 ' SEQ ID NO: 17
  • 5'-GCGCAAGTTAGGTTTTGTCA-3' SEQ ID NO: 18
  • mice initiate a classical IgM response in the first week that converts to a specific IgG2b response in the second week, which has recently been shown to have potent opsonic and protective activities against 5 * .
  • aureus antigens (Maira-Litran et al, "Comparative Opsonic and Protective Activities of Staphylococcus aureus Conjugate Vaccines Containing Native or Deacetylated Staphylococcal Poly-N-acetyl-beta-(l-6)- glucosamine," Infect. Immun. 73(10):6752-62 (2005), which is hereby incorporated by reference in its entirety).
  • Atl has also recently found Atl to be an immuno-dominant antigen in a rabbit tibia model of MRSA OM (Brady et al, "Identification of Staphylococcus aureus Proteins Recognized by the Antibody-Mediated Immune Response to a Biofilm Infection," Infect. Immun.
  • a recombinant 6-His tagged fusion protein was generated by cloning the l,465bp coding region of the 53 kDa glucosaminidase subunit of S. aureus autolysin into the XhoI-BamHI site of the pET- 28a(+) expression plasmid ( ovagen), which contains the lac I promoter for IPTG induction. Following DNA sequencing, the plasmid was used to transform BL21 E. coli, which were used to make recombinant His-glucosaminidase (His-Gmd).
  • This recombinant protein was then used to evaluate the reactivity of pre- immune and immune sera.
  • the results showed that the IPTG induced 57kDa recombinant protein is only recognized by immune serum, thus confirming that Gmd is a S. aureus immuno-dominant antigen.
  • This experiment was repeated with anti-sera from mice infected with Xen 29, and confirmed that C57B1/6 also generate Gmd specific antibodies against this bioluminescent strain of S. aureus.
  • RTQ-PCR Although the RTQ-PCR method of quantifying OM in mouse model is very useful, there are three major limitations to this approach. First, it is not longitudinal, as analysis requires sacrifice of the mice to harvest the DNA. Second, it is very labor intense and requires great care during the DNA isolation, PCR and data analysis. Third, detection of S. aureus genomic DNA (nuc genes) cannot distinguish between bacteria that are in an active growth phase vs. dormant bacteria tightly packed in a biofilm. Thus, RTQ-PCR cannot be readily used to assess mAb effect on bacterial growth in vivo.
  • the present invention relates to a highly innovative approach to monitor pathogens in vivo using bioluminescence imaging (Contag et al, "Photonic Detection of Bacterial Pathogens in Living Hosts," Mol. Microbiol. 18(4): 593 -603 (1995), which is hereby incorporated by reference in its entirety). More recently, P. R. Contag and colleagues have generated
  • Group 1 PBS in adjuvant (negative control)
  • Group 2 (2C ⁇ g S. aureus Xen 29 total proteome extract emulsified 1 : 1 with equal volume of adjuvant (positive control)
  • Group 3 (2C ⁇ g His-glucosaminidase in adjuvant).
  • a 150 ⁇ 1 emulsion of each vaccine was injected intramuscularly (i.m.) 28 day prior to challenge.
  • Booster immunizations i.m.; 2C ⁇ g protein in Freund's incomplete adjuvant
  • FIGS 7A-C The results clearly demonstrate a significant reduction of BLI detected in the His-Gmd immunized mice ( Figures 7A-B), which shows a decrease in planktonic growth of the bacteria. Consistent with this finding, it was observed that there was a significant reduction in the number of nuc genes at the peak of the bacterial load in this model (day 1 1). Thus, these data demonstrate that the recombinant Gmd vaccine can protect mice from OM in the model.
  • Example 6 this protocol was used to generate mouse anti-Gmd mAb. Standard procedures were used to generate the mAb. Out of an initial pool of hybridomas that were prepared, a first subset was selected following screened by ELISA for anti-Gmd activity and a second subset possessing higher affinity were selected following a western dot-blot assay.
  • hybridoma cell lines Five of the hybridoma cell lines were selected based on their apparent high affinity for Gmd ( ⁇ 10 "9 M) and the putative epitope for these regions being found within the R3 domain of Gmd. Because the R3 domain is not the catalytic domain of the Gmd protein, it was unexpected that these monoclonal antibodies would possess as significant anti-Gmd inhibitory activity.
  • the five selected hybridomas were 1C1 1, 1E12, 2D11, 3A8 and 3H6. All secreted mouse IgGl antibodies.
  • Frozen aliquots of each cell line (1 CI 1, 1E12, 2D11, 3A8 and 3H6) were obtained directly from the vendor who prepared them at our request (Precision Antibodies, Inc., Columbia, MD). The frozen cells were thawed, and then washed in Dulbecco's Modified Eagle's Medium (DMEM) supplemented with 50 ⁇ g/mL gentamicin and 10% fetal bovine serum (FBS). Harvested culture supernatant was clarified by centrifugation (10 min, 1000 x g) and frozen.
  • DMEM Dulbecco's Modified Eagle's Medium
  • FBS fetal bovine serum
  • Adsorbed antibody was eluted with two column volumes of 0.1 M glycine, pH 2.7, into a collection vessel containing 1 mL of 1.0 M Tris, pH 8.0, to neutralize the eluted product. The column was then washed with four column volumes of PBS in preparation for the next antibody, or with PBS containing 0.02% a 3 for storage.
  • the bacteria were then diluted in LB medium to 1000 cfu/ mL and 100 ⁇ L of the diluted suspension was added to wells of a flat-bottomed microtiter (with cover) designated for the addition of the antibodies and controls.
  • Protein G-Agarose concentrated to 1 mg/mL in PBS and dialyzed to remove preservatives such as a 3 and antibiotics that might interfere in the assay.
  • 100 cfu of S. aureus strain Xen29 from a mid-log phase culture were placed in each microtiter well in LB medium along with 100 ⁇ L of each antibody or control (also in LB medium) at 50 ⁇ g/mL ( ⁇ 3 x 10 "7 M). Growth was monitored by measuring light scattering at 490 and 670 nm at intervals over 26 hours.
  • Results for the isotype-matched control antibody MOPC21 are presented in Figure 10.
  • the growth curves were essentially identical to the no antibody control.
  • the slight elevation of the 50 ⁇ g/mL samples was due to their placement in outside wells in the microtiter plate (edge effect).
  • the antibodies of the present invention have already been shown to satisfy several key criteria. These are high affinity IgG antibodies produced by the parental hybridomas at robust levels (-50 ⁇ g/mL in static culture). They recognize conserved epitopes and consequently some or most will recognize Gmd from the majority of S. aureus strains. In addition, these experiments provide evidence that these monoclonal antibodies recognize native Gmd and not merely the recombinant His-Gmd that was used as the immunogen, and that they act as Gmd inhibitors. The monoclonal antibodies all exhibit Gmd-inhibitory activity of between about 70 to about 80 percent.
  • DMEM fetal bovine serum
  • FBS fetal bovine serum
  • RT-PCR amplification of the heavy chain mRNA was successful in the five hybridomas. Sequence analysis revealed that three different germ-line VH gene segments were used. Two of the hybridomas (2D1 1 and 3H6) used the same germ- line VH and J segments, but different D-segments and each displayed only modest sequence diversification from germ-line at the protein level. The heavy chain from the fifth hybridoma (1C11) did not initially amplify in RT-PCR even with PCR primers designed to amplify some of the more rarely used VH gene-segments. It can be inferred that it expressed an Ig VH gene distinct from the others.
  • RNA was reverse transcribed using the BioRad iScript kit.
  • Aliquots of cDNA were PCR amplified with consensus primers for the 5'-ends of murine variable heavy and light regions paired with constant region primers. Strong products were obtained for 4/5 VH and 5/5 VL genes.
  • the PCR products were gel purified and directly sequenced. All 4 VH products gave clean sequence, but 2/4 light chain products were mixed. The remaining two gave good sequences. The light chain derived from the cell line that failed to give a heavy chain product was not sequenced.
  • the variable regions for those antibodies that failed to amplify in the initial experiments using framework 1 primers were successfully amplified using a different primer set that targets the secretory leader regions of the variable gene segments. These PCR products were also directly sequenced after purification.
  • Hybridoma 2D1 1 (Closest germ line match: J558.18.108) has the V H nucleotide sequence (SEQ ID NO: 21) as follows:
  • the 2D 11 VL (Closest germ line match: at4) has the nucleotide sequence (SEQ ID NO: 22) as follows:
  • amino acid sequence of hybridoma 2D1 1 VH (SEQ ID NO: 1) is as follows:
  • the 2D11 VL has the amino acid sequence (SEQ ID NO: 8) as follows:
  • Hybridoma 3H6 (Closest germ line match: J558.18.108) has the V H nucleotide sequence (SEQ ID NO: 23) as follows:
  • the 3H6 VL (closest germ line match: cp9, JKl) has the nucleotide sequence (SEQ ID NO: 24) as follows:
  • hybridoma 3H6 VL (SEQ ID NO: 9) is as follows:
  • Hybridoma 1E12 (Closest germ line match: 7183.46 VH7) has the V H nucleotide sequence (SEQ ID NO: 25) as follows:
  • the 1E12 VL (Closest germ line match: ai4) has the nucleotide sequence (SEQ ID NO: 26) as follows:
  • hybridoma 1E12 VH SEQ ID NO: 3
  • SEQ ID NO: 3 GATATTGTGATCACCCAGTCTCCAGCAATCATGTCTGCATCTCTAGGGGAACGGGTCACCATG
  • TCCTCCCCCAAACTNTGGATTTATAGCACATCCAACCTGGCTTCTGGAGTCCCAGCTCGCTTC AGTGGCAGTGGGTCTGGGACCTCTTACTCTCTCACAATCAGCAGCATGGAGGCTGAAGATGCT GCCACTTATTACTGCCACCAGTATCATCGTTCCCCATGGACGTTCGGTGGAGGCACC amino acid sequence of hybridoma 1E12 VH SEQ ID NO: 3
  • the 1E12 VL has the amino acid sequence (SEQ ID NO: 10) as follows:
  • Hybridoma 3A8 (Closest germ line match: VHJ606.4.8.2) has the V H nucleotide sequence (SEQ ID NO: 27) as follows:
  • the 3A8 VL (closest germ line match: KV 19-25, JK2) has the nucleotide sequence (SEQ ID NO: 28) as follows:
  • hybridoma 3A8 VH The amino acid sequence of hybridoma 3A8 VH (SEQ ID NO: 4) is as follows:
  • hybridoma 3A8 VL The amino acid sequence of hybridoma 3A8 VL (SEQ ID NO: 11) is as follows:
  • Hybridoma 1C1 1 (closest germline match: VH 9-15, DST4-C57B1-6, JH3) has the V H nucleotide sequence (SEQ ID NO: 29) as follows:
  • the 1C11 VL (closest germ line match: VK23-43, JK5) has the nucleotide sequence (SEQ ID NO: 30) as follows:
  • hybridoma 1C1 1 VH The amino acid sequence of hybridoma 1C1 1 VH (SEQ ID NO: 5) is as follows:
  • amino acid sequence of hybridoma 1C1 1 VL (SEQ ID NO: 12) is as follows:
  • FIG. 1 1 shows the alignment of the four initially sequenced VH genes
  • Figure 13 shows the alignment of all five sequenced VH genes
  • Figure 15 shows the alignment of the sequenced VH genes for 1 CI 1 and 3A8 only.
  • Figure 12 shows the alignment of the two initially obtained VL genes.
  • Figure 14A shows the alignment of all five sequenced Vi genes, whereas Figure 14B all five sequenced Vi genes except of that for 1 CI 1.
  • hybridoma 1 CI 1 did not yield a PCR product with the initial primers that amplify the most common VH genes suggests that it uses a fourth VH gene segment not identical to any of the others identified here.
  • Two of the hybridomas used the same VH germ line gene, but are not identical.
  • Hybridomas 2D11 and 3H6 both used the germ line VH gene segment J558.18.108. Their sequences are compared with the germ line gene in Figure 11. Inspection of the sequence reveals that there is only one difference in CDR1, four in CDR2 and five in CDR3 (including gaps).
  • the five hybridomas are not sibs and among them at least four VH germ line genes were utilized.
  • Example 10 Inhibition of 5. aureus Gmd Enzymatic Activity by mAbs 1C11,
  • the method of measurement of Gmd enzymatic activity is essentially the method of Mani et al. (Mani et al., "Isolation and Characterization of Autolysis- Defective Mutants of Staphylococcus aureus Created by Tn917-lacZ Mutagenesis" J. Bacteriol. 175(5): 1493-1499 (1993)).Lyophilized and resuspended Micrococcus lysodeikticus were degraded by the action of the Gmd resulting in a reduction in light scattering at 490 nm.
  • FIG. 20C-D An SEM analysis of anti-Gmd activity for several monoclonal antibodies is shown in Figures 20C-D.
  • Xen29 S. aureus was grown for 12 hours in Luria-Bertani broth to achieve a mid-log growth suspension, and then 10,000 CFU were incubated with: ( Figures 20A-B) no antibody, ( Figure 20C) 50 ⁇ g/ml 1E12, or ( Figure 20D) 50 ⁇ g/ml 1C1 1 for 1 hour. Samples were then plated onto sterile silicon chips, fixed, dehydrated, and coated with gold for visualization by scanning electron microscopy. Micrographs ( Figures 20C-D) illustrate the effect of anti-Gmd antibody, promoting formation of large clusters and cell-independent lysis (arrows) of approximately 20% of the cells.
  • mice were imaged to assess bioluminescence on days 0, 3, 5, 7, 10 or 11, and 14, and images with the BLI heat map from a representative animal in each group are shown in Figures 21 A and 22A.
  • this therapy cured 50% of the animals at day 3.
  • X-rays from a representative animal in each group obtained on day 14 is shown to illustrate the osteolytic lesion (arrow) in the placebo mouse, which was not present in the anti-Gmd treated animals ( Figures 21 C, 22C).
  • variable regions of the light and heavy chains of the 1C1 1 antibody were re-amplified from the purified hybridoma PCR product described in Example 9 using primers to permit cloning into the human antibody expression vectors described by Tiller et al. ("Efficient Generation of Monoclonal Antibodies from Single Human B Cells by Single Cell RT-PCR and Expression Vector Cloning," J. Immunol. Methods 329(1-2): 1 12-24 (2008), which is hereby incorporated by reference in its entirety). Plasmids containing the 1C11 light and heavy chain variable regions and human kappa and IgGl constant regions were prepared and co-transfected into HEK293 cells.
  • the medium was removed from the cells and assayed for the presence of human IgG and for binding to immobilized Gmd protein by ELISA. Bound antibody was detected using a goat anti- Human IgG antibody coupled to horseradish peroxidase and 3,3', 5, 5' tetramethylbenzidene substrate.
  • the humanized 1C11 antibody and antibody comprising the human CDR1 and CDR2 homologs of 1C1 1 can be utilized in a phase I clinical trial in elderly patients (>65yrs) undergoing primary total joint replacement.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Organic Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Engineering & Computer Science (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Immunology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Epidemiology (AREA)
  • Vascular Medicine (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Biomedical Technology (AREA)
  • Transplantation (AREA)
  • Oral & Maxillofacial Surgery (AREA)
  • Cardiology (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Rheumatology (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Pain & Pain Management (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/US2011/035033 2010-05-03 2011-05-03 Anti-glucosaminidase passive immunization for staphylococcus aureus infections Ceased WO2011140114A2 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
EP16187268.4A EP3150631B1 (en) 2010-05-03 2011-05-03 Anti-glucosaminidase passive immunization for staphylococcus aureus infections
ES11778188.0T ES2606017T3 (es) 2010-05-03 2011-05-03 Inmunización pasiva anti-glucosaminidasa para infecciones por Staphylococcus aureus
US13/696,019 US9737601B2 (en) 2010-05-03 2011-05-03 Anti-glucosaminidase passive immunization for Staphylococcus aureus infections
EP11778188.0A EP2566891B1 (en) 2010-05-03 2011-05-03 Anti-glucosaminidase passive immunization for staphylococcus aureus infections
CA2797121A CA2797121C (en) 2010-05-03 2011-05-03 Anti-glucosaminidase passive immunization for staphylococcus aureus infections
AU2011248209A AU2011248209B2 (en) 2010-05-03 2011-05-03 Anti-glucosaminidase passive immunization for Staphylococcus aureus infections
JP2013509186A JP6038777B2 (ja) 2010-05-03 2011-05-03 黄色ブドウ球菌(Staphylococcusaureus)感染のための抗グルコサミニダーゼ受動免疫化
US15/662,715 US10179170B2 (en) 2010-05-03 2017-07-28 Anti-glucosaminidase passive immunization for Staphylococcus aureus infections
US16/221,442 US10653775B2 (en) 2010-05-03 2018-12-14 Anti-glucosaminidase passive immunization for staphylococcus aureus infections
US16/864,343 US11065333B2 (en) 2010-05-03 2020-05-01 Anti-glucosaminidase passive immunization for Staphylococcus aureus infections

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US33056810P 2010-05-03 2010-05-03
US61/330,568 2010-05-03

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US13/696,019 A-371-Of-International US9737601B2 (en) 2010-05-03 2011-05-03 Anti-glucosaminidase passive immunization for Staphylococcus aureus infections
US15/662,715 Continuation US10179170B2 (en) 2010-05-03 2017-07-28 Anti-glucosaminidase passive immunization for Staphylococcus aureus infections

Publications (2)

Publication Number Publication Date
WO2011140114A2 true WO2011140114A2 (en) 2011-11-10
WO2011140114A3 WO2011140114A3 (en) 2013-05-30

Family

ID=44904432

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2011/035033 Ceased WO2011140114A2 (en) 2010-05-03 2011-05-03 Anti-glucosaminidase passive immunization for staphylococcus aureus infections

Country Status (7)

Country Link
US (4) US9737601B2 (cg-RX-API-DMAC7.html)
EP (2) EP3150631B1 (cg-RX-API-DMAC7.html)
JP (3) JP6038777B2 (cg-RX-API-DMAC7.html)
AU (1) AU2011248209B2 (cg-RX-API-DMAC7.html)
CA (1) CA2797121C (cg-RX-API-DMAC7.html)
ES (1) ES2606017T3 (cg-RX-API-DMAC7.html)
WO (1) WO2011140114A2 (cg-RX-API-DMAC7.html)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2013066876A1 (en) 2011-11-02 2013-05-10 University Of Rochester Anti-glucosaminidase passive immunization for staphylococcus aureus infections
WO2014143886A3 (en) * 2013-03-15 2014-11-20 Edimer Pharmaceuticals, Inc. Anti-ectodysplasin antibodies
WO2015089502A2 (en) 2013-12-13 2015-06-18 University Of Rochester Passive immunization for staphylococcus infections
AU2015224393B2 (en) * 2011-11-02 2016-12-15 University Of Rochester Anti-glucosaminidase passive immunization for staphylococcus aureus infections
US10653775B2 (en) 2010-05-03 2020-05-19 University Of Rochester Anti-glucosaminidase passive immunization for staphylococcus aureus infections
WO2022174009A1 (en) * 2021-02-12 2022-08-18 Telephus Biosciences, Llc Antibodies that bind glucosaminidase and uses thereof

Families Citing this family (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10759859B2 (en) 2016-01-14 2020-09-01 Bps Bioscience, Inc. Anti-PD-1 antibodies and uses thereof
AU2018217720A1 (en) * 2017-02-10 2019-09-05 The Trustees Of The University Of Pennsylvania Anti-factor D antibodies and uses thereof
US10973908B1 (en) 2020-05-14 2021-04-13 David Gordon Bermudes Expression of SARS-CoV-2 spike protein receptor binding domain in attenuated salmonella as a vaccine
US12537071B1 (en) 2020-07-22 2026-01-27 David Gordon Bermudes Bacteria having boolean control pathways expressing therapeutic proteins including immunotherapeutic cytotoxins
WO2022155421A1 (en) * 2021-01-15 2022-07-21 University Of Rochester Staphylococcus aureus antigen-based nucleic acid vaccines

Citations (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4237224A (en) 1974-11-04 1980-12-02 Board Of Trustees Of The Leland Stanford Jr. University Process for producing biologically functional molecular chimeras
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US5516637A (en) 1994-06-10 1996-05-14 Dade International Inc. Method involving display of protein binding pairs on the surface of bacterial pili and bacteriophage
US5545807A (en) 1988-10-12 1996-08-13 The Babraham Institute Production of antibodies from transgenic animals
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5750373A (en) 1990-12-03 1998-05-12 Genentech, Inc. Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants
US20020076766A1 (en) 1996-02-20 2002-06-20 Black Michael Terence Novel glucosaminidase
WO2010028013A2 (en) 2008-09-02 2010-03-11 University Of Maryland, Baltimore In vivo biofilm infection diagnosis and treatment
WO2010039563A2 (en) 2008-09-30 2010-04-08 University Of Maryland, Baltimore Protective vaccine against staphylococcus aureus biofilms comprising cell wall-associated immunogens

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2285831A4 (en) * 2008-05-07 2011-05-04 Innovative Biosensors Inc REAGENTS, METHODS, AND SYSTEMS FOR DETECTION OF METHICILLIN-RESISTANT STAPHYLOCOCCUS (MRSA)
CA2797121C (en) 2010-05-03 2020-07-14 University Of Rochester Anti-glucosaminidase passive immunization for staphylococcus aureus infections

Patent Citations (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4237224A (en) 1974-11-04 1980-12-02 Board Of Trustees Of The Leland Stanford Jr. University Process for producing biologically functional molecular chimeras
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US5545807A (en) 1988-10-12 1996-08-13 The Babraham Institute Production of antibodies from transgenic animals
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5750373A (en) 1990-12-03 1998-05-12 Genentech, Inc. Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants
US5516637A (en) 1994-06-10 1996-05-14 Dade International Inc. Method involving display of protein binding pairs on the surface of bacterial pili and bacteriophage
US20020076766A1 (en) 1996-02-20 2002-06-20 Black Michael Terence Novel glucosaminidase
WO2010028013A2 (en) 2008-09-02 2010-03-11 University Of Maryland, Baltimore In vivo biofilm infection diagnosis and treatment
WO2010039563A2 (en) 2008-09-30 2010-04-08 University Of Maryland, Baltimore Protective vaccine against staphylococcus aureus biofilms comprising cell wall-associated immunogens

Non-Patent Citations (88)

* Cited by examiner, † Cited by third party
Title
AZZAM ET AL.: "Outcome of a Second Two-stage Reimplantation for Periprosthetic Knee Infection", CLIN. ORTHOP. RELAT. RES., vol. 467, no. 7, 2009, pages 1706 - 1714
BABA; SCHNEEWIND: "Targeting of Muralytic Enzymes to the Cell Division Site of Gram-Positive Bacteria: Repeat Domains Direct Autolysin to the Equatorial Surface Ring of Staphylococcus aureus", EMBO. J., vol. 17, no. 16, 1998, pages 4639 - 4346, XP002228331, DOI: doi:10.1093/emboj/17.16.4639
BIRD ET AL.: "Single-Chain Antigen-Binding Proteins", SCIENCE, vol. 242, 1988, pages 423 - 426, XP000575094, DOI: doi:10.1126/science.3140379
BRADY ET AL., INFECTION AND IMMUNITY, vol. 74, no. 6, 2006, pages 3415
BRADY ET AL., INFECTION AND IMMUNITY, vol. 79, no. 4, 2011, pages 1797
BRADY ET AL.: "Identification of Staphylococcus aureus Proteins Recognized by the Antibody-Mediated Immune Response to a Biofilm Infection", INFECT. IMMUN., vol. 74, no. 6, 2006, pages 3415 - 3426, XP008128735, DOI: doi:10.1128/IAI.00392-06
BUXTON ET AL.: "Binding of a Staphylococcus aureus Bone Pathogen to Type I Collagen", MICROB. PATHOG., vol. 8, no. 6, 1990, pages 441 - 448, XP023312665, DOI: doi:10.1016/0882-4010(90)90031-K
CHANG ET AL., ADVANCED DRUG DELIVERY REVIEWS, vol. 32, 1998, pages 173 - 186
CHUARD ET AL.: "Resistance of Staphylococcus aureus Recovered From Infected Foreign Body in Vivo to Killing by Antimicrobials", J. INFECT. DIS., vol. 163, no. 6, 1991, pages 1369 - 1373
CHUARD ET AL.: "Susceptibility of Staphylococcus aureus Growing on Fibronectin-Coated Surfaces to Bactericidal Antibiotics", ANTIMICROB. AGENTS CHEMOTHER., vol. 37, no. 4, 1993, pages 625 - 632
CLACKSON ET AL.: "Making Antibody Fragments using Phage Display Libraries", NATURE, vol. 352, 1991, pages 624 - 628, XP002101159, DOI: doi:10.1038/352624a0
CONTAG ET AL.: "Photonic Detection of Bacterial Pathogens in Living Hosts", MOL. MICROBIOL., vol. 18, no. 4, 1995, pages 593 - 603, XP000579836, DOI: doi:10.1111/j.1365-2958.1995.mmi_18040593.x
COSTERTON ET AL.: "Bacterial Biofilms: A Common Cause of Persistent Infections", SCIENCE, vol. 284, no. 5418, 1999, pages 1318 - 1322, XP002954870, DOI: doi:10.1126/science.284.5418.1318
DAROUICHE: "Treatment of Infections Associated With Surgical Implants", N. ENGL. J. MED., vol. 350, no. 14, 2004, pages 1422 - 1429, XP008164298, DOI: doi:10.1056/NEJMra035415
DAUM ET AL.: "A Model of Staphylococcus aureus Bacteremia, Septic Arthritis, and Osteomyelitis in Chickens", J. ORTHOP. RES., vol. 8, no. 6, 1990, pages 804 - 813
DENG; NICKOLOFF: "Site-Directed Mutagenesis of Virtually any Plasmid by Eliminating a Unique Site", ANAL. BIOCHEM., vol. 200, 1992, pages 81 - 88, XP024819821, DOI: doi:10.1016/0003-2697(92)90280-K
ED HARLOW; DAVID LANE: "ANTIBODIES: A LABORATORY MANUAL", 1988, COLD SPRING HARBOR LABORATORY
ED HARLOW; DAVID LANE: "USING ANTIBODIES: A LABORATORY MANUAL", 1999, COLD SPRING HARBOR LABORATORY PRESS
ELLINGTON ET AL.: "Involvement of Mitogen-Activated Protein Kinase Pathways in Staphylococcus aureus Invasion of Normal Osteoblasts", INFECT. IMMUN., vol. 69, no. 9, 2001, pages 5235 - 5242
FLOCK ET AL.: "Cloning and Expression of the Gene for a Fibronectin-Binding Protein From Staphylococcus aureus", EMBO. J., vol. 6, no. 8, 1987, pages 2351 - 2357, XP001037994
FRANCIS ET AL.: "Monitoring Bioluminescent Staphylococcus aureus Infections in Living Mice Using a Novel luxABCDE Construct", INFECT. IMMUN., vol. 68, no. 6, 2000, pages 3594 - 3600, XP002153182, DOI: doi:10.1128/IAI.68.6.3594-3600.2000
FRED M. AUSUBEL ET AL: "CURRENT PROTOCOLS IN MOLECULAR BIOLOGY", 2003
GARCIA-LARA; FOSTER, CURR OPIN IN PHARMACOL, vol. 9, 2009, pages 552
GRAY ET AL.: "Effect of Extracellular Slime Substance From Staphylococcus epidermidis on the Human Cellular Immune Response", LANCET, vol. 1, no. 8373, 1984, pages 365 - 367
GRIBSKOV ET AL.: "The Codon Preference Plot: Graphic Analysis of Protein Coding Sequences and Prediction of Gene Expression", NUC. ACIDS. RES., vol. 12, 1984, pages 539 - 549
HEIN ET AL.: "Comparison of Different Approaches to Quantify Staphylococcus aureus Cells by Real-Time Quantitative PCR and Application of This Technique for Examination of Cheese", APPL. ENVIRON. MICROBIOL., vol. 67, no. 7, 2001, pages 3122 - 3126
HOOGENBOOM ET AL.: "By-passing Immunisation. Human Antibodies From Synthetic Repertoires of Germline VH Gene Segments Rearranged in vitro", J. MOL. BIOL., vol. 227, 1992, pages 381 - 388, XP024020530, DOI: doi:10.1016/0022-2836(92)90894-P
HOUSTON ET AL.: "Protein Engineering of Antibody Binding Sites: Recovery of Specific Activity in an Anti-Digoxin Single-Chain Fv Analogue Produced in Escherichia coli", PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883
JAMES GODING: "MONOCLONAL ANTIBODIES:PRINCIPLES AND PRACTICE", 1983, ACADEMIC PRESS, pages: 98 - 118
JOHNSON ET AL.: "Interference With Granulocyte Function By Staphylococcus epidermidis Slime", INFECT. IMMUN., vol. 54, no. 1, 1986, pages 13 - 20
JONES ET AL.: "Replacing the Complementarity-Determining Regions in a Human Antibody With Those From a Mouse", NATURE, vol. 321, 1986, pages 522 - 525, XP002949266, DOI: doi:10.1038/321522a0
KAARSEMAKER ET AL.: "New Model for Chronic Osteomyelitis With Staphylococcus aureus in Sheep", CLIN. ORTHOP. RELAT. RES., vol. 339, 1997, pages 246 - 252
KADURUGAMUWA ET AL.: "Noninvasive Optical Imaging Method to Evaluate Postantibiotic Effects on Biofilm Infection In Vivo", ANTIMICROB AGENTS CHEMOTHER, vol. 48, 2004, pages 2283 - 2287
KADURUGAMUWA ET AL.: "Rapid Direct Method for Monitoring Antibiotics in a Mouse Model of Bacterial Biofilm Infection", ANTIMICROB AGENTS CHEMOTHER, vol. 47, 2003, pages 3130 - 3137, XP009164214, DOI: doi:10.1128/AAC.47.10.3130-3137.2003
KATES ET AL., EUROPEAN CELLS AND MATERIALS, vol. 21, no. 2, 2011, pages 23
KOIDE ET AL.: "Probing Protein Conformational Changes in Living Cells by Using Designer Binding Proteins: Application to the Estrogen Receptor", PROC. NATL. ACAD. SCI. USA, vol. 99, 2002, pages 1253 - 1258, XP009123728, DOI: doi:10.1073/pnas.032665299
KOIDE ET AL.: "The Fibronectin Type III Domain as a Scaffold for Novel Binding Proteins", J. MOL. BIOL., vol. 284, 1998, pages 1141 - 1151, XP004455886, DOI: doi:10.1006/jmbi.1998.2238
KOMATSUZAWA ET AL.: "Subcellular Localization of the Major Autolysin, ATL and Its Processed Proteins in Staphylococcus aureus", MICROBIOL IMMUNOL., vol. 41, 1997, pages 469 - 479
KUNKEL ET AL.: "Rapid and Efficient Site-Specific Mutagenesis Without Phenotypic Selection", METHODS ENZYMOL., vol. 154, 1987, pages 367 - 382, XP001098930, DOI: doi:10.1016/0076-6879(87)54085-X
KUNKEL ET AL.: "Rapid and Efficient Site-Specific Mutagenesis Without Phenotypic Selection", PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 488 - 492, XP002052322, DOI: doi:10.1073/pnas.82.2.488
LEW; WALDVOGEL: "Osteomyelitis", LANCET, vol. 364, no. 9431, 2004, pages 369 - 379, XP004747135, DOI: doi:10.1016/S0140-6736(04)16727-5
LI ET AL.: "Quantitative Mouse Model of Implant-Associated Osteomyelitis and the Kinetics of Microbial Growth, Osteolysis, and Humoral Immunity", J. ORTHOP. RES., vol. 26, no. 1, 2008, pages 96 - 105
MADER; CALHOUN: "Long-Bone Osteomyelitis Diagnosis and Management", HOSP. PRACT. (OFFED), vol. 29, no. 10, 1994, pages 71 - 86
MAHOMED ET AL.: "Rates and Outcomes of Primary and Revision Total Hip Replacement in the United States Medicare Population", J. BONE JOINT SURG. AM., vol. 85, no. A-L, 2003, pages 27 - 32
MAIRA-LITRAN ET AL.: "Comparative Opsonic and Protective Activities of Staphylococcus aureus Conjugate Vaccines Containing Native or Deacetylated Staphylococcal Poly-N-acetyl-beta-(1-6)-glucosamine", INFECT. IMMUN, vol. 73, no. 10, 2005, pages 6752 - 6762, XP009058830, DOI: doi:10.1128/IAI.73.10.6752-6762.2005
MANI ET AL.: "Isolation and Characterization of Auto lysis-Defective Mutants of Staphylococcus aureus Created by Tn917-lacZ Mutagenesis", J. BACTERIOL., vol. 175, no. 5, 1993, pages 1493 - 1499
MARKS ET AL.: "By-Passing Immunization. Human Antibodies from V-Gene Libraries Displayed on Phage", J. MOL. BIOL., vol. 222, 1991, pages 581 - 597, XP024010124, DOI: doi:10.1016/0022-2836(91)90498-U
MARRIOTT ET AL.: "Osteoblasts Express the Inflammatory Cytokine Interleukin-6 in a Murine Model of Staphylococcus aureus Osteomyelitis and Infected Human Bone Tissue", AM. J. PATHOL., vol. 164, no. 4, 2004, pages 1399 - 1406
MARY A. RITTER AND HEATHER M. LADYMAN: "MONOCLONAL ANTIBODIES - PRODUCTION, ENGINEERING AND CLINICAL APPLICATIONS", 1995
MCCAFFERTY ET AL.: "Phage Antibodies: Filamentous Phage Displaying Antibody Variable Domains", NATURE, vol. 348, 1990, pages 552 - 554, XP002196759, DOI: doi:10.1038/348552a0
MILSTEIN; KOHLER: "Derivation of Specific Antibody-Producing Tissue Culture and Tumor Lines by Cell Fusion", EUR. J. IMMUNOL., vol. 6, 1976, pages 511, XP000654957, DOI: doi:10.1002/eji.1830060713
NAIR ET AL.: "Surface-Associated Proteins From Staphylococcus aureus Demonstrate Potent Bone Resorbing Activity", J. BONE MINER. RES., vol. 10, no. 5, 1995, pages 726 - 734
NAYLOR ET AL.: "Antibiotic Resistance of Biomaterial-Adherent Coagulase-Negative and Coagulase-Positive Staphylococci", CLIN. ORTHOP. RELAT. RES., vol. 261, 1990, pages 126 - 133
NORD ET AL.: "Binding Proteins Selected from Combinatorial Libraries of an alpha-helical Bacterial Receptor Domain", NATURE BIOTECHNOL., vol. 15, no. 8, 1997, pages 772 - 777, XP002149252
NORDEN: "Lessons Learned From Animal Models of Osteomyelitis", REV. INFECT. DIS., vol. 10, no. 1, 1988, pages 103 - 110
OSHIDA ET AL.: "A Staphylococcus aureus Autolysin that has an N-acetylmuramoyl-L-Alanine Amidase Domain and an Endo-beta-N-acetylglucosaminidase Domain: Cloning, Sequence Analysis, and Characterization", PROC NATL ACAD SCI USA, vol. 92, 1995, pages 285 - 289, XP002090226, DOI: doi:10.1073/pnas.92.1.285
OSHIDA ET AL.: "A Staphylococcus aureus Autolysin That Has an N-acetylmuramoyl-L-alanine Amidase Domain and an Endo-beta-N-acetylglucosaminidase Domain: Cloning, Sequence Analysis, and Characterization", PROC. NAT'L. ACAD. SCI. U.S.A., vol. 92, no. 1, 1995, pages 285 - 289, XP002090226, DOI: doi:10.1073/pnas.92.1.285
OSHIDA ET AL.: "Expression Analysis of the Autolysin Gene (at!) of Staphylococcus aureus", MICROBIOL IMMUNOL, vol. 42, 1998, pages 655 - 659
PALOMARES ET AL.: "Rapid Detection and Identification of Staphylococcus aureus From Blood Culture Specimens Using Real-Time Fluorescence PCR", DIAGN. MICROBIOL. INFECT. DIS., vol. 45, no. 3, 2003, pages 183 - 189
PASSL ET AL.: "A Model of Experimental Post-Traumatic Osteomyelitis in Guinea Pigs", J. TRAUMA, vol. 24, no. 4, 1984, pages 323 - 326
PATTI ET AL.: "MSCRAMM-Mediated Adherence of Microorganisms to Host Tissues", ANNU. REV. MICROBIOL., vol. 48, 1994, pages 585 - 617, XP001037269, DOI: doi:10.1146/annurev.mi.48.100194.003101
PHILIP L.R. B: "PROTEIN PURIFICATION", 2007, ROUTLEDGE
PROCTOR ET AL.: "Persistent and Relapsing Infections Associated with Small-Colony Variants of Staphylococcus aureus", CLIN. INFECT. DIS., vol. 20, no. 1, 1995, pages 95 - 102
REILLY ET AL.: "In Vivo Internalization of Staphylococcus aureus by Embryonic Chick Osteoblasts", BONE, vol. 26, no. L, 2000, pages 63 - 70
REISFELD ET AL.: "MONOCLONAL ANTIBODIES AND CANCER THERAPy", vol. 77, 1985
RIECHMANN ET AL.: "Reshaping Human Antibodies for Therapy", NATURE, vol. 332, 1988, pages 323 - 327, XP002007067, DOI: doi:10.1038/332323a0
RISSING ET AL.: "Model of Experimental Chronic Osteomyelitis in Rats", INFECT. IMMUN., vol. 47, no. 3, 1985, pages 581 - 586, XP008131094
ROBERTS; LAUER: "Maximizing Gene Expression on a Plasmid Using Recombination In Vitro", METHODS IN ENZYMOLOGY, vol. 68, 1979, pages 473 - 482, XP001314595
SA OO; R SS: "MOLECULAR CLONING: A LABORATORY MANUAL", 2001, COLD SPRINGS LABORATORY PRESS
SAMBROOK; RUSSELL: "MOLECULAR CLONING: A LABORATORY MANUAL", 2001, COLD SPRINGS LABORATORY PRESS
SAMBROOK; RUSSELL: "MOLECULAR CLONING: A LABORATORY MANUAL. 2ND ED.", 1989
SANDHU ET AL.: "Dual Asymetric PCR: One-Step Construction of Synthetic Genes", BIOTECH, vol. 12, 1992, pages 14 - 16
SHEETS ET AL.: "Efficient Construction of a Large Nonimmune Phage Antibody Library: The Production of High-Affinity Human Single-Chain Antibodies to Protein Antigens", PROC. NAT'L. ACAD. SCI. U.S.A., vol. 95, 1998, pages 6157 - 6162, XP002191576, DOI: doi:10.1073/pnas.95.11.6157
SUGAI ET AL.: "Identification of Endo-beta-N-acetylglucosaminidase and N-acetylmuramyl-L-alanine Amidase as Cluster-dispersing Enzymes in Staphylococcus aureus", JBACTERIOL, vol. 177, 1995, pages 1491 - 1496, XP055070004
SUGAI ET AL.: "Localized Perforation of the Cell Wall by a Major Autolysin: atl Gene Products and the Onset of Penicillin-induced Lysis of Staphylococcus aureus", J BACTERIOL, vol. 179, 1997, pages 2958 - 2962, XP001127471
SWITALSKI ET AL.: "A Collagen Receptor on Staphylococcus aureus Strains Isolated From Patients With Septic Arthritis Mediates Adhesion to Cartilage", MOL. MICROBIOL., vol. 7, no. 1, 1993, pages 99 - 107, XP002044192, DOI: doi:10.1111/j.1365-2958.1993.tb01101.x
TILLER ET AL.: "Efficient Generation of Monoclonal Antibodies from Single Human B Cells by Single Cell RT-PCR and Expression Vector Cloning", J. IMMUNOL. METHODS, vol. 329, no. 1-2, 2008, pages 112 - 124, XP022389335
TOMS ET AL.: "The Management of Peri-Prosthetic Infection in Total Joint Arthroplasty", J. BONE JOINT SURG. BR., vol. 88, no. 2, 2006, pages 149 - 155
VARRONE ET AL., 57TH ANNUAL MEETING OF THE ORTHOPEDIC RESEARCH SOCIETY, 2011
VARRONE ET AL., IBMS BONEKEY, vol. 8, no. 4, 2011, pages 187
VARSHNEY ET AL.: "Experimental Model of Staphylococcal Osteomyelitis in Dogs", INDIAN J. EXP. BIOL., vol. 27, no. 9, 1989, pages 816 - 819
VAUGHAN ET AL.: "Human Antibodies with Sub-Nanomolar Affinities Isolated from a Large Non-immunized Phage Display Library", NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 309 - 314, XP000196144, DOI: doi:10.1038/nbt0396-309
VERHOEYEN ET AL.: "Reshaping Human Antibodies: Grafting an Antilysozyme Activity", SCIENCE, vol. 239, 1988, pages 1534 - 1536, XP002949269, DOI: doi:10.1126/science.2451287
WHO GLOBAL STRATEGY FOR CONTAINMENT OF ANTIMICROBIAL RESISTANCE, 2001
WORLOCK ET AL.: "An Experimental Model of Post-Traumatic Osteomyelitis in Rabbits", BR. J. EXP. PATHOL., vol. 69, no. 2, 1988, pages 235 - 244
YAMADA ET AL.: "An Autolysin Ring Associated with Cell Separation of Staphylococcus aureus", J BACTERIOL, vol. 178, 1996, pages 1565 - 1571
YAMADA ET AL.: "An Autolysin Ring Associated With Cell Separation of Staphylococcus aureus", J. BACTERIOL., vol. 178, no. 6, 1996, pages 1565 - 1571
ZHANG ET AL.: "Cyclooxygenase-2 Regulates Mesenchymal Cell Differentiation Into the Osteoblast Lineage and is Critically Involved in Bone Repair", J. CLIN. INVEST., vol. 109, no. 11, 2002, pages 1405 - 1415, XP008105951, DOI: doi:10.1172/JCI200215681

Cited By (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10653775B2 (en) 2010-05-03 2020-05-19 University Of Rochester Anti-glucosaminidase passive immunization for staphylococcus aureus infections
US11065333B2 (en) 2010-05-03 2021-07-20 University Of Rochester Anti-glucosaminidase passive immunization for Staphylococcus aureus infections
JP2017141264A (ja) * 2011-11-02 2017-08-17 ユニバーシティー オブ ロチェスター 黄色ブドウ球菌(Staphylococcus aureus)感染症に対する抗グルコサミニダーゼ受動免疫処置
US9758572B2 (en) 2011-11-02 2017-09-12 University Of Rochester Anti-glucosaminidase passive immunization for Staphylococcus aureus infections
JP2016040250A (ja) * 2011-11-02 2016-03-24 ユニバーシティー オブ ロチェスター 黄色ブドウ球菌(Staphylococcusaureus)感染症に対する抗グルコサミニダーゼ受動免疫処置
US9487577B2 (en) 2011-11-02 2016-11-08 University Of Rochester Anti-glucosaminidase passive immunization for Staphylococcus aureus infections
AU2015224393B2 (en) * 2011-11-02 2016-12-15 University Of Rochester Anti-glucosaminidase passive immunization for staphylococcus aureus infections
EP2785376A4 (en) * 2011-11-02 2014-11-26 Univ Rochester PASSIVE IMMUNIZATION AGAINST GLUCOSAMINIDASE FOR STAPHYLOCOCCUS AUREUS INFECTIONS
WO2013066876A1 (en) 2011-11-02 2013-05-10 University Of Rochester Anti-glucosaminidase passive immunization for staphylococcus aureus infections
EP3643323A1 (en) 2011-11-02 2020-04-29 University Of Rochester Anti-glucosaminidase passive immunization for staphylococcus aureus infections
US10112986B2 (en) 2011-11-02 2018-10-30 University Of Rochester Anti-glucosaminidase passive immunization for Staphylococcus aureus infections
AU2017201748B2 (en) * 2011-11-02 2019-02-14 University Of Rochester Anti-glucosaminidase passive immunization for staphylococcus aureus infections
US9695245B2 (en) 2013-03-15 2017-07-04 Edimer Pharmaceuticals, Inc Anti-ectodysplasin antibodies
WO2014143886A3 (en) * 2013-03-15 2014-11-20 Edimer Pharmaceuticals, Inc. Anti-ectodysplasin antibodies
WO2015089502A2 (en) 2013-12-13 2015-06-18 University Of Rochester Passive immunization for staphylococcus infections
WO2022174009A1 (en) * 2021-02-12 2022-08-18 Telephus Biosciences, Llc Antibodies that bind glucosaminidase and uses thereof

Also Published As

Publication number Publication date
US9737601B2 (en) 2017-08-22
US11065333B2 (en) 2021-07-20
EP3150631A1 (en) 2017-04-05
AU2011248209B2 (en) 2016-03-17
US20130110249A1 (en) 2013-05-02
EP2566891A4 (en) 2014-05-28
CA2797121A1 (en) 2011-11-10
US20190314501A1 (en) 2019-10-17
EP2566891B1 (en) 2016-11-02
CA2797121C (en) 2020-07-14
EP3150631B1 (en) 2023-08-30
JP2018027974A (ja) 2018-02-22
US10179170B2 (en) 2019-01-15
US10653775B2 (en) 2020-05-19
JP2013533210A (ja) 2013-08-22
JP6580649B2 (ja) 2019-09-25
EP3150631C0 (en) 2023-08-30
US20200330597A1 (en) 2020-10-22
ES2606017T3 (es) 2017-03-17
JP6038777B2 (ja) 2016-12-07
JP6227092B2 (ja) 2017-11-08
US20180043021A1 (en) 2018-02-15
JP2017105756A (ja) 2017-06-15
AU2011248209A1 (en) 2012-11-22
WO2011140114A3 (en) 2013-05-30
EP2566891A2 (en) 2013-03-13

Similar Documents

Publication Publication Date Title
US11065333B2 (en) Anti-glucosaminidase passive immunization for Staphylococcus aureus infections
US10100127B2 (en) Passive immunization for Staphylococcus infections
US10112986B2 (en) Anti-glucosaminidase passive immunization for Staphylococcus aureus infections
AU2017201748B2 (en) Anti-glucosaminidase passive immunization for staphylococcus aureus infections
HK1236211A1 (en) Anti-glucosaminidase passive immunization for staphylococcus aureus infections
HK1236211B (en) Anti-glucosaminidase passive immunization for staphylococcus aureus infections

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 11778188

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2797121

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2013509186

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2011248209

Country of ref document: AU

Date of ref document: 20110503

Kind code of ref document: A

REEP Request for entry into the european phase

Ref document number: 2011778188

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2011778188

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 13696019

Country of ref document: US