WO2011132940A2 - Rtk에 특이적으로 결합하는 rtk-bpb - Google Patents

Rtk에 특이적으로 결합하는 rtk-bpb Download PDF

Info

Publication number
WO2011132940A2
WO2011132940A2 PCT/KR2011/002840 KR2011002840W WO2011132940A2 WO 2011132940 A2 WO2011132940 A2 WO 2011132940A2 KR 2011002840 W KR2011002840 W KR 2011002840W WO 2011132940 A2 WO2011132940 A2 WO 2011132940A2
Authority
WO
WIPO (PCT)
Prior art keywords
type
rtk
trp
thr
glu
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/KR2011/002840
Other languages
English (en)
French (fr)
Other versions
WO2011132940A3 (ko
Inventor
전상용
김성현
박세호
김대진
이상헌
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Gwangju Institute of Science and Technology
Original Assignee
Gwangju Institute of Science and Technology
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Gwangju Institute of Science and Technology filed Critical Gwangju Institute of Science and Technology
Priority to KR1020127023550A priority Critical patent/KR20130103299A/ko
Publication of WO2011132940A2 publication Critical patent/WO2011132940A2/ko
Publication of WO2011132940A3 publication Critical patent/WO2011132940A3/ko
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
    • C07K1/107—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C—CHEMISTRY; METALLURGY
    • C40—COMBINATORIAL TECHNOLOGY
    • C40B—COMBINATORIAL CHEMISTRY; LIBRARIES, e.g. CHEMICAL LIBRARIES
    • C40B30/00—Methods of screening libraries
    • C40B30/04—Methods of screening libraries by measuring the ability to specifically bind a target molecule, e.g. antibody-antigen binding, receptor-ligand binding
    • C—CHEMISTRY; METALLURGY
    • C40—COMBINATORIAL TECHNOLOGY
    • C40B—COMBINATORIAL CHEMISTRY; LIBRARIES, e.g. CHEMICAL LIBRARIES
    • C40B40/00—Libraries per se, e.g. arrays, mixtures
    • C40B40/04—Libraries containing only organic compounds
    • C40B40/10—Libraries containing peptides or polypeptides, or derivatives thereof
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
    • G01N2333/715—Assays involving receptors, cell surface antigens or cell surface determinants for cytokines; for lymphokines; for interferons

Definitions

  • the present invention relates to RTK ′ BPB that specifically binds to receptor tyrosine kinase (RTK).
  • RTK ′ BPB that specifically binds to receptor tyrosine kinase (RTK).
  • Antibodies are immunoglobulin proteins, a type of plasma protein produced by B cells, that specifically inactivate and inactivate antigens by specifically recognizing and binding to specific sites of antigens.
  • immunoglobulin proteins a type of plasma protein produced by B cells, that specifically inactivate and inactivate antigens by specifically recognizing and binding to specific sites of antigens.
  • the overall market size of therapeutic antibodies is estimated to grow at an annual rate of 20%, from $ 10 billion in 2004 to $ 30 billion in 2010.
  • the market is expected to grow exponentially.
  • the development of new drugs using antibodies is active because the drug development period is short, investment costs are low, and side effects can be easily predicted.
  • the antibody is a herbal medicine, the human body is hardly affected, and the half-life in the body is overwhelmingly long compared to low molecular weight drugs, so the patient is friendly.
  • monoclonal antibodies in humans are recognized as foreign antigens, causing severe allergic reactions or hypersensitivity reactions.
  • the anti-cancer monoclonal antibody is used clinically, the production cost is high, and thus the price of the therapeutic agent increases rapidly.
  • Antibody-replacement protein is a recombinant protein made to have constant and variable regions like an antibody.
  • a small and stable protein is replaced with a random sequence of amino acids to make a library, which is then screened for the target material, thereby providing high affinity and good Substances with specificity can be found.
  • avimers and affibodies among antibody replacement proteins have been reported to have a picomol affinity for a target substance. It is reported that these antibody replacement proteins are small and stable and can penetrate deep into cancer cells and generally produce less immune responses.
  • antibody replacement proteins There are currently 40 antibody replacement proteins that have been developed. Among them, the antibody replacement proteins that are being commercialized by venture companies and multinational pharmaceutical companies are fibronectin type m domain, lipocalin, LDLR-A domain, crystallin, protein A, and ankyrin repeat. (Ankyrin repeat), which uses a protein called BPTI, has a high affinity of several nanomolar to picomolar to the target. Among them, Adnectin, Avimer, and Kunitz domains are currently undergoing FDA clinical trials.
  • the present invention focused on peptide-based antibody replacement proteins that are different from antibody replacement proteins using proteins up to now.
  • Peptides have been widely used in place of antibody therapeutics due to proper pharmacokinetics, mass productivity, low toxicity, antigenic inhibition and low production cost compared to antibodies.
  • the advantages of peptides as therapeutic drugs are low production costs, high safety and reactivity, relatively low patent royalties, less exposure to unwanted immune systems, which can inhibit the production of antibodies to the peptides themselves, The deformation is easy and accurate.
  • most peptides show low affinity and specificity for specific protein targets compared to antibodies, they cannot be used in various applications. therefore, There is a need in the art for the development of new peptide-based antibody replacement proteins that can overcome the disadvantages of peptides.
  • the present inventors have tried to develop a peptide material capable of specific binding with high affinity to a biological target molecule. This is expected to be a technology that can produce new drug candidates with high affinity and specificity in a short time using peptides having low affinity reported for a large number of targets.
  • receptor tyrosine kinases are cell surface receptors for many growth factors, cytokines and hormones. Of the approximately 90 tyrosine kinase genes found in the human genome, 58 encode the receptor tyrosine kinase (Robinson DR et al., Oncogene 19 (49): 5548-5557 (2000)). Receptor tyrosine kinases (RTKs) play important roles in the development and development of many cancers, as well as important regulators in normal cellular processes (Zwick, E. et al., Endocr. Relat. Cancer 8 ( 3): 161-173 (2001). Therefore, a lot of medicine development targeting RTKs has been made.
  • the present inventors have tried to develop a system capable of transporting various substances within or on the cell surface based on RTK binding and specificity.
  • the structure stabilization site having a relatively rigid peptide backbone
  • BPB bipodal peptide binder
  • an object of the present invention to provide a receptor tyrosine kinase (RTK) -bipodal peptide binder (RTK-BPB), Another object of the present invention is to provide a RTK receptor tyrosine kinase) -bipodal peptide binder (RTK-BPB).
  • RTK receptor tyrosine kinase
  • RTK-BPB RTK receptor tyrosine kinase binder
  • the present invention provides RTKCreceptor tyrosine kinase) -bipodal peptide binder (RTK-BPB) comprising:
  • RTK-bipodal peptide binder that specifically binds to RTK comprising a binding region ⁇ ).
  • the present inventors have tried to develop a system that can transport a variety of substances into or on the cell surface based on RTK binding and specificity.
  • the structure stabilization site having a relatively rigid peptide backbone
  • a bipodal peptide binder having greatly increased binding capacity and specificity was obtained.
  • the basic strategy of the present invention is to connect a peptide that is bound to a target at both ends of a rigid peptide backbone.
  • the rigid peptide backbone acts to stabilize the overall structure of the bipodal peptide provider and enhances the binding of target binding site I and target binding site ⁇ to the target molecule.
  • Structural stabilization sites usable in the present invention include parallel, antiparallel or parallel and antiparallel amino acid strands, Protein structure motifs that form non-covalent bonds by interstrand hydrogen bonding, electrostatic interactions, hydrophobic interactions, van der Waals interactions, pi-pi interactions, cation-pi interactions, or combinations thereof do.
  • Non-covalent bonds formed by hydrogen bonds, electrostatic interactions, hydrophobic interactions, van der Waals interactions, pi-pi interactions, cation-pi interactions, or a combination of these strands are the rigidity of the structural stabilization site. Contribute to.
  • interstrand non-covalent bonds at the structure stabilization site include hydrogen bonds, hydrophobic interactions, van der Waals interactions, pi-pi interactions or combinations thereof.
  • disulfide bonds can be formed at the structured stabilization site to further increase the firmness of the structure stabilized site.
  • the increase in firmness by such covalent bonds is given in consideration of the specificity and affinity of the bipodal peptide binder for the target.
  • the amino acid strands of the structure stabilization site are linked by a linker.
  • linker as used to refer to the strands refers to the material that connects the strands.
  • the turn sequence in ⁇ -hairpin serves as a linker
  • a substance connecting two C-terminus of leucine zipper eg , Peptide linkers
  • Linkers link parallel, antiparallel or parallel and antiparallel amino acid strands. For example, at least two strands (preferably two strands) arranged in parallel fashion, at least two strands (preferably two strands) arranged in antiparallel fashion, and at least three strands arranged in parallel and antiparallel fashion.
  • the linker (preferably three strands) is connected by the linker.
  • the linker is a turn sequence or peptide linker.
  • the turn sequence is ⁇ -turn, ⁇ -turn, ⁇ -turn, ⁇ -turn or ⁇ -loop °] (Venkatachalam CM (1968), Biopolymers, 6, 1425-1436; Nemethy G and Print z MP. (1972), Macro / no 1 ecu JEs, 5, 755-758; Lewis PN et al. , (1973), Biochim. Biophys. Acta, 303, 211-229; Toniolo C. (1980) CRC Crit. Rev. Biochem. , 9, 1-44; Richardson JS. (1981), Adv. Protein Chem. , 34, 167-339; Rose GD et al. , (1985), Adv.
  • the turn sequence used in the present invention is ⁇ -turn.
  • ⁇ -turn When ⁇ -turn is used as the turn sequence, it is preferably a type I, type I ', type ⁇ , type ⁇ ', type m or type m 'turn sequence, more preferably type I, type ⁇ ; Type ⁇ , type ⁇ 'turn sequence, even more preferably type I' or type ⁇ 'turn sequence, most preferably type ⁇ turn sequence ( ⁇ , L. Sibanda et al., J. Mol. Biol , 1989, 206, 4, 759-777; B, L. Sibanda et al., Methods Enzymol., 1991, 202, 59-82).
  • the turn sequence in the present invention is H. Jane Dyson et al, Eur. J. Biochem. 255: 462-471 (1998), which is incorporated herein by reference, which can be used as turn sequences include the following amino acid sequences: X-Pro-Gly-Glu-Val; Ala-X-Gly— Ghi-Val (X is selected from 20 amino acids).
  • X is selected from 20 amino acids.
  • the peptide linker connects two strands arranged in parallel or two strands arranged in an antiparallel manner. desirable.
  • Peptide linkers can be used in any known in the art.
  • the sequence of a suitable peptide linker may be selected in consideration of the following factors: (a) the ability to be applied to flexible extended conformation; (b) the ability not to create secondary structures that interact with biological target molecules; And (c) the absence of hydrophobic residues or residues with charges that interact with the biological target molecule.
  • Preferred peptide linkers are Gly, Asn And Ser residues. Other neutral amino acids such as Thr and Ala can also be included in the linker sequence. Suitable amino acid sequences for linkers are described in Marat ea et al. , Gene 40: 39-46 (1985); Murphy et al. , Proc. Natl. Acad Sci. USA 83: 8258-8562 (1986); US Pat. Nos. 4, 935,233, 4,751,180, and 5,990,275.
  • the peptide linker sequence may consist of 1-50 amino acid residues.
  • the structural stabilization site is a ⁇ -hairpin, a linker linked to a beta-sheet or a linker to a leucine zipper, more preferably the structural stabilization site is a ⁇ -hairpin or a linker linked to a ⁇ -sheet And most preferably ⁇ -hairpin.
  • ⁇ -hairpin refers to the simplest protein motif comprising two ⁇ strands, the two ⁇ strands representing an antiparallel alignment with each other. In this ⁇ -hairpin the two ⁇ strands are generally linked by turn sequences.
  • the turn sequence applied to the ⁇ -hairpin is a type I, type ⁇ , type n, type ⁇ ', type m or type m' turn sequence, more preferably type I, type r, type ⁇ , type ⁇ 'turn sequence, even more preferably type I' or type ⁇ 'turn sequence, most preferably type
  • turn sequences ⁇ Also, turn sequences represented by X-Pro-Gly-Glu-Val; or Ala-X-Gly-Ghi-Val (X is selected from 20 amino acids) can also be used for ⁇ -hairpins. have.
  • the type I turn sequence is Asp-Asp-Ala-Thr-Lys-Thr
  • the type ⁇ turn sequence is Glu-Asn-Gly-Lys
  • the type ⁇ turn sequence is X-Pro -Gly-Glu-Val
  • Ala-X-Gly— Glu-Val X is selected from 20 amino acids
  • the type ⁇ 'turn sequence is Glu-Gly-Asn-Lys or Glu-D-Pro—Asn -Lys.
  • Peptides with ⁇ -hairpin formulations are well known in the art. Tryptophan zipper, as disclosed in, for example, US Pat. No. 6,914,123 and Andrea G. Cochran et al., PNAS, 98 (10): 5578-5583, template-fixed-hairpins as disclosed in WO 2005/047503.
  • the ⁇ -hairpin variants disclosed in Mimectic, US Pat. No. 5,807,979 are well known.
  • ⁇ - Peptides with hairpin conformation are described in Smith & Regan (1995) Science 270: 980-982; Chou & Fassman (1978) Annu. Rev. Biochem.
  • tryptophan zipper is used.
  • the tryptophan zipper used in the present invention is represented by the following general formula (I):
  • 3 ⁇ 4 is Ser or Gly-Gki, ⁇ and X ' 2 are independently Thr, His, Val, lie, Phe or Tyr, 3 ⁇ 4 is Trp or Tyr, X4 is Type I, Type ⁇ ', Type ⁇ , Type ⁇ ′ or type m or type ⁇ turn sequence, 3 ⁇ 4 is Trp or Phe, X 6 is Trp or Val, and X 7 is Lys or Thr-Glu.
  • 3 ⁇ 4 in Formula I is Ser or Gly-Glu
  • 3 ⁇ 4 and X'2 are independently of each other Thr, His or Val, 3 ⁇ 4 is Trp or Tyr, X4 is type I, type ⁇ , type ⁇ or type ⁇ 'turn sequence, 3 ⁇ 4 is Trp or Phe, 3 ⁇ 4 is Trp or Val and X 7 is Lys or Thr-Glu.
  • 3 ⁇ 4 in Formula I is Ser or Gly-Glu
  • X 2 and X'2 are independently of each other Thr, His or Val
  • 3 ⁇ 4 is Trp
  • 3 ⁇ 4 is Trp
  • 3 ⁇ 4 is Trp
  • X 7 is Lys or Thr—Ghi.
  • 3 ⁇ 4 in Formula I is Ser, 3 ⁇ 4 and
  • X'2 is Thr
  • 3 ⁇ 4 is Trp
  • 3 ⁇ 4 is Trp
  • 3 ⁇ 4 is Trp
  • ⁇ 7 is Lys.
  • Xl is Ser, 3 ⁇ 4 and X'2 are
  • Trp is type ⁇ turn sequence (ENGK) or type ⁇ 'turn sequence (EGNK)
  • 3 ⁇ 4 is Trp
  • 3 ⁇ 4 is Trp
  • X 7 is Lys
  • amino acid sequences of tryptophan zippers suitable for the present invention are described in SEQ ID NOs: 1 to 3 and 5 to 10.
  • ⁇ -hairpin peptides usable as structural stabilization sites in the present invention are peptides derived from B1 domainin of protein G, ie GB1 peptides.
  • the structural stabilization site is preferably represented by the following general formula ⁇ :
  • 3 ⁇ 4 is Arg, Gly-Glu or Lys-Lys, 3 ⁇ 4 is Gin or Thr, 3 ⁇ 4 is type I, type ⁇ , type II, type ⁇ 'or type m or type ⁇ turn sequence, X4 is Gin, Thr- Glu or Gln-Glu.
  • the structural stabilization site of the general formula ⁇ is
  • 3 ⁇ 4 is Gly-Glu or Lys-Lys
  • 3 ⁇ 4 is type I, type 1 ', type ⁇ , type ⁇ ' or type m or type ⁇ turn sequence
  • 3 ⁇ 4 is Thr-Glu or Gln-Glu.
  • Exemplary amino acid sequences of GB1 ⁇ -hairpins suitable for the present invention are described in SEQ ID NO: 4 and 14 to 15 sequences.
  • ⁇ -hairpin peptides usable as structural stabilization sites in the present invention are described in SEQ ID NO: 4 and 14 to 15 sequences.
  • the structural stabilization site is preferably represented by the following general formula m:
  • 3 ⁇ 4 is Lys or Lys— Lys, 3 ⁇ 4 is Trp or Tyr, 3 ⁇ 4 is Val or Thr, X4 is type I, type ⁇ , type ⁇ , type ⁇ or type ⁇ or type ⁇ turn sequence, 3 ⁇ 4 is Trp or Ala, 3 ⁇ 4 is Trp or Val, and X 7 is Glu or Gln-Glu.
  • ⁇ -hairpin peptide that can be used as a structural stabilization site in the present invention is represented by the following general formula IV:
  • 3 ⁇ 4 is Lys-Thr or Gly, 3 ⁇ 4 is Trp or Tyr, 3 ⁇ 4 is type I, type r, type ⁇ , type ⁇ 'or type m or type m' turn sequence,
  • X4 is Thr-Glu or Gly.
  • amino acid sequences of the ⁇ -hairpins of Formulas III and IV are set forth in SEQ ID NOs: 11-12, 15-15 and 16-19
  • a ⁇ -sheet connected by a linker can be used as the structure stabilization site.
  • two or more amino acid strands, which are parallel or antiparallel, preferably antiparallel, are in an extended form, and hydrogen bonds are formed between the amino acid strands.
  • ⁇ -sheet structure two adjacent ends of two amino acid strands are connected by a linker.
  • linker the various turn-sequences or peptide linkers described above can be used.
  • the turn-sequence is used as the linker, the ⁇ -turn sequence is most preferred.
  • a leucine zipper or a leucine zipper linked by a linker may be used as the structural stabilization site.
  • the leucine zipper is a conservative peptide domain that causes dimerization of two parallel ⁇ -chains. , Generally found in proteins involved in gene expression Dimerization domain (“Leucine scissors”. Glossary of Biochemistry and Molecular Biology (Revised). (1997). Ed. David M. Glick. London: Portland Press; Landschulz WH, et al. (1988) Science 240: 1759- 1764).
  • Leucine zippers generally comprise a heptad repeat sequence, with the leucine residues located at the fourth or fifth.
  • leucine zippers that may be used in the present invention include the amino acid sequence of LEALKEK, LKALEKE, LKKLVGE, LEDKVEE, LENEVAR, or LLSKNYH.
  • Specific examples of leucine zippers used in the present invention include SEQ ID NO: 39 sequence It is described in.
  • Each half of the leucine zipper consists of short ⁇ -hexes, with direct leucine contact between the ⁇ -hexes.
  • the leucine zipper in the transcription factor generally consists of a hydrophobic leucine zipper site and a basic site (site that interacts with the main groove of the DNA molecule). When the leucine zipper is used in the present invention, the basic site is not necessarily required.
  • Adjacent two ends of two amino acid strands (ie, two ⁇ -chains) in the leucine zipper structure may be linked by a linker.
  • linker various turn-sequences or peptide linkers described above may be used, preferably Peptide linkers are used that do not affect the structure of leucine zippers.
  • Random amino acid sequences are joined to both ends of the structure stabilization site described above.
  • the random amino acid sequence forms RTK-target binding site I and RTK-target binding site ⁇ .
  • One of the biggest features of the present invention is to prepare a peptide binder in a bipodal manner by connecting RTK-target binding site I and RTK-target binding site ⁇ at both ends of the structure stabilization site.
  • the RTK-target binding site I and the RTK-target binding site ⁇ cooperatively bind to the target, thereby greatly increasing the affinity for RTK.
  • the amino acid number n of the RTK-target binding site I is not particularly limited, preferably an integer of 2-100, more preferably an integer of 2-50, even more preferably an integer of 2-20, most preferably Preferably an integer of 3-10.
  • the amino acid number m of the RTK-target binding site ⁇ is not particularly limited, preferably an integer of 2-100, more preferably an integer of 2-50, Even more preferably an integer of 2-20, most preferably an integer of 3-10.
  • the RTK-target binding site I and the RTK-target binding site ⁇ may each contain different or the same number of amino acid residues.
  • the RTK-target binding site I and the RTK-target binding site ⁇ may include different or identical amino acid sequences, and preferably include different amino acid sequences, respectively.
  • the amino acid sequence included in the RTK-target binding site I and / or RTK-target binding site ⁇ is a linear amino acid sequence or a cyclic amino acid sequence.
  • at least one amino acid residue of the amino acid sequence included in the RTK-target binding site I and / or RTK-target binding site ⁇ is an acetyl group, a fluorenyl methoxy carbonyl group, It can be modified with formyl, palmitoyl, myristyl, stearyl or polyethylene glycol (PEG).
  • RTK ⁇ BPB of the present invention bound to a biological target molecule can be used for the regulation of physiological responses in vivo, detection of in vivo substances, in vivo molecular imaging, and drug delivery targeting, and also as an escort molecule. Can be.
  • cargo is added to the structure stabilization site, RTK-target binding site I or RTK-target binding site ⁇ (more preferably, the structure stabilization site, even more preferably the linker of the structure stabilization site).
  • cargoes include, but are not limited to, labels, chemicals, biopharmaceuticals or nanoparticles that generate detectable signals.
  • the label that generates the detectable signal may be a T1 contrast medium (e.g.,
  • T2 contrast materials e.g. superparamagnetics (e.g. magnetite, Fe 3 0 4 , Y-Fe 2 0 3 , manganese ferrite, cobalt ferrite and nickel ferrite)
  • radioisotopes e.g.
  • RTK-target binding site I and / or RTK-target binding site ⁇ comprises an amino acid sequence that binds to RTK.
  • RTK to which the BPB molecule of the present invention binds is a variety of known in the art
  • RT Epidermal growth factor receptor family
  • Insulin receptor family Platelet derived groowth factor receptor family
  • Fibroblast growth factor receptor family Vascular endothelial growth factor receptor family
  • HGF receptor family HGF receptor family
  • Trk receptor family Eph receptor family
  • AXL receptor family And LTK receptor family TIE receptor family
  • ROR receptor family DDR receptor family
  • RET receptor family KLG receptor family and RYK receptor family
  • MuSK receptor family RNA
  • RTK-BPB of the present invention binds to the extracellular domain of RTK, preferably RTK, and acts as an agonist or antagonist for RTK.
  • Agonists for RTK promote intracellular signaling triggered by RTK, and antagonists for RTK act to inhibit intracellular signaling triggered by RTK.
  • RTK-BPB of the present invention may bind to the extracellular domain of RTK exposed on the cell surface, but may also bind to the intracellular domain to regulate the action of GPCR.
  • RTK-BPB targets an intracellular domain
  • RTK- BPB additionally comprises a cell transmembrane peptide (CPP).
  • CPP cell transmembrane peptide
  • the CPP includes various CPPs known in the art and include, for example, HIV-1 Tat protein, oligoarginine, ANTP peptide, HSV VP22 transcriptional regulator protein, MTS peptide derived from vFGF, Penetratin, Transport an, Pep- 1 peptide, Pep-7 peptide, Buforin II, model amphiphatic peptide (MAP), k-FGF, Ku 70, pVEC, SynBl or HN-1, including but not limited to binding the CPP to bipodal peptide
  • MAP model amphiphatic peptide
  • k-FGF Ku 70
  • pVEC SynBl or HN-1
  • the bipodal tide binder of the present invention is typically " one strand-linker-structural stabilization site of the N-RTK-target binding site I-structure stabilization site-RTK-target binding site ⁇ -C " Has a construct of,
  • between the RTK-target binding site I and one strand of the structural stabilization site and / or between the other strands of the structural stabilization site -RTK-target binding site ⁇ in the RTK-bipodal peptide binder of the present invention Includes a structure influence inhibiting region that blocks the interstructural effects between the RTK-target binding site and the structure stabilization site.
  • At the site of rotation are amino acids that are relatively free of rotation of ⁇ and ⁇ in the peptide molecule.
  • the amino acids that are relatively free of rotation of 0 and 3 ⁇ 4 ⁇ are glycine, alanine and serine. 1-10 amino acids, preferably 1-8, and more preferably 1-3 amino acid residues may be located at the structure influence inhibitory site.
  • the library of RTK-bipodal peptide binders of the present invention having the constructs described above can be obtained by various methods known in the art.
  • the RTK-bipodal peptide binder will have a random sequence, which has no sequence preference or designation (or fixation) at any position of RTK-target binding site I and / or RTK-target binding site ⁇ . It means no amino acid residues.
  • a library of RTK-bipodal peptide binders can be used for the split-synthesis method performed on solid support (eg, polystyrene or polyacrylamide resin) (Lam et al. (1991) Nature 354: 82; WO 92/00091). Can be built according to.
  • solid support eg, polystyrene or polyacrylamide resin
  • the library of RTK-bipodal peptide binders is constructed in a cell surface display manner (eg, phage display, bacterial display or yeast display).
  • the library of RTK-bipodal peptide binder may be prepared through a display method based on plasmid, bacteriophage, phagemid, yeast, bacteria, mRNA or ribosomes.
  • Phage display is a technique for displaying various polypeptides in the form of proteins fused to coat proteins on the surface of the phage (Scott, JK and Smith, GP (1990) Science 249: 386; Sambrook, J. et al., Molecular Cloning.
  • a random peptide is displayed by fusing the gene to be expressed in gene m or gene VII of the filamentous phage (eg M13).
  • Phageimide may be used for the fiji display.
  • Phageimide is a plasmid vector with a copy of the bacterial origin (eg, ColEl) and one copy of the intergenic site of the bacteriophage. DNA fragments cloned in this phagemid are propagated like plasmids.
  • a preferred embodiment of the present invention comprises the following steps: (i) a phage coat protein (eg, gene m of a filamentous phage such as M13 or A fusion gene in which a gene encoding a gene ⁇ coat protein) and a gene encoding a bipodal piptide binder are fused; And constructing a library of expression vectors comprising transcriptional regulatory sequences (eg, lac promoters) operably linked to the fusion gene; (ii) introducing said expression vector library into a suitable host cell; (iii) culturing the host cell to form recombinant phage or phagemid virus particles so that the fusion protein is displayed on the surface; (iv) contacting the RTK molecule with the viral particle to bind the particle to the target molecule; And (V) separating particles not bound to RTK molecules.
  • a phage coat protein eg, gene m of a filamentous phage such as M13 or A fusion gene in which
  • the method for preparing an expression vector comprising a gene of a bipodal tempide binder may be carried out according to methods known in the art.
  • known phagemids or phage vectors eg, pIGT2, fUSE5, fAFFl, fd-CATl, m663, fdtetDOG, pHENl, pComb3, pComb8, pCANTAB 5E (Pharmacia), LamdaSurfZap, pIF4, PM48, PM52, PM54, fdH
  • An expression vector can be prepared by inserting a bipodal peptide binder gene into p8V5).
  • phage display methods are performed using filamentous phage, lambda phage display (W0 95/34683; US Pat. No. 5,627,024), T4 phage display (Ren et ah (1998) Gene 215: 439; Zhu (1997) CAN 33: 534) and # 7 phage display (US Pat. No. 5,766,905) can also be used to build libraries of bipodal peptide binders.
  • the method of introducing the vector library into a suitable host cell can be carried out according to various transformation methods, most preferably according to the electroporation method (see US Pat. Nos. 5,186,800, 5,422,272, 5,750,373).
  • Suitable hosts are Gram-negative bacterial cells such as E. coli, and suitable E. coli hosts are JM101, E ' coli K12 strain 294, E. coli strain W3110 and E ⁇ coli XL-lBlue. (Stratagene), including but not limited to. It is recommended that host cells be prepared as competent cells prior to transformation (Sambrook, J. et al., Molecular Cloning. A Laboratory Manual, 3rd ed. Cold Spring Harbor Press (200D), Selection of Transformed Cells).
  • Is generally carried out by culturing in a medium comprising antibiotics (eg, tetracycline and ampicillin)
  • the selected transformed cells are further cultured in the presence of helper phage to generate recombinant phage or phagemid virus particles.
  • Suitable phages include, but are not limited to, Ex helper phage, M13-K07, M13-VCS, and R408.
  • the selection of viral particles that bind to biological target molecules can typically be carried out through a biopanning process. (Sambrook, J Hugheset al., Molecular Cloning. A Laboratory Manual, 3rd ed. Cold Spring Harbor Press (2001); Clackson and Lowman, Ph age Display, Oxford University Press (2004).
  • the present invention provides a nucleic acid molecule encoding the aforementioned RTK-bipodal peptide binder.
  • the present invention provides a vector for expressing an RTK-bipodal peptide binder comprising a nucleic acid molecule encoding an RTK-bipodal peptide binder.
  • the present invention provides a transformant comprising a vector for expressing an RTK-bipodal peptide binder.
  • nucleic acid molecule is meant to encompass DNA (gDNA and cDNA) and RNA molecules inclusively, and the nucleotides that are the basic building blocks of nucleic acid molecules are naturally modified nucleotides, as well as modified sugar or base sites.
  • Analogues Schott-Propanediol, RNA-Propanediol, RNA-Propanediol, RNA-Propanediol-N-phosphatethyl-N-phosphatethyl-N-phosphatethyl-N-phosphatethyl, RNA molecules, and the nucleotides that are the basic building blocks of nucleic acid molecules are naturally modified nucleotides, as well as modified sugar or base sites.
  • the vector of the present invention is a powerful promoter (for example, tac promoter, lac promoter, / adJV5) capable of promoting transcription to the nucleic acid molecule in addition to the nucleic acid molecule encoding RTK—bipodal peptide binder.
  • promoter for example, tac promoter, lac promoter, / adJV5
  • Promoter Ipp promoter, promoter, promoter, rac5 promoter, shock promoter, recA promoter, SP6 promoter, trp promoter and T7 promoter, etc.
  • ribosomal binding site for initiation of translation and transcription / detox termination sequence.
  • the vector of the invention may further comprise a signal sequence (eg pelB) on the 5'-direction of the nucleic acid molecule encoding the RTK-bipodal peptide binder.
  • the vector of the present invention further includes a tagging sequence (eg, myc tag) for confirming that the bipodal peptide binder is well expressed on the surface of the phage.
  • the vector of the invention comprises a phage coat protein, preferably a gene encoding a filamentous phage gene m or gene VI coat protein.
  • the vector of the present invention comprises an origin of replication of bacteria (eg ColEl) and / or a bacteriophage.
  • Vectors may include antibiotic resistance genes commonly used in the art as selectable markers, e.g. ampicillin, gentamicin, carbenicillin, chloramphenicol, streptomycin, kanamycin, geneticin, neomycin and tetracycline. It may include a resistance gene for.
  • the transformants of the present invention are preferably Gram-negative bacterial cells such as E. coli, and suitable E. coli hosts are JM101, E. coli K12 strain 294, E. coli strain W3110 and E. coli XL-lBlue (Stratagene ), But is not limited thereto.
  • Methods for carrying the vector of the present invention into a host cell include the CaCl 2 method (Cohen, SN et al., Proc. NatL Acac. Sc USA, 9: 2110-2114 (1973)), one method (Cohen, SN et al., Proc. Natl. Acac. ScL USA, 9: 2110-2114 (1973); and Hanahan, D., J, Mol. Biol., 166: 557-580 (1983)) and electroporation methods (US patents). 5,186,800, 5,422,272, 5, 750, 373), or the like. ⁇
  • the RTK-bipodal peptide binders of the present invention exhibit very low levels (e.g., nM levels) of 3 ⁇ 4 values (dissociation constants) to provide peptides with very high affinity to RTK molecules.
  • the bipodal peptide binder exhibits about 10 2 -10 5 times (preferably about 10 3 -10 4 times) high affinity as compared to the binder made in the monopodal manner.
  • the RTK-bipodal peptide binder of the present invention not only has a use as a medicament, but also can be used for the detection of substances in vivo, in vivo molecular imaging, in vitro cell imaging and drug delivery, and as an escort molecule.
  • the features and advantages of the present invention are as follows:
  • the present invention provides RTK-BPB that specifically binds to RTK.
  • RTK-bipodal peptide binder of the present invention In the RTK-bipodal peptide binder of the present invention, two distant RTK-target binding sites bound to both ends of the structural stability site are cooperatively and synergetically with each other. To the target. (iii) The RTK-bipodal peptide binder of the present invention thus exhibits very low levels (eg nM levels) of K D values (dissociation constants), resulting in very high affinity to the target.
  • RTK-BPB of the present invention binds to RTK in vivo and can act as an antagonist or agonist on RTK.
  • La shows a schematic diagram of a bipodal-peptide binder and RTK-BPB including ⁇ -hairpin as a structural stabilization site.
  • Lb shows a schematic diagram of RTK-BPB including ⁇ -sheets linked by linkers as structural stabilization sites.
  • Figure lc shows a schematic of RTK-BPB comprising leucine zippers linked by linkers as structural stabilization sites.
  • FIG. ID shows a schematic of RTK-BPB including leucine-rich motifs linked by linkers as structural stabilization sites.
  • 2 shows a strategy for cloning the RTK-BPB library.
  • the pelB signal sequence, myc tag is a tagging sequence to confirm that the target gene is well expressed on the surface of the phage.
  • the lac promoter was used as a promoter.
  • Figure 4a is a result of measuring the affinity of a specific bipodal peptide binder that binds to the pyronectin ED-B protein.
  • Figure 4b is the result of measuring the affinity for the demonstration of the synergistic effect of the bipodal peptide binder BPB.
  • 5 is a result of measuring the affinity of the bipodal peptide binder by replacing the structure stabilization site in the bipodal tempide binder with several -hairpin motifs instead of tryptophan zipper.
  • 6 is a result of measuring the affinity of the bipodal peptide binder by replacing the structural stabilization site with leucine zipper instead of tryptophan zipper in the bipodal peptide binder.
  • Figure 7 is a result of measuring the affinity using the SPR Biacore system CBiacore AB, Uppsala, Sweden to synthesize a peptide for HER2.
  • Beta-Fl (5'-TOTATGCGGCCCAGCTGGCC (NNK) 6 GGATCTTGGACATGGGAAAACGGAAAA-3 ') and Beta-Bl (5'- MCAGTTTCTGCGGCCGCTCCTCC TCC (MNN) 6 TCCCTTCCATGTCCArnTCCGTT-3 * )
  • N is A, T, T, C; K is G or T; M is C or A.
  • ExTaq DNA polymerase 1 / ⁇ (Takara, Seoul, Korea) and 5 ⁇ of 10XPCR buffer were mixed to make a total of 25 mixtures with distilled water added to a total of 50 ⁇ .
  • CIAP Calf Intestinal Alkaline
  • PIGT2 phagemid vector using DNA ligase (Bioneer, Dae j eon, Korea)
  • Electroporation was performed by dispensing 25 // 100 phylamide vector 12g and a bipodal peptide binder into a 2.9 f insert DNA. Competent cells were dissolved on ice, mixed with 200 ⁇ of competent cells and mixed with solution 4 ⁇ , then placed in a prepared 0.2 cm cuvette and placed on ice for 1 minute. The electroporator (BioRad, Hercules, CA) was programmed at 200 ⁇ at 25 uF and 2,5 kV, drained the prepared cuvettes, placed in the electroporator and pulsed (time constant is 4.5-5 msec). . Thereafter immediately placed in 1 LB medium containing 20 mM glucose prepared at 37 ° C. A total of 25 cells obtained were transferred to 100 test tubes.
  • Recombinant phage was produced in a bipodal peptide binder library stored at -80 ° C.
  • Ampicillin 50 // g / and 20 mM glucose
  • Library 1 stored at -80 ° C, and mixed at a speed of 150 rpm at 37 ° C for one hour.
  • Culture medium 50 iig / m and kanamycin (25 g / rnl)
  • Biopanning was performed for HER2 as a representative receptor of RTK.
  • Fibronectin ED-B was selected as a model protein for confirming the basic operation of BPB, and also biopanning was performed.
  • Biopanning was performed on the BPB (Bipodal-peptide binder) library prepared in Example 1 for each protein five times and the output phage / input phage ratio of the phage peptides recovered in each panning step was determined. ⁇
  • the protein (5) was placed in 10 wells of a 96 well ELISA plate (Corning) by 50 ⁇ , left overnight at 4 ° C, and blocked for 2 hours at room temperature using 2% BSA the next day. All were discarded and washed three times with 0.1% PBST, where 800 ⁇ and 10% BSA 200 ⁇ of bipodal peptide binder recombinant phages were mixed, transferred to 10 wells bound to GPR 39 protein, and left at room temperature for 1 hour.
  • ELISA of each input phage of the bipodal peptide binder library was performed on HER2ECD, straptavidin, BSA and ED-B. Put 10 jug / i HER2ECD 50 ⁇ into 10 wells on a 96 well ELISA plate, add 10 s / ml BSA into 10 wells 50 ⁇ per well, and 10 us / ml straptavidin 50 ⁇ per well put in and allowed to stand for one day at 4 ° C. washed three times all the wells with 0.1% PBST following day and for 1 hour at 37 0 C using a 2% BSA by dilution in PBS blocking the rear, away all of the solution 0.1% Trituration was washed with PBST.
  • the supernatant was removed and the precipitated cells were resuspended in 1 ⁇ LB medium containing ampicillin (50 ⁇ / ⁇ ) and kanamycin (25 ⁇ g / mi) o ⁇ .
  • the mixture was incubated at 30 ° C at a speed of 200 rpm and incubated for one day.
  • the culture was centrifuged at 10,000Xg, 20 minutes and 4 ° C conditions to recover the supernatant, and then 23 ⁇ 4 skim milk was added and used for phage peptide search.
  • HER2 or Fibronectin ED-B was added to 30 wells at 50 ⁇ for each well, and 10 / BSA was added to 30 wells at 50 for each well and left at 4 ° C for one day. The following day all wells were washed three times with 0.1% PBST and blocked for 2 hours at room temperature using 2% skim milk distilled with PBS, then discarded the solution and washed three times with 0,1% PBST, each clone. 100 ⁇ aliquots of the amplified phage peptide solution were dispensed into all wells and allowed to stand for 1 hour and 30 minutes at 27 ° C.
  • ED-B-specific bipodal peptide binder peptide was synthesized (Anigen, Korea) from DNA sequencing. It was performed using BIAcore X (Biacore AB, Uppsala, Sweden). ED-B was immobilized by as much as 2,000 RU of biotin-EDB on a straptavidin SA chip (Biacore). PBS (pH 74) was used as the running buffer, and the flow was measured at various concentrations while holding at 30 ⁇ per minute, and then the affinity was calculated using BIAevaluation software (Biacore AB, Uppsala, Sweden). Experiment result
  • a stable beta-hairpin motif was used as the structure stabilization site of the bipodal peptide binder.
  • a tryptophan zipper (Andrea et al., Proc. Natl. Acad. Sc 98: 5578-5583 (2001)) which stabilizes the beta-hairpin motif structure by the interaction of tryptophan-tryptophan amino acids was used.
  • Variable regions were created in two portions by randomly arranging six amino acids each at the N- and C-terminal portions of the backbone tryptophan zipper (FIG. La).
  • This is called a bipodal peptide binder and has variable regions on both sides so that it can be cooperatively attached to the antigen and thus have high affinity and specificity.
  • the structure stabilization site of the bipodal peptide binder may be configured in various ways as shown in FIGS.
  • the bipodal peptide binder library was fibronectin ED-B or
  • Each input phage of the library of bipodal peptide binders was subjected to ELISA for HER2, strapavidin and BSA.
  • the response of the first input phage was similar in absorbance of HER2, Streptavidin, and BSA, but the brightness of HER2 was 3,7 times higher than that of Streptavidin and 3.14 times higher than that of BSA at the seventh input phage.
  • the absorbance of HER2 at the seventh input Streptavidin showed higher reactivity than BSA, indicating that biopanning was successfully performed on AR—DBD (FIG. 3).
  • Example 9 Phage Peptide Search (Phase ELISA) and Sequencing Specific to a Target
  • the phages recovered at the highest output / input ratio during the panning step of each library were obtained in plaque form.
  • ELISA was performed on BSA after amplifying 60 phages from each plaque. Clones with higher absorbances compared to BSA were selected for DNA sequencing, from which peptide sequences specific for each overlapping protein were obtained (Tables 2a and 2b).
  • Example 10 Determination of the Affinity of Fibronectin ED-B
  • the peptide for fibronectin ED-B was synthesized and affinity was measured using the SPR Biacore system (Biacore AB, Uppsala, Sweden).
  • affinity was measured using the SPR Biacore system (Biacore AB, Uppsala, Sweden).
  • affinity was measured using the SPR Biacore system (Biacore AB, Uppsala, Sweden).
  • affinity for fibronectin ED-B peptide 1 showed 620 nM
  • peptide 2 showed 75 nM
  • peptide 3 showed 2.5 ⁇ (FIG. 4A).
  • Example 11 Confirmation of Co-action Effect by SPRCSurface Plasmon Resonance N- and C-terminus of Peptide 2 to ED-B of Table 2a having the highest affinity to demonstrate the co-action effect of the bipodal peptide binder on the antigen Peptides were removed from each other to synthesize affinity.
  • the affinity of the N-terminal part was 592 ⁇ M and the C-terminal part was 12.8 ⁇ M (FIG. 4B).
  • the synergistic effect exhibited by having bipodal in the bipodal peptide binder proved to be an affinity of 43 nM (FIG. 4A).
  • Example 12 Binding Assays for Other ⁇ -Hairpins
  • p-doping peptides were synthesized with N-terminal sequence (HCSSAV) and C-terminal sequence (IIRLEQ) of Peptide2 that specifically bind ED-B to other ⁇ -hairpin skeletons GBlm3 and HP7 (Anigen , Korea). That is, the sequence of the bipodal peptide binder containing tryptophan zipper is HCSSAVGSWTWENGKWTWKGI IRLEQ, the bipodal peptide binder containing GBlm3 is HCSSAVGKKWTY PA GKFTVQEGIIRLEQ, and the bipodal peptide binder containing HP7 is HCSSAVGKTWNPA GKWTEGIQ.
  • CSSPIQGGSM QLEDKVEELLSKNYHLENEVARLKKLVGER and I IRLEQGGSMKQLEDKVEELLSKNYHLENEGERBARLK peptide to have a ⁇ -terminal sequence (HCSSAV) and a C-terminal sequence (IIRLEQ) of peptide 2 that specifically bind ED-B to leucine zippers as structural stabilization sites instead of the ⁇ -hairpin backbone.
  • HSSAV ⁇ -terminal sequence
  • IIRLEQ C-terminal sequence
  • leucine zipper showed an affinity of 5 ⁇ , which is lower than similar affinities of tryptophan zipper (43 ⁇ ), but leucine zipper also functions as a structural stabilizing site for bipodal peptide binders. It can be seen that (FIG. 6).
  • Recombinant phage that specifically binds to HER2 protein was tested for specificity using ELISA.
  • 5 fig / ml of each protein was added to the wells of 50 ⁇ each day, washed three times with 0.13 ⁇ 4 PBST (Tween-20) the next day and blocked for 2 hours at room temperature using 23 ⁇ 4 BSA. The solution was discarded and washed three times with 0,1% PBST.
  • Recombinant phage having the peptide of the present invention was well mixed with 2% BSA and dispensed into wells having 10 proteins bound by 100, and left at 27 ° C for 2 hours.
  • HRP-conjugated anti-M13 antibody (GE Healthcare) was diluted 1: 1,000 and reacted at 27 ° C for 1 hour. After washing 5 times with 0 ' 1% PBST, 100 ⁇ TMB solution was dispensed to induce a color reaction, and then the reaction was stopped by adding 1M HC1 100 ⁇ and absorbance was measured at 450 nm.
  • a bipodal peptide binder peptide specific for HER2 overlapped in DNA sequencing was synthesized (Anigen, Korea). Affinity was measured using BIAcore X (Biacore AB, Uppsala, Sweden). Fixed to CM5 chip (Biacore) using EDC / NHS. PBS (pH 7.4) was used as the running buffer, and the flow was measured at various concentrations at 30 ⁇ / min and the affinity was calculated using BIAevaluation software (Biacore AB, Uppsala, Sweden).
  • Cell recognition experiments were performed using CH0 cells (American Type Culture Collection), which are deficient cells. First, attach BT-474 and CH0 cells to the cover slide the day before sample processing. The next day, the peptide with FITC (sigma) was treated with BT-474 and CH0 cells at 4 ° C. for lh, followed by washing with PBS, followed by imaging using a confocal microscope (Carl zeiss).
  • the peptide for HER2 was synthesized and affinity was measured using the SPR Biacore system (Biacore AB, Uppsala, Sweden). The affinity to HER2 was measured and found to be 89 nM.
  • Recombinant phage that specifically binds to each protein was tested for specificity using ELISA.
  • 5 // g / of each protein was added to the wells by 50 ⁇ , washed three times with 0.1% PBST (Tween-20) the next day and blocked for 2 hours at room temperature using 2% BSA. The solution was then discarded and washed three times with 0.13 ⁇ 4) PBST, where recombinant phages having peptides of the present invention were well mixed with 2% BSA and dispensed into wells containing 10 proteins bound at 100 ⁇ by 27 °. It was left at C for 2 hours.
  • Imaging experiments were conducted to determine whether the peptide can recognize HER2 of cells using BT-474 cells overexpressing HER2 and CH0 cells with low expression. As shown in the figure below, the peptide is also able to specifically recognize HER2 in cells.
  • Biopanning for VEGFRl was performed in the same process as HER2. The same method was used for each panning step, except that the cleaning process was increased in steps of 10, 20, 30 cycles of 0'1% PBST.
  • BPBIVEGFRI was synthesized (Anygen) and affinity was measured using BIAcore X.
  • VEGFRl was flowed into the CM5 chip (Biacore) by 7000 RU and fixed.
  • PBS pH7.4 was used as the running buffer, and the affinity was calculated by BIAevahiation after measuring the kinetics at various concentrations with a flow rate of 30 ⁇ / min.
  • the phage recovered in the last panning step of the bipodal peptide binder attached to VEGFRl was secured in the form of plaque. Thirty phages were amplified from each plaque and ELISA was performed on VEGFRl and BSA. DNA was sequenced from 12 clones that absorbed more than three times more absorbed than VEGFRl. Three duplicate peptide sequences were obtained. Peptide Sequences Found Through Screening
  • BPBIVEGFRI GNQWF IGGGSWT ENGKWTWKGRIPKNR
  • BPB2VE GFR1 GNQWF IGGGSWTWENGKWTWKGKLQNPM
  • BPB3VEGFRI GNQWF IGGGSWTWENGKWTWKGQQAIQP
  • VEGFRl VEGFR2
  • streptavidin HSA
  • TNF TNF
  • VEGF vascular endothelial growth factor
  • BPBIVEGFRI Affinity Study of BPBIVEGFRI Synthesized optimized peptides BPB1 chinhwaryeokreul VEGFR1 were measured using SPR system biacore ol. Affinity was measured and BPB1VEGFR1 had affinity of 1.0 uM.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Zoology (AREA)
  • Biophysics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Wood Science & Technology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • Toxicology (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Immunology (AREA)
  • Microbiology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Analytical Chemistry (AREA)
  • Peptides Or Proteins (AREA)

Abstract

본 발명은 (a) 가닥간(interstrand) 비공유결합이 형성된 패러럴(parallel), 안티패러럴(antiparallel) 또는 패러럴(parallel)과 안티패러럴(antiparallel) 아미노산 가닥들을 포함하는 구조 안정화 부위(structure stabilizing region); 및 (b) 상기 구조 안정화 부위의 양 말단에 결합되어 있고 무작위적으로 선택된 각각 n 및 m개의 아미노산을 포함하는 Cytokine-타겟 결합 부위 I(Cytokine-target binding region I) 및 Cytokine-타겟 결합 부위 Ⅱ(Cytokine-target binding region Ⅱ)를 포함하는 Cytokine에 특이적으로 결합하는 Cytokine-바이포달 펩타이드 바인더에 관한 것으로서, 본 발명의 Cytokine-바이포달 펩타이드 바인더는 Cytokine에 대하여 매우 낮은 수준(예컨대, nM 수준)의 KD 값(해리상수)을 나타내어, Cytokine 타겟에 매우 높은 친화도를 나타낸다. 본 발명의 Cytokine-바이포달 펩타이드 바인더는 의약으로서의 용도를 가질 뿐만 아니라, 인 비보 분자 이미징, 및 약물전달용 타겟팅을 하는 데 이용될 수 있으며, 에스코트 분자로도 매우 유용하게 이용될 수 있다.

Description

【명세서】
【발명의 명칭】
RTK에 특이적으로 결합하는 RTK— BPB 【기술 분야】
본 발명은 수용체 타이로신 키나아제 (receptor tyrosine kinase: RTK)에 특이적으로 결합하는 RTKᅳ BPB에 관한 것이다.
【배경 기술】
항체는 B 세포가 생산하는 혈장단백질의 일종인 면역글로불린 단백질로써 외부에서 들어온 항원의 특정부위를 특이적으로 인식하여 결합함으로써 항원을 비활성화하거나 무력화시킨다. 이러한 항원 -항체 반응의 특이성과 고도의 친화도 및 수천만 종류의 항원을 구별할 수 있는 항체의 다양성을 응용하여 오늘날 진단제와 치료제 등을 포함하는 많은 종류의 항체 제품이 출현하게 되었다. 현재 FDA 에서는 21 개의 단일클론항체를 승인하였으며 리턱시맵 (Rituximab) 및 헤르셉틴 (Herceptin)과 같은 항체는 다른 치료에서 전혀 반웅을 보이지 않던 환자들의 50% 이상에서 효과를 보인바 있으며 실질적으로 여러 연구에서 단일클론항체를 이용하여 림프종， 대장암 또는 유방암 등에 성공적인 임상치료를 보여주고 있다. 치료용 항체의 전체 시장 규모는 2004 년 100 억 달러 규모에서 2010 년에는 300 억 달러로 연평균 20%의 성장률을 보일 것으로 추정하고 있으며, 그 시장 규모는 기하급수적으로 증가할 것으로 추정되고 있다. 항체를 이용한 신약개발이 활발해지는 이유는 약품의 개발기간이 짧으며 투자비용이 작고 부작용을 쉽게 예측할 수 있기 때문이다. 또한 항체는 생약이어서 인체가 거의 영향을 받지 않으며 체내에서의 반감기가 저 분자량 약품에 비하여 압도적으로 길어서 환자에게 친화적이다. 이러한 유용성에도 불구하고 인간에서 단일클론항체는 외래 항원으로 인식하여 심한 알레르기 반응 또는 과민반웅을 일으키기도 한다. 또한, 이러한 항암 기능의 단클론 항체를 임상적으로 사용할 경우 생산 단가가 높기 때문에 치료제로서의 가격이 급격히 상승한다는 단점이 있으며， 항체를 배양하는 방법 및 정제 방법 등 광범위한 분야의 기술들이 각종 지적 소유권에 의해 보호받고 있기 때문에 비싼 라이센싱비를 지불해야 한다.
따라서 이 문제를 해결하기 위해서 미국을 중심으로 유럽연합에서 항체 대체 단백질 개발이 태동기에 있다. 항체 대체 단백질은 항체와 같이 불변영역과 가변영역을 가질 수 있도록 만든 재조합 단백질로 크기가 작고 안정한 단백질의 일정부분을 무작위 서열의 아미노산으로 바꾸어 라이브러리를 만들고 이를 표적물질에 대해 스크리닝을 하여 높은 친화력과 좋은 특이성을 가진 물질을 찾을 수 있다. 예를 들어 항체 대체 단백질중 아비머 (avimer)와 아피바디 (af f ibody)는 표적물질에 대해 피코몰 (picomole) 정도의 친화력을 가진 예시가 보고되어 있다. 이런 항체 대체 단백질은 크기가 작고 안정해서 암세포에 깊이 침투 가능하며 일반적으로 면역반응을 적게 일으킨다고 보고되어 있다. 그리고 무엇보다도 광범위한 항체 특허 문제에서 벗어 날 수 있으며 박테리아에서 쉽게 대량정제 할 수 있기 때문에 생산단가가 낮아 경제적으로 항체보다 큰 장점을 가진다. 현재 개발된 항체 대체 단백질은 40 개가 있으나 이 중 벤처 회사나 다국적 제약회사에서 상용화를 시도하고 있는 항체 대체 단백질은 피브로넥틴 타입 m 도메인, 리포칼린， LDLR-A 도메인， 크리스탈린， 프로테인 A, 안키린 리피트 (Ankyrin repeat), BPTI 라는 단백질올 이용하고 있으며 타겟에 대한 피코몰에서 수 나노몰정도의 높은 친화력을 가지고 있다. 그 중 애드넥틴 (Adnectin), 아비머， 쿠니츠 (Kunitz) 도메인은 현재 FDA 임상 실험이 진행 중이다,
본 발명은 지금까지의 단백질을 이용한 항체대체 단백질과는 다른 펩타이드 기반 항체대체 단백질에 초점을 맞추었다. 펩타이드는 항체에 비해 적절한 약물동력학, 대량생산성, 낮은 독성, 항원성 억제 및 낮은 생산 단가 등으로 인해 현재 항체 치료제를 대체하여 다양하게 활용되고 있다. 치료용 약으로서의 펩타이드의 장점은 생산 단가가 낮고， 안전성 및 반응성이 높으며, 특허 로얄티가 상대적으로 저렴하고, 원하지 않는 면역시스템에 덜 노출되어 펩타이드 자체에 대한 항체 생산을 억제 할 수 있으며, 합성을 통한 변형이 쉽고 정확하다는 것이다. 그러나 대부분의 펩타이드는 항체에 비해 특정 단백질 타켓에 대해 낮은 친화력 및 특이성을 보이기 때문에 여러 웅용분야에 사용되지 못하는 단점이 있다. 따라서, 펩타이드의 단점을 극복할 수 있는 새로운 펩타이드 기반 항체 대체 단백질 개발에 대한 요구가 당업계에 대두되고 있다. 이에 본 발명자들은 생물학적 타겟 분자에 높은 친화성으로 특이적 결합이 가능한 펩타이드 물질을 개발하고자 노력하였다. 이는 현재 매우 많은 타겟에 대해 보고된 낮은 친화력를 가진 펩타이드를 이용하여 빠른 시간안에 높은 친화성 및 특이성을 가진 신약후보를 만들 수 있는 기술이 될 것으로 기대된다.
한편， 수용체 타이로신 키나아제는 많은 성장인자， 사이토카인 및 호르몬에 대한 세포표면 수용체이다. 인간 지놈에서 발견된 약 90 개의 타이로신 키나아제 유전자 중에서 58 개 유전자는 수용체 타이로신 키나아제를 코딩한다 (Robinson DR et al . , Oncogene 19(49) :5548- 5557(2000)). 수용체 타이로신 키나아제 (RTKs)는 정상적인 세포 프로세스들에서 중요한 조절자의 역할을 할 뿐 아니라, 많은 암의 발생 및 발전에 중요할 역할을 한다 (Zwick, E. et al., .Endocr. Relat. Cancer 8(3) :161- 173(2001)). 따라서 RTKs 를 타겟으로 한 많은 의약 개발이 이루어지고 있다.
본 명세서 전체에 걸쳐 다수의 논문 및 특허문헌이 참조되고 그 인용이 표시되어 있다. 인용된 논문 및 특허문헌의 개시 내용은 그 전체로서 본 명세서에 참조로 삽입되어 본 발명이 속하는 기술 분야의 수준 및 본 발명의 내용이 보다 명확하게 설명된다.
【발명의 상세한 설명】
본 발명자들은 본 발명자들은 RTK 결합성 및 특이성에 기초하여 다양한 물질들을 세포 내 또는 세포 표면에 운반할 수 시스템을 개발하고자 노력하였다。 그 결과， 비교적 리지드 (rigid)한 펩타이드 골격을 가지는 구조안정화 부위의 양 말단에 무작위적 (random)으로 펩타이드를 결합시키고， 이 두 펩타이드를 공동으로 RTK 분자에 결합시키는 경우에는 크게 증가된 결합능 및 특이성을 가지는 바이포달 펩타이드 바인더 (BPB)를 얻을 수 있음을 확인함으로써， 본 발명을 완성하게 되었다。
따라서 본 발명의 목적은 RTK(receptor tyrosine kinase)-바이포달 펩타이드 바인더 (RTK-BPB)를 제공하는 데 있다, 본 발명의 다른 목적은 RTK receptor tyrosine kinase)-바이포달 펩타이드 바인더 (RTK-BPB)를 제공하는 데 있다.
본 발명의 다른 목적 및 이점은 하기의 발명의 상세한 설명, 청구범위 및 도면에 의해 보다 명확하게 된다. 본 발명의 일 양태에 따르면， 본 발명은 다음을 포함하는 RTKCreceptor tyrosine kinase)-바이포달 펩타이드 바인더 (RTK-BPB)을 제공한다:
(a) 가닥간 (interstrand) 비공유결합이 형성된 패러럴 (paral lei ) , 안티패러럴 (antiparallel) 또는 패러럴 (parallel)과 안티패러럴 (ant i paral lei) 아미노산 가닥들을 포함하는 구조 안정화 부위 (structure stabilizing region)； 및
(b) 상기 구조 안정화 부위의 양 말단에 결합되어 있고 무작위적으로 선택된 각각 n 및 m 개의 아미노산을 포함하는 RTK-타겟 결합 부위 KRTK- target binding region I) 및 RTK-타겟 결합 부위 n(RTK-target binding region Π )를 포함하는 RTK 에 특이적으로 결합하는 RTK-바이포달 펩타이드 바인더.
본 발명자들은 본 발명자들은 RTK 결합성 및 특이성에 기초하여 다양한 물질들을 세포 내 또는 세포 표면에 운반할 수 시스템을 개발하고자 노력하였다。 그 결과, 비교적 리지드 (rigid)한 펩타이드 골격을 가지는 구조안정화 부위의 양 말단에 무작위적 (random)으로 펩타이드를 결합시키고, 이 두 펩타이드를 공동으로 RTK 분자에 결합시키는 경우에는 크게 증가된 결합능 및 특이성을 가지는 바이포달 펩타이드 바인더 (BPB)를 얻을 수 있음을 확인하였다ᄋ
본 발명의 기본적인 전략은 리지드한 펩타이드 골격의 양 말단에 타겟에 결합되는 펩타이드를 연결하는 것이다. 이 경우 리지드한 펩타이드 골격은 바이포달 펩타이드 바이더의 전체적인 구조를 안정화시키는 작용을 하며, 타겟 결합 부위 I 및 타겟 결합 부위 Π가 타겟 분자에 결합되는 것을 강화시킨다。
본 발명에서 이용 가능한 구조안정화 부위는 패러럴, 안티패러럴 또는 패러럴과 안티패러럴 아미노산 가닥들을 포함하며， 가닥간 (interstrand) 수소결합, 정전기적 상호작용, 소수성상호작용， 반데르 발스 상호작용， 파이 -파이 상호작용， 양이온 -파이 상호작용 또는 이들의 조합에 의한 비공유결합이 형성되는 단백질 구조 모티프들을 포함한다. 가닥간 수소결합， 정전기적 상호작용， 소수성상호작용, 반데르 발스 상호작용, 파이 -파이 상호작용， 양이온 -파이 상호작용 또는 이들의 조합에 의한 형성되는 비공유결합은 구조안정화 부위의 견고성 (rigidity)에 기여한다.
본 발명의 바람직한 구현예에 따르면， 구조안정화 부위에서의 가닥간 (interstrand) 비공유결합은 수소결합， 소수성 상호작용， 반데르 발스 상호작용， 파이 -파이 상호작용 또는 이들의 조합을 포함한다.
선택적으로, 구조화안정화 부위에 공유결합이 있을 수 있다. 예를 들어, 구조화안정화 부위에 이황화결합을 형성시켜 구조안정화 부위의 견고성을 더 증가시킬 수 있다. 이러한 공유결합에 의한 견고성 증가는 바이포달 펩타이드 바인더의 타겟에 대한 특이도 및 친화도를 고려하여 부여한다.
본 발명의 바람직한 구현예에 따르면， 구조 안정화 부위의 아미노산 가닥들은 링커로 연결되어 있다. 본 명세서에서 가닥을 언급하면서 사용되는 용어 "링커" 는 가닥과 가닥을 연결시켜 주는 물질을 의미한다. 예컨대， 구조안정화 부위로서 β-헤어핀이 이용되는 경우에는 β-헤어핀에 있는 턴 서열이 링커의 역할을 하며， 루이신 지퍼가 이용되는 경우에는 루이신 지퍼의 두 C-말단을 연결하는 물질 (예컨대, 펩타이드 링커)이 링커의 역할을 한다.
링커는 패러럴, 안티패러럴 또는 패러럴과 안티패러럴 아미노산 가닥들을 연결한다. 예컨대， 패러럴 방식으로 정렬된 최소 2 개의 가닥 (바람직하게는 2 개의 가닥)， 안티패러럴 방식으로 정렬된 최소 2 개의 가닥 (바람직하게는 2 개의 가닥)， 패러럴 및 안티패러럴 방식으로 정렬된 최소 3개의 가닥 (바람직하게는 3개의 가닥)을 링커가 연결하게 된다.
본 발명의 바람직한 구현예에 따르면, 링커는 턴 서열 또는 펩타이드 링커이다。
본 발명의 바람직한 구현예에 따르면, 상기 턴 서열은 β-턴， Υ-턴, α一턴， π-턴 또는 ω-loop °]다 (Venkatachalam CM (1968) , Biopolymers, 6, 1425-1436； Nemethy G and Print z MP. (1972), Macro/no 1 ecu J es, 5, 755- 758； Lewis PN et al . , (1973), Biochim. Biophys. Acta, 303， 211-229； Toniolo C. (1980) CRC Crit. Rev. Biochem. , 9， 1-44； Richardson JS. (1981), Adv. Protein Chem. , 34, 167-339； Rose GD et al . , (1985), Adv. Protein Chem. , 37， 1-109； Milner-White EJ and Poet R. (1987), TIBS, 12, 189-192； Wilmot CM and Thornton JM. (1988), J. Mol. Biol., 203, 221- 232； Milner-White EJ. (1990), J. MoL BioL, 216, 385-397； Pavone V et al . (1996), Biopolymers, 38， 705-721； Rajashankar KR and Ramakumar S. (1996), Protein Sci . , 5， 932-946). 가장 바람직하게는， 본 발명에서 이용되는 턴 서열은 β-턴이다.
턴 서열로서 β-턴이 이용되는 경우， 바람직하게는 타입 I， 타입 I', 타입 π, 타입 π', 타입 m 또는 타입 m' 턴 서열이고, 보다 바람직하게는 타입 I， 타입 Γ; 타입 Π, 타입 π' 턴 서열이고， 보다 더 바람직하게는 타입 I' 또는 타입 π' 턴 서열이며, 가장 바람직하게는 타입 Γ 턴 서열이다 (Β, L. Sibanda et al., J. Mol. Biol. , 1989， 206, 4, 759- 777； B, L. Sibanda et al . , Methods Enzymol. , 1991, 202， 59-82).
본 발명의 다른 바람직한 구현예에 따르면， 본 발명에서 턴 서열로서 이용될 수 있는 것은 H. Jane Dyson et al , , Eur. J. Biochem. 255： 462- 471(1998)에 개시되어 있으며， 상기 문헌은 본 명세서에 참조로서 삽입된다, 턴 서열로 이용될 수 있는 것은 다음의 아미노산 서열을 포함한다: X-Pro- Gly-Glu-Val; Ala-X-Gly— Ghi-Val (X는 20 개의 아미노산으로부터 선택된다). 본 발명의 일 구현예에 따라, 구조안정화 부위로서 β-쉬트 또는 루이신 지퍼가 이용되는 경우， 패러럴 방식으로 정렬된 2 개의 가닥 또는 안티패러럴 방식으로 정렬된 2 개의 가닥을 펩타이드 링커가 연결하는 것이 바람직하다.
펩타이드 링커는 당업계에 공지된 어떠한 것도 이용 가능하다. 적합한 펩타이드 링커의 서열은 다음과 같은 요소를 고려하여 선택될 수 있다: (a) 유연한 연장된 컨포메이션 (flexible extended conformation)에 적용될 수 있는 능력; (b) 생물학적 타겟 분자와 상호작용 하는 이차구조를 생성하지 않는 능력; 및 (c) 생물학적 타겟 분자와 상호작용하는 소수성 잔기 또는 전하를 갖는 잔기의 부재. 바람직한 펩타이드 링커는 Gly, Asn 및 Ser 잔기를 포함한다. Thr 및 Ala 과 같은 다른 중성 아미노산들도 링커 서열에 포함될 수 있다. 링커에 적합한 아미노산 서열은 Marat ea et al . , Gene 40： 39-46 ( 1985)； Murphy et al . , Proc. Natl. Acad Sci . USA 83:8258-8562(1986)； 미국 특허 제 4， 935 ,233 호, 제 4,751,180 호 및 제 5,990,275 호에 개시되어 있다. 펩타이드 링커 서열은 1-50 아미노산 잔기로 구성될 수 있다.
본 발명의 바람직한 구현예에 따르면, 구조안정화 부위는 β-헤어핀， 링커로 연결된 β-쉬트 또는 링커로 연결된 루이신 지퍼이고, 보다 바람직하게는 구조안정화 부위는 β-헤어핀 또는 링커로 연결된 β- 쉬트이며， 가장 바람직하게는 β-헤어핀이다.
본 명세서에서 용어 "β-헤어핀" 은 두 개의 β 가닥을 포함하는 가장 간단한 단백질 모티프를 의미하며， 이 두 개의 β 가닥은 서로 안티패러럴한 정렬을 나타낸다. 이 β-헤어핀에서 두 개의 β 가닥은 일반적으로 턴 서열에 의해 연결된다.
바람직하게는, β-헤어핀에 적용되는 턴 서열은 타입 I, 타입 Γ , 타입 n, 타입 π', 타입 m 또는 타입 m' 턴 서열이고， 보다 바람직하게는 타입 I, 타입 r， 타입 π, 타입 π' 턴 서열이고， 보다 더 바람직하게는 타입 I' 또는 타입 π' 턴 서열이며, 가장 바람직하게는 타입
Γ 턴 서열이다ᅳ 또한， X-Pro-Gly-Glu-Val； 또는 Ala-X-Gly-Ghi-Val (X는 20 개의 아미노산으로부터 선택된다)으로 표시되는 턴 서열도 β—헤어핀에 이용될 수 있다.
본 발명의 예시적인 실시예에 따르면, 타입 I 턴 서열은 Asp-Asp- Ala-Thr-Lys-Thr 이고, 타입 Γ 턴 서열은 Glu-Asn-Gly-Lys 이며, 타입 Π 턴 서열은 X-Pro-Gly-Glu-Val； 또는 Ala-X-Gly— Glu-Val (X 는 20 개의 아미노산으로부터 선택된다)이고， 타입 Π ' 턴 서열은 Glu-Gly-Asn-Lys 또는 Glu-D-Pro— Asn-Lys이다。
β-헤어핀 콘포메이션을 갖는 펩타이드는 당업계에 잘 알려져 있다. 예를 들어 , 미국 특허 제 6,914,123호 및 Andrea G. Cochran et al .， PNAS, 98(10) :5578-5583)에 개시되어 있는 트립토판 지퍼， W0 2005/047503 에 개시되어 있는 주형-고정된 -헤어핀 미멕틱, 미국 특허 제 5，807，979호에 개시되어 있는 β-헤어핀 변형체들이 잘 알려져 있다. 이외에도， β- 헤어핀 콘포메이션을 갖는 펩타이드는 Smith & Regan (1995) Science 270:980-982; Chou & Fassman (1978) Annu. Rev. Biochem. 47:251-276; Kim & Berg (1993) Nature 362:267-270; Minor & Kim (1994) Nature 367:660- 663； Minor & Kim (1993) Nature 371:264-267; Smith et al. Biochemistry (1994) 33:5510-5517； Searle et al . (1995) Nat. Struct. Biol. 2:999- 1006； Haque & Gel 1 man (1997) J. Am. Chem. Soc. 119:2303-2304; Blanco et al. (1993) J. Am. Chem. Soc. 115:5887-5888; de Alba et al . (1996) Fold. Des, 1： 133-144； de Alba et al . (1997) Protein Sci. 6:2548-2560； Ramirez-AIvarado et al. (1996) Nat. Struct. Biol. 3:604—612; St anger & Gel 1 man (1998) J. Am, Chem. Soc. 120:4236-4237; Maynard & Searle (1997) Chem. Commun. 1297-1298； Griffiths-Jones et al . (1998) Chem. Commun. 789-790； Maynard et al . (1998) J. Am. Chem. Soc. 120:1996- 2007； 및 Blanco et al. (1994) Nat. Struct. Biol. 1： 584-590 에 개시되어 있으며, 상기 문헌은 본 명세서에 참조로서 삽입된다.
β-헤어핀 콘포메이션을 갖는 펩타이드를 구조안정화 부위로 이용하는 경우， 가장 바람직하게는 트립토판 지퍼를 이용한다.
본 발명의 바람직한 구현예에 따르면, 본 발명에서 이용되는 트립토판 지퍼는 다음 일반식 I로 표시된다:
일반식 I
Xi-Trp(X2)X3-X4-X5(X'2)X6-X7
¾은 Ser 또는 Gly-Gki이고, ι 및 X'2는서로 독립적으로 Thr, His, Val, lie, Phe 또는 Tyr 이며 , ¾는 Trp 또는 Tyr 이^， X4는 타입 I, 타입 Ι' , 타입 Π, 타입 Π' 또는 타입 m 또는 타입 ΠΓ 턴 서열이고， ¾는 Trp 또는 Phe이며 , X6는 Trp 또는 Val이고, X7는 Lys 또는 Thr-Glu이다.
보다 바람직하게는， 상기 일반식 I에서 ¾은 Ser 또는 Gly-Glu이고，
¾ 및 X'2 는 서로 독립적으로 Thr, His 또는 Val 이며, ¾ 는 Trp 또는 Tyr이고， X4는 타입 I, 타입 Γ， 타입 Π 또는 타입 Π' 턴 서열이고, ¾는 Trp또는 Phe이며， ¾는 Trp 또는 Val이고， X7는 Lys 또는 Thr-Glu이다. 보다 더 바람직하게는， 일반식 I 에서 ¾은 Ser 또는 Gly-Glu 이고， X2 및 X'2는 서로 독립적으로 Thr, His 또는 Val 이며 , ¾는 Trp 이고， 는 타입 I， 타입 I'， 타입 Π 또는 타입 Π' 턴 서열이고， ¾는 Trp이며， ¾는 Trp이고, X7는 Lys또는 Thr— Ghi이다.
보다 더욱 더 바람직하게는, 일반식 I 에서 ¾은 Ser 이고， ¾ 및
X'2는 Thr 이며 , ¾는 Trp 이고， 는 타입 Γ 또는 타입 Π' 턴 서열이고， ¾는 Trp이며, ¾는 Trp이고 , Χ7는 Lys이다.
가장 바람직하게는, 일반식 I 에서 Xl 은 Ser 이고， ¾ 및 X'2 는
Thr 이며， ¾는 Trp 이고, X4는 타입 Γ 턴 서열 (ENGK) 또는 타입 Π ' 턴 서열 (EGNK)이고， ¾는 Trp이며， ¾는 Trp이고， X7는 Lys이다,
본 발명에 적합한 트립토판 지퍼의 예시적인 아미노산 서열은 서열목록 제 1서열 내지 제 3서열 및 제 5서열 내지 제 10서열에 기재되어 있다.
본 발명에서 구조안정화 부위로서 이용가능한 β-헤어핀 펩타이드는 단백질 G의 B1도멘인으로부터 유래된 펩타이드, 즉 GB1 펩타이드이다. 본 발명에서 GB1 펩타이드가 이용되는 경우， 바람직하게는 구조안정화 부위는 다음 일반식 Π로 표시된다:
일반식 Π
X厂 Trp-¾-Tyr-¾— Phe-Thr-Va 1 -¾
¾은 Arg, Gly-Glu또는 Lys-Lys이고, ¾는 Gin또는 Thr이며， ¾는 타입 I, 타입 Γ, 타입 II， 타입 Π' 또는 타입 m 또는 타입 ΠΓ 턴 서열이고， X4는 Gin, Thr-Glu또는 Gln-Glu이다.
보다 바람직하게는, 일반식 π의 구조안정화 부위는 다음 일반식
ΙΓ으로표시된다:
일반식 Π
Xi-Trp-Thr-Tyr-X2-Phe-Thr-Va 1 -¾
¾은 Gly-Glu 또는 Lys-Lys 이고 , ¾는 타입 I， 타입 1'， 타입 Π, 타입 Π' 또는 타입 m 또는 타입 ΠΓ 턴 서열이고, ¾ 는 Thr-Glu 또는 Gln-Glu이다.
본 발명에 적합한 GB1 β-헤어핀의 예시적인 아미노산 서열은 서열목록 제 4서열 및 제 14서열 내지 제 15서열에 기재되어 있다. 본 발명에서 구조안정화 부위로서 이용 가능한 β-헤어핀 펩타이드는
HP 펩타이드이다. 본 발명에서 HP 펩타이드가 이용되는 경우， 바람직하게는 구조안정화부위는 다음 일반식 m으로 표시된다:
일반식 m
Xi-X2-X3-Trp-X4-X5-Thr-X6-X7
¾은 Lys 또는 Lys— Lys이고, ¾는 Trp또는 Tyr이고， ¾는 Val 또는 Thr 이며， X4는 타입 I， 타입 Γ, 타입 Π, 타입 ΓΓ 또는 타입 ΠΙ 또는 타입 ΠΓ 턴 서열이고， ¾는 Trp 또는 Ala 이며， ¾는 Trp 또는 Val 이고， X7은 Glu또는 Gln-Glu이다.
본 발명에서 구조안정화 부위로서 이용 가능한 또 다른 β-헤어핀 펩타이드는 다음 일반식 IV로 표시된다:
일반식 IV
Figure imgf000012_0001
¾은 Lys-Thr 또는 Gly이고, ¾는 Trp또는 Tyr 이고， ¾는 타입 I, 타입 r， 타입 π， 타입 π' 또는 타입 m 또는 타입 m' 턴 서열이고，
X4는 Thr-Glu또는 Gly이다.
일반식 III 및 IV 의 β-헤어핀의 예시적인 아미노산 서열은 서열목록 제 11 서열 내지 제 12 서열， 제 15 서열 및 제 16 서열 내지 제 19서열에 기재되어 있다ᅳ
본 발명에 따르면, 구조안정화 부위로서 링커로 연결된 β—쉬트를 이용할 수 있다. -쉬트 구조에서 패러럴 또는 안티패러럴한， 바람직하게는 안티패러럴한 두 개의 아미노산 가닥이 뻗은 구조 (extended form)로 되어 있으며, 아미노산 가닥사이에 수소 결합이 형성된다ᄋ
β-쉬트 구조에서 두 개의 아미노산 가닥의 인접한 두 말단은 링커에 의해 연결된다. 링커로서는 상술한 다양한 턴 -서열 또는 펩타이드 링커가 이용될 수 있다。 턴—서열이 링커로 이용되는 경우, β-턴 서열이 가장 바람직하다.
본 발명의 다른 변형예에 따르면， 구조안정화 부위로서 루이신 지퍼 또는 링커로 연결된 루이신 지퍼가 이용될 수 있다。 루이신 지퍼는 패러럴한 2 개의 α-사슬의 다이머화를 야기하는 보존성 펩타이드 도메인이며， 일반적으로 유전자 발현에 관여하는 단백질에 발견되는 다이머화 도메인이다 ("Leucine scissors" . Glossary of Biochemistry and Molecular Biology (Revised). (1997). Ed. David M. Glick. London: Portland Press; Landschulz WH, et al . (1988) Science 240:1759-1764). 루이신 지퍼는 일반적으로 헵태드 (heptad) 반복 서열을 포함하며, 루이신 잔기가 4 번째 또는 5 번째에 위치해 있다. 예를들어, 본 발명에 이용될 수 있는 루이신 지퍼는 LEALKEK, LKALEKE, LKKLVGE, LEDKVEE, LENEVAR또는 LLSKNYH 의 아미노산 서열을 포함한다, 본 발명에서 이용되는 루이신 지퍼의 구체적인 예를 서열목록 제 39 서열에 기재되어 있다. 루이신 지퍼의 각각의 반은 짧은 α—사술로 이루어져 있으며, α-사술간의 직접적인 루이신 접촉이 있다. 전사인자에 있는 루이신 지퍼는 일반적으로 소수성 루이신 지퍼 부위 및 염기성 부위 (DNA 분자의 주 그루브와 상호작용하는 부위)로 이루어져 있다. 본 발명에서 루이신 지퍼가 이용되는 경우에는 염기성 부위는 반드시 필요로 하지 않는다. 루이신 지퍼 구조에서 두 개의 아미노산 가닥 (즉， 두 개의 α-사슬)의 인접한 두 말단은 링커에 의해 연결될 수 있다。 링커로서는 상술한 다양한 턴 -서열 또는 펩타이드 링커가 이용될 수 있으며， 바람직하게는 루이신 지퍼의 구조에 영향올 미치지 않는 펩타이드 링커가 이용된다。
상술한 구조안정화 부위의 양 말단에는 무작위 아미노산 서열이 결합된다. 상기 무작위 아미노산 서열이 RTK-타켓 결합 부위 I 및 RTK- 타겟 결합 부위 Π를 형성한다. 본 발명의 가장 큰 특징 중 하나는, 구조안정화 부위의 양쪽 말단에 RTK-타겟 결합 부위 I 및 RTK-타겟 결합 부위 Π를 연결하여 바이포달 방식으로 펩타이드 바인더를 제작하는 것이다. RTK-타겟 결합 부위 I 및 RTK-타겟 결합 부위 Π는 서로 협동적으로 (cooperatively) 타겟에 결합함으로써, RTK 에 대한 친화도를 크게 증가시킨다.
RTK-타겟 결합 부위 I 의 아미노산 개수 n 은 특별하게 제한되지 않으며， 바람직하게는 2-100 의 정수， 보다 바람직하게는 2-50 의 정수， 보다 더욱 더 바람직하게는 2-20 의 정수， 가장 바람직하게는 3-10 의 정수이다.
RTK-타겟 결합 부위 Π의 아미노산 개수 m 은 특별하게 제한되지 않으며, 바람직하게는 2-100 의 정수， 보다 바람직하게는 2-50 의 정수， 보다 더욱 더 바람직하게는 2-20 의 정수, 가장 바람직하게는 3-10 의 정수이다.
RTK-타겟 결합 부위 I 및 RTK-타겟 결합 부위 Π에는 서로 각각 다른 또는 동일한 개수의 아미노산 잔기가 포함될 수 있다. RTK-타겟 결합 부위 I 및 RTK-타겟 결합 부위 Π에는 서로 각각 다른 또는 동일한 아미노산 서열이 포함될 수 있으며， 바람직하게는 서로 각각 다른 아미노산 서열이 포함된다,
RTK-타겟 결합 부위 I 및 /또는 RTK-타겟 결합 부위 Π에 포함되는 아미노산 서열은 선형의 아미노산 서열 또는 환형의 아미노산 서열이다. 타겟 결합 부위의 펩타이드 서열의 안정성을 증가시키기 위하여， RTK-타겟 결합 부위 I 및 /또는 RTK-타겟 결합 부위 Π에 포함되는 아미노산 서열 중에서 적어도 하나의 아미노산 잔기는 아세틸기， 플루오레닐 메톡시 카르보닐기， 포르밀기, 팔미토일기, 미리스틸기， 스테아릴기 또는 폴리에틸렌글리콜 (PEG)로 변형될 수 있다。
생물학적 타겟 분자에 결합되는 본 발명의 RTKᅳ BPB 는 생체 내 생리학적 반응의 조절， 생체 내 물질의 검출， 인 비보 분자 이미징， 및 약물전달용 타겟팅을 하는 데 이용될 수 있으며, 에스코트 분자로도 이용될 수 있다.
본 발명의 바람직한 구현예에 따르면， 구조 안정화 부위， RTK-타겟 결합 부위 I 또는 RTK-타겟 결합 부위 Π(보다 바람직하게는, 구조안정화 부위, 보다 더 바람직하게는 구조안정화 부위의 링커)에 카르고가 결합되어 있다。 상기 카르고의 예는 검출가능한 신호를 발생시키는 레이블， 화학약물, 바이오약물 또는 나노입자를 포함하나， 이에 한정되는 것은 아니다„
상기 검출가능한 신호를 발생시키는 레이블은 T1 조영물질 (예컨대，
Gd 킬레이트 화합물)， T2 조영물질 (예컨대, 초상자성 물질 (예: 마그네타이트, Fe304, Y-Fe203, 망간 페라이트， 코발트 페라이트 및 니켈 페라이트)) , 방사성 동위 원소 (예컨대， UC, 150, 13N, P32, S35, 44Sc, 45Ti, 118I, 136La, 198T1 , 200T1 , 205Bi 및 20 )， 형광물질 (플루오리신 (fluorescein), 피코에리트린 (phycoerythrin)， 로다민, 리사민 (lissamine), 그리고 Cy3 와 Cy5), 화학발광단， 자기입자, 매스 표지 또는 전자밀집입자를 포함하나 이에 제한되는 것은 아니다.
RTK-타겟 결합 부위 I 및 /또는 RTK-타겟 결합 부위 Π는 RTK 에 결합하는 아미노산서열을 포함한다.
본 발명의 BPB 분자가 결합하는 RTK 은 당업계에 공지된 다양한
RT 을 포함하며, Epidermal growth factor receptor family, Insulin receptor family, Platelet derived groowth factor receptor family, Fibroblast growth factor receptor family, Vascular endothelial growth factor receptor family, HGF receptor family, Trk receptor family, Eph receptor family, AXL receptor family, LTK receptor family, TIE receptor family, ROR receptor family, DDR receptor family, RET receptor family, KLG receptor family 및 RYK receptor family, MuSK receptor family를 포함한다.
본 발명의 RTK-BPB 는 RTK, 바람직하게는 RTK 의 세포외 도메인에 결합하여 RTK에 대한 아고니스트 또는 안타고니스트 작용을 한다. RTK에 대한 아고니스트는 RTK 에 의해 촉발되는 세포 내 시그널링을 촉진하며， RTK 에 대한 안타고니스트는 RTK 에 의해 촉발되는 세포 내 시그널링을 억제하는 작용을 한다.
본 발명의 RTK-BPB 는 세포 표면에 노출된 RTK 의 세포외 도메인에 결합할 수도 있지만， 세포 내 도메인에도 결합하여 GPCR 의 작용을 조절할 수 있다.
RTK-BPB 가 세포 내 도메인을 타겟팅 하는 경우， 바람직하게는 RTK- BPB는 추가적으로 세포막투과 펩타이드 (CPP)를 포함한다.
상기 CPP 는 당업계에 공지된 다양한 CPP 를 포함하며， 예를 들어 HIV-1 Tat 단백질, 올리고알지닌, ANTP 펩타이드， HSV VP22 전사조절단백질， vFGF에서 유래된 MTS 펩타이드, Penetratin, Transport an, Pep-1 펩타이드， Pep-7 펩타이드， Buforin II, MAP(model amphiphatic peptide), k-FGF, Ku 70, pVEC, SynBl 또는 HN-1 를 포함하나， 이에 한정되는 것은 아니다, 상기 CPP를 바이포달 펩타이드에 결합시키는 방법은 다양한 방법이 있으며， 예를 들어 바이포달 펩타이드의 구조 안정화 부위에 있는 루프 부분의 라이신 잔기와 CPP를 공유결합 시킨다。 상술한 바와 같이, 본 발명의 바이포달 타이드 바인더는 전형적으로 "N-RTK-타겟 결합 부위 I-구조안정화 부위의 한 가닥-링커- 구조안정화 부위의 다른 가닥 -RTK-타겟 결합 부위 Π-C"의 컨스트럭트를 갖는다,
본 발명의 바람직한 구현예에 따르면, 본 발명의 RTK-바이포달 펩타이드 바인더에서 RTK-타겟 결합 부위 I 과 구조안정화 부위의 한 가닥 사이 및 /또는 구조안정화 부위의 다른 가닥 -RTK-타겟 결합 부위 Π 사이에는， RTK-타겟 결합 부위와 구조안정화 부위 간의 상호 구조적 영향을 차단하는 구조영향 억제부위 (structure influence inhibiting region)를 포함한다. 회전 부위에는 펩타이드 분자에서 ø와 ^의 회전이 비교적 자유로운 아미노산이 위치한다. 바람직하게는, 0와 ¾ ^의 회전이 비교적 자유로운 아미노산은 글라이신， 알라닌 및 세린이다. 구조영향 억제부위에는 1-10 개， 바람직하게는 1-8 개， 보다 바람직하게는 1-3 개의 아미노산 잔기가 위치할 수 있다.
상술한 컨스트럭트를 갖는 본 발명의 RTK-바이포달 펩타이드 바인더의 라이브러리는 당업계에 공지된 다양한 방법으로 얻을 수 있다. 이 라이브러리에서 RTK-바이포달 펩타이드 바인더는 무작위 서열을 갖게 되며， 이는 RTK-타겟 결합 부위 I 및 /또는 RTK-타겟 결합 부위 Π의 어떤 위치에서도 서열 선호도 (sequence preference)가 없거나 또는 지정 (또는 고정)된 아미노산 잔기가 없다는 것을 의미한다.
예를 들어 RTK-바이포달 펩타이드 바인더의 라이브러리는 고상지지체 (예컨대， 폴리스틸렌 또는 폴리아크릴아미드 수지) 상에서 실시되는 스플리트 -합성 방법 (Lam et al . (1991) Nature 354： 82； WO 92/00091)에 따라 구축될 수 있다.
본 발명의 바람직한 구현예에 따르면, RTK-바이포달 펩타이드 바인더의 라이브러리는 세포 표면 전시 (cell surface display)방식 (예컨대, 파아지 디스플레이， 박테리아 디스플레이 또는 이스트 디스플레이)으로 구축된다. 바람직하게는， RTK-바이포달 펩타이드 바인더의 라이브러리는 플라스미드， 박테리오파아지, 파아지미드， 이스트， 박테리아, mRNA 또는 라이보좀을 기반으로 하는 디스플레이방법을 통하여 제작될 수 있다. 파아지 디스플레이는 파아지의 표면 상의 코트 단백질에 융합된 단백질 형태로 다양한 폴리펩타이드를 디스플레이하는 기술이다 (Scott, J. K. and Smith, G. P. (1990) Science 249： 386； Sambrook, J. et al . , Molecular Cloning. A Laboratory Manual , 3rd ed. Cold Spring Harbor Press(2001)； Clackson and Lowman , Phage Display, Oxford University Press(2004)). 필라멘트성 파아지 (예컨대， M13)의 유전자 m 또는 유전자 观에 발현하고자 하는 유전자를 융합시켜 무작위 펩타이드를 디스플레이한다ᅳ
파이지 디스플레이에는 파아지미드가 이용될 수 있다. 파아지미드는 박테리아의 복제원점 (예컨대, ColEl) 및 박테리오파아지의 인터제닉 (intergenic) 부위의 한 카피를 갖는 플라스미드 백터이다. 이 파아지미드에 클로닝된 DNA 단편은 플라스미드처럼 증식된다.
RTK-바이포달 펩타이드 바인더의 라이브러리를 파아지 디스플레이 방식으로 구축하는 경우， 본 발명의 바람직한 구현예는 다음의 단계를 포함한다: (i) 파아지 코트 단백질 (예컨대， M13 과 같은 필라멘트성 파아지의 유전자 m 또는 유전자 環 코트 단백질)을 코딩하는 유전자와 바이포달 핍타이드 바인더를 코딩하는 유전자가 융합된 융합 유전자; 및 상기 융합 유전자에 작동적으로 결합된 전사 조절 서열 (예컨대， lac 프로모터)을 포함하는 발현 백터의 라이브러리를 제작하는 단계; (ii) 상기 발현 백터 라이브러리를 적합한 숙주 세포에 도입시키는 단계; (iii) 상기 숙주세포를 배양하여 재조합 파아지 또는 파아지미드 바이러스 파티클을 형성시켜 융합 단백질이 표면에 디스플레이 되도록 하는 단계; (iv) RTK 분자와 상기 바이러스 파티클을 접촉시켜 파티클을 타겟 분자에 결합시키는 단계; 및 (V) RTK분자에 결합하지 않은 파티클을 분리하는 단계.
파아지 디스플레이를 이용하여 펩타이드라이브러리를구축하고 이들 라이브러리를 스크리닝 하는 방법은 미국 특허 제 5,723,286 호, 제 5,432,018 호, 제 5,580,717 호, 제 5,427,908 호, 제 5,498,530 호, 제 5,770,434호, 제 5,734,018 호8 제 5,698,426 호, 제 5,763,192 호 및 제 5,723,323호에 개시되어 있다,
바이포달 템타이드 바인더를 유전자를 포함하는 발현 백터를 제작하는 방법은 당업계에 공지된 방법에 따라 실시될 수 있다ᅳ 예를 들어， 공지의 파아지미드 또는 파아지 백터 (예컨대, pIGT2, fUSE5, fAFFl, fd-CATl, m663, fdtetDOG, pHENl, pComb3, pComb8, pCANTAB 5E (Pharmacia), LamdaSurfZap, pIF4, PM48, PM52, PM54, fdH 및 p8V5)에 바이포달 펩타이드 바인더를 유전자를 삽입시켜 발현 백터를 제작할 수 있다.
대부분의 파아지 디스플레이 방법이 필라멘트성 파아지를 이용하여 실시되지만, 람다 파아지 디스플레이 (W0 95/34683； 미국 특허 제 5,627,024호), T4 파아지 디스플레이 (Ren et ah (1998) Gene 215： 439； Zhu (1997) CAN 33:534) 및 Ί7 파아지 디스플레이 (미국 특허 제 5,766,905호)도 바이포달 펩타이드 바인더의 라이브러리를 구축하는 데 이용될 수 있다.
백터 라이브러리를 적합한 숙주 세포에 도입시키는 방법은 다양한 형질전환 방법에 따라 실시될 수 있으몌 가장 바람직하게는 전기천공 (electroporation) 방법에 따라 실시된다 (참조: 미국 특허 제 5,186,800호, 제 5,422,272호, 제 5,750,373호)。 본 발명에 적합한 숙주는 세포는 E. coli 와 같은 그람 음성 박테리아 세포이며, 적합한 E. coli숙주는 JM101, E' coli K12 strain 294, E. coli strain W3110 및 Eᅳ coli XL-lBlue (Stratagene)을 포함하나, 이에 한정되는 것은 아니다. 숙주세포는 형질전환 전에 컴피턴스 세포로 준비하는 것이 w}람직하다 (Sambrook, J . et al., Molecular Cloning. A Laboratory Manual , 3rd ed. Cold Spring Harbor Press(200D) , 형질전환된 세포의 선별은 일반적으로 항생제 (예컨대, 테트라사이클린 및 암피실린)를 포함하는 배지에서 배양하여 실시된다. 선별된 형질전환 세포를 헬퍼 파아지의 존재 하에서 추가적으로 배양하여 재조합 파아지 또는 파아지미드 바이러스 파티클을 생성시킨다. 상기 헬퍼 파아지 파아지로 적합한 것은， Ex 헬퍼 파아지 , M13-K07, M13-VCS 및 R408을 포함하나， 이에 한정되는 것은 아니다. 생물학적 타겟 분자와 결합하는 바이러스 파티클의 선별은 통상적으로 바이오패닝 과정을 통하여 실시될 수 있다 (Sambrook, J„ et al. , Molecular Cloning. A Laboratory Manual , 3rd ed. Cold Spring Harbor Press(2001)； Clackson and Lowman , Phage Display, Oxford University Press (2004)). 본 발명의 또 다른 양태에 따르면, 본 발명은 상술한 RTK-바이포달 펩타이드 바인더를 코딩하는 핵산 분자를 제공한다.
본 발명의 다른 양태에 따르면, 본 발명은 RTK-바이포달 펩타이드 바인더를 코딩하는 핵산 분자를 포함하는 RTK-바이포달 펩타이드 바인더의 발현용 백터를 제공한다。
본 발명의 다른 양태에 따르면, 본 발명은 RTK-바이포달 펩타이드 바인더의 발현용 백터를 포함하는 형질전환체를 제공한다.
본 명세서에서 용어 "핵산 분자" 는 DNA (gDNA 및 cDNA) 그리고 RNA 분자를 포괄적으로 포함하는 의미를 갖으며， 핵산 분자에서 기본 구성 단위인 뉴클레오타이드는 자연의 뉴클레오타이드뿐만 아니라, 당 또는 염기 부위가 변형된 유사체 (analogue)도 포함한다 (Scheit, Nucleotide Analogs, John Wiley, New York(1980)； Uhlman 및 Peyman , Chemical Reviews,
Figure imgf000019_0001
본 발명의 바람직한 구현예에 따르면, 본 발명의 백터는 RTK— 바이포달 펩타이드 바인더를 코딩하는 핵산 분자 이외에 상기 핵산 분자에, 전사를 진행시킬 수 있는 강력한 프로모터 (예컨대， tac 프로모터 , lac 프로모터， /adJV5 프로모터， Ipp 프로모터, 프로모터， 프로모터, rac5 프로모터 , 卿프로모터 , recA 프로모터 , SP6 프로머터， trp프로모터 및 T7 프로모터 등)， 해독의 개시를 위한 라이보좀 결합 자리 및 전사 /해독 종결 서열을 포함한다.
본 발명의 바람직한 구현예에 따르면， 본 발명의 백터는 RTK- 바이포달 펩타이드 바인더를 코딩하는 핵산 분자의 5 '—방향쪽에 시그널 서열 (예컨대, pelB)를 추가적으로 포함할 수 있다. 또한, 본 발명의 바람직한 구현예에 따르면, 본 발명의 백터는 바이포달 펩타이드 바인더가 파아지의 표면에 잘 발현되었는지를 확인하기 위한 태깅 서열 (예컨대， myc tag)올 추가적으로 포함한다.
본 발명의 바람직한 구현예에 따르면， 본 발명의 백터는 파아지 코트 단백질， 바람직하게는 M13 과 같은 필라멘트성 파아지의 유전자 m 또는 유전자 VI 코트 단백질을 코딩하는 유전자를 포함한다. 본 발명의 바람직한 구현예에 따르면， 본 발명의 백터는 박테리아의 복제원점 (예컨대， ColEl) 및 /또는 박테리오파아지의 복제원점을 포함한다. 한편, 본 발명의 백터는 선택표지로서 당업계에서 통상적으로 이용되는 항생제 내성 유전자를 포함할 수 있으며, 예를 들어 암피실린， 겐타마이신， 카베니실린， 클로람페니콜， 스트렙토마이신, 카나마이신， 게네티신， 네오마이신 및 테트라사이클린에 대한 내성 유전자를 포함할 수 있다.
본 발명의 형질전환체는 바람직하게는 E. coli 와 같은 그람 음성 박테리아 세포이며， 적합한 E. coli숙주는 JM101, E. coli K12 strain 294, E. coli strain W3110 및 E. coli XL-lBlue (Stratagene)을 포함하나， 이에 한정되는 것은 아니다. 본 발명의 백터를 숙주 세포 내로 운반하는 방법은， CaCl2 방법 (Cohen, S.N. et al . , Proc. NatL Acac. Sc USA, 9:2110-2114(1973)), 하나한 방법 (Cohen, S.N. et al . , Proc. Natl. Acac. ScL USA, 9:2110-2114(1973)； 및 Hanahan, D. , J, Mol . Biol. , 166:557- 580(1983)) 및 전기 천공 방법 (미국특허 제 5,186,800호, 제 5,422,272호, 제 5, 750, 373호) 등에 의해 실시될 수 있다. ᅳ
본 발명의 RTK-바이포달 펩타이드 바인더는 매우 낮은 수준 (예컨대， nM 수준)의 ¾ 값 (해리상수)을 나타내어， RTK 분자에 매우 높은 친화도를 나타내는 펩타이드를 제공한다. 하기 실시예에 기재된 바와 같이， 모노포달 방식으로 제작된 바인더와 비교하여 바이포달 펩타이드 바인더는 약 102-105배 (바람직하게는， 약 103-104배) 높은 친화도를 나타낸다.
본 발명의 RTK-바이포달 펩타이드 바인더는 의약으로서의 용도를 가질 뿐만 아니라, 생체 내 물질의 검출， 인 비보 분자 이미징, 인 비트로 세포 이미징 및 약물전달용 타겟팅을 하는 데 이용될 수 있으며， 에스코트 분자로도 이용될 수 있다, 본발명의 특징 및 이점을요약하면 다음과같다:
( i ) 본발명은 RTK에 특이적으로결합하는 RTK-BPB를 제공한다.
(ii) 본 발명의 RTK-바이포달 펩타이드 바인더에서 구조안정성 부위의 양 말단에 결합되어 있는 이격된 (distal) 두 개의 RTK-타겟 결합 부위는 서로 협동적으로 (cooperatively), 시너직 (synergetically)하게 타겟에 결합한다. (iii) 이에， 본 발명의 RTK-바이포달 펩타이드 바인더는 매우 낮은 수준 (예컨대， nM 수준)의 KD 값 (해리상수)을 나타내어, 타겟에 매우 높은 친화도를 나타낸다.
(iv) 본 발명의 RTK-BPB 는 생체 내 RTK 에 결합하여, RTK 에 대한 antagonist 또는 agonist 작용을 할 수 있다.
【도면의 간단한 설명】
도 la 는 구조안정화 부위로서 β-헤어핀 (hairpin)을 포함하는 바이포달 펩타이드 바인더 (bipodal-peptide binder) 및 RTK-BPB의 모식도를 나타낸다.
도 lb 는 구조안정화 부위로서 링커로 연결된 β-쉬트를 포함하는 RTK-BPB의 모식도를 나타낸다.
도 lc 는 구조안정화 부위로서 링커로 연결된 루이신 지퍼를 포함하는 RTK-BPB의 모식도를 나타낸다.
도 Id 는 구조안정화 부위로서 링커로 연결된 루이신 -리치 모티프 (leucine-rich motif)를 포함하는 RTK— BPB의 모식도를 나타낸다. 도 2 는 RTK-BPB 라이브러리를 클로닝하기 위한 전략을 나타낸다. PIGT2 파이지미드 백터 맵에서， pelB시그널서열， myc tag은 목적 유전자가 파아지의 표면에 잘 발현되었는지를 확인하기 위한 태깅 서열이다, 프로모터로서 lac 프로모터가 이용되었다。
도 3 은 HER2 에 특이적인 파아지 펩타이드를 검색하기 위한 파아지 ELISA의 실험 결과이다.
도 4a 는 피르로넥틴 ED-B 단백질에 결합하는 특정 바이포달 펩타이드 바인더의 친화력을 측정한 결과이다.
도 4b는 바이포달 펩타이드 바인더 BPB의 공동 작용 효과의 증명을 위한 친화력을 측정한 결과이다.
도 5는 바이포달 템타이드 바인더에서 구조 안정화 부위를 트립토판 지퍼 대신 여러 -헤어핀 모티프로 바꾸어 바이포달 펩타이드 바인더의 친화력을 측정한 결과이다. 도 6 은 바이포달 펩타이드 바인더에서 구조 안정화 부위를 트립토판 지퍼 대신 루이신 지퍼로 바꾸어 바이포달 펩타이드 바인더의 친화력을 측정한 결과이다.
도 7 은 HER2 에 대한 펩타이드를 합성하여 SPR Biacore systemCBiacore AB, Uppsala, Sweden)을 이용하여 친화도를 측정한 결과이다.
도 8 은 HER2 단백질에 특이적으로 결합하는 재조합 파아지를 여러 단백질에 대해서 ELISA를 이용한 특이성 검사 결과이다.
도 9 는 HER2 과발현하는 BT-474 세포와 발현이 적은 CH0 세포를 이용하여 상기 펩타이드가 세포의 HER2 를 인식 민감도을 확인한 이미징 실험 결과이다.
도 10은 VEGFR1-바인딩 BPB콜로니의 ELISA 결과이다.
도 11 은 스크리닝을 통해 찾은 펩타이드의 BPB1VEGFR1 특이성을 실험한 ELISA결과이다ᅳ
도 12는 81 1^^1의 친화력 측정결과이다ᅳ
【실시예】
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 보다 구체적으로 설명하기 위한 것으로서， 본 발명의 요지에 따라 본 발명의 범위가 이들 실시예에 의해 제한되지 않는다는 것은 본 발명이 속하는 기술분야에서 통상의 지식을 가진 자에게 있어서 자명할 것이다. 실시예
실험재료 및 실험방법
실시예 1: 라이브러리의 제작
바이포달펩타이드 바인더 유전자제작및파아지미드 백터에의삽입
두 개의 을리고뉴클레오티드 Beta-Fl ( 5 ' -TOTATGCGGCCCAGCTGGCC (NNK)6GGATCTTGGACATGGGAAAACGGAAAA-3' ) 및 Beta-Bl (5'- MCAGTTTCTGCGGCCGCTCCTCC TCC(MNN)6TCCCTTCCATGTCCArnTCCGTT-3 * ) (N 은 A, T, G또는 C; K는 G또는 T; M은 C또는 A)를 합성하였다. 이중 사슬을 만들기 위해서 Beta-F! 4 μΜ, Beta-Bl 4 μΜ, 2.5 mM dNTP 흔합액 4 μί,
ExTaq DNA 중합효소 1 /^(Takara, Seoul , Korea) 및 10XPCR 버퍼 5 μΐ를 흔합하여 총 50 ^가 되도록 증류수를 첨가한 흔합액을 총 25 개 만들었다.
이 흔합액을 PCR 반응 (94°C에서 5분, 60 싸이클: 30°C에서 30초， 72°C에서
30 초 및 72°C에서 7 분)을 하여 이중 사슬로 만든 후 PCR 정제 키트 (GeneAll, Seoul, Korea) 를 이용하여 정제하여, 바이포달 펩타이드 바인더 유전자를 얻었다. 바이포달 펩타이드 바인더에 삽입시킬 유전자를 pIGT2 파아지미드 백터 (Ig therapy, Chuncheon, Korea) 에 연결하기 위해 인서트 유전자와 pIGT2 파아지미드 백터에 제한효소를 처리하였다. 약 11
의 인서트 DNA 를 5i /(New England Bio labs (NEB, Ipswich) 및 ½? /(ΝΕΒ,
Ipswich)으로 각각 4 시간 씩 반응시킨 후 PCR 정제 키트를 이용하여 정제하였다. 또한， 약 40 /g의 pIGT2 파아지미드 백터를 Sfil 및
Notl 으로 각각 4 시간 씩 반응시킨 후 CIAP(Calf Intestinal Alkaline
Phosphatase) (NEB, Ipswich)를 넣고 1 시간 동안 반응시킨 후, PCR 정제 키트를 이용하여 정제하였다. 이들을 UV-가시광선 분광기 (Ultrospec
2100pro, Amersham Bioscience)로 정량하여 2.9 의 인서트 유전자를 T4
DNA 리가아제 (Bioneer, Dae j eon, Korea)를 이용하여 pIGT2 파아지미드 백터
12 /g과 18°C에서 15 시간 동안 연결한 후, 에탄올로 침전시켜 TE 버퍼 100 ¬ᅳ로 DNA를 용해시켰다. 컴피턴트 세포의 준비
E. co J i XL1-BLUE 세포 (American Type Culture Collection, Manassas,
USA)를 LB 아가 -플레이트에 선상 도말하였다. 한천 평판 배지에서 자란 군락을 5 의 LB 배지에 접종한후 37°C에서 200 rpm의 속도로 흔합하면서 하루 동안 배양하였다, 배양된 10 m£의 세포들을 2 £의 LB 배지에 접종하고 같은 방식으로 600 nm 의 파장에서 흡광도가 0,3—0.4가 될 때까지 배양하였다. 배양된 플라스크를 30 분 동안 얼음에 방치한 후， 4°C 에서
4,000X g로 20 분 동안 원심 분리하여 가라앉은 세포들을 제외한 상층액을 모두 제거하고, 1 의 넁각된 멸균 증류수로 현탁시켰다. 이것을 다시 같은 방법으로 원심분리하고 상층액을 제거한 후， 1 £의 냉각된 멸균 증류수로 재현탁시키고 같은 방식으로 10% 글리세를 용액 40 로 세척을 반복하여 원심 분리한 후, 마지막으로 10% 글리세롤 용액 4 m£으로 현탁시킨 후， 200 ^씩 분주하여 액체 질소에 넁동시킨 뒤 -80°C에 보관하였다. 전기 천공법
파아지미드 백터 12 //g과 바이포달 펩타이드 바인더에 인서트 DNA 2.9 f 을 연결 반응시킨 100 峰 25개로 분주하여 전기 천공을 수행하였다. 컴피턴트 세포를 얼음 위에서 녹이고, 200 ^의 컴피턴트 세포를 연결 반웅시킨 용액 4 ^와 흔합한 후， 넁각하여 준비된 0.2 cm 의 큐벳에 넣은 뒤 1 분 동안 얼음 위에 두었다. 전기 천공기 (BioRad, Hercules, CA)를 200 Ω에서 25 uF 및 2,5 kV 의 조건으로 프로그램하고 준비된 큐벳의 물기를 제거하고 전기 천공기에 위치시킨 후 펄스를 주었다 (시간 상수는 4.5-5 msec). 이후 즉시 37°C로 준비한 20 mM 의 글루코오스가 포함된 1 의 LB 액체배지에 넣고 얻어진 총 25 의 세포를 100 시험관에 옮겼다. 한 시간 동안 37°C에서 200 rpm 의 속도로 흔합하며 배양한 후 라이브러리의 개수를 측정하기 위해 10 i 희석해서 암피실린 아가 배지에 도말하였다. 남은 세포를 1 의 LB 에 20 mM 글루코오스 및 50 의 암피실린을 넣고 30°C에서 하루 동안 배양하였다. 4°C 에서 4,000Xg 로 20 분 동안 원심 분리하여 침전된 세포들을 제외한 상층액을 모두 제거하고, 40 1 의 LB 로 재현탁시킨 후 글리세롤을 최종 농도 20% 이상 넣고 -80°C에 보관하였다ᅳ 라이브러리에서재조합파아지 생산과 PEG침전
-80°C에 저장된 바이포달 펩타이드 바인더 라이브러리에서 재조합 파아지를 생산하였다. 500 플라스크에 100 의 LB 액체배지에 암피실린 (50 //g/ 및 20 mM 의 글루코오스를 넣은 후， -80°C 에 보관된 라이브러리 1 을 추가하여 한 시간 동안 37°C에서 150 rpm 의 속도로 흔합하며 배양하였다, 여기에 lX10u pfu 의 Ex 헬퍼 파아지 (Ig therapy, Chuncheon, Korea)를 넣고 다시 한 시간 동안 같은 조건으로 배양하였다. l.OOOXg 로 10 분 동안 원심 분리하여 상층액을 제거하고 여기에 암피실린 (50 iig/m 및 카나마이신 (25 g/rnl)^] 포함된 LB 액체배지 100 을 넣고 하루 동안 배양하여 재조합 파아지를 생산하였다. 배양액을
3,000Xg 로 10 분 동안 원심 분리하여 얻은 상층액 100 에 PEG/NaCl 25 ^을 흔합하고 얼음에 1 시간 동안 방치시킨 후， 4°C에서 20 분 동안 10, 000 X g 로 원심 분리하여 상층액은 조심스럽게 제거하고 2 m£의 PBS(pH 7, 4)로 펠렛을 재현탁시켰다. 실시예 2: 바이오 패닝
RTK 의 대표적인 수용체로서 HER2 에 대하여 바이오 패닝을 하였다. 또한, BPB 의 기본적인 작동을 확인하기 위한 모델 단백질로서 피브로넥틴 (Fibronectin) ED-B를 선택하였고， 이에 대하여도 바이오 패닝을 하였다.
상기 실시예 1 에서 제작한 BPB(Bipodal-peptide binder) 라이브러리를 각각의 단백질에 대해 5 차에 걸쳐 바이오패닝을 실시하고 각 패닝 단계에서 회수한 파아지 펩타이드들의 output phage/ input phage 비 (ratio)를 결정하였다ᅳ
상기 단백질 (5 을 96 웰 ELISA 플레이트 (Corning)의 10 개의 웰에 50 ^씩 넣은 후， 4°C에서 하룻밤 동안 방치하였고， 다음날 2% BSA 를 사용하여 상온에서 2 시간 동안 블로킹한 후， 용액을 모두 버리고 0.1% PBST 로 3 회 세척하였다. 여기에 바이포달 펩타이드 바인더 재조합 파아지 포함용액 800 ≠ 및 10% BSA 200 μί을 흔합하여 GPR 39 단백질에 결합한 10 개의 웰에 옮겨 상온에서 1 시간 동안 방치하였다. 10 개 웰의 용액을 모두 제거하고 0.1% PBST 로 10 회 세척한 뒤 0,2 M 글리신 /HCKpH 2.2) 1 m을 각 웰당 50 ^씩 넣어 20 분간 파아지를 용리시키고 1 ^을 튜브에 모아 여기에 2M Tris-base(pH 9.0) 150 ^를 넣어 용액을 중화시켰다. 각 바이오패닝마다 인풋 파아지 및 일루트 파아지의 수를 측정하기 위해 0D=0.7 인 XL-1 BLUE 세포에 섞어 주어 암피실린이 포함된 아가 배지에 도말하였다. 패닝을 반복하기 위해 10 의 E. coli XL1- BLUE 세포와 섞어 37°C에서 1 시간 동안 200 rpm 의 속도로 흔합하며 배양하였다。 암피실린 (50 ^g/ra^) 및 20 mM 글루코오스를 흔합한 후, 2xi010pfu의 Ex 헬퍼 파아지를 첨가하여 37°C에서 1 시간 동안 200 rpm 의 속도로 흔합하며 배양하였다. 배양액을 l,000Xg 로 10 분 동안 원심 분리한 후 상층액은 제거하고 침전된 세포들을 암피실린 (50 fg/ ) 및 카나마이신 (25 g/m£)이 포함된 40 LB 액체 배지로 재현탁하여 30°C에서 200 rpm 의 속도로 흔합하며 하루 동안 배양하였다. 배양액을 4,000Xg, 20 분 및 4°C의 조건으로 원심 분리하였다. 상층액에 8 1 의 5x PEG/NaCl[20% PEG(w/v) 및 15% NaCKw/v)]을 첨가한후 4°C에서 1시간동안 정치시켰다. 원심분리 후 PEG 용액을 완전히 제거하고 1 의 PBS 용액으로 파아지 펩타이드 펠렛을 녹인 다음 2 차 바이오패닝에 사용하였다. 각 패닝 단계마다 상기와 동일한 방법을 사용했으며, 세척과정만 단계별로 각각 20회 및 30회 (0.1% PBST) 증가시켰다. 실시예 3: HER2의 인풋 파아지의 ELISA
바이포달 펩타이드 바인더 라이브러리의 각 인풋 파아지의 ELISA 를 HER2ECD, 스트랩타비딘， BSA 및 ED-B 에 대해 수행하였다. 96 웰 ELISA 플레이트에 10 jug/ i HER2ECD 50 ^씩 10 웰에 넣고， 10 s/ml BSA 를 각 웰당 50 ^씩 10 웰에 넣고, 10 us/ml 스트랩타비딘을 각 웰당 50 ^씩 10 개의 웰에 넣고 4°C에서 하루 동안 방치하였다。 다음날 모든 wells 을 0.1% PBST 로 3 회 세척하고 PBS 로 회석한 2% BSA 를 사용하여 370C 에서 1 시간 동안 blocking 한 뒤， 용액을 모두 버리고 0.1% PBST 로 3 화 세척하였다. 여기에 Bipodal -peptide binder 재조합 파아지인 첫번째， 두번째， 세번째 네번째 , 다섯번째 Input phage 200ul 과 4% BSA 300ul 을 잘 흔합하여 50ul 씩 HER2ECD, Streptavidin, BSA wells 에 각각 2wells 씩 분주하고 37 °C 에서 1 시간 30 분 정치하였다. 0,1% PBST 용액으로 4 번 세척한 다음 HRP-conjugated anti-M13 항체 (GE Healthcare)를 1:1,000으로 회석하여 37 X 에서 1 시간 반응시켰다. 0„1% PBST 로 4 번 세척한 후 TMB 용액 50 μ ΐ 를 분주하여 발색반응을 유도한 다음 50ul 의 1M HC1 를 첨가하여 반웅을 중지시켰다. 450 nm에서 흡광도를 측정하였다. 실시예 4: HER2 또는 피브로넥틴 ED— B 에 특이적인 파아지 펩타이드 검색 (파아지 ELISA)
아웃풋 파아지 /인풋 파아지 비율이 가장 높은 바이오패닝 단계에서 회수한 파아지를 XL1-BLUE 세포에 감염시킨 후 플라크가 플레이트당 100- 200 개 정도가 되도록 도말하였다. 멸균된 팁을 이용하여 플라크 60 개를 2 의 LB-암피실린 (50
Figure imgf000027_0001
배양액에 접종한 후 37°C에서 5 시간 동안 진탕 배양하여 0D=0.8-1 에서 5X109 pfu 의 Ex 헬퍼 파아지를 첨가하여 37°C에서 1 시간 동안 200 rpm 의 속도로 흔합하며 배양하였다. 배양액을 l,000Xg로 10 분 동안 원심 분리한 후 상층액은 제거하고 침전된 세포들을 암피실린 (50 β /ηί) 및 카나마이신 (25 βg/mi)o} 포함된 1 ι 의 LB 액체배지로 재현탁하여 30°C에서 200 rpm 의 속도로 흔합하며 하루 동안 배양하였다. 배양액을 10,000Xg, 20분 및 4°C의 조건으로 원심 분리하여 상층액을 회수한 후 2¾의 탈지 우유를 넣고 이를 파아지 펩타이드 검색에 사용하였다. 96 웰 ELISA 플레이트에 5 의 HER2 또는 Fibronectin ED-B 을 각 웰당 50 ^씩 30 개의 웰에 넣고, 또한 10 / 의 BSA 을 각 웰당 50 씩 30 개의 웰에 넣어 4°C에서 하루 동안 방치하였다. 다음날 모든 웰을 0.1% PBST 로 3 회 세척하고 PBS 로 회석한 2% 탈지 우유를 사용하여 상온에서 2 시간 동안 블로킹한 뒤， 용액을 모두 버리고 0,1% PBST 로 3 회 세척하였다, 각 클론별로 증폭된 파아지 펩타이드 용액 100 ^씩을 모든 웰에 분주하고 27°C에서 1 시간 30 분 동안 정치하였다。 0.1¾> PBST 용액으로 5 회 세척한 다음 HRP-컨쥬게이트 항 -M13 항체 (GE Healthcare)를 1:1,000 으로 희석하여 27°C에서 1 시간 동안 반웅시켰다, 0.1% PBST로 5회 세척한후 TMB용액 100 峰 분주하여 발색반응을 유도한 다음 100 ^의 1 M HCI 를 첨가하여 반응을 중지시켰다. 450 nm 에서 흡광도를 측정하여 BSA 에 비해 흡광도가 높은 클론들을 선택하였다. 이들의 파아지를 XL1 세포에 감염시킨 후 플라크가 플레이트당 100-200 개 정도가 되도록 도말하였다ᅳ 멸균된 팁을 이용하여 플라크를 4 m의 LB- 암피실린 (50 ^g/m^) 배양액에 접종한 후 37°C에서 하루 동안 진탕 배양하여 플라스미드 프랩 키트을 이용하여 플라스미드를 정제하여 시뭔싱을 의뢰하였다 (Genotech, Dae j eon, Korea). 시뭔성 프라이머는 백터 시퀀스인 5'-TGC TAA ACA ACT TTC AAC-3'을 사용하였다, 실시예 5: 바인딩 어세이
DNA 시퀀싱에서 중복되어 나온 ED—B 에 특이적인 바이포달 펩타이드 바인더 펩타이드를 합성 (애니젠, 한국)을 하였다。 친화도의 측정은 BIAcore X(Biacore AB, Uppsala, Sweden)를 이용하여 수행하였다. ED-B는 스트랩타비딘 SA 칩 (Biacore)에 바이오틴 -EDB 을 2,000 RU 만큼 홀려주어 고정시켰다. 러닝 버퍼로는 PBS(pH 74)을 사용하였고, 플로우는 분당 30 ^로 홀리면서 여러 농도로 동력학을 측정한 후 BIAevaluation 소프트웨어 (Biacore AB, Uppsala, Sweden)로 친화도를 계산하였다. 실험 결과
실시예 6: 바이포달 펩타이드 바인더 라이브러리의 제작
바이포달 펩타이드 바인더의 구조 안정화 부위로는 안정한 베타- 헤어핀 모티프를 사용하였다. 특히 트립토판-트립토판 아미노산의 상호 작용에 의해 베타-헤어핀 모티프 구조를 안정하게 이루어 주는 트립토판 지퍼 (Andrea et al . , Proc. Natl. Acad. Sc 98 :5578-5583(2001))을 이용하였다. 뼈대인 트립토판 지퍼의 N- 및 C—말단 부분에 각각 6 개 아미노산을 무작위로 배열함으로써 두 부분에 가변적 부위를 생성하였다 (도 la). 이를 바이포달 펩타이드 바인더라고 명명하였으며 양쪽의 가변적 부위를 가지고 있어 항원에 공동작용으로 붙을 수 있어 높은 친화력 및 특이성을 가질 수 있다. 또한， 바이포달 펩타이드 바인더의 구조 안정화 부위는 도 lb 내지 도 le와 같이 여러 가지로 구성될 수 있다.
합성한 2 개의 무작위 서열 올리고뉴클레오티드를 PCR 반응을 통해 이중 사슬로 만든 후 제한효소인 Sfi\ 및 Not\ 으로 자른 후 pIGT2 파아지 '미드 백터에 클로닝을 하여 8X108 이상의 라이브러리를 구축하였다 (도 2). 실시예 7: 바이오 패닝 결과
바이포달 펩타이드 바인더 라이브러리를 피브로넥틴 ED-B 또는
HER2 에 대해 3-6 차에 걸쳐 바이오 패닝을 실시하고 각 패닝 단계에서 회수한 파아지 펩타이드들의 아웃풋 파아지 /인풋. 파아지의 비율을 결정하였다 (표 la 및 lb). 【표 la]
피브로넥틴 ED-B 단백질에 대한 바이오 패닝 결과 패닝단계 인풋 파아지 (pfu) 일루트 파아지 (pfu) 산출
1회 2,8X10" 1.1X107 4.0X10"5
2회 1.6X1011 1.0X107 5.1 10"5
3회 1.6X10" 2.1 108 1.3X10"3
【표 lb]
HER2에 대한 바이오 패닝 결과
Figure imgf000029_0001
실시예 8: HER2의 인풋 파아지의 파아지 ELISA결과
바이포달 펩타이드 바인더의 라이브러리의 각 인풋 파아지를 HER2, 스트랩타비딘 및 BSA 에 대해 ELISA 를 수행하였다. 첫 번째 인풋 파아지의 반웅성은 HER2, Streptavidin, BSA 모두 흡광도가 비슷하나 일곱번째 Input phage 에서 HER2 의 광도가 Streptavidin 에 비해 3,7 배， BSA 에 비해 3.14 배 높았다. 일곱번째 Input 에서 HER2 의 흡광도가 Streptavidin 과 BSA 보다 높은 반응성을 보여 AR— DBD 에 대해 성공적으로 Biopanning이 이루어짐을 알 수 있다 (도 3). 실시예 9: 타겟에 특이적인 파아지 펩타이드 검색 (파아지 ELISA) 및 시뭔싱 각 라이브러리의 패닝 단계중 아웃풋 /인풋의 비율이 가장 높은 단계에서 회수한 파아지를 플라크 형태로 확보하였다. 각 플라크로부터 60 개의 파아지를 증폭시킨 후 BSA 에 대해 ELISA 를 수행하였다. BSA 에 비해 흡광도가 높은 클론들을 선택하여 DNA 시퀀싱을 의뢰하였다, 이로부터 중복된 각각의 단백질에 특이적인 펩타이드 시뭔스를 얻었다 (표 2a 및 표 2b)
【표 2a]
Figure imgf000030_0001
실시예 10: 피브로넥틴 ED-B의 친화도의 측정 피브로넥틴 ED-B 에 대한 상기 펩타이드를 합성하여 SPR Biacore system(Biacore AB, Uppsala, Sweden)을 이용하여 친화도를 측정하였다. 피브로넥틴 ED-B 에 대한 친화도를 측정한 결과 펩타이드 1 은 620 nM 를 나타내었고， 펩타이드 2 는 75 nM 를 나타내었으며， 펩타이드 3 은 2.5 μΜ을 나타내었다 (도 4a). 실시예 11: SPRCSurface Plasmon Resonance)에 의한 공동 작용 효과 확인 바이포달 펩타이드 바인더의 항원에 대한 공동 작용 효과를 증명하기 위해서 친화력이 가장 좋은 표 2a 의 ED-B 에 대한 펩타이드 2 의 N- 및 C- 말단 한쪽 부위만 각각 제거한 펩타이드를 합성하여 친화력을 측정하였다。 N-말단 부분은 592 μΜ을 가지며 C-말단 부분은 12.8 μΜ을 나타내었다 (도 4b). 바이포달 펩타이드 바인더에서 양발 (bipodal)을 가지고 있음으로써 나타내는 공동 작용 효과는 43 nM의 친화력임을 증명하였다 (도 4a). 실시예 12: 다른 β-헤어핀에 대한 바인딩 어세이
트립토판 지퍼 이외에 다른 β-헤어핀 골격인 GBlm3 및 HP7 에 ED- B 에 특이적으로 결합하는 Peptide2 의 N-말단 시퀀스 (HCSSAV)와 C-말단 시퀀스 (IIRLEQ)를 가지도톡 펩타이드를 합성하였다 (애니젠, 한국). 즉， 트립토판 지퍼를 포함한 바이포달 펩타이드 바인더의 시뭔스는 HCSSAVGSWTWENGKWTWKGI IRLEQ 이며 GBlm3 을 포함한 바이포달 펩타이드 바인더는 HCSSAVGKKWTY PA GKFTVQEGIIRLEQ 이고， HP7 을 포함한 바이포달 펩타이드 바인더는 HCSSAVGKTWNPA GKWTEGIIRLEQ 이다. 각 펩타이드의 친화도는 BIAcore X(Biacore AB, Uppsala, Sweden)를 사용하여 측정하였다. 스트랩타비딘 SA 칩 (Biacore AB, Uppsala, Sweden)에 비오틴 -EDB 를 2,000 RU 만큼 홀려주어 고정시켰다. 러닝 버퍼로는 PBS(pH 7.4)를 사용하였고 플로우는 분당 30 로 흘리면서 여러 농도로 동력학을 측정한 후 BIAevaluation으로 친화도를 계산하였다, 친화도를 측정한 결과 GBlm3가 70 nM, HP7 이 84 nM 로 트립토판 지퍼 (43 nM)와 비슷한 친화력을 가짐을 확인하였다 (도 5), 이는 모든 안정한 β-헤어핀 모티프가 구조 안정화 부위로서 가능함을 증명하는 결과이다. 실시예 13: 구조안정화 부위로서 루이신 지퍼를 포함하는 바이포달 펩타이드 바인더에 대한 바인딩 어세이
β-헤어핀 골격 대신 구조안정화 부위로서 루이신 지퍼에 ED-B 에 특이적으로 결합하는 펩타이드 2 의 Ν-말단 시퀀스 (HCSSAV)와 C-말단 시퀀스 (IIRLEQ)를 가지도록 CSSPIQGGSM QLEDKVEELLSKNYHLENEVARLKKLVGER 및 I IRLEQGGSMKQLEDKVEELLSKNYHLENEVARLKKLVGER 펩타이드를 합성하였다 (애니젠， 한국)ᅳ 두 펩타이드를 다이머로 만든 다음 BIAcore X(Biacore AB, Uppsala, Sweden)를 사용하여 친화도를 측정하였다. 친화도를 측정한 결과， 루이신 지퍼는 5 μΜ 의 친화도를 나타내었고 이는 트립토판 지퍼 (43 ηΜ)의 비슷한 친화도보다 떨어지는 친화도이기는 하지만 루이신 지퍼도 바이포달 펩타이드 바인더의 구조 안정화 부위로서 기능할 수 있음을 알 수 있다 (도 6).
HER2에 특이적인 바이포달펩타이드 바인더의 특이성 측정
HER2 단백질에 특이적으로 결합하는 재조합 파아지를 여러 단백질에 대해서 특이성 검사를 ELISA 을 이용하여 시행하였다. 96-웰 ELISA 플레이트에 각각의 단백질을 5 fig/ ml을 50 ^씩 웰에 넣고 다음날 0.1¾ PBST(Tween-20)로 3 회 세척하고 2¾ BSA 를 사용하여 상온에서 2 시간 동안 블로킹을 한 후， 용액을 모두 버리고 0,1% PBST 로 3 회 세척하였다. 여기에 본 발명의 펩타이드를 가지는 재조합 파아지를 2% BSA 와 잘 흔합하여 100 씩 10개의 단백질이 결합되어 있는 웰에 분주하고 27°C에서 2 시간 동안 정치하였다. 0.1% PBST 용액으로 5 회 세척한 다음 HRP- 컨쥬게이션 항 -M13 항체 (GE Healthcare)를 1:1,000 으로 회석하여 27°C에서 1 시간 반응하였다. 0'1% PBST 로 5 회 세척한 후 TMB 용액 100 ^를 분주하여 발색반응을 유도한 다음 1M HC1 100 ^을 첨가하여 반응을 중지시킨 다음 450 nm에서 흡광도를 측정하였다.
HER2에 특이적인 바이포달펩타이드 바인더의친화력 측정
DNA 시퀀싱에서 중복되어 나온 HER2 에 특이적인 바이포달 펩타이드 바인더 펩타이드를 합성 (애니젠, 한국)을 하였다. 친화도의 측정은 BIAcore X(Biacore AB, Uppsala, Sweden)를 이용하여 수행하였다, HER2를 EDC/NHS 을 이용하여 CM5 칩 (Biacore)에 고정하였다. 러닝 버퍼로는 PBS(pH 7.4)을 사용하였고 플로우는 분당 30 ^로 홀리면서 여러 농도로 동력학을 측정한 후 BIAevaluation 소프트웨어 (Biacore AB, Uppsala, Sweden)로 친화도를 계산하였다.
HER2에 특이적인 바이포달펩타이드 바인더의 HER2과발현세포 인식실험 HER2 를 과발현하는 세포를 찾은 바이포달 펩타이드 바인더가 인식할 수 있는지 확인하기 위하여 HER2 과발현하는 세포인 BT-474 (American Type Culture Col lection)와 HER2-결핍 세포인 CH0 세포 (American Type Culture Col lection)를 이용하여 세포 인식 실험을 진행하였다. 우선 시료를 처리하기 전날에 커버슬라이드에 BT-474 와 CH0 세포를 붙인다. 그 다음날 FITC (sigma)를 붙인 상기 펩타이드를 BT-474 와 CH0 세포에 4 °C에서 lh 동안 처리한 후에 PBS로 washing을 한후에 컨포칼 현미경 (Carl zeiss)을 이용하여 이미지를 측정하였다.
BPB匿의 친화도의 측정
HER2 에 대한 상기 펩타이드를 합성하여 SPR Biacore system(Biacore AB, Uppsala, Sweden)을 이용하여 친화도를 측정하였다. HER2 에 대한 친화도를 측정한 결과 89 nM을 나타냈다.
HER2에 대한특이성분석
각각의 단백질에 특이적으로 결합하는 재조합 파아지를 여러 단백질에 대해서 특이성 검사를 ELISA 을 이용하여 시행하였다. 96-웰 ELISA 플레이트에 각각의 단백질을 5 //g/ 을 50 ^씩 웰에 넣고 다음날 0.1% PBST(Tween-20)로 3 회 세척하고 2% BSA 를 사용하여 상온에서 2 시간 동안 블로킹을 한 후, 용액을 모두 버리고 0.1¾) PBST 로 3 회 세척하였다, 여기에 본 발명의 펩타이드를 가지는 재조합 파아지를 2% BSA 와 잘 흔합하여 100 ^씩 10개의 단백질이 결합되어 있는 웰에 분주하고 27°C에서 2 시간 동안 정치하였다. 0,1% PBST 용액으로 5 회 세척한 다음 HRP- 컨쥬게이션 항 -M13 항체 (GE Healthcare)를 1:1,000 으로 희석하여 27°C에서 1 시간 반응시켰다。 0.1% PBST 로 5 회 세척한 후 TMB 용액 100 ^를 분주하여 발색반웅을 유도한 다음 1M HC1 100 ^을 첨가하여 반응을 중지시킨 다음 450 nm 에서 흡광도를 측정하였다. 이 펩타이드는 HER2 에 대하여 특이성을갖는다는 것을 알수 있다.
HER2과발현하는세포 인식실험
HER2 과발현하는 BT-474 세포와 발현이 적은 CH0 세포를 이용하여 상기 펩타이드가 세포의 HER2 를 인식할 수 있는지 이미징 실험을 하였다. 아래 그림을 보듯이 이 펩타이드는 세포에 있는 HER2 도 층분히 특이적으로 인식할 수 있다.
VEGFRl에 붙는 바이포달펩타이드 바인더를 찾기 위한 바이오패닝
VEGFRl 에 관한 바이오패닝도 HER2 와 같은 과정으로 진행했다. 각 panning 단계마다 상기 같은 방법을 사용했으며 , 단 세척과정만 0„1% PBST 10, 20, 30회로 단계별로 증가시켰다.
VEGFRl 단백질에 붙는 phage의 특이성실험
시뭔싱을 통해 찾은 펩타이드 (BPB½GFR1, BPB2VEGFRI, BPB3VEGFR1)의 VEGFRl에 대한 특이성을 조사하기 위해서 이 펩타이드들을 발현하는 재조합 파지들을 이용하여 VEGFRl, VEGFR2, 스트랩타비딘 (streptavidin)， HSA, TNF, VEGF 에 대해서 특이성을 조사하였다. 먼저 96well EL ISA plate에 5ug/ml VEGFRl, VEGFR2, 스트렙타비딘, HSA, TNF, VEGF 을 50 웰 씩 넣고 4 °C 에서 하룻밤 방치하였고, 다음날 모든 wells 을 0.1% PBST 로 3 회 세척하고 PBS 로 희석한 2% BSA 를 사용하여 상온에서 2 시간 동안 blocking 한 뒤， 용액을 모두 버리고 0.1¾ PBST 로 3 회 세척하였다. 여기에 BPBlvEGFR1, BPB2VEGFRI, BPB3VEGFR1의 각각의 재조합 파지 800ul 과 10% BSA 200ul 을 잘 흔합하여 100 씩 스트렙타비딘， BSA, ovalbumin, VEGF 웰에 분주하고 270C 에서 1 시간 정치하였다ᅳ 0.1% PBST 용액으로 5 번 세척한 다음 HRP-conjugated anti-M13 항체 (GE Healthcare)를 1:1,000으로 희석하여 27 °C 에서 1 시간 반웅시켰다. 0„1% PBST 로 5 번 세척한 후 TMB 용액 100 μΐ 를 분주하여 발색반응을 유도한 다음 lOOul 의 1M HC1 를 첨가하여 반웅을 중지시켰다. 450 nm에서 흡광도를 측정하였다.
BPBlwGi 의 Binding assays(SPR)
BPBIVEGFRI 를 합성 (Anygen)하여 BIAcore X 을 이용하여 친화도를 측정하였다. CM5 칩 (Biacore)에 VEGFRl 을 7000RU 만큼 흘려주어 고정시켰다. 러닝버퍼로는 PBS(pH7.4)을 사용했고 유속는 30 ^/min 으로 홀리면서 여러 농도로 동력학을 측정을 한 후 BIAevahiation 으로 친화도를 계산하였다.
VEGFRl에 붙는 바이포달펩타이드 바인더의 바이오패닝 후에파지 ELISA
VEGFRl 에 붙는 바이포달 펩타이드 바인더의 마지막 패닝 단계에서 회수한 파아지를 플라크 (plaque)형태로 확보하였다. 각 플라크로부터 30 개의 파아지을 증폭시킨 후 VEGFRl 과 BSA 에 대해 ELISA를 시행하였다。 VEGFRl 보다 3 배 이상 흡광도를 보이는 클론 12 개를 DNA 시뭔싱을 해 보았다. 3개의 중복된 펩타이드 시뭔스를 얻었다. 스크리닝을 통해서찾은 펩타이드 시뭔스
BPBIVEGFRI： GNQWF IGGGSWT ENGKWTWKGRIPKNR
BPB2VEGFR1: GNQWF IGGGSWTWENGKWTWKGKLQNPM
BPB3VEGFRI： GNQWF IGGGSWTWENGKWTWKGQQAIQP
BPBIVEGFRI의 특이성조사
최적화된 펩타이드인 특이성을 조사하기 위해서 VEGFRl, VEGFR2, streptavidin, HSA, TNF, VEGF 에 대해서 ELISA 를 하였다. 그림 8 에서 보듯이 세 개의 펩타이드들이 VEGFRl 에 대해서 특이적으로 결합함을 알 수 있다.
BPBIVEGFRI의 친화력조사 최적화된 펩타이드 BPB1VEGFR1 을 합성하여 SPR biacore system 올 이용하여 친화력를 측정하였다. Affinity 를 측정한 결과 BPB1VEGFR1 는 1.0 uM의 친화력을 가진다.
이상으로 본 발명의 특정한 부분을 상세히 기술하였는 바, 당업계의 통상의 지식을 가진 자에게 있어서 이러한 구체적인 기술은 단지 바람직한 구현 예일 뿐이며， 이에 본 발명의 범위가 제한되는 것이 아닌 점은 명백하다. 따라서， 본 발명의 실질적인 범위는 첨부된 청구항과 그의 등가물에 의하여 정의된다고 할 것이다.

Claims

【청구의 범위】
【청구항 1]
다음의 단계를 포함하는 수용체 타이로신 키나아제 (receptor tyrosine kinase: RTK) 타겟에 특이적으로 결합하는 RTK-바이포달 펩타이드 바인더 (RTK-BPB)의 제조방법 :
(a) (i) 가닥간 (interstrand) 비공유결합이 형성되는 패러럴 (parallei), 안티패러럴 (antiparallel) 또는 패러럴 (paral lei )과 안티패러럴 (antiparallel) 아미노산 가닥들을 포함하는 구조 안정화 부위 (structure stabilizing region); (ii) 상기 구조 안정화 부위의 양 말단에 결합되어 있고 무작위적으로 선택된 각각 n 및 m 개의 아미노산을 포함하는 RTK-타겟 결합 부위 KRTK-target binding region I) 및 RTK-타겟 결합 부위 n(RTK-target binding region Π )를 포함하는 RTK—바이포달 펩타이드 바인더 (RTK-BPB)의 라이브러리를 제공하는 단계;
(b) 상기 라이브러리와 타켓으로서의 RTK 을 접촉시키는 단계; 그리고，
(c) 상기 RTK 과 결합된 RTK-바이포달 펩타이드 바인더 (RTK— BPB)를 선택하는 단계。
【청구항 2】
제 1 항에 있어서, 상기 구조 안정화 부위에 형성되는 가닥간 비공유결합은 수소결합， 정전기적 상호작용, 소수성상호작용， 반데르 발스 상호작용, 파이 -파이 상호작용， 양이온 -파이 상호작용 또는 이들의 조합인 것을 특징으로 하는 방법。
【청구항 3】
제 1 항에 있어서, 상기 구조 안정화 부위의 아미노산 가닥들은 링커로 연결된 것을 특징으로 하는 방법.
【청구항 4】 제 1 항에 있어서, 상기 구조 안정화 부위는 β-헤어핀， 링커로 연결된 -쉬트, 루이신 지퍼， 링커로 연결된 루이신 지퍼， 루이신 리치 모티프 또는 링커로 연결된 루이신 리치 모티프인 것을 특징으로 하는 방법.
【청구항 5】
제 4 항에 있어서， 상기 구조 안정화 부위는 β-헤어핀인 것을 특징으로 하는 방법。
【청구항 6】
제 5 항에 있어서， 상기 β—헤어핀은 서열목록 제 1 서열 내지 제 19 서열로 구성된 군으로부터 선택되는 아미노산 서열을 포함하는 것을 특징으로 하는 방법ᅳ
【청구항 7】
제 6 항에 있어서, 상기 β-헤어핀은 서열목록 제 2서열， 제 14서열 또는 제 18 서열로부터 선택되는 아미노산 서열을 포함하는 것을 특징으로 하는 방법ᅳ
【청구항 8】
제 5 항에 있어서， 상기 β-헤어핀은 다음 일반식 I 로 표시되는 것을 특징으로 하는 방법 :
일반식 I
X;rTrp(X2 )¾- -¾ (X ' 2 )¾-X7
Χι은 Ser 또는 Gly-Glu이고， ¾ 및 X'2는 서로 독립적으로 Thr, His, Val, lie, Phe 또는 Tyr 이며， ¾는 Trp 또는 Tyr 이고， 는 타입 I， 타입 Γ , 타입 Π , 타입 Π ' 또는 타입 ΠΙ 또는 타입 ΠΓ 턴 서열이고， ¾는 Trp 또는 Phe이며 , ¾는 Trp 또는 Val이고, X7는 Lys 또는 Thr-Glu이다.
【청구항 9】
제 5 항에 있어서， 상기 β-헤어핀은 다음 일반식 Π로 표시되는 것을 특징으로 하는 방법 : 일반식 Π
Xi-Trp-X2-Tyr-X3-Phe-Thr-Va 1 -¾
Χι은 Arg, Gly-Glu또는 Lys-Lys이고， X2는 Gin또는 Thr이며, ¾는 타입 I， 타입 1'， 타입 Π, 타입 Π' 또는 타입 m 또는 타입 ΠΓ 턴 서열이고， ¾는 Gin, Thr-Glu또는 Gln-Glu이다.
【청구항 10】
제 5 항에 있어서， 상기 β-헤어핀은 다음 일반식 m으로 표시되는 것을 특징으로 하는 방법 :
일반식 m
Xi-X2-X3-Trp-X4-X5-Thr-X6-X7
¾은 Lys 또는 Lys-Lys이고， X2는 Trp또는 Tyr이고， ¾는 Val 또는 Thr 이며, 는 타입 I， 타입 1'， 타입 II， 타입 Π' 또는 타입 m 또는 타입 ΠΓ 턴 서열이고, ¾는 Trp 또는 Ala 이며， ¾는 Trp 또는 Val 이고， X7은 Glu또는 Gin— Ghi이다,
【청구항 11】
제 5 항에 있어서, 상기 β-헤어핀은 다음 일반식 IV로 표시되는 것을 특징으로 하는 방법:
일반식 IV
Figure imgf000039_0001
Xi은 Lys— Thr 또는 Gly이고, X2는 Trp또는 Tyr 이고, X3는 타입 I, 타입 1'， 타입 타입 Π' 또는 타입 ΙΠ 또는 타입 ΠΓ 턴 서열이고, X4는 Thr-Glu또는 Gly이다ᅳ
【청구항 12】
제 8 항에 있어서， 상기 β-헤어핀은 상기 일반식 I 에서 ¾은 Ser 또는 Gly-Glu 이고, ¾ 및 X'2는 서로 독립적으로 Thr, His 또는 Val 이며 , ¾는 Trp 또는 Tyr 이고, 는 타입 I， 타입 Γ, 타입 Π 또는 타입 Π' 서열이고， Χ5는 Trp또는 Phe이며， ¾는 Trp또는 Val 이고, X7는 Lys 또는 Thr-Glu이다.
【청구항 13】
제 1 항에 있어서 , 상기 RTK-타겟 결합 부위 I의 아미노산 개수 n은 2-20인 것을 특징으로 하는 방법 .
【청구항 14]
제 1 항에 있어서， 상기 RTK-타겟 결합 부위 Π의 아미노산 개수 m은 2-20인 것을 특징으로 하는 방법 .
【청구항 15】
제 1 항에 있어서, 상기 라이브러리는 플라스미드， 박테리오파아지， 파아지미드로, 이스트 또는 박테리아로부터 제작된 것을 특징으로 하는 방법.
【청구항 16]
제 1 항에 있어서, 상기 RTK-타겟 결합 부위 I 및 RTK-타겟 결 부위 Π는 RTK에 공동으로 작용하여 결합하는 것을 특징으로 하는 방법 .
【청구항 17】
제 1 항에 있어서ᅳ 상기 구조 안정화 부위， RTK-타겟 결합 부위 I 또는 RTK-타겟 결합 부위 Π에 추가적으로 기능성 분자가 결합되어 있는 것을 특징으로 하는 방법 .
【청구항 18】
제 17 항에 있어서, 상기 기능성 분자는 검출가능한 신호를 발생시키는 레이블, 화학약물, 바이오약물, 세포막투과 펩타이드 (CPP) 또는 나노입자인 것을 특징으로 하는 방법。
【청구항 19】
(a) 가닥간 (interstrand) 비공유결합이 형성된 패러럴 (paral lei ) , 안티패러럴 (antiparallel) 또는 패러럴 (parallel)과 안티패러럴 (antiparallel) 아미노산 가닥들을 포함하는 구조 안정화 부위 (structure stabilizing region)； 및
(b) 상기 구조 안정화 부위의 양 말단에 결합되어 있고 무작위적으로 선택된 각각 n 및 m 개의 아미노산을 포함하는 RTK-타겟 결합 부위 I(RTK- target binding region I) 및 RTK-타겟 결합 부위 EKRTK-target binding region Π )를 포함하는 RTK 에 특이적으로 결합하는 RTK-바이포달 펩타이드 바인더ᅳ
【청구항 20】
제 19 항에 있어서, 상기 구조 안정화 부위에 형성된 가닥간 비공유결합은 수소결합， 정전기적 상호작용， 소수성상호작용， 반데르 발스 상호작용， 파이 -파이 상호작용, 양이온 -파이 상호작용 또는 이들의 조합인 것을 특징으로 하는 RTK-바이포달 펩타이드 바인더.
【청구항 21】
제 19 항에 있어서， 상기 구조 안정화 부위의 아미노산 가닥들은 링커로 연결된 것을 특징으로 하는 RTK-바이포달 펩타이드 바인더.
【청구항 22】
제 19 항에 있어서, 상기 구조 안정화 부위는 β-헤어핀， 링커로 연결된 β-쉬트, 루이신 지퍼 또는 링커로 연결된 루이신 지퍼， 루이신 리치 모티프인 것을 특징으로 하는 RTK-바이포달 펩타이드 바인더ᅳ
【청구항 23】
제 19 항에 있어서, 상기 구조 안정화 부위는 β_헤어핀인 것을 특징으로 하는 RTK-바이포달 펩타이드 바인더 .
【청구항 24】
제 23 항에 있어서， 상기 β-헤어핀은 서열목록 제 1 서열 내지 제 19서열로 구성된 군으로부터 선택되는 것을 특징으로 하는 RTK-바이포달 펩타이드 바인더.
【청구항 25】
제 24항에 있어서 , 상기 -헤어핀은 서열목록 제 2서열, 제 14서열 또는 제 18서열로부터 선택되는 것올 특징으로 하는 RTK-바이포달 펩타이드 바인더 .
【청구항 26】
제 23 항에 있어서， 상기 β-헤어핀은 다음 일반식 I 로 표시되는 것을 특징으로 하는 RTK-바이포달 펩타이드 바인더:
일반식 I
X厂 Trp(X2)¾— Χ4-Χ5(Χ'2)Χ6-Χ7 - ¾은 Ser 또는 Gly-Glu이고， ¾ 및 X'2는 서로 독립적으로 Thr, His, Val, He, Phe또는 Tyr 이며， X3는 Trp또는 Tyr 이고， ¾는 타입 I， 타입 ι'， 타입 π， 타입 π' 또는 타입 m또는 타입 m' 턴 서열이고, ¾는 Trp 또는 Phe이며， ¾는 Trp또는 Val이고, X7는 Lys 또는 Thr-Glu이다.
【청구항 27】
제 23 항에 있어서， 상기 β-헤어핀은 다음 일반식 Π로 표시되는 것을 특징으로 하는 RTK-바이포달 펩타이드 바인더 :
일반식 Π
Xi-Trp-Xa-Tyr-Xs-Phe-Thr-Va 1 -X4
¾은 Arg, Gly-Glu또는 Lys-Lys이고, X2는 Gin또는 Thr이며， ¾는 타입 I， 타입 1'， 타입 II， 타입 Π' 또는 타입 m 또는 타입 ΠΓ 턴 서열이고 는 Gin, Thr-Glu또는 Gln-Glu이다.
【청구항 28】
제 23항에 있어서， 상기 β-헤어핀은 다음 일반식 m으로 표시되는 것을 특징으로 하는 RTK—바이포달 펩타이드 바인더 :
일반식 m
Xi-X2-X3-Tr -X4-X5-Thr-X6-X7 ¾은 Lys 또는 Lys-Lys이고, X2는 Trp또는 Tyr이고, X3는 Val 또는 Thr 이며, 는 타입 I, 타입 1'， 타입 Π, 타입 Π' 또는 타입 ΙΠ 또는 타입 ΠΓ 턴 서열이고， ¾는 Trp 또는 Ala 이며， ¾는 Trp 또는 Val 이고, X7은 Glu또는 Gln-Glu이다.
【청구항 29】
제 23 항에 있어서， 상기 β-헤어핀은 다음 일반식 IV로 표시되는 것을 특징으로 하는 RTK-바이포달 펩타이드 바인더:
일반식 IV
Figure imgf000043_0001
¾은 Lys-Thr 또는 Gly이고， ¾는 Trp또는 Tyr 이고, ¾는 타입 I, 타입 1'， 타입 Π, 타입 Π' 또는 타입 m 또는 타입 ΠΓ 턴 서열이고, ¾는 Thr-Glu또는 Gly이다.
【청구항 30】
제 24 항에 있어서， 상기 β-헤어핀은 상기 일반식 I 에서 ¾은 Ser 또는 Gly-Glu 이고， ¾ 및 X'2는 서로 독립적으로 Thr, His 또는 Val 이며, ¾는 Trp 또는 Tyr 이고, 는 타입 I， 타입 Γ, 타입 Π 또는 타입 Π' 서열이고， ¾는 Trp또는 Phe이며， ¾는 Trp또는 Val 이고， X7는 Lys 또는 Thr-Glu 인 것을 특징으로 하는 RTK-바이포달 펩타이드 바인더 .
【청구항 31]
제 19 항에 있어서， 상기 RTK-타겟 결합 부위 I 의 아미노산 개수 n은 2-20인 것을 특징으로 하는 RTK—바이포달 펩타이드 바인더 .
【청구항 32】
제 19 항에 있어서, 상기 RTK-타겟 결합 부위 Π의 아미노산 개수 m은 2-20인 것을 특징으로 하는 RTK-바이포달 펩타이드 바인더 .
【청구항 33】 제 19 항에 있어서， 상기 RTK-타겟 결합 부위 I 및 RTK-타겟 결합 부위 Π는 RTK 에 공동으로 작용하여 결합하는 것을 특징으로 하는 RTK- 바이포달 펩타이드 바인더 .
【청구항 34】
제 19 항에 있어서, 상기 구조 안정화 부위， RTK-타겟 결합 부위 I 또는 RTK-타겟 결합 부위 Π에 추가적으로 기능성 분자가 결합되어 있는 것을 특징으로 하는 RTK-바이포달 펩타이드 바인더 .
【청구항 35】
제 34 항에 있어서, 상기 기능성 분자는 검출가능한 신호를 발생시키는 레이블， 화학약물， 바이오약물, 세포막투과 펩타이드 (CPP) 또는 나노입자인 것을 특징으로 하는 RTK-바이포달 펩타이드 바인더.
【청구항 36】
상기 제 19 항 내지 제 35 항 중 어느 한 항의 바이포달 펩타이드 바인더를 코딩하는 핵산 분자.
【청구항 37】
상기 제 36 항의 핵산 분자를 포함하는.바이포달 펩타이드 바인더의 발현용 백터.
PCT/KR2011/002840 2010-04-20 2011-04-20 Rtk에 특이적으로 결합하는 rtk-bpb Ceased WO2011132940A2 (ko)

Priority Applications (1)

Application Number Priority Date Filing Date Title
KR1020127023550A KR20130103299A (ko) 2010-04-20 2011-04-20 Ｒｔｋ에 특이적으로 결합하는 ｒｔｋ―ｂｐｂ

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2010-0036608 2010-04-20
KR20100036608 2010-04-20

Publications (2)

Publication Number Publication Date
WO2011132940A2 true WO2011132940A2 (ko) 2011-10-27
WO2011132940A3 WO2011132940A3 (ko) 2012-04-05

Family

ID=44834646

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2011/002840 Ceased WO2011132940A2 (ko) 2010-04-20 2011-04-20 Rtk에 특이적으로 결합하는 rtk-bpb

Country Status (2)

Country Link
KR (1) KR20130103299A (ko)
WO (1) WO2011132940A2 (ko)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2909226A4 (en) * 2012-10-19 2016-04-13 Nat Res Council Canada DERIVATIVES OF COLLAGEN BINDING HAIR NEEDLE PEPTIDES

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5427908A (en) * 1990-05-01 1995-06-27 Affymax Technologies N.V. Recombinant library screening methods
JP2001002592A (ja) * 1999-06-18 2001-01-09 Dai Ichi Seiyaku Co Ltd 遺伝子導入用組成物
US6914123B2 (en) * 2001-04-17 2005-07-05 Genentech, Inc. Hairpin peptides with a novel structural motif and methods relating thereto
US7462703B2 (en) * 2003-01-31 2008-12-09 Max-Delbruck-Centrum Fur Molekulare Medizin Agent for gene transfer
CA2741040C (en) * 2008-10-20 2015-09-22 Gwangju Institute Of Science And Technology Bipodal-peptide binder

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2909226A4 (en) * 2012-10-19 2016-04-13 Nat Res Council Canada DERIVATIVES OF COLLAGEN BINDING HAIR NEEDLE PEPTIDES

Also Published As

Publication number Publication date
WO2011132940A3 (ko) 2012-04-05
KR20130103299A (ko) 2013-09-23

Similar Documents

Publication Publication Date Title
KR101151805B1 (ko) 바이포달 펩타이드 바인더
JP5677454B2 (ja) 細胞内ターゲット結合用二座ペプチドバインダー
US20210145976A1 (en) Cd71 binding fibronectin type iii domains
CN114945584A (zh) 重组肽-mhc复合物结合蛋白及其生成和用途
WO2011071279A2 (ko) Bpb-기반 카르고 운반 시스템
JP2023509004A (ja) ニドゲンをベースとする足場タンパク質および治療用ナノ複合体
TW201309720A (zh) 胜肽庫
JP2024511155A (ja) 多価タンパク質およびスクリーニング法
TW201102086A (en) Antibodies against human CCN1 and uses thereof
WO2011132940A2 (ko) Rtk에 특이적으로 결합하는 rtk-bpb
CN116199744A (zh) 一种结合fgfr2受体的多肽及其用途
KR20120115022A (ko) 타겟 친화도가 유지되고 안정성이 개선된 ｄ－앱타이드
KR20150118252A (ko) 환형의 β-헤어핀 기반 펩타이드 바인더 및 이의 제조방법
KR20130103301A (ko) 전사인자에 특이적으로 결합하는 ｔｆ-ｂｐｂ
Jennings et al. Production of calmodulin-tagged proteins in Drosophila Schneider S2 cells: a novel system for antigen production and phage antibody isolation
WO2011132938A2 (ko) Gpcr에 특이적으로 결합하는 gpcr-bpb
KR20110116930A (ko) 이온채널에 특이적으로 결합하는 이온채널―ｂｐｂ
KR101443839B1 (ko) 펩타이드의 타겟 친화도 개선방법
WO2011132939A2 (ko) Rtk에 특이적으로 결합하는 rtk-bpb
CN102224162B (zh) 双齿肽结合物
WO2023145860A1 (ja) Ｓｃｆ受容体結合ペプチド
Rajagopal Directed evolution of a beta-sheet scaffold for targeting proteins involved in human disease–Thrombin and the vascular endothelial growth factor (VEGF)
WO2015132248A2 (en) Sequamers - a novel non-natural type of peptide libraries randomly constrained by their primary sequences

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 11772228

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 20127023550

Country of ref document: KR

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 11772228

Country of ref document: EP

Kind code of ref document: A2