WO2011056899A2 - Chimeric rsv-f polypeptide and lentivirus or alpha-retrovirus gag-based vlps - Google Patents
Chimeric rsv-f polypeptide and lentivirus or alpha-retrovirus gag-based vlps Download PDFInfo
- Publication number
- WO2011056899A2 WO2011056899A2 PCT/US2010/055334 US2010055334W WO2011056899A2 WO 2011056899 A2 WO2011056899 A2 WO 2011056899A2 US 2010055334 W US2010055334 W US 2010055334W WO 2011056899 A2 WO2011056899 A2 WO 2011056899A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- virus
- cell
- gag
- polypeptide
- delivery
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/081—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from DNA viruses
- C07K16/085—Herpetoviridae, e.g. pseudorabies virus, Epstein-Barr virus
- C07K16/087—Herpes simplex virus
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
- C07K16/1027—Paramyxoviridae, e.g. respiratory syncytial virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/525—Virus
- A61K2039/5258—Virus-like particles
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/11011—Alpharetrovirus, e.g. avian leucosis virus
- C12N2740/11023—Virus like particles [VLP]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16023—Virus like particles [VLP]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16211—Human Immunodeficiency Virus, HIV concerning HIV gagpol
- C12N2740/16222—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/00023—Virus like particles [VLP]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/18011—Paramyxoviridae
- C12N2760/18511—Pneumovirus, e.g. human respiratory syncytial virus
- C12N2760/18522—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/18011—Paramyxoviridae
- C12N2760/18511—Pneumovirus, e.g. human respiratory syncytial virus
- C12N2760/18534—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
Definitions
- the present invention relates to the field of chimeric virus-like particles
- VLPs that include a respiratory syncytial virus (RSV) F polypeptide and a lentivirus or alpha-retrovirus GAG polypeptide.
- RSV respiratory syncytial virus
- the field includes chimeric VLPs and methods of producing chimeric VLPs.
- the chimeric VLPs comprise an avian leukosis virus (ALV), a rous sarcoma virus, a simian
- SIV immunodeficiency virus
- HAV human immunodeficiency virus
- Respiratory syncytial virus is a leading cause of bronchiolitis and pneumonia among infants and children under 1 year of age (CDC National Center for Infectious Diseases (2004) Respiratory Syncytial Virus). RSV can also be a significant lower respiratory tract pathogen in immuno-compromised adults and the elderly.
- RSV is a negative-sense, single-stranded RNA virus that belongs to the genus Pneumovirus of the family Paramyxoviridae.
- the RSV genome is surrounded by a helical nucleocapsid and encodes at least ten proteins: three transmembrane structural proteins (F, G, and SH), two matrix proteins (M and M2), three nucleocapsid proteins (N, P, and L), and two nonstructural proteins (NS 1 and NS2) (Collins et al (1 996)
- VLPs Virus-like particles offer several advantages over conventional vaccine technology.
- An important advantage of VLPs for vaccine development is that they mimic native viruses in terms of three-dimensional structure and the ability to induce neutralizing antibody responses to both primary and conformational epitopes and therefore should prove more immunogenic than other vaccine formulations.
- VLPs exhibit no problem with pre-existing immunity, thus allowing for recurrent use.
- VLPs containing RSV antigens have been generated by co-expression of RSV F protein with RSV matrix (M) protein or with a heterologous M protein in insect cells (US 2008/0233150).
- the chimeric VLPs will comprise a lentivirus or alpha-retrovirus Gag polypeptide and a respiratory syncytial virus F polypeptide.
- compositions includes chimeric virus-like particles comprising a lentivirus or alpha-retrovirus Gag polypeptide and a respiratory syncytial virus F polypeptide, which may have at least 80% sequence identity, at least 85% sequence identity, at least 90% sequence identity, at least 95% sequence identity, at least 97%> sequence identity, or at least 99% sequence identity to any of the respiratory syncytial virus F polypeptide amino acid sequences disclosed in the examples herein.
- the Gag polypeptide is from a human immunodeficiency virus, which may have at least 80% sequence identity, at least 85% sequence identity, at least 90% sequence identity, at least 95% sequence identity, at least 97% sequence identity, or at least 99% sequence identity to any of the human immunodeficiency virus Gag polypeptide amino acid sequences disclosed in the examples herein, or a simian immunodeficiency virus, which may have at least 80% sequence identity, at least 85%) sequence identity, at least 90% sequence identity, at least 95% sequence identity, at least 97% sequence identity, or at least 99% sequence identity to the simian immunodeficiency virus Gag polypeptide amino acid sequences disclosed in the examples herein.
- the Gag polypeptide is from an avian leukosis virus, which may have at least 80%) sequence identity, at least 85%) sequence identity, at least 90% sequence identity, at least 95% sequence identity, at least 97% sequence identity, or at least 99% sequence identity to any of the avian leukosis virus Gag polypeptide amino acid sequences disclosed in the examples herein.
- the virus-like particle further comprises mammalian glycosylation.
- the preparation also includes an adjuvant in admixture with the virus-like particles.
- the adjuvant may be located outside the virus-like particle or may be located inside the virus-like particle.
- the adjuvant may be covalently linked to the respiratory syncytial virus F polypeptide to form a covalent linkage.
- a neutralizing anti-RSV-F antibody may bind to the respiratory syncytial virus F polypeptide (demonstrating that the RSV F polypeptide is in
- the neutralizing anti-RSV-F antibody may be Palivizumab.
- the chimeric virus-like particles further comprise an additional VLP-associating antigen, or VLP-associating polypeptide linked to a second antigen.
- Another aspect includes methods for producing a chimeric virus-like particle, comprising: (a) providing one or more expression vectors together which express a lentivirus or alpha-retrovirus Gag polypeptide and a respiratory syncytial virus F polypeptide, which may have at least 80% sequence identity, at least 85% sequence identity, at least 90% sequence identity, at least 95% sequence identity, at least 97% sequence identity, or at least 99% sequence identity to any of the respiratory syncytial virus F polypeptide nucleic acid sequences disclosed in the examples herein; (b) introducing the one or more expression vectors into a eukaryotic cell in a media; and (c) expressing the retroviral Gag polypeptide and the respiratory syncytial virus F polypeptide to produce the chimeric virus-like particle.
- the eukaryotic cell is a yeast cell or a mammalian cell. In certain embodiments, the eukaryotic cell is a mammalian cell.
- the Gag polypeptide is from a human immunodeficiency virus, which may have at least 80% sequence identity, at least 85% sequence identity, at least 90% sequence identity, at least 95% sequence identity, at least 97% sequence identity, or at least 99% sequence identity to any of the human immunodeficiency Gag polypeptide nucleic acid sequences disclosed in the examples herein, or a simian immunodeficiency virus, which may have at least 80% sequence identity, at least 85% sequence identity, at least 90% sequence identity, at least 95% sequence identity, at least 97% sequence identity, or at least 99% sequence identity to the simian immunodeficiency virus Gag polypeptide amino acid sequences disclosed in the examples herein.
- the Gag polypeptide is from an avian leukosis virus, which may have at least 80% sequence identity, at least 85% sequence identity, at least 90% sequence identity, at least 95% sequence identity, at least 97% sequence identity, or at least 99% sequence identity to any of the avian leukosis virus Gag polypeptide nucleic acid sequences disclosed in the examples herein.
- the virus-like particle further comprises mammalian glycosylation.
- the method further includes the step of recovering the virus-like particles from the media in which the eukaryotic cell is cultured.
- the expression vector may be a viral vector.
- the viral vector may be selected from the group consisting of: an adenovirus, a herpesvirus, a poxvirus and a retrovirus.
- the viral vector further includes a transcriptional regulator that down-regulates expression of the respiratory syncytial virus F polypeptide when the viral vector is propagated in a helper cell or up- regulates expression of the respiratory syncytial virus F polypeptide in the eukaryotic cell.
- the transcriptional regulator may be a tet repressor or a metallothionine inducible enhancer.
- the eukaryotic cell may be selected from the group consisting of a BHK cell, a VERO cell, an HT1080 cell, an MRC-5 cell, a WI 38 cell, an MDC cell, an MDB cell, a 293 cell, a 293T cell, an RD cell, a COS-7 cell, a CFIO cell, a Jurkat cell, a HUT cell, a SUPT cell, a C8166 cell, a MOLT4/clone8 cell, an MT-2 cell, an MT-4 cell, an H9 cell, a PM1 cell, a CEM cell, a myeloma cell, SB20 cell, a LtK cell, a HeLa cell, a WI-38 cell, an L2 cell, a CMT-93, and
- a neutralizing anti-RSV-F antibody may bind to the expressed respiratory syncytial virus F polypeptide (demonstrating that the respiratory syncytial virus F polypeptide is substantially in a native fold).
- the neutralizing anti-RSV-F antibody is Palivizumab.
- Another aspect includes methods for treating or preventing respiratory syncytial virus infection comprising administering to a subject an immunogenic amount of the preparation of any of the preceding embodiments of that aspect or the population produced by the method or any of the preceding embodiments of that aspect.
- Another embodiment that may be combined with any of the embodiments of the preceding aspect the administration induces a protective immunization response in the subject.
- the administration may be selected from the group consisting of subcutaneous delivery, transcutaneous delivery, intradermal delivery, subdermal delivery, intramuscular delivery, peroral delivery, oral delivery, intranasal delivery, buccal delivery, sublingual delivery, intraperitoneal delivery, intravaginal delivery, anal delivery and intracranial delivery.
- Another aspect includes pharmaceutical compositions comprising an immunogenic amount of the preparation of any of the preceding embodiments of that aspect or the population produced by the method or any of the preceding embodiments of that aspect.
- the pharmaceutical composition further includes a pharmaceutically acceptable carrier.
- Another aspect includes methods for providing protection against respiratory syncytial virus infection comprising administering to a subject an
- the administration may be selected from the group consisting of subcutaneous delivery, transcutaneous delivery, intradermal delivery, subdermal delivery, intramuscular delivery, peroral delivery, oral delivery, intranasal delivery, buccal delivery, sublingual delivery, intraperitoneal delivery, intravaginal delivery, anal delivery and intracranial delivery.
- Figure 1 shows the plasmid map of p3.1 -shFvl .
- Figure 2 shows the plasmid map of p3.1 -shFv2.
- Figure 3 shows the plasmid map for p3.1 -Gag.
- Figure 4 shows cytometric analysis of surface expression of RSV F on cells transfected with RSV F and Gag expression vectors.
- Figure 5 shows detection of RSV F antigenic activity in the 100,000 x g pellets from the medium of cells transfected with RSV F genes with and without co- transfection with a Gag gene.
- Figure 6 shows the plasmid map of p3.1-bruGag.
- Figure 7 shows the plasmid map of p3.1 -F-GPI.
- Figure 8 shows the HIV- 1 Gag Western blot of VLPs derived from p3.1 - bruGag plus p3.1 -F-GPI transfection.
- G indicates bruGag only expression.
- F indicates F-GPI only expression.
- 1 : 1 ,” “3 : 1 ,” and “9: 1 " indicate the ratio of bruGag to F-GPI.
- Figure 9 shows an RSV F Western blot of VLPs derived from p3.1- bruGag plus p3.1 -F-GPl transfection.
- G indicates bruGag only expression.
- F indicates F-GPI only expression.
- 1 : 1 ,” “3: 1 ,” and “9: 1” indicate the ratio of bruGag to F-GPI.
- Figure 10 shows an SDS-PAGE and Western blot showing bruGag and F-
- GPI products in VLPs released from transfected 293F cells A silver-stained SDS-PAGE gel is shown in the left panel.
- the Western blot is shown in the right panel.
- Figure 1 1 shows ELISA detection of F antigen in VLPs released from 293
- Figure 12 shows the plasmid map of p3.1 -RSVFT.
- Figure 13 shows an SDS-PAGE and Western blot showing bruGag and
- RSVFT products in VLPs released from transfected 293F cells A silver-stained SDS- PAGE gel is shown in the left panel.
- the Western blot is shown in the right panel.
- Figure 14 shows ELISA detection of F antigen in VLPs released from 293
- Figure 15 shows an electron micrograph of negative-stained, sucrose- banded VLPs derived from transfection of 293F cells with plasmids p3.1-bruGag and p3. 1 -RSVFT.
- Figure 16 shows a plaque reduction assay demonstrating the induction of
- Figure 17 shows the plasmid map of p3.1 -alvGag-dPR.
- Figure 18 shows ELISA detection of F antigen pseudotyped onto alvGag
- VLPs following transfection of 293F cells with p3.1 -alvGag-dPR and p3.1 -RSVFT.
- Figure 19 shows ELISA detection of F antigen pseudotyped onto alvGag
- Black circles indicate RSV virus positive control. Dark gray circles indicate alvGag-dPR + FT (3 : 1 ). Triangles pointing down indicate alvGag-dPR + FT (3 : 1). Triangles pointing up indicate HIVGag + FT (3: 1 ).
- Figure 20 shows ELISA detection of RSV F-pseudotyped VLPs produced via co-transfection of p3.1 -RSVFT along with vectors encoding various Gag products.
- Black circles indicate MPMV-Gag + FT.
- Dark gray circles indicate BLV-Gag + FT.
- Triangles pointing down indicate EIAV-Gag + FT.
- Triangles pointing up indicate alvGag-dPR + FT.
- Figure 21 shows plasmid map of p3.1 -alvGag encoding the complete alvGag polyprotein with intact retroviral protease activity.
- Figure 22 shows detection of RSV F antigenic activity in the medium of cells transfected with p3.1 -RSVFT or p3.1 -RSVFL in combination with p3.1 -alvGag- dPR and/or p3.1 -alvGag.
- VLPs were collected from the medium by ultracentrifugation then trapped on filter bottom ELISA plates.
- Black circles indicate Gag-dPR + FL (3: 1 ).
- Dark gray circles indicate Gag-dPR + FT (3: 1).
- Triangles pointing down indicate Gag + FL (3 : 1 ).
- Triangles pointing up indicate Gag + FT (3 : 1 ).
- Black squares indicate Gag- dPR + Gag + FL (10: 1 :3).
- Grey squares indicate Gag-dPR + Gag + FT (10: 1 :3).
- Grey diamonds indicate Gag-dPR + Gag + FL (3 : 1 : 1.3).
- Light grey diamonds indicate Gag- dPR + Gag + FT (3 : 1 : 1.3).
- Figure 23 shows a silver stained PAGE showing the proteolytic processing of ALV Gag in pelleted VLPs following transfection of cells with plasmids p3.1 -alvGag- dPR and/or p3.1-alvGag.
- the lanes are as follows: Lane 1 : alvGag-dPR + FL (3 : 1); Lane 2: alvGag-dPR + FT (3: 1); Lane 3: alvGag + FL (3: 1); Lane 4: alvGag + FT (3: 1); Lane 5: alvGag-dPR + alvGag + FT (10: 1 :3); Lane 6: alvGag-dPR + alvGag + FL (10: 1 :3); Lane 7: alvGag-dPR + alvGag + FL (3 : 1 : 1.3); and Lane 8: alvGag-dPR + alvGag + FT (3: 1 : 1.3).
- Figure 24 shows an electron micrograph of negative-stained, sucrose- banded VLPs derived from transfection of 293 F cells with plasmids p3.1 -alvGag-dPR, p3.1 -alvGag and p3.1 -RSVFT at a ratio of 10: 1 :3.
- Figure 25 shows (panel A) ELISA titers and (panel B) plaque reduction titers in various strains of mice immunized with ALV Gag VLPs pseudotyped with RSV "FT" and RSV "FL".
- Panel A Antibody titers specific for RSV virus immobilized on ELISA plates.
- Panel B Plaque reduction neutralizing titers.
- Figure 26 shows the plasmid map of p3.1-HSVgD.
- Figure 27 shows the direct ELISA of HSVgD- and alvGAG-dPR- transfected F1EK 293F Culture Supernatant Fluids.
- Figure 28 shows the immunoblot of HSVgD- and alvGAG-dPR- transfected HEK 293F Ultracentrifuge (UC) pelleted material.
- Panels (A) and (B) both have from left to right: standard (molecular weights are shown on the left); A
- Panel (A) shows the western blot using an anti- HSVgD monoclonal antibody
- (B) shows the western blot using anti-P27 alvGAG polyclonal antibodies.
- Figure 29 shows two electron micrographs of sample C: p3.1 -alvGAG- dPR only transfected HEK 293F Ultracentnfuge (UC) pelleted material.
- micrographs have a 500 nm scale bar.
- Figure 30 shows five electron micrographs of Sample D: p3.1 -HSVgD only transfected HEK 293F Ultracentrifuge (UC) pelleted material. All five micrographs have a 1000 nm scale bar. The solid line arrows point to large triangular or folded particles -150 - 200 nm. The dashed line arrows point to smaller oval to round particles - 90 - 120 nm.
- Figure 31 shows five electron micrographs of Sample F: p3.1 -HSVgD and p3.1 -alvGAG-dPR (2.3 : 1 ) transfected HEK 293F Ultracentrifuge (UC) pelleted material. Top two micrographs have a 1000 scale bar.
- Figure 32 shows the map of p3.1 -SIVagmGag.
- Figure 33 shows ELISA detection of F antigen in VLPs released from 293
- Figure 34 shows the plasmid map of pShuttle-CMV-TO.
- Figure 35 shows the plasmid map of pShuttle-ALV-Gag-dPR.
- Figure 36 shows the plasmid map of pShuttle-TO-FL.
- Figure 37 shows the plasmid map of pShuttle-dPR-TO-FL-rev.
- Figure 38 shows (a) the visible band of RSV F-pseudotyped VLPs collected between the 30% and 60% steps of a sucrose step gradient and (b) SDS-PAGE analysis of purified RSV F-pseudotyped VLPs produced via adenovirus vector transduction of Vero cells.
- Figure 39 shows the Western blot of VLPs showing presence of F antigen.
- Figure 40 shows an electron micrograph of RSV F-pseudotyped VLPs in the final VLP preparation derived from adenovirus vector-transduced Vero cells.
- Figure 41 shows RSV neutralization titers in cotton rats immunized with
- Figure 42 shows virus titers in the lungs of immunized and challenged cotton rats.
- Figure 43 shows lung histopathology scores (alveolitis and interstitial pneumonia) in VLP-immunized and challenged cotton rats.
- compositions and methods disclosed herein include, without limitation, chimeric VLPs that include at least an RSV-F polypeptide and a lentivirus or alpha-retrovirus GAG polypeptide; methods of expressing or generating such chimeric VLPs (which can be in a mammalian cell expression system); methods of further processing such VLPs into vaccine compositions and methods of using such vaccine compositions.
- chimeric VLPs disclosed herein comprise a lentivirus or alpha-retrovirus Gag polypeptide and a respiratory syncytial virus F polypeptide.
- Certain aspects and embodiments of the chimeric VLPs disclosed herein are based upon the surprising discovery that co-expression of an RSV-F polypeptide with a number of retroviral Gag proteins including the murine leukemia virus Gag protein, the Mason-Phizer monkey virus Gag protein, the bovine leukemia virus Gag protein, and the equine infectious anemia virus Gag protein result in markedly reduced amounts of VLPs which indicates that the RSV-F polypeptide interferes in some way with the budding function of the MLV Gag protein.
- the RSV-F polypeptide surprisingly does not interfere with VLP formation by rous sarcoma virus Gag protein, by avian leukosis virus Gag protein, by simian immunodeficiency virus Gag protein, or by human immunodeficiency virus Gag protein.
- An exemplary method of generating the chimeric VLPs is by expression in eukaryotic cells, which in particular embodiments may be yeast, insect or mammalian cells, and which may include co-expression of additional polypeptide antigens.
- a "chimeric VLP” as used here refers to virus-like particles that are formed using a lentivirus or alpha-retrovirus Gag polypeptide that may be expressed simultaneously with a respiratory syncytial virus F polypeptide.
- examples include, without limitation, VLPs comprising a respiratory syncytial virus F polypeptide substantially lacking the cytoplasmic portion of the respiratory syncytial virus F polypeptide or a respiratory syncytial virus F polypeptide substantially lacking the transmembrane domain and the cytoplasmic portion of respiratory syncytial virus F polypeptide and additionally linked to a GPI anchor signal.
- Mammalian glycosylation refers to glycosylation patterns generated by mammalian cell expression systems. Such glycosylation patterns do not include glycosylation patterns produced by insect cells that have been modified to include mammalian glycosylation enzymes, so long as such modified insect cells only produce "mammalian-like" glycosylation rather than the glycosylation pattern that would be naturally produced by a mammal or a mammalian cell based expression system.
- Non- limiting examples of mammalian glycosylation patterns include glycosylation produced by expression in human (e.g., HE 293, HeLa), Chinese hamster ovary (CHO), dog (e.g., DC ), mouse (e.g., H9), rat (e.g., IE) and non-human primate (e.g., NCTC) cells.
- human e.g., HE 293, HeLa
- CHO Chinese hamster ovary
- dog e.g., DC
- mouse e.g., H9
- rat e.g., IE
- NCTC non-human primate
- Gag polypeptide as used herein includes any retroviral Gag polypeptide that is from a lentivirus (but excluding EIAV) or alpha-retrovirus. Certain embodiments of the chimeric VLPs described herein are formed by ALV or HIV Gag polypeptides.
- the genome of retroviruses codes for three major gene products: the gag gene coding for structural proteins, the pol gene coding for reverse transcriptase and associated proteolytic polypeptides, nuclease and integrase associated functions, and env whose encoded glycoprotein membrane proteins are detected on the surface of infected cells and also on the surface of mature released virus particles.
- the gag genes of all retroviruses have an overall structural similarity and within each group of retroviruses are conserved at the amino acid level. The gag gene gives rise to the core proteins excluding the reverse transcriptase.
- the Gag precursor polyprotein is Pr65 Gag and is cleaved into four proteins whose order on the precursor is NH 2 -pl 5-ppl2-p30-plO-COOH. These cleavages are mediated by a viral protease and may occur before or after viral release depending upon the virus.
- the MLV Gag protein exists in a glycosylated and a non- glycosylated form. The glycosylated forms are cleaved from gPr80 Gag which is synthesized from a different inframe initiation codon located upstream from the AUG codon for the non-glycosylated Pr65 ag .
- Deletion mutants of MLV that do not synthesize the glycosylated Gag are still infectious and the non-glycosylated Gag can still form virus-like particles, thus raising the question over the importance of the glycosylation events.
- the post translational cleavage of the HIV-1 Gag precursor of pr55 Gag by the virus coded protease yields the N-myristoylated and internally phosphorylated pi 7 matrix protein (pl 7MA), the phosphorylated p24 capsid protein (p24CA), and the nucleocapsid protein p 15 (p i 5NC), which is further cleaved into p9 and p6.
- the prototypical Gag polyprotein is divided into three main proteins that always occur in the same order in retroviral gag genes: the matrix protein (MA) (not to be confused with influenza matrix protein Ml, which shares the name matrix but is a distinct protein from MA), the capsid protein (CA), and the nucleocapsid protein (NC). Processing of the Gag polyprotein into the mature proteins is catalyzed by the retroviral encoded protease and occurs as the newly budded viral particles mature.
- MA matrix protein
- Ml influenza matrix protein
- CA capsid protein
- NC nucleocapsid protein
- the Gag polyprotein is divided into three domains: the membrane binding domain, which targets the Gag polyprotein to the cellular membrane; the interaction domain which promotes Gag polymerization; and the late domain which facilitates release of nascent virions from the host cell.
- the form of the Gag protein that mediates assembly is the polyprotein.
- the assembly domains need not lie neatly within any of the cleavage products that form later. The state of the art is quite advanced regarding these important functional elements. See, e.g., Hansen et al. J. Virol 64, 5306-5316, 1990; Will et al, AIDS 5, 639-654, 1991 ; Wang et al. J. Virol.
- retroviral sources for Gag polypeptides include alpha- retroviruses (such as the avian leukosis virus or the Rous sarcoma virus), or lentiviruses (human immunodeficiency virus type 1 , HIV-2, simian immunodeficiency virus, feline immunodeficiency virus, and caprine arthritis encephalitis virus (but excluding the equine infectious anemia virus)).
- alpha- retroviruses such as the avian leukosis virus or the Rous sarcoma virus
- lentiviruses human immunodeficiency virus type 1 , HIV-2, simian immunodeficiency virus, feline immunodeficiency virus, and caprine arthritis encephalitis virus (but excluding the equine infectious anemia virus)
- Alpha-retroviruses such as avian leukosis virus contain their protease domain as part of the Gag polyprotein rather than the Pol polyprotein as is the case with most other retroviruses.
- a Gag polypeptide may be substantially lacking a C-terminal protease domain.
- lipid raft refers to the cell membrane microdomain in which the gag polypeptide may concentrate during the viral particle assembly process and therefore may be used as a means to incorporate additional antigens that either naturally associated with lipid rafts or are linked to a lipid-raft associated polypeptide.
- VLP-associated polypeptide refers to any polypeptide that is directly or indirectly associated with a VLP excluding any enveloped virus core forming polypeptide that would interfere with the lentivirus or alpha-retrovirus Gag polypeptide.
- the particular VLP-associated polypeptide used in the compositions and methods disclosed herein will depend on the desired use of the VLP and the role of the VLP-associated polypeptide (e.g., attaching one or more additional antigens or adjuvants to the VLP).
- the VLP-associated polypeptide can be an integral membrane protein or a lipid raft-associating portion, a protein or portion thereof directly associated with the VLP via a protein modification which causes association with the membrane such as lipid modification, or a polypeptide with an indirect association with the VLP via a lipid raft- associated polypeptide.
- Lipid anchors that couple polypeptides to lipid rafts include GPI anchors, myristoylation, palmitoylation, and double acetylation.
- Many different types of polypeptides are associated with lipid rafts. Lipid rafts function as platforms for numerous biological activities including signal
- lipid rafts that function as signaling platforms.
- One type of lipid raft which functions as signaling platform is called a caveolae. It is a flask shaped invagination of the plasma-membrane which contains polypeptides from the caveolin family (e.g., caveolin and/or flottillin).
- Membrane trafficking polypeptides are associated with lipid rafts which function as membrane trafficking platforms. Examples include the proteins involved in endocytosis and excocytosis, such as syntaxin-1 , syntaxin-4, synapsin I, adducin, VAMP2, VAMP/synaptobrevin, synaptobrevin II, SNARE proteins, SNAP-25, SNAP- 23, synaptotagmin I, synaptotagmin II, and the like.
- Viral receptors, receptor-coreceptor complexes, any other components which help modulate the entry process are associated with lipid rafts which function as specialized membrane trafficking platforms for viral entry.
- lipid raft- associated viral receptors include the decay accelerating factor (DAF or CD55), a GPI- anchored membrane glycoprotein that is a receptor for many enteroviruses; the receptor for group A rotaviruses, a complex containing multiple components including gangliosides, Hsc70 protein, alpha2-betal and alpha5-beta2 integrins; glycoproteins of several enveloped viruses like HIV, MLV, measles, and Ebola; and polypeptides involved in HIV entry like CD5, CCR5, and nef. See Chazal and Gerlier, 2003, Virus Entry, Assembly, Budding, and Membrane Rafts, Microbiol. & Mol. Bio. Rev.
- Polypeptides involved in viral particle assembly are associated with lipid rafts functioning as viral assembly platforms. So long as portions that are responsible for formation of the viral nucleocapsid, capsid or core are omitted, such polypeptides or portions thereof may be used as VLP-associated polypeptides. Examples of such polypeptides include the HA and NA influenza envelope glycoproteins, the H and mature F l -F2 fusion proteins from measles, and the gpl 60, gp41 , and Pr55gag from HIV. See Chazal and Gerlier, 2003, Virus Entry, Assembly, Budding, and Membrane Rafts, Microbiol. And Mol. Bio. Rev. 67(2):226-237.
- Polypeptides involved in budding of assembled virus are associated with lipid rafts that function as viral budding platforms. There is data suggesting that HIV-1 budding from the host cell occurs in membrane rafts. See Chazal and Gerlier, 2003, Virus Entry, Assembly, Budding, and Membrane Rafts, Microbiol. And Mol. Bio. Rev. 67(2):226-237. General information about polypeptides involved in viral budding can be found in Fields Virology (4th ed.) 2001 .
- VLP-associated polypeptides include viral polypeptides such as hemagglutinin polypeptide, neuraminidase polypeptide, fusion protein polypeptide, glycoprotein polypeptide, and envelope protein polypeptide.
- viral polypeptides such as hemagglutinin polypeptide, neuraminidase polypeptide, fusion protein polypeptide, glycoprotein polypeptide, and envelope protein polypeptide.
- Each of these polypeptides can be from any type of virus; however, certain embodiments include envelope protein from HIV- 1 virus, fusion protein from respiratory syncytial virus or measles virus, glycoprotein from respiratory syncytial virus, herpes simplex virus, or Ebola virus, and hemagglutinin protein from measles virus.
- Certain non-viral pathogen VLP-associated polypeptides may be obtained from pathogenic protozoa, helminths, and other eukaryotic microbial pathogens including, but not limited to, Plasmodium such as Plasmodium falciparum, Plasmodium malariae, Plasmodium ovale, and Plasmodium vivax; Toxoplasma gondii; Trypanosoma brucei, Trypanosoma cruzi; Schistosoma haematobium, Schistosoma mansoni,
- Plasmodium such as Plasmodium falciparum, Plasmodium malariae, Plasmodium ovale, and Plasmodium vivax
- Toxoplasma gondii Trypanosoma brucei, Trypanosoma cruzi
- Schistosoma haematobium Schistosoma mansoni
- VLP-associated polypeptides may be used without being linked to an antigen not naturally associated with a lipid-raft as the VLP-associated polypeptide itself will act as the antigen.
- hemagglutinin polypeptide An example of a viral VLP-associated polypeptide that may be included with the chimeric VLPs is a hemagglutinin polypeptide.
- the "hemagglutinin polypeptide" as used herein is derived from the influenza virus protein that mediates binding of the virus to the cell to be infected. Hemagglutinin polypeptides may also be derived from the comparable measles virus protein.
- the protein is an antigenic glycoprotein found anchored to the surface of influenza viruses by a single membrane spanning domain. At least sixteen subtypes of the influenza hemagglutinin have been identified labeled H I through HI 6. HI , H2, and H3, are found in human influenza viruses.
- Hemagglutinin is a homotrimeric integral membrane polypeptide.
- the membrane spanning domain naturally associates with the raft-lipid domains, which allows it to associate with the respiratory syncytial virus F polypeptides for incorporation into VLPs. It is shaped like a cylinder, and is approximately 135 A long.
- the three identical monomers that constitute HA form a central coiled-coil and a spherical head that contains the sialic acid binding sites, which is exposed on the surface of the VLPs.
- HA monomers are synthesized as a single polypeptide precursor that is glycosylated and cleaved into two smaller polypeptides: the HA1 and HA2 subunits.
- the HA2 subunits form the trimeric coiled-coil that is anchored to the membrane and the HA 1 subunits form the spherical head.
- VLP-associated VLPs As used in certain VLPs disclosed herein as a VLP-associated VLP-associated VLPs disclosed herein as a VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated VLP-associated
- the hemagglutinin polypeptide shall at a minimum include the membrane anchor domain.
- the hemagglutinin polypeptide may be derived from any influenza virus type, subtype, strain or substrain, which for example may be from the HI , H2, H3, H5, H7, and H9 hemagglutinins.
- the hemagglutinin polypeptide may be a chimera of different influenza hemagglutinins.
- the hemagglutinin polypeptide may include one or more additional antigens not naturally associated with a lipid raft that may be generated by splicing the coding sequence for the one or more additional polypeptides into the hemagglutinin polypeptide coding sequence.
- An exemplary site for insertion of additional polypeptides into the hemagglutinin polypeptide is the N-terminus.
- viral VLP-associated polypeptide is a
- neuraminidase polypeptide is derived from the influenza virus protein that mediates release of the influenza virus from the cell by cleavage of terminal sialic acid residues from glycoproteins.
- the neuraminidase glycoprotein is expressed on the viral surface.
- the neuraminidase proteins are tetrameric and share a common structure consisting of a globular head with a beta-pinwheel structure, a thin stalk region, and a small hydrophobic region that anchors the protein in the virus membrane by a single membrane spanning domain.
- the active site for sialic acid residue cleavage includes a pocket on the surface of each subunit formed by fifteen charged amino acids, which are conserved in all influenza A viruses. At least nine subtypes of the influenza neuraminidase have been identified labeled Nl through N9.
- the neuraminidase polypeptide shall at a minimum include the membrane anchor domain.
- the state of the art regarding functional regions is quite high. See, e.g., Varghese et al, Nature 303, 35-40, 1983; Colman et al., Nature 303, 41-44, 1983; Lentz et al., Biochem, 26, 5321 -5385, 1987; Webster et al., Virol. 135, 30-42, 1984.
- the neuraminidase polypeptide may be derived from any influenza virus type, subtype strain or substrain, which may be from the N l and N2 neuraminidases.
- the neuraminidase polypeptide may be a chimera of different influenza neuraminidase.
- the neuraminidase polypeptide may include one or more additional antigens that are not naturally associated with a lipid raft that may be generated by splicing the coding sequence for the one or more additional polypeptides into the hemagglutinin polypeptide.
- An exemplary site for insertion of additional polypeptides into the neuraminidase polypeptide coding sequence is the C-terminus.
- VLP-associated peptide is an insect derived adhesion protein termed fasciclin I (Fasl).
- fasciclin I polypeptide is derived from the insect protein that is involved in embryonic development. This non- viral protein can be expressed in an insect cell baculovirus expression system leading to lipid raft association of Fasl (J. Virol. 77, 6265-6273, 2003). It therefore follows that attachment of a heterologous antigen to a fasciclin I polypeptide will lead to
- the fasciclin I polypeptide shall at a minimum include the membrane anchor domain.
- VLP-associated peptide is a viral derived attachment protein from RSV named the G glycoprotein.
- the "G glycopoly peptide" as used herein is derived from the RSV G glycoprotein. Recent data has demonstrated that lipid raft domains are important for RSV particle budding as they are for influenza virus (Virol 327, 175-1 85, 2004; Arch. Virol. 149, 199-210, 2004; Virol. 300, 244-254, 2002).
- the G glycoprotein from RSV is a 32.5 kD integral membrane protein that serves as a viral attachment protein as well as a protective antigen for RSV infection.
- compositions and methods disclosed herein include additional antigens associated with the chimeric VLPs.
- additional antigens may be included in the same composition and may further be covalently or non-covalently associated with the VLPs.
- the Gag polypeptide is a readily adaptable platform for forming chimeric VLPs containing respiratory syncytial virus F polypeptide and/or other VLP-associated polypeptides. This section describes exemplary antigens for use with the disclosed VLPs.
- VLPs containing antigens not naturally associated with a VLP a linkage may be formed between the respiratory syncytial virus F polypeptide and/or another VLP-associated polypeptide and the antigen.
- the VLP- associated polypeptide may be linked to a single antigen or to multiple antigens to increase immunogenicity of the VLP, to confer immunogenicity to various pathogens, or to confer immunogenicity to various strains of a particular pathogen.
- the linkage between the antigen and a VLP-associated polypeptide can be any type of linkage sufficient to result in the antigen being incorporated into the VLP.
- the bond can be a covalent bond, an ionic interaction, a hydrogen bond, an ionic bond, a van der Waals force, a metal-ligand interaction, or an antibody-antigen interaction.
- the linkage is a covalent bond, such as a peptide bond, carbon- oxygen bond, a carbon-sulfur bond, a carbon-nitrogen bond, a carbon-carbon bond, or a disulfide bond.
- the antigen may be produced recombinantly with an existing linkage to the VLP-associated polypeptide or it may be produced as an isolated substance and then linked at a later time to the VLP-associated polypeptide.
- the antigens as used herein can be any substance capable of eliciting an immune response and which does not naturally associate with a lipid raft.
- Antigens include, but are not limited to, proteins, polypeptides (including active proteins and individual polypeptide epitopes within proteins), glycopolypeptides, lipopolypeptides, peptides, polysaccharides, polysaccharide conjugates, peptide and non-peptide mimics of polysaccharides and other molecules, small molecules, lipids, glycolipids, and carbohydrates. If the antigen does not naturally associate either directly or indirectly with a VLP, it would not be expected to be incorporated into a VLP without linkage to a VLP- associated polypeptide.
- the antigen can be any antigen implicated in a disease or disorder, e.g., microbial antigens (e.g., viral antigens, bacterial antigens, fungal antigens, protozoan antigens, helminth antigens, yeast antigens, etc.), tumor antigens, allergens and the like.
- microbial antigens e.g., viral antigens, bacterial antigens, fungal antigens, protozoan antigens, helminth antigens, yeast antigens, etc.
- tumor antigens e.g., allergens and the like.
- the antigens described herein may be synthesized chemically or enzymatically, produced recombinantly, isolated from a natural source, or a combination of the foregoing.
- the antigen may be purified, partially purified, or a crude extract.
- Polypeptide antigens may be isolated from natural sources using standard methods of protein purification known in the art, including, but not limited to, liquid chromatography (e.g., high performance liquid chromatography, fast protein liquid chromatography, etc.), size exclusion chromatography, gel electrophoresis (including one-dimensional gel electrophoresis, two-dimensional gel electrophoresis), affinity chromatography, or other purification technique.
- liquid chromatography e.g., high performance liquid chromatography, fast protein liquid chromatography, etc.
- size exclusion chromatography e.g., size exclusion chromatography
- gel electrophoresis including one-dimensional gel electrophoresis, two-dimensional gel electrophoresis
- affinity chromatography e.g., affinity chromatography, or other purification technique.
- the antigen is a purified antigen, e.g., from about 50% to about 75% pure, from about 75% to about 85% pure, from about 85% to about 90% pure, from about 90% to about 95% pure, from about 95% to about 98% pure, from about 98% to about 99% pure, or greater than 99% pure.
- lipid-raft associated polypeptide e.g., an expression construct comprising a nucleotide sequence encoding a polypeptide is introduced into an appropriate host cell (e.g., a eukaryotic host cell grown as a unicellular entity in in vitro cell culture, e.g., a yeast cel l, an insect cell, a mammalian cell, etc.) or a prokaryotic cell (e.g., grown in in vitro cell culture), generating a genetically modified host cell; under appropriate culture conditions, the protein is produced by the genetically modified host cell.
- an appropriate host cell e.g., a eukaryotic host cell grown as a unicellular entity in in vitro cell culture, e.g., a yeast cel l, an insect cell, a mammalian cell, etc.
- a prokaryotic cell e.g., grown in in vitro cell culture
- Suitable viral antigens include those associated with (e.g., synthesized by) viruses of one or more of the following groups: Retroviridae (e.g. human
- immunodeficiency viruses such as HIV-1 (also referred to as HTLV-III, LAV or HTLV- III/LAV, or H1V-III); and other isolates, such as HIV-LP; Picomaviridae (e.g. polio viruses, hepatitis A virus; enteroviruses, human Coxsackie viruses, rhinoviruses, echoviruses); Calciviridae (e.g. strains that cause gastroenteritis, including Norwalk and related viruses); Togaviridae (e.g. equine encephalitis viruses, rubella viruses); Flaviridae (e.g. dengue viruses, encephalitis viruses, yellow fever viruses); Coronoviridae (e.g. coronaviruses); Rhabdoviradae (e.g. vesicular stomatitis viruses, rabies viruses);
- Picomaviridae e.g. polio viruses, hepatitis A virus; enteroviruses
- Coronaviridae e.g. coronaviruses
- Rhabdoviridae e.g. vesicular stomatitis viruses, rabies viruses
- Filoviridae e.g. ebola viruses
- Paramyxoviridae e.g. parainfluenza viruses, mumps virus, measles virus, respiratory syncytial virus
- Orthomyxoviridae e.g. influenza viruses
- Bungaviridae e.g. Hantaan viruses, bunga viruses, phleboviruses and Nairo viruses
- Arena viridae hemorrhagic fever viruses
- Reoviridae e.g. reoviruses, orbiviurses and rotaviruses
- Bimaviridae Hepadnaviridae (Hepatitis B virus);
- Parvovirida parvoviruses
- Papovaviridae papilloma viruses, polyoma viruses
- Adenoviridae most adenoviruses
- Herpesviridae herpes simplex virus (HSV) 1 and 2, varicella zoster virus, cytomegalovirus (CMV), herpes virus
- Poxyiridae variola viruses, vaccinia viruses, pox viruses
- Iridoviridae e.g. African swine fever virus
- unclassified viruses e.g.
- VLPs disclosed herein may include various antigens from the
- Norovirus family Noroviruses, also called “Norwalk-like viruses” represent one of four genera within the Caliciviridae virus family. Within the Norovirus genus there are two major genetic groups that have been designated Genogroup I and Genogroup II.
- Genogroup I Norovirus strains include Norwalk virus, Southampton virus, Desert Shield virus, and Chiba virus.
- Genogroup II Norovirus strains include Houston virus, Hawaii virus, Lordsdale virus, Grimsby virus, Mexico virus, and the Snow Mountain agent (Parker, T.D., et al. J Virol. (2005) 79(12):7402-9; Hale, A.D., et al. J Clin. Micro.
- Norwalk virus is the prototype strain of a group of human caliciviruses responsible for the majority of epidemic outbreaks of acute viral gastroenteritis worldwide.
- the Norwalk virus capsid protein has two domains: the shell domain (S) and the protruding domain (P).
- the P domain (aa 226-530, Norwalk strain numbering) is divided into two subdomains, P I and P2.
- the P2 domain is a 127 aa insertion (aa 279-405) in the P I domain and is located at the most distal surface of the folded monomer.
- the P2 domain is the least conserved region of VP 1 among norovirus strains, and the hypervariable region within P2 is thought to play an important role in receptor binding and immune reactivity. Given the external location of the P domain, it is an exemplary antigen or source of polypeptide epitopes for use as antigens for the VLP vaccines disclosed herein.
- the P2 domain is an exemplary antigen for Genogroup I or Genogroup II Norovirus strains.
- Yet another example is the mAb 61.21 epitope recently identified as lying in a region of the P2 domain conserved across a range of norovirus strains, as well as the mAb 54.6 epitope (Lochridge, V.P., et al. J Gen. Virol. (2005) 86:2799-2806).
- the VLPs disclosed herein may include various antigens from influenza including, without limitation, hemagglutinin, neuraminidase, or an additional influenza antigen.
- An additional influenza antigen is the M2 polypeptide.
- the M2 polypeptide of influenza virus is a small 97 amino acid class III integral membrane protein encoded by RNA segment 7 (matrix segment) following a splicing event (80, 81). Very little M2 exists on virus particles but it can be found more abundantly on infected cells. M2 serves as a proton-selective ion channel that is necessary for viral entry (82, 83).
- peptide can also be chemically conjugated to a carrier such as KLH, or the outer membrane protein complex of N. meningitides, or human papilloma virus VLPs and is protective as a vaccine in mice and other animals (92, 93).
- a carrier such as KLH, or the outer membrane protein complex of N. meningitides, or human papilloma virus VLPs and is protective as a vaccine in mice and other animals (92, 93).
- Additional proteins from influenza virus may be included in the VLP vaccine either by co-expression or via linkage of all or part of the additional antigen to the respiratory syncytial virus F polypeptide or other VLP- associated polypeptides.
- additional antigens include PB2, PB 1 , PA, nucleoprotein, matrix (M 1 ), NS 1 , and NS2. These latter antigens are not generally targets of neutralizing antibody responses but may contain important epitopes recognized by T cells. T cell responses induced by a VLP vaccine to such epitopes may prove beneficial in boosting protective immunity.
- Other Pathogenic Antigens include PB2, PB 1 , PA, nucleoprotein, matrix (M 1 ), NS 1 , and NS2.
- Suitable bacterial antigens include antigens associated with (e.g., synthesized by and endogenous to) any of a variety of pathogenic bacteria, including, e.g., pathogenic gram positive bacteria such as pathogenic Pasteurella species,
- Staphylococci species, and Streptococcus species include Staphylococci species, and Streptococcus species; and gram-negative pathogens such as those of the genera Neisseria, Escherichia, Bordetella, Campylobacter, Legionella, Pseudomonas, Shigella, Vibrio, Yersinia, Salmonella, Haemophilus, Brucella, Francisella and Bacterioides. See, e.g., Schaechter, M, H. Medoff, D. Schlesinger, Mechanisms of Microbial Disease. Williams and Wilkins, Baltimore (1989).
- Suitable antigens associated with (e.g., synthesized by and endogenous to) infectious pathogenic fungi include antigens associated with infectious fungi including but not limited to: Cryptococcus neoformans, Histoplasma capsulatum, Coccidioides immitis, Blastomyces dermatitidis, and Candida albicans, Candida glabrata, Aspergillus fumigata, Aspergillus flavus, and Sporothrix schenckii.
- Suitable antigens associated with (e.g., synthesized by and endogenous to) pathogenic protozoa, helminths, and other eukaryotic microbial pathogens include antigens associated with protozoa, helminths, and other eukaryotic microbial pathogens including, but not limited to, Plasmodium such as Plasmodium falciparum, Plasmodium malariae, Plasmodium ovale, and Plasmodium vivax; Toxoplasma gondii; Trypanosoma brucei, Trypanosoma cruzi; Schistosoma haematobium, Schistosoma mansoni,
- Schistosoma japonicum Leishmania donovani; Giardia intestinalis; Cryptosporidium parvum; and the like.
- Suitable antigens include antigens associated with (e.g., synthesized by and endogenous to) pathogenic microorganisms such as: Helicobacter pyloris, Borelia burgdorferi, Legionella pneumophila, Mycobacteria sps (e.g. M. tuberculosis, M. avium, M. intracellulare, M. kansaii, M.
- Streptococcus pyogenes Group A Streptococcus
- Streptococcus agalactiae Group B Streptococcus
- Streptococcus viridans group
- Streptococcus faecalis Streptococcus bovis
- Streptococcus anaerobic sps.
- Streptococcus pneumoniae pathogenic
- Campylobacter sp. Enterococcus sp., Haemophilus influenzae, Bacillus anthracis, Corynebacterium diphtheriae, corynebacterium sp., Erysipelothrix rhusiopathiae, Clostridium perfringens, Clostridium tetani, Enterobacter aerogenes, Klebsiella pneumoniae, Pasturella multocida, Bacteroides sp., Fusobacterium nucleatum,
- Non-limiting examples of pathogenic E. coli strains are: ATCC No. 31618, 23505, 43886, 43892, 35401 , 43896, 33985, 31619 and 31617.
- polypeptides or other antigens associated with intracellular pathogens may be included in the VLPs.
- Polypeptides and peptide epitopes associated with intracellular pathogens are any polypeptide associated with (e.g., encoded by) an intracellular pathogen, fragments of which are displayed together with MHC Class I molecule on the surface of the infected cell such that they are recognized by, e.g., bound by a T-cell antigen receptor on the surface of, a CD8 + lymphocyte.
- Polypeptides and peptide epitopes associated with intracellular pathogens include, but are not limited to, antigens associated with human immunodeficiency virus, e.g., HIV gpl 20, or an antigenic fragment thereof; cytomegalovirus antigens; Mycobacterium antigens (e.g., Mycobacterium avium, Mycobacterium tuberculosis, and the like);
- Pneumocystic carinii (PCP) antigens Pneumocystic carinii (PCP) antigens
- malarial antigens including, but not limited to, antigens associated with Plasmodium falciparum or any other malarial species, such as 41 -3, AMA- 1 , CSP, PFEMP-1 , GBP-130, MSP- 1, PFS-16, SERP, etc.
- fungal antigens e.g., an antigen of a Candida spp.
- toxoplasma antigens including, but not limited to, antigens associated with Toxoplasma gondii, Toxoplasma encephalitis, or any other Toxoplasma species
- Plasmodium antigens e.g., gp l 90/MSPl , and the like
- EBV Epstein-Barr virus
- VLP vaccine may be directed against Bacillus anthracis.
- Bacillus anthracis are aerobic or facultative anaerobic Gram-positive, nonmotile rods measuring 1.0 ⁇ ⁇ wide by 3.0-5.0 ⁇ long. Under adverse conditions, B. anthracis form highly resistant endospores, which can be found in soil at sites where infected animals previously died.
- An antigen for use in a VLP vaccine as disclosed herein is the protective antigen (PA), an 83 kDa protein that binds to receptors on mammalian cells and is critical to the ability of B. anthracis to cause disease.
- PA protective antigen
- Another antigen is the C- terminal 140 amino acid fragment of Bacillus anthracis PA which may be used to induce protective immunity in a subject against Bacillus anthracis.
- antigens for use in a VLP vaccine against anthrax are antigens from the anthrax spore (e.g., BclA), antigens from the vegetative stage of the bacterium (e.g., a cell wall antigen, capsule antigen (e.g., poly-gamma-D-glutamic acid or PGA), secreted antigen (e.g., exotoxin such as protective antigen, lethal factor, or edema factor).
- Another antigen for use in a VLP vaccine is the tetra-saccharide containing anthrose, which is unique to B. anthracis (Daubenspeck J.M., et al. J. Biol. Chem. (2004), 279:30945). The tetra-saccharide may be coupled to a VLP-associated polypeptide allowing association of the antigen with the VLP vaccine.
- TAA tumor-specific antigens or tumor-associated antigens
- Tumor-associated antigens which may be used in VLPs include, but are not limited to, MAGE-2, MAGE-3, MUC-1 , MUC-2, HER-2, high molecular weight melanoma-associated antigen MAA, GD2, carcinoembryonic antigen (CEA), TAG-72, ovarian-associated antigens OV-TL3 and MOV 18, TUAN, alpha-feto protein (AFP), OFP, CA-125, CA-50, CA-19-9, renal tumor-associated antigen G250, EGP-40 (also known as EpCAM), SI 00 (malignant melanoma-associated antigen), p53, and p21ras.
- a synthetic analog of any TAA (or epitope thereof), including any of the foregoing, may be used.
- combinations of one or more TAAs (or epitopes thereof) may be included in the composition.
- the antigen that is part of the VLP vaccine may be any of a variety of allergens. Allergen based vaccines may be used to induce tolerance in a subject to the allergen. Examples of an allergen vaccine involving co-precipitation with tyrosine may be found in U.S. Patent No. 3,792, 159, 4,070,455, and 6,440,426.
- Allergens include but are not limited to environmental aeroallergens; plant pollens such as
- ragweed/hayfever weed pollen allergens; grass pollen allergens; Johnson grass; tree pollen allergens; ryegrass; arachnid allergens, such as house dust mite allergens (e.g., Der p I, Der f I, etc.); storage mite allergens; Japanese cedar pollen/hay fever; mold spore allergens; animal allergens (e.g., dog, guinea pig, hamster, gerbil, rat, mouse, etc., allergens); food allergens (e.g., allergens of crustaceans; nuts, such as peanuts; citrus fruits); insect allergens; venoms: (Hymenoptera, yellow jacket, honey bee, wasp, hornet, fire ant); other environmental insect allergens from cockroaches, fleas, mosquitoes, etc.; bacterial allergens such as streptococcal antigens; parasite allergens such as Ascaris anti
- Allergens include but are not limited to cells, cell extracts, proteins, polypeptides, peptides, polysaccharides, polysaccharide conjugates, peptide and non- peptide mimics of polysaccharides and other molecules, small molecules, lipids, glycolipids, and carbohydrates.
- Examples of specific natural, animal and plant allergens include but are not limited to proteins specific to the following genera: Canine (Canis familiaris);
- Dermatophagoides e.g. Dermatophagoides farinae
- Felis Felis domesticus
- Ambrosia Ambrosia artemiisfolia
- Lolium e.g. Lolium perenne or Lolium multiflorum
- Cryptomeria (Cryptomeria japonica); Altemaria (Altemaria altemata); Alder; Alnus (Alnus gultinoas); Betula (Betula verrucosa); Quercus (Quercus alba); Olea (Olea europa); Artemisia (Artemisia vulgaris); Plantago (e.g. Plantago lanceolata); Parietaria (e.g. Parietaria officinalis or Parietaria judaica); Blattella (e.g. Blattella germanica); Apis (e.g. Apis multiflorum); Cupressus (e.g.
- Juniperus e.g. Juniperus sabinoides, Juniperus virginiana, Juniperus communis and Juniperus ashei
- Thuya e.g. Thuya orientalis
- Chamaecyparis e.g. Chamaecyparis obtusa
- Dactylis e.g. Dactylis glomerata
- Festuca e.g. Festuca elatior
- Poa e.g. Poapratensis or Poa compressa
- Avena e.g. Avena sativa
- Holcus e.g. Holcus lanatus
- Anthoxanthum e.g. Anthoxanthum odoratum
- Arrhenatherum e.g. Arrhenatherun elatius
- Agrostis e.g. Agrostis alba
- Phleum e.g. Phleum pratense
- Phalaris e.g.
- Phalaris arundinacea Paspalum (e.g. Paspalum notatum); Sorghum (e.g. Sorghum halepensis); and Bromus (e.g. Bromus inermis).
- Chimeric VLPs may be made by any method available to one of skill in the art.
- Chimeric VLPs include a lentivirus or alpha-retrovirus Gag polypeptide which is responsible for the formation of the VLP with the RSV-F polypeptide.
- the chimeric VLP may include one or more additional polypeptides such as a membrane (including lipid-raft)-associated polypeptide to provide additional antigens (other than those present naturally or artificially as a part of the one or more polypeptides responsible for the formation of the VLP or the RSV-F polypeptide).
- the polypeptides may be co-expressed in any available protein expression system including, for example, a mammalian cell-based system that includes lipid raft domains in the plasma membrane.
- Recombinant expression of the polypeptides for the VLPs involves expression vectors containing polynucleotides that encode one or more of the
- the vector for the production of the polypeptide may be produced by recombinant DNA technology using techniques well known in the art.
- methods for preparing a protein by expressing a polynucleotide containing any of the VLP may be produced by recombinant DNA technology using techniques well known in the art.
- polypeptide-encoding nucleotide sequences are described herein. Methods which are well known to those skilled in the art can be used to construct expression vectors containing the VLP polypeptide coding sequences and appropriate transcriptional and translational control signals. These methods include, for example, in vitro recombinant DNA techniques, synthetic techniques, and in vivo genetic recombination.
- the methods and compositions disclosed herein thus, provides replicable vectors comprising a nucleotide sequence encoding a lentivirus or alpha-retrovirus Gag polypeptide and a nucleotide sequence encoding respiratory syncytial virus F polypeptide and optionally one or more additional VLP-associated polypeptides, all operably linked to one or more promoters.
- Non-limiting examples of vectors that can be used to express sequences that assemble into VLPs as described herein include viral-based vectors (e.g., retrovirus, adenovirus, adeno-associated virus, lentivirus, pox viruses and baculovirus), plasmid vectors, non-viral vectors, mammalian vectors, mammalian artificial chromosomes (e.g., liposomes, particulate carriers, etc.) and combinations thereof.
- viral-based vectors e.g., retrovirus, adenovirus, adeno-associated virus, lentivirus, pox viruses and baculovirus
- plasmid vectors e.g., retrovirus, adenovirus, adeno-associated virus, lentivirus, pox viruses and baculovirus
- non-viral vectors e.g., mammalian vectors, mammalian artificial chromosomes (e.g., liposomes
- the expression vector(s) typically contain(s) coding sequences and expression control elements which allow expression of the coding regions in a suitable host.
- the control elements generally include a promoter, enhancer, exon, intron, splicing sites translation initiation codon, and translation and transcription termination sequences, and an insertion site for introducing the insert into the vector.
- Translational control elements have been reviewed by M. Kozak (e.g., ozak, M., Mamm. Genome 7(8):563- 574, 1996; Kozak, M., Biochimie 76(9):815-821 , 1994; Kozak, M., J Cell Biol
- typical promoters used for mammalian cell expression include the SV40 early promoter, a CMV promoter such as the CMV immediate early promoter (a CMV promoter can include intron A), RSV, HIV-LTR, the mouse mammary tumor virus LTR promoter (MMLV-LTR), FIV-LTR, the adenovirus major late promoter (Ad MLP), and the herpes simplex virus promoter, among others.
- CMV promoter such as the CMV immediate early promoter
- RSV CMV immediate early promoter
- HIV-LTR the mouse mammary tumor virus LTR promoter
- MMLV-LTR mouse mammary tumor virus LTR promoter
- FIV-LTR the adenovirus major late promoter
- Ad MLP adenovirus major late promoter
- herpes simplex virus promoter among others.
- Other nonviral promoters such as a promoter derived from the murine metallothionein gene, will also find use for mammalian expression.
- polyadenylation sequences will also be present, located 3' to the translation stop codon.
- a sequence for optimization of initiation of translation, located 5' to the coding sequence, may also be present.
- transcription terminator/polyadenylation signals include those derived from SV40, as described in Sambrook, et al., supra, as well as a bovine growth hormone terminator sequence.
- Introns, containing splice donor and acceptor sites, may also be designed into the constructs as described herein (Chapman et al., Nuc. Acids Res. (1991) 19:3979-3986).
- Enhancer elements may also be used herein to increase expression levels of the constructs, for example in mammalian host cells.
- Examples include the SV40 early gene enhancer, as described in Dijkema et al., EMBO J. ( 1985) 4:761 , the enhancer/promoter derived from the long terminal repeat (LTR) of the Rous Sarcoma Virus, as described in Gorman et al., Proc. Natl. Acad. Sci. USA (1982b) 79:6777 and elements derived from human CMV, as described in Boshart et al., Cell (1985) 41 :521 , such as elements included in the CMV intron A sequence (Chapman et al., Nuc. Acids Res. (1991 ) 19:3979-3986).
- LTR long terminal repeat
- a vector may contain one or more sequences as described herein.
- a single vector may carry sequences encoding all the proteins found in the VLP.
- multiple vectors may be used (e.g., multiple constructs, each encoding a single polypeptide-encoding sequence or multiple constructs, each encoding one or more polypeptide-encoding sequences).
- the sequences may be operably linked to the same or different transcriptional control elements (e.g., promoters) within the same vector.
- sequences encoding non-RSV proteins may be expressed and incorporated into the VLP, including, but not limited to, sequences comprising and/or encoding immunomodulatory molecules (e.g., adjuvants described below), for example, immunomodulating oligonucleotides (e.g., CpGs), cytokines, detoxified bacterial toxins and the like.
- immunomodulatory molecules e.g., adjuvants described below
- immunomodulating oligonucleotides e.g., CpGs
- cytokines detoxified bacterial toxins and the like.
- the expression vector may be transferred to a host cell by conventional techniques and the transfected cells are then cultured by conventional techniques to produce the VLP polypeptide(s).
- the compositions and methods disclosed herein include host cells containing a polynucleotide encoding one or more of the VLP polypeptides operably linked to a heterologous promoter.
- vectors encoding the lentivirus or alpha-retrovirus Gag polypeptide and the respiratory syncytial virus F polypeptide and optionally an additional VLP- associating antigen or VLP-associated polypeptide linked to an additional antigen or adjuvant may be (co)expressed in the host cell for generation of the VLP, as detailed below.
- the VLPs may be produced in eukaryotic cells, for example mammalian cells, following transfection, establishment of continuous cell lines (using standard protocols as known to one skilled in the art) and/or infection with DNA molecules that carry the RSV genes of interest.
- the level of expression of the proteins required for VLP formation is maximized by sequence optimization of the eukaryotic or viral promoters that drive transcription of the selected genes.
- the VLP is released into the culture medium from where the VLP may be purified and subsequently formulated as vaccine.
- the VLPs are not infectious vaccines and therefore vaccine inactivation is not required.
- lentivirus or alpha-retrovirus Gag polypeptides expressed from sequences as described herein to self-assemble into VLPs with antigenic proteins presented on the surface allows these VLPs to be produced in any host cell by the co- introduction of the desired sequences.
- the sequence(s) e.g., in one or more expression vectors
- Suitable host cells include, but are not limited to, bacterial, mammalian, insect, yeast, plant, and Xenopus cells.
- a number of mammalian cell lines are known in the art and include primary cells as well as immortalized cell lines available from the American Type Culture Collection (A.T.C.C.), such as, but not limited to, BHK, VERO, HT1080, MRC-5, WI 38, MDCK, MDBK, 293, 293T, RD, COS-7, CHO, Jurkat, HUT, SUPT, C8166, MOLT4/clone8, MT-2, MT-4, H9, PMl , CEM, myeloma cells (e.g., SB20 cells), LtK, HeLa, WI-38, L2, CMT-93, and CEMX174 (such cell lines are avai lable, for example, from the A.T.C.C.).
- bacteria hosts such as E. coli, Bacillus subtilis, and
- Streptococcus spp. will find use with the present expression constructs.
- Yeast hosts useful in the present disclosure include inter alia,
- Fungal hosts include, for example, Aspergillus.
- Insect cells for use with baculovirus expression vectors include, inter alia,
- Cell lines expressing one or more of the sequences described above can readily be generated given the disclosure provided herein by stably integrating one or more sequences (expression vectors) encoding the respiratory syncytial virus F polypeptide of the VLP.
- the promoter regulating expression of the stably integrated respiratory syncytial virus F polypeptide sequences (s) may be constitutive or inducible.
- the parent cell line from which a chimeric VLP -producer cell line is derived can be selected from any cell described above, including for example, mammalian, insect, yeast, bacterial cell lines.
- the cell line is a mammalian cell line (e.g., 293, RD, COS-7, CHO, BHK, VERO, MRC-5, HT1080, and myeloma cells).
- Production of chimeric VLPs using mammalian cells provides (i) VLP formation; (ii) correct myristylation, glycosylation and budding; (iii) absence of non- mammalian cell contaminants and (iv) ease of purification.
- RSV F-encoding sequences may also be transiently expressed in host cells, with or without an additional antigen or adjuvant.
- Suitable recombinant expression host cell systems include, but are not limited to, bacterial, mammalian, baculovirus/insect, vaccinia, Semliki Forest virus (SFV), adenovirus, Alphaviruses (such as, Sindbis, Venezuelan Equine Encephalitis (VEE)), mammalian, yeast and Xenopus expression systems, well known in the art.
- Exemplary expression systems are mammalian cell lines, vaccinia, Sindbis, insect and yeast systems.
- baculovirus expression Reilly, P. R., et al, BACULOVIRUS EXPRESSION VECTORS: A LABORATORY MANUAL (1992); Beames, et al., Biotechniques 1 1 :378 (1991); Pharmingen; Clontech, Palo Alto, Calif.
- vaccinia expression systems Earl, P. L., et al., "Expression of proteins in mammalian cells using vaccinia" In Current Protocols in Molecular Biology (F. M. Ausubel, et al.
- Plant cloning vectors Clontech Laboratories, Inc., Palo-Alto, Calif., and Pharmacia LKB Biotechnology, Inc., Pistcataway, N.J.; Hood, E., et al., J. Bacteriol. 168: 1291 -1301 (1986); Nagel, R., et al., FEMS Microbiol. Lett. 67:325 ( 1990); An, et al., "Binary Vectors", and others in Plant Molecular Biology Manual A3 : l -19 (1988); Miki, B. L. A., et al., pp.
- VLP When expression vectors containing the altered genes that code for the proteins required for VLP formation are introduced into host cell(s) and subsequently expressed at the necessary level, the VLP assembles and is then released from the cell surface into the culture media.
- the VLPs are produced by growing host cells transformed by an expression vector under conditions whereby the particle-forming polypeptides are expressed and VLPs can be formed.
- the selection of the appropriate growth conditions is within the skill of the art.
- the particles are then isolated (or substantially purified) using methods that preserve the integrity thereof, such as, by density gradient centrifugation, e.g., sucrose gradients, PEG-precipitation, pelleting, and the like (see, e.g., Kimbauer et al. J. Virol. (1993) 67:6929-6936), as well as standard purification techniques including, e.g., ion exchange and gel filtration chromatography.
- density gradient centrifugation e.g., sucrose gradients, PEG-precipitation, pelleting, and the like
- standard purification techniques including, e.g., ion exchange and gel filtration chromatography.
- An exemplary method of inactivation is through electromagnetic radiation as electromagnetic radiation is capable of inactivating the infectious agents without substantially reducing the immunogenicity of the chimeric VLP.
- electromagnetic radiation i.e., UV irradiation with photoreactive compounds, UV irradiation alone and gamma irradiation
- UV irradiation with photoreactive compounds i.e., UV irradiation with photoreactive compounds
- UV irradiation alone and gamma irradiation have a long history of use for inactivation of pathogens in a wide variety of samples such as blood, food, vaccines, etc.
- there are a wide variety of commercially available apparatus for applying the inactivating electromagnetic radiation that may be used with little to no modification to practice the methods disclosed herein.
- optimizing wavelengths and dosages is routine in the art and therefore readily within the capabilities of one of ordinary skill in the art.
- An exemplary method of inactivation with electromagnetic radiation is a combination of ultraviolet irradiation, such as UV-A irradiation, in the presence of a photoreactive compound, such as one that will react with polynucleotides in the infectious agent.
- Exemplary photoreactive compounds include: actinomycins,
- anthracyclinones anthramycin, benzodipyrones, fluorenes, fluorenones, furocoumarins, mitomycin, monostral fast blue, norphillin A, phenanthridines, phenazathionium salts, phenazines, phenothiazines, phenylazides, quinolines, and thiaxanthenones.
- furocoumarins which belong in one of two main categories.
- the first category is psoralens [7H-furo(3,2-g)-(l )-benzopyran-7-one, or delta-lactone of 6-hydroxy-5- benzofuranacrylic acid], which are linear and in which the two oxygen residues appended to the central aromatic moiety have a 1 , 3 orientation, and further in which the furan ring moiety is linked to the 6 position of the two ring coumarin system.
- the second category is isopsoralens [2H-furo(2,3-h)-(l )-benzopyran-2-one, or delta-lactone of 4-hydroxy-5- benzofuranacrylic acid], which are angular and in which the two oxygen residues appended to the central aromatic moiety have a 1, 3 orientation, and further in which the furan ring moiety is linked to the 8 position of the two ring coumarin system.
- Psoralen derivatives may be generated by substitution of the linear furocoumarin at the 3, 4, 5, 8, 4', or 5' positions
- isopsoralen derivatives may be generated by substitution of the angular furocoumarin at the 3, 4, 5, 6, 4', or 5 positions.
- Psoralens can intercalate between the base pairs of double-stranded nucleic acids, forming covalent adducts to pyrimidine bases upon absorption of long wave ultraviolet light (UVA).
- UVA long wave ultraviolet light
- Exemplary wavelengths of UV (or in some cases visible light) radiation will depend upon the wavelength at which photoadducts are generated which is dependent upon the chemistry of the photoreactive chemical.
- UV radiation in the wavelengths between 320 and 380 nm are most effective for many psoralens with 330 to 360 nm having maximum effectiveness.
- infectious agents may be inactivated by UV irradiation alone.
- the radiation is UVC radiation having a wavelength between about 1 80 and 320 nm, or between about 225 and 290 nm, or about 254 nm (i.e., the maximal absorbance peak of polynucleotides).
- UVC radiation may be used because it is less detrimental to the components of the chimeric VLPs disclosed herein for both stability and immunogenicity such as the lipid bilayer forming the envelope while retaining sufficient energy to inactivate infectious agents.
- other types of UV radiation such as, for example, UVA and UVB may also be used.
- Gamma irradiation i.e., ionizing radiation
- Gamma irradiation may also be used in the practice of the methods disclosed herein to generate the compositions.
- Gamma irradiation can inactivate infectious agents by introducing strand breaks in the compositions.
- polynucleotides encoding the genome of the infectious agent or by generating hydroxy! radicals that attack the polynucleotides.
- An exemplary use of the chimeric VLPs described herein is as a vaccine preparation.
- such vaccines are prepared as injectables either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid prior to injection may also be prepared.
- Such preparations may also be emulsified or produced as a dry powder.
- the active immunogenic ingredient is often mixed with excipients which are pharmaceutically acceptable and compatible with the active ingredient. Suitable excipients are, for example, water, saline, dextrose, sucrose, glycerol, ethanol, or the like, and combinations thereof.
- the vaccine may contain auxiliary substances such as wetting or emulsifying agents, pH buffering agents, or adjuvants which enhance the effectiveness of the vaccines.
- Vaccines may be conventionally administered parenterally, by injection, for example, either subcutaneously, intradermally, subdermally or intramuscularly.
- Additional formulations which are suitable for other modes of administration include suppositories and, in some cases, oral, intranasal, buccal, sublinqual, intraperitoneal, intravaginal, anal and intracranial formulations.
- traditional binders and carriers may include, for example, polyalkalene glycols or triglycerides; such
- suppositories may be formed from mixtures containing the active ingredient in the range of 0.5% to 1 0%, or even 1 -2%.
- a low melting wax such as a mixture of fatty acid glycerides or cocoa butter is first melted and the chimeric VLPs described herein are dispersed homogeneously, for example, by stirring. The molten homogeneous mixture is then poured into conveniently sized molds, allowed to cool, and to solidify.
- Formulations suitable for intranasal delivery include liquids (e.g., aqueous solution for administration as an aerosol or nasal drops) and dry powders (e.g. for rapid deposition within the nasal passage).
- Formulations include such normally employed excipients as, for example, pharmaceutical grades of mannitol, lactose, sucrose, trehalose, xylitol, and chitosan.
- Mucosadhesive agents such as chitosan can be used in either liquid or powder formulations to delay mucocilliary clearance of intranasally-administered formulations.
- Sugars such as mannitol and sucrose can be used as stability agents in liquid formulations and as stability, bulking, or powder flow and size agents in dry powder formulations.
- adjuvants such as monophosphoryl lipid A (MPL) or CpG oligoneucleotides can be used in both liquid and dry powder formulations as an immunostimulatory adjuvant.
- MPL monophosphoryl lipid A
- CpG oligoneucleotides can be used in both liquid and dry powder formulations as an immunostimulatory adjuvant.
- Formulations suitable for oral delivery include liquids, solids, semi-solids, gels, tablets, capsules, lozenges, and the like.
- Formulations suitable for oral delivery include tablets, lozenges, capsules, gels, liquids, food products, beverages, nutraceutica!s, and the l ike.
- Formulations include such normally employed excipients as, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, and the like.
- Other chimeric VLPs vaccine compositions may take the form of solutions, suspensions, pills, sustained release formulations or powders and contain 10-95% of active ingredient, or 25-70%.
- cholera toxin is an interesting formulation partner (and also a possible conjugation partner).
- the chimeric VLP vaccines when formulated for vaginal administration may be in the form of pessaries, tampons, creams, gels, pastes, foams or sprays. Any of the foregoing formulations may contain agents in addition to chimeric VLPs, such as carriers, known in the art to be appropriate.
- the chimeric VLP vaccine may be formulated for systemic or localized delivery.
- Such formulations are well known in the art.
- Parenteral vehicles include sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's or fixed oils.
- Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers (such as those based on Ringer's dextrose), and the like.
- Systemic and localized routes of administration include, e.g., intradermal, topical application, intravenous, intramuscular, etc.
- the chimeric VLPs may be formulated into the vaccine including neutral or salt-based formulations.
- Pharmaceutically acceptable salts include acid addition salts (formed with the free amino groups of the peptide) and which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric, mandelic, and the like. Salts formed with the free carboxyl groups may also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, 2-ethylamino ethanol, histidine, procaine, and the like.
- the vaccines may be administered in a manner compatible with the dosage formulation, and in such amount as will be therapeutically effective and immunogenic.
- the quantity to be administered depends on the subject to be treated, including, e.g., the capacity of the individual's immune system to mount an immune response, and the degree of protection desired.
- Suitable dosage ranges are of the order of several hundred micrograms active ingredient per vaccination with an exemplary range from about 0.1 ⁇ g to 2000 ⁇ g (even though higher amounts in the 1 -10 mg range are contemplated), such as in the range from about 0.5 ⁇ g to 1000 ⁇ g, or even in the range from 1 ⁇ g to 500 ⁇ g or in the range from about 10 ⁇ g to 100 ⁇ g.
- Suitable regimens for initial administration and booster shots are also variable but are typified by an initial administration followed by subsequent inoculations or other administrations.
- the manner of application may be varied widely. Any of the conventional methods for administration of a vaccine are applicable. These include oral application on a solid physiologically acceptable base or in a physiologically acceptable dispersion, parenterally, by injection or the like.
- the dosage of the vaccine will depend on the route of administration and will vary according to the age of the person to be vaccinated and the formulation of the antigen.
- Some of the vaccine formulations will be sufficiently immunogenic as a vaccine by themselves, but for some of the others the immune response will be enhanced if the vaccine further includes an adjuvant substance.
- Delivery agents that improve mucoadhesion can also be used to improve delivery and immunogenicity especially for intranasal, oral or lung based delivery formulations.
- One such compound, chitosan, the N-deacetylated form of chitin is used in many pharmaceutical formulations (32). It is an attractive mucoadhesive agent for intranasal vaccine delivery due to its ability to delay mucociliary clearance and allow more time for mucosal antigen uptake and processing (33, 34). In addition, it can transiently open tight junctions which may enhance transepithelial transport of antigen to the NALT.
- Chitosan can also be formulated with adjuvants that function well intranasally such as the genetically detoxified E. coli heat-labile enterotoxin mutant LTK63. This adds an immunostimulatory effect on top of the delivery and adhesion benefits imparted by chitosan resulting in enhanced mucosal and systemic responses (35).
- adjuvants that function well intranasally such as the genetically detoxified E. coli heat-labile enterotoxin mutant LTK63. This adds an immunostimulatory effect on top of the delivery and adhesion benefits imparted by chitosan resulting in enhanced mucosal and systemic responses (35).
- chitosan formulations can also be prepared in a dry powder format that has been shown to improve vaccine stability and result in a further delay in mucociliary clearance over liquid formulations (42). This was seen in a recent human clinical trial involving an intranasal dry powder diphtheria toxoid vaccine formulated with chitosan in which the intranasal route was as effective as the traditional intramuscular route with the added benefit of secretory IgA responses (43). The vaccine was also very well tolerated. Intranasal dry powdered vaccines for anthrax containing chitosan and MPL induce stronger responses in rabbits than intramuscular inoculation and are also protective against aerosol spore challenge (44).
- Intranasal vaccines represent an exemplary formulation as they can affect the upper and lower respiratory tracts in contrast to parenterally administered vaccines which are better at affecting the lower respiratory tract. This can be beneficial for inducing tolerance to allergen-based vaccines and inducing immunity for pathogen-based vaccines.
- intranasal vaccines avoid the complications of needle inoculations and provide a means of inducing both mucosal and systemic humoral and cellular responses via interaction of particulate and/or soluble antigens with nasopharyngeal-associated lymphoid tissues (NALT) (16-19).
- NALT nasopharyngeal-associated lymphoid tissues
- chimeric VLPs containing functional hemagglutinin polypeptides may be especially well suited for intranasal delivery due to the abundance of sialic acid-containing receptors in the nasal mucosa resulting in the potential for enhanced HA antigen binding and reduced mucociliary clearance.
- a chimeric VLP vaccine includes the chimeric
- One of skill in the art can readily determine the appropriate ratio through information regarding the adjuvant and routine experimentation to determine optimal ratios.
- Exemplary examples of adjuvants may include, but are not limited to, tolllike receptor (TLR) agonists, monophosphoryl lipid A (MPL), synthetic lipid A, lipid A mimetics or analogs, aluminum salts, cytokines, saponins, muramyl dipeptide (MDP) derivatives, CpG oligos, lipopolysaccharide (LPS) of gram-negative bacteria, polyphosphazenes, emulsions, oil in water emulsions, virosomes, cochleates, poly(lactide-co-glycolides) (PLG) microparticles, poloxamer particles, microparticles, and liposomes.
- TLR tolllike receptor
- MPL monophosphoryl lipid A
- MDP muramyl dipeptide
- LPS lipopolysaccharide
- PLA poly(lactide-co-glycolides)
- the adjuvants are not bacterialiy-derived exotoxins.
- Preferred adjuvants are those which stimulate a Thl type response such as 3DMPL, CpG oligonucleotides, or QS21 .
- MPL Monophosphoryl Lipid A
- Salmonella is a potent TLR-4 agonist that has been developed as a vaccine adjuvant (Evans et al. 2003). In pre-clinical murine studies intranasal MPL has been shown to enhance secretory, as well as systemic, humoral responses (Baldridge et al. 2000; Yang et al. 2002). It has also been proven to be safe and effective as a vaccine adjuvant in clinical studies of greater than 120,000 patients (Baldrick et al , 2002; 2004).
- MPL stimulates the induction of innate immunity through the TLR-4 receptor and is thus capable of eliciting nonspecific immune responses against a wide range of infectious pathogens, including both gram negative and gram positive bacteria, viruses, and parasites (Baldrick et al. 2004; Persing et al. 2002). Inclusion of MPL in intranasal formulations should provide rapid induction of innate responses, eliciting nonspecific immune responses from viral challenge while enhancing the specific responses generated by the antigenic components of the vaccine.
- the present invention provides a composition comprising monophosphoryl lipid A (MPL ® ) or 3 De-O-acylated monophosphoryl lipid A (3D-MPL ® ) as an enhancer of adaptive and innate immunity.
- MPL ® monophosphoryl lipid A
- 3D-MPL ® 3 De-O-acylated monophosphoryl lipid A
- a preferred form of 3 De-O-acylated monophosphoryl lipid A is disclosed in European Patent 0 689 454 B l (SmithKline Beecham Biologicals SA), which is incorporated herein by reference.
- the present invention provides a composition comprising synthetic lipid A, lipid A mimetics or analogs, such as BioMira's PET Lipid A, or synthetic derivatives designed to function like TLR-4 agonists.
- Exemplary examples of adjuvants are polypeptide adjuvants that may be readily added to the chimeric VLPs described herein by co-expression with the polypeptide components of the chimeric VLP or fusion with the polypeptide components to produce chimeric polypeptides.
- Bacterial flagellin the major protein constituent of flagella, is an adjuvant which has received increasing attention as an adjuvant protein because of its recognition by the innate immune system by the toll-like receptor TLR5 (65).
- TLR5 toll-like receptor
- Flagellin signaling through TLR5 has effects on both innate and adaptive immune functions by inducing DC maturation and migration as well as activation of macrophages, neutrophils, and intestinal epithelial cells resulting in production of proinflammatory mediators (66-72).
- TLR5 recognizes a conserved structure within flagellin monomers that is unique to this protein and is required for flagellar function, precluding its mutation in response to immunological pressure (73).
- the receptor is sensitive to a 100 fM concentration but does not recognize intact filaments. Flagellar disassembly into monomers is required for binding and stimulation.
- flagellin As an adjuvant, flagellin has potent activity for induction of protective responses for heterologous antigens administered either parenterally or intranasally (66, 74-77) and adjuvant effects for DNA vaccines have also been reported (78).
- a Th2 bias is observed when flagellin is employed which would be appropriate for a respiratory virus such as influenza but no evidence for IgE induction in mice or monkeys has been observed.
- no local or systemic inflammatory responses have been reported following intranasal or systemic administration in monkeys (74).
- Th2 character of responses elicited following use of flagellin is somewhat surprising since flagellin signals through TLR5 in a MyD88-dependent manner and all other MyD88-dependent signals through TLRs have been shown to result in a Thl bias (67, 79). Importantly, pre-existing antibodies to flagellin have no appreciable effect on adjuvant efficacy (74) making it attractive as a multi-use adjuvant.
- a common theme in many recent intranasal vaccine trials is the use of adjuvants and/or delivery systems to improve vaccine efficacy.
- an influenza H3 vaccine containing a genetically detoxified E. coli heat-labile enterotoxin adjuvant (LT R192G) resulted in heterosubtypic protection against H5 challenge but only following intranasal delivery. Protection was based on the induction of cross neutralizing antibodies and demonstrated important implications for the intranasal route in development of new vaccines (22).
- Cytokines may also be used as adjuvants as they may be readily included in the chimeric VLP vaccine by admixing or fusion with the polypeptide component.
- the chimeric VLP vaccine compositions disclosed herein may include other adjuvants that act through a Toll-like receptor such as a nucleic acid TLR9 ligand comprising a 5 -TCG-3' sequence; an imidazoquinoline TLR7 ligand; a substituted guanine TLR7/8 ligand; other TLR7 ligands such as Loxoribine, 7- deazadeoxyguanosine, 7-thia-8-oxodeoxyguanosine, Imiquimod (R-837), and
- Certain adjuvants facilitate uptake of the vaccine molecules by APCs, such as dendritic cells, and activate these.
- APCs such as dendritic cells
- Non-limiting examples are selected from the group consisting of an immune targeting adjuvant; an immune modulating adjuvant such as a toxin, a cytokine, and a mycobacterial derivative; an oil formulation; a polymer; a micelle forming adjuvant; a saponin; an immunostimulating complex matrix (ISCOM matrix); a particle; DDA; aluminum adjuvants; DNA adjuvants; MPL; and an encapsulating adjuvant.
- adjuvants include agents such as aluminum salts such as hydroxide or phosphate (alum), commonly used as 0.05 to 0.1 percent solution in buffered saline (see, e.g., Nicklas (1992) Res. Immunol. 143:489-493), admixture with synthetic polymers of sugars (e.g. Carbopol®) used as 0.25 percent solution, aggregation of the protein in the vaccine by heat treatment with temperatures ranging between 70° to 101 °C for 30 second to 2 minute periods respectively and also aggregation by means of cross-linking agents are possible. Aggregation by reactivation with pepsin treated antibodies (Fab fragments) to albumin, mixture with bacterial cells such as C.
- aluminum salts such as hydroxide or phosphate (alum)
- alum alum
- synthetic polymers of sugars e.g. Carbopol®
- aggregation of the protein in the vaccine by heat treatment with temperatures ranging between 70° to 101 °C
- parvum or endotoxins or lipopolysaccharide components of gram-negative bacteria emulsion in physiologically acceptable oil vehicles such as mannide mono-oleate (Aracel A) or emulsion with 20 percent solution of a perfluorocarbon (Fluosol-DA) used as a block substitute may also be employed. Admixture with oils such as squalene and IFA may als be used. [0177J DDA (dimethyldioctadecylammonium bromide) is an interesting candidate for an adjuvant, but also Freund's complete and incomplete adjuvants as well as quillaja saponins such as QuilA and QS21 are interesting.
- PCPP poly[di(earboxylatophenoxy)phosphazene
- MPL ® monophosphoryl lipid A
- MDP muramyl dipeptide
- tMDP threonyl muramyl dipeptide
- the lipopolysaccharide based adjuvants may also be used for producing a predominantly Th l -type response including, for example, a combination of monophosphoryl lipid A, such as 3-de-O-acylated monophosphoryl lipid A, together with an aluminum salt.
- MPL ® adjuvants are available from GlaxoSmithKline (see, for example, U.S. Pat. Nos. 4,436,727; 4,877,61 1 ; 4,866,034 and 4,912,094).
- Liposome formulations are also known to confer adjuvant effects, and therefore liposome adjuvants may be used in conjunction with the chimeric VLPs.
- Immunostimulating complex matrix type (ISCOM® matrix) adjuvants may also be used with the chimeric VLPs, especially since it has been shown that this type of adj uvants are capable of up-regulating MHC Class II expression by APCs.
- An ISCOM matrix consists of (optionally fractionated) saponins (triterpenoids) from Quillaja saponaria, cholesterol, and phospholipid.
- saponin may constitute 60-70% w/w, the cholesterol and phospholipid 10- 1 5% w/w, and the protein 10-15% w/w.
- the saponins whether or not in the form of iscoms, that may be used in the adjuvant combinations with the chimeric VLP vaccines disclosed herein include those derived from the bark of Quillaja Saponaria Molina, termed Quil A, and fractions thereof, described in U.S. Pat. No. 5,057,540 and "Saponins as vaccine adjuvants", ensil, C. R., Crit Rev Ther Drug Carrier Syst, 1996, 12 (1 -2): 1 -55; and EP 0 362 279 B l .
- Exemplary fractions of Quil A are QS21 , QS7, and QS 17.
- ⁇ -Escin is another haemolytic saponin for use in the adjuvant
- Escin is described in the Merck index ( 12th ed: entry 3737) as a mixture of saponins occurring in the seed of the horse chestnut tree, Lat: Aesculus hippocastanum. Its isolation is described by chromatography and purification (Fiedler, Arzneistoff-Forsch. 4, 213 (1953)), and by ion-exchange resins (Erbring et al., U.S. Pat. No. 3,238, 190). Fractions of escin have been purified and shown to be biologically active (Yoshikawa M, et al. (Chem Pharm Bull (Tokyo) 1996
- ⁇ -escin is also known as aescin.
- Another haemolytic saponin for use in the chimeric VLPs is Digitonin.
- Digitonin is described in the Merck index (12 th Edition, entry 3204) as a saponin, being derived from the seeds of Digitalis purpurea and purified according to the procedure described Gisvold et al., J.Am.Pharm.Assoc, 1934, 23, 664; and Oxfordstroth-Bauer, Physiol.Chem., 1955, 301 , 621 . Its use is described as being a clinical reagent for cholesterol determination.
- a relevant antigen such as an antigen in a chimeric VLP disclosed herein can be enhanced by conjugating the antigen to antibodies (or antigen binding antibody fragments) against the Fc receptors on monocytes/macrophages.
- antibodies or antigen binding antibody fragments
- the antibody may be conjugated to the chimeric VLP after generation or as a part of the generation including by expressing as a fusion to any one of the polypeptide components of the chimeric VLP.
- cytokines include the targeting and immune modulating substances (i.e. cytokines).
- synthetic inducers of cytokines such as poly I:C may also be used.
- Suitable mycobacterial derivatives may be selected from the group consisting of muramyl dipeptide, complete Freund's adjuvant, RIBI, (Ribi ImmunoChem Research Inc., Hamilton, Mont.) and a diester of trehalose such as TDM and TDE.
- Suitable immune targeting adjuvants include CD40 ligand and CD40 antibodies or specifically binding fragments thereof (cf. the discussion above), mannose, a Fab fragment, and CTLA-4.
- Suitable polymer adjuvants include a carbohydrate such as dextran, PEG, starch, mannan, and mannose; a plastic polymer; and latex such as latex beads.
- VLN virtual lymph node
- the VLN (a thin tubular device) mimics the structure and function of a lymph node. Insertion of a VLN under the skin creates a site of sterile inflammation with an upsurge of cytokines and chemokines. T- and B-cells as well as APCs rapidly respond to the danger signals, home to the inflamed site and accumulate inside the porous matrix of the VLN.
- Oligonucleotides may be used as adjuvants in conjunction with the chimeric VLP vaccines and may contain two or more dinucleotide CpG motifs separated by at least three or more or even at least six or more nucleotides.
- CpG-containing oligonucleotides induce a predominantly Thl response.
- Such oligonucleotides are well known and are described, for example, in WO 96/02555, WO 99/33488 and U.S. Pat. Nos. 6,008,200 and
- Such oligonucleotide adjuvants may be deoxynucleotides.
- the nucleotide backbone in the oligonucleotide is phosphorodithioate, or a phosphorothioate bond, although phosphodiester and other nucleotide backbones such as PNA including oligonucleotides with mixed backbone linkages may also be used.
- oligonucleotides have the following sequences.
- the sequences may contain phosphorothioate modified nucleotide backbones.
- Alternative CpG oligonucleotides include the above sequences with inconsequential deletions or additions thereto.
- the CpG oligonucleotides as adjuvants may be synthesized by any method known in the art (e.g., EP 468520). For example, such oligonucleotides may be synthesized utilizing an automated synthesizer. Such oligonucleotide adjuvants may be between 10-50 bases in length.
- Another adjuvant system involves the combination of a CpG-containing oligonucleotide and a saponin derivative particularly the combination of CpG and QS21 is disclosed in WO 00/09159.
- oil emulsion adjuvants for use with the chimeric VLP vaccines described herein may be natural or synthetic, and may be mineral or organic. Examples of mineral and organic oils will be readily apparent to the man skilled in the art.
- the oil phase of the emulsion system may include a metabolizable oil.
- metabolizable oil is well known in the art. Metabolizable can be defined as "being capable of being transformed by metabolism” (Dorland's Illustrated Medical Dictionary, W.B. Sanders Company, 25th edition (1974)).
- the oil may be any vegetable oil, fish oil, animal oil or synthetic oil, which is not toxic to the recipient and is capable of being transformed by metabolism. Nuts (such as peanut oil), seeds, and grains are common sources of vegetable oils. Synthetic oils may also be used and can include commercially available oils such as NEOBEE ® and others.
- Squalene (2,6,10, 15, 19,23- Hexamethyl-2,6, 10, 14,18,22-tetracosahexaene) is an unsaturated oil which is found in large quantities in shark-liver oil, and in lower quantities in olive oil, wheat germ oil, rice bran oil, and yeast, and may be used with the chimeric VLPs. Squalene is a
- Exemplary oil emulsions are oil in water emulsions, and in particular squalene in water emulsions.
- the oil emulsion adjuvants for use with the chimeric VLPs may include an antioxidant, such as the oil a-tocopherol (vitamin E, EP 0 382 271 B l).
- WO 95/17210 and WO 99/1 1241 disclose emulsion adjuvants based on squalene, a-tocopherol, and TWEEN 80 (TM), optionally formulated with the immunostimulants QS21 and/or 3D-MPL.
- WO 99/12565 discloses an improvement to these squalene emulsions with the addition of a sterol into the oil phase.
- a triglyceride such as tricaprylin (C27H50O6), may be added to the oil phase in order to stabilize the emulsion (WO 98/56414).
- the size of the oil droplets found within the stable oil in water emulsion may be less than 1 micron, may be in the range of substantially 30-600 nm, substantially around 30-500 nm in diameter, or substantially 150-500 nm in diameter, and in particular about 150 nm in diameter as measured by photon correlation spectroscopy. In this regard, 80% of the oil droplets by number may be within these ranges, more than 90% or more than 95% of the oil droplets by number are within the defined size ranges.
- the amounts of the components present in oil emulsions are conventionally in the range of from 2 to 10% oil, such as squalene; and when present, from 2 to 10% alpha tocopherol; and from 0.3 to 3% surfactant, such as polyoxyethylene sorbitan monooleate.
- the ratio of oil: alpha tocopherol may be equal or less than 1 as this provides a more stable emulsion.
- SPAN 85 (TM) may also be present at a level of about 1 %. In some cases it may be advantageous that the chimeric VLP vaccines disclosed herein will further contain a stabilizer.
- the method of producing oil in water emulsions is well known to the man skilled in the art. Commonly, the method includes the step of mixing the oil phase with a surfactant such as a PBS/TWEEN80 ® solution, followed by homogenization using a homogenizer, it would be clear to a man skilled in the art that a method comprising passing the mixture twice through a syringe needle would be suitable for homogenizing small volumes of liquid.
- a surfactant such as a PBS/TWEEN80 ® solution
- micro fluidizer M H OS microfluidics machine, maximum of 50 passes, for a period of 2 minutes at maximum pressure input of 6 bar (output pressure of about 850 bar)
- output pressure of about 850 bar
- the chimeric VLP vaccine preparations disclosed herein may be used to protect or treat a mammal or bird susceptible to, or suffering from a viral infection, by means of administering the vaccine by intranasal, intramuscular, intraperitoneal, intradermal, transdermal, intravenous, or subcutaneous administration.
- Methods of systemic administration of the vaccine preparations may include conventional syringes and needles, or devices designed for ballistic delivery of solid vaccines (WO 99/27961 ), or needleless pressure liquid jet device (U.S. Pat. No. 4,596,556; U.S. Pat. No.
- the chimeric VLP vaccines may also be applied to the skin (transdermal or transcutaneous delivery WO 98/20734; WO 98/28037).
- the chimeric VLP vaccines disclosed herein therefore includes a delivery device for systemic administration, pre-filled with the chimeric VLP vaccine or adjuvant compositions. Accordingly there is provided a method for inducing an immune response in an individual such as a mammal or bird, comprising the administration of a vaccine comprising any of the chimeric VLP compositions described herein and optionally including an adjuvant and/or a carrier, to the individual, wherein the vaccine is administered via the parenteral or systemic route.
- the vaccine preparations of the chimeric VLPs may be used to protect or treat a mammal or bird susceptible to, or suffering from a viral infection, by means of administering the vaccine via a mucosal route, such as the oral/alimentary or nasal route.
- a mucosal route such as the oral/alimentary or nasal route.
- Alternative mucosal routes are intravaginal and intra-rectal.
- the mucosal route of administration may be via the nasal route, termed intranasal vaccination.
- Methods of intranasal vaccination are well known in the art, including the administration of a droplet, spray, or dry powdered form of the vaccine into the nasopharynx of the individual to be immunized.
- Nebulized or aerosolized vaccine formulations are potential forms of the chimeric VLP vaccines disclosed herein.
- Enteric formulations such as gastro resistant capsules and granules for oral administration, suppositories for rectal or vaginal administration are also formulations of the chimeric VLP vaccines disclosed herein.
- the exemplary chimeric VLP vaccine compositions disclosed herein represent a class of mucosal vaccines suitable for application in humans to replace systemic vaccination by mucosal vaccination.
- the chimeric VLP vaccines may also be administered via the oral route.
- the pharmaceutically acceptable excipient may also include alkaline buffers, or enteric capsules or microgranules.
- the chimeric VLP vaccines may also be administered by the vaginal route.
- the pharmaceutically acceptable excipients may also include emulsifiers, polymers such as CARBOPOL ® , and other known stabilizers of vaginal creams and suppositories.
- the chimeric VLP vaccines may also be administered by the rectal route. In such cases the excipients may also include waxes and polymers known in the art for forming rectal suppositories.
- the chimeric VLP vaccines formulations may be combined with vaccine vehicles composed of chitosan (as described above) or other polycationic polymers, polylactide and polylactide-coglycolide particles, poly-N-acetyl glucosamine- based polymer matrix, particles composed of polysaccharides or chemically modified polysaccharides, liposomes and lipid-based particles, particles composed of glycerol monoesters, etc.
- the saponins may also be formulated in the presence of cholesterol to form particulate structures such as liposomes or ISCOMs.
- the saponins may be formulated together with a polyoxyethylene ether or ester, in either a non- particulate solution or suspension, or in a particulate structure such as a paucilamelar liposome or ISCOM.
- Additional illustrative adjuvants for use in the pharmaceutical and vaccine compositions using the chimeric VLPs as described herein include SAF (Chiron, Calif, United States), MF-59 (Chiron, see, e.g., Granoff et al. (1997) Infect Immun. 65
- SBAS series of adjuvants e.g., SB-AS2 (Smith line Beecham adjuvant system #2; an oil-in-water emulsion containing MPL and QS21 ); SBAS-4 (SmithKline Beecham adjuvant system #4; contains alum and MPL), available from SmithKline Beecham, Rixensart, Belgium), Detox (Enhanzyn ® ) (GlaxoSmithKline), RC- 512, RC-522, RC-527, RC-529, RC-544, and RC-560 (GlaxoSmithKline) and other aminoalkyl glucosaminide 4-phosphates (AGPs), such as those described in pending U.S. patent application Ser. Nos. 08/853,826 and 09/074,720.
- AGPs aminoalkyl glucosaminide 4-phosphates
- adjuvants include, but are not limited to, Hunter's
- TiterMax ® adjuvants (CytRx Corp., Norcross, Ga.); Gerbu adjuvants (Gerbu Biotechnik GmbH, Gaiberg, Germany); nitrocellulose ( ilsson and Larsson (1992) Res. Immunol. 143 :553-557); alum (e.g., aluminum hydroxide, aluminum phosphate) emulsion based formulations including mineral oil, non-mineral oil, water-in-oil or oil-in-water emulsions, such as the Seppic ISA series of Montamide adjuvants (e.g., ISA-51 , ISA-57, 1SA-720, ISA-151 , etc.; Seppic, Paris, France); and PRO VAX® (IDEC Pharmaceuticals); OM-174 (a glucosamine disaccharide related to lipid A); Leishmania elongation factor; non-ionic block copolymers that form micelles such as CRL 1005; and Syntex Adjuvant Formulation.
- alum
- n 1 -50
- A is a bond or— C(0) ⁇
- R is Ci -50 alkyl or Phenyl Q-50 alkyl .
- One embodiment consists of a vaccine formulation comprising a polyoxyethylene ether of general formula (I), wherein n is between 1 and 50, 4-24, or 9; the R component is Ci -50 , C 4 -C 20 alkyl, or C12 alkyl, and A is a bond.
- concentration of the polyoxyethylene ethers should be in the range 0.1 -20%, from 0.1 -10%, or in the range 0.1 - 1 %.
- Exemplary polyoxyethylene ethers are selected from the following group: polyoxyethylene-9-lauryl ether, polyoxyethylene-9-steoryl ether, polyoxyethylene-8- steoryl ether, polyoxyethylene-4-lauryl ether, polyoxyethylene-35-lauryl ether, and polyoxyethylene-23-lauryl ether.
- Polyoxyethylene ethers such as polyoxyethylene lauryl ether are described in the Merck index (12 edition: entry 7717). These adjuvant molecules are described in WO 99/52549.
- polyoxyethylene ether according to the general formula (1) above may, if desired, be combined with another adjuvant.
- an adjuvant combination may include the CpG as described above.
- Suitable pharmaceutically acceptable excipients for use with the chimeric VLP vaccines disclosed herein include water, phosphate buffered saline, isotonic buffer solutions.
- the invention includes chimeric VLPs which optionally comprise an additional VLP-associated polypeptide linked to an antigen or adjuvant.
- the following Examples describe a representative embodiment of the invention which includes chimeric VLPs.
- This example demonstrates that mammalian cell expression of a truncated version of the RSV fusion (F) glycoprotein lacking the cytoplasmic tail region or hybrid F proteins containing transmembrane and cytoplasmic tail regions derived from influenza hemagglutinin results in the formation of enveloped virus-like particles (VLPs) containing RSV F.
- RSV fusion (F) glycoprotein lacking the cytoplasmic tail region or hybrid F proteins containing transmembrane and cytoplasmic tail regions derived from influenza hemagglutinin results in the formation of enveloped virus-like particles (VLPs) containing RSV F.
- VLPs enveloped virus-like particles
- This example was designed such that the RSV F glycoprotein was expressed in mammalian cells with and without co-expression of the murine leukemia virus Gag gene product. The expectation was that the RSV F would be incorporated into enveloped Gag VLPs budding from the cells.
- a map of p3.1 - RSVFT is shown in Figure 16 and the coding sequence for RSVFT as follows: tggaactgctgatcctgaaggctaacgctatcaccaccatcctgaccgctgtc accttc gcttccggccagaacatcaccgaggaattctaccagtccacc tgctctccaagggttacctgtccgctctgcaccggctggtacacc tccgtcatcaccatcgagctgtccaacatcaaggaaaacaagtgcaacggcacc gacgctaaggtcaa
- Plasmid p3.1 -shFvl encoded a hybrid protein consisting of the ectodomain of RSV F fused to the transmembrane domain and cytoplasmic tail of an H5 hemagglutinin from influenza A.
- Figure 1 shows a map of p3.1 -shFvl and the coding sequence for shFvl is as follows: atggaactgctgatcctgaaggctaacgctatcaccaccatcctgaccgctgtg accttctgcttcgcttccggccagaacatcaccgaggaattctaccagtccacc tgctccgctgtgtccaagggttacctgtccgctcgcgtaccggttggtacacc tccgtgatcaecatcgagctgtccaacatcaaagagaacaagtgcaacggcacc gacgctaaggtcaagctgatcaagcaggaactggacaagtacaagaacgctgtgtg accgagctgcagctgatgtgaccgagct
- shFvl amino acid sequence of shFvl is as follows (with the signal peptide coding sequence and the HA transmembrane and cytoplasmic tail sequences shown in capital letters):
- shFvl coding sequence was generated by DNA synthesis.
- Plasmid p3.1 -shFv2 encoded a hybrid protein consisting of the ectodomain of RSV F fused to the transmembrane domain and cytoplasmic tail of an H5 hemagglutinin from influenza A.
- shFv2 differed from shFv l in that the influenza HA-derived transmembrane and tail region is four amino acids longer.
- Figure 2 shows a plasmid map of p3.1-shFv2.
- the coding sequence for shFv2 is as follows: atggaactgctgatcctgaaggctaacgctatcaccaccatcctgaccgctgtg accttctgcttcgcttccggccagaacatcaccgaggaattctaccagtccacc tgctccgctgtgtccaagggttacctgtccgctctgcgtaccggttggtacacc tccgtgatcaccatcgagctgtccaacatcaaagagaacaagtgcaacggcacc gacgctaaggtcaagctgatcaagcaggaactggacaagtacaagaacgctgtgtg accgagctgctgtgaccgagctgctaccaacaaccgtgctgtgtgtg
- shFv2 amino acid sequence of shFv2 is as follows (with the signal peptide coding sequence and the HA transmembrane and cytoplasmic tail sequences shown in capital letters):
- the shFv2 coding sequence was generated by DNA synthesis.
- Plasmid p3.1-Gag encoded the Gag gene product from murine leukemia virus.
- Figure 3 shows a plasmid map of p3.1 Gag.
- the coding sequence for Gag from plasmid p3.1-Gag is as follows: atgggccagactgttaccactcccttaagtttgaccttaggtcactggaaagat gtcgagcggatcgctcacaaccagtcggtagatgtcaagaagagacgttgggttt acctctgctctgcagaatggccaacctttaacgtcggatggccgcgagacggc accttaaccgagacctcatcacccaggttaagatcaaggtcttttcacctggc cccgcatggacacccagaccaggtcccctacatcgtgacctgggaagcctt
- amino acid sequence for MLV Gag is as follows:
- Gag gene represented a natural clone from the genome of MLV found in plasmid pAMS (ATCC).
- FIG. 4 shows the histograms from the flow cytometric runs demonstrating significant levels of surface expression of F on cells transfected with any of the F expression vectors with and without the Gag vector.
- the growth medium harvested from the transfected cells was centrifuged at 2000 rpm for 5 minutes to remove syncytia and any cellular debris and the supernatant from this step was centrifuged over a 30% sucrose cushion in tris-buffered saline at 100,000 x g for 1 hour to collect any VLPs that may have been released into the medium as a result of Gag and/or F gene expression. 100,000 x g pellets from this step were resuspended in tris-buffered saline for additional analyses.
- TM BLOCK (TM) (PBS) (Pierce, Biotechnology). After blocking, 100 ⁇ of 1 : 1000 diluted monoclonal antibody 9C5 in STARTING BLOCK T20 (TM) (Pierce) was loaded into each well and the plate was incubated at room temperature for 3 hours. The plate was washed again and 100 ⁇ of goat anti-mouse HRP conjugate antibody (Southern Biotech) diluted 1 : 1000 in STARTING BLOCK T20 (TM) was added to each well and incubated at room temperature for 1 .5 hours. Following a final wash (3x) with PBS-T, the plate was developed by the addition of 100 ⁇ ABTS reagent (Pierce) and incubated at room temperature for 45 minutes.
- FIG. 5 shows the results of this ELISA in which it can be observed that significant levels of RSV F antigen were detected in the 100,000 x g pellets from both F gene alone and F gene + Gag gene transfections. Importantly and unexpectedly, greater amounts of RSV F antigenic activity were observed in the pellets from cells transfected with the RSV F genes alone. These data demonstrates that expression of the F gene alone, in the absence of Gag expression, results in the formation of VLPs carrying the F antigen. This is also consistent with the above observation that co-expression of F and Gag results in a suppression of Gag budding, possibly due to interference of Gag budding by F.
- This example demonstrates the production of HIV-1 Gag VLPs pseudotyped with the GPI-anchored version of the RSV F glycoprotein.
- Plasmid p3.1 -bruGag contains a synthetic sequence that encodes the HIV-Gag product from the bru strain of HIV-1. This plasmid employs the CMV immediate early promoter and is suitable for transient transfection expression studies. Figure 6 shows the map of p3.1 -bruGag.
- the coding sequence for the bruGag is as follows: atgggagccagagccagcgtgctgtctggcggcgagctggacagatgggagaag atccggctgcggccaggcggcaagaagaagtacaagctgaagcacatcgtgtgg gctagccgggagctggaaagattcgccgtgaaccccggactgctggaaaccagc gagggctgcagacagatcctgggccagctgcagccatctctgcagaccggcagc gaggaactgcggagcctgtacaacaccgtggccaccctgtactgcgtgcaccag cggatcgagatcaaggacaccaaagaggccctggacaagatcgaggaggagatcgaggaggccaccctgtactg
- amino acid sequence encoded by p3.1 -bruGag is as follows: mgarasvlsggeldrwekirlrpggkkkyklkhivwasrelerfa npgllets egcrqilgqlqpslqtgseelrslyntvatlycvhqrieikdtkealdkieeeq nkskkkaqqaaadtghssqvsqnypivqniqgqmvhqaisprtlnawvk veek afspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvh pvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilgl nkivrmysptsildirqgpkep
- Plasmid p3.1 -F-GPI contains a synthetic sequence that encodes a GPI- anchored version of the RSV F glycoprotein from RSV strain A2. This plasmid was constructed by deleting the F gene sequences encoding the transmembrane and cytoplasmic tail domains and replacing them with sequences encoding the GPI anchor signal from human carboxypeptidase M.
- Figure 7 shows a map of p3.1-F-GPI.
- the F- GPI coding sequence is as follows: atggagctgctgatcctgaaggccaacgccatcaccaccatcctgaccgccgtg accttctgcttcgcctcggccagaacatcaccgaggagttctaccagtccacc tgctccgccgtgtccaagggctacctgtccgcctgcggaccggctggtacacc tccgtgatcaccatcgagctgtccaacatcaaagaaaacaagtgcaacggcacc gacgccaaggtgaagctgatcaagcaggagctggacaagtacaagaacgccgtgaccgagctgcagctgtgaccgagctgcagtgaccgagctgcagctgtgaccgagc
- amino acid sequence encoded by p3.1-F-GPI is as follows: mellilkanaittiltavtfcfasgqniteefyqstcsavskgylsalrtgwyt svitielsnikenkcngtdakvklikqeldkyknavtelqllmqstpatnnrar relprfmnyt lnnakktnvtlskkrkrrflgfllgvgsaiasgvavskvlhleg evnkiksallstnka vslsngvsvltskvldlknyidkqllpivnkqscsisn ietviefqqknnrlleitrefsvnagvttpvstymltnsellslindmpitndq kklmsnnvqivrqqsysimsiikeevlay
- Plasmids p3.1 -bruGag and p3.1-F-GPI were transfected into 293 F cells either alone or in combination with one another at various ratios (1 : 1 , 3: 1 , and 9: 1 Gag-to-F). Each transfection employed a T75 culture flask of 293F cells growing as a monolayer. Transfections employed LIPOFECTAMINE (TM) 2000 as described by the
- the DMEM + 10% FBS growth medium was replaced with serum-free CD293 medium.
- the growth medium was harvested and clarified of debris by low speed centrifugation, after which, VLPs in the medium were collected by centrifugation at 100,000 x g through a 20% sucrose cushion in tris-buffered saline (TBS). Pelleted material was resuspended in TBS and subjected to Western blot analysis using antibodies specific for HIV-1 Gag and RSV antigens.
- Figure 8 shows the Gag Western blot and Figure 9 shows the RSV Western blot.
- the Gag Western blot ( Figure 8) shows that abundant amounts of the Gag product were present in all cultures whether transfected with the Gag vector alone or in combination with the F vector. There was some reduction in the yield of the Gag gene product in the 1 : 1 ratio culture but HIV Gag gene expression and VLP budding was not shut down by RSV F expression as was the case for MLV Gag.
- the RSV F antigen was detected in the pelleted samples as shown in Figure 9 and the amount of F antigen found in the samples was markedly increased in those cultures in which HIV-1 Gag was expressed along with RSV F.
- This example describes larger scale production of HIV-1 Gag VLPs pseudotyped with the GPI-anchored version of the RSV F glycoprotein.
- VLP pellet was resuspended in TBS, layered onto a 20-60% sucrose step gradient, and centrifuged at 100,000 x g for 1 hour at 10°C. Gradient fractions were analyzed by SDS-PAGE to identify Gag-containing fractions. Peak Gag-containing fractions were pooled, sucrose was diluted by three-fold with TBS, and VLPs were concentrated by centrifugation once again at 100,000 x g for 1 hour at 10°C. Samples were then resuspended in TBS for analysis by SDS-PAGE, Western blotting, and ELISA. Results
- Figure 10 shows a silver- stained SDS-PAGE gel (left panel) revealing a prominent bruGag band (-57 Kd) and a lighter band consistent with the GPI-anchored F ( ⁇ 61 Kd). The identity of the F band was confirmed by Western blotting ( Figure 10, right panel). Further evidence for the presence of the F antigen was obtained by ELISA in which a sample of the VLPs was serially diluted on an ELISA plate and was reacted with the Synagis RSV F-specific neutralizing monoclonal antibody (Medlmmune). ELISA data are shown in Figure 1 1 in which the sucrose-banded VLPs elicited a signal similar to that of live RSV virus in their reactivity to the Synagis antibody.
- This example describes larger scale production of HIV- 1 Gag VLPs pseudotyped with the RSV F glycoprotein containing the cytoplasmic tail truncation.
- the F coding sequence is as follows: atggaactgctgatcctgaaggctaacgctatcaccaccatcctgaccgctgtc accttctgcttcgcctccggccagaacatcaccgaggaattctaccagtccacc tgctccgctgtctccaagggttacctgtccgctctgcgcaccggctggtacacc tccgtcatcaccatcgagctgtccaacatcaaggaaacaagtgcaacggcacc gacgctaaggtcaagctgatcaagcaggaactggacaagtacaagaacgctgtc accgagctgcagctgatcaccgaacaaccgctgctcgctaccaacaaccgcgctaccaacaacc
- the encoded F amino acid sequence is as follows (the N-terminal signal peptide and the C-terminal transmembrane domain are underlined: mellilkanaittiltavtfcfasgqniteefyqstcsavskgylsalrtgwyt svitielsnikenkcngtdakvklikqeldkyknavtelqllmqstpatnnrar relprfmnytlnnakktnvtlskkrkrrflgfllgvgsaiasgvavskvlhleg evnkiksallstnkavvslsngvsvltskvldlknyidkqllpivnkqscsisn ietviefqqknnrlleitrefsvnagvttpvstymltnsellslindmpitndq kklmsnnnn
- the transfection medium (DMEM + 10% FBS) was replaced with CD293 medium. Forty-eight hours post-transfection the growth medium was collected, clarified of debris, and centrifuged at 100,000 x g for 1 hour at 10°C through a 20% sucrose cushion to pellet VLPs. The VLP pellet was resuspended in TBS, layered onto a 20-60% sucrose step gradient, and centrifuged at 100,000 x g for 1 hour at 10°C. Gradient fractions were analyzed by SDS-PAGE to identify Gag-containing fractions.
- Peak Gag-containing fractions were pooled, sucrose was diluted by three-fold with TBS, and VLPs were concentrated by centrifugation once again at 100,000 x g for 1 hour at 10°C. The samples were then resuspended in TBS for analysis by SDS-PAGE, Western blotting, and ELISA.
- Figure 13 shows a silver-stained SDS-PAGE gel (left panel) revealing a prominent bruGag band (-57 Kd) and a lighter band consistent with the truncated F ( ⁇ 61 Kd). The identity of the F band was confirmed by Western blotting ( Figure 13, right panel). Further evidence for the presence of the F antigen was obtained by ELISA in which a sample of the VLPs was serially diluted on an ELISA plate and was reacted with the Synagis RSV F-specific neutralizing monoclonal antibody (Medlmmune). ELISA data are shown in Figure 14 in which the sucrose-banded VLPs elicited a signal similar to that of live RSV virus in their reactivity to the Synagis antibody.
- This example demonstrates the induction of neutralizing antibody responses in mice by RSV F-pseudotyped HIV Gag VLPs.
- RSV F-GPI pseudotyped HIV-1 Gag VLPs were prepared as described in Example 3 and used to immunize mice. Mice received two immunizations each, spaced 4 weeks apart, in which each immunization consisted of VLPs in TBS that contained approximately 0.5 ⁇ g of the F antigen. Two weeks following the second immunization serum samples were collected for use in an RSV plaque reduction (virus neutralizing) assay. Live RSV aliquots consisting of an average of 125 plaque forming units (pfu) of virus were treated with serial dilutions of RSV neutralizing control antibodies or sera from immunized mice or control mice.
- RSV plaque reduction virus neutralizing
- the antibody-treated virus inocula were then added to individual wells of a 96-well plate of Vero cells, and the plate was incubated for 48 hours at 37°C to allow non-neutralized virus to infect cells. After 48 hours plaques of RSV growth were identified by fixing the cells and allowing them to react with a goat polyclonal RSV-specific antibody.
- This example demonstrates the production of RSV F-pseudotyped ALV Gag VLPs.
- HIV-1 Gag lentivirus
- ALV avian leukosis virus
- Plasmid p3.1 -alvGag-dPR contains a synthetic sequence encoding the ALV Gag gene product devoid of its C-terminal protease domain.
- Alpha retroviruses such as ALV contain their protease domain as part of the Gag polyprotein rather than the Pol polyprotein as is the case with most other retroviruses. Because the protease domain is dispensable for VLP budding, it was not included in the final vector.
- Figure 17 shows a map of p3.1 -alvGag-dPR.
- the nucleotide coding sequence is as follows: atggaagctgtgatcaaggtcatctcctccgcttgcaagacctactgcggcaag acctcccctccaagaaagaaatcggtgctatgctgtccctgctgcagaaagag ggcctgctgatgtccccccgacctgtactccccccccggttcctgggaccctatc accgctgctctgtcccagcgtgctatgatcctgggcaagtccggcgaactcaag acctggggcctggtgctgggtgctctgaaggctgctcgcgaggaggctctcgcgaggacaagtgacc tccgagcaggctaagtggtggtcgc
- Plasmids p3.1-alvGag-dPR and p3.1-RSVFT were transfected into 293F cells individually or together at ratios of 1 : 1, 3: 1 and 9: 1 (Gag-to-F). Forty-eight hours post- transfection the medium was harvested, clarified of debris, and VLPs were pelleted at 100,000 x g for 1 hour at 10°C. Resuspended pellets were analyzed for RSV F antigenic activity via an ELISA using the Synagis monoclonal antibody as described above.
- Example 7 Comparison of RSV F pseudotyped VLP production between vectors encoding HIV-1 Gag and alvGag-dPR.
- This example compares the productions of pseudotyped HIV-1 Gag + RSV F VLP with the production of alvGag-dPR + RSV F VLP.
- Plasmid p3.1-alvGag-dPR was co-transfected into 293F cells along with p3.1- RSVFT at ratios of 1 : 1 and 3: 1.
- plasmid p3.1-bruGag was co-transfected into 293 F cells with p3.1-RSVFT at a ratio of 3:1. Seventy-two hours post-transfection the medium was harvested, clarified of debris and VLPs were pelleted at 100,000 x g for 1 hour at 10°C. Resuspended pellets were analyzed for RSV F antigenic activity via an ELISA using the Synagis monoclonal antibody as described above. Results
- This example attempts to determine if Gag proteins from other retroviruses were effective for the production of RSV F-pseudotyped VLPs.
- Vectors encoding the Gag products of Mason Pfizer Monkey virus (MPMV, betaretrovirus), Bovine Leukemia virus (BLV, deltaretrovirus), and Equine Infectious Anemia virus (EIAV, lentivirus) were constructed using custom synthesized Gag coding sequence fragments that were confirmed by DNA sequence analysis. These vectors were co-transfected into 293F cells along with the F-encoding vector p3.1 -RSVFT at a ratio of 3 : 1 (Gag:F). Seventy-two hours post-transfection the medium was harvested, clarified of debris and VLPs were pelleted at 100,000 x g for 1 hour at 10°C. Resuspended pellets were analyzed for RSV F antigenic activity via an ELISA using the Synagis monoclonal antibody as described above.
- MPMV Mason Pfizer Monkey virus
- BLV Bovine Leukemia virus
- EIAV Equine Infectious Anemia virus
- alvGag-dPR complete alvGag with its C-terminal protease activity intact can also form pseudotyped VLPs with the RSV F protein. This was demonstrated in a transfection experiment comparing the release of VLPs following transfection with p3. 1 -alvGag-dPR (plus FL or FT) versus transfection with p3.1 -alvGag (plus FL or FT) versus transfection of a mixture of p3.1 -alvGag-dPR and p3.1 -alvGag (plus FL or FT).
- Figure 21 shows a map of plasmid p3.1 -alvGag encoding the complete alvGag polyprotein with intact retroviral protease activity.
- the nucleotide coding sequence is as follows: atggaagccgtgatcaaagtgatcagcagcgcctgcaagacctactgcggcaag accagccccagcaagaaagaaattggcgccatgctgtctgctgcagaaggaa ggcctgctgcagaaggaa ggcctgctgatgagccccagcgacctgtacagcccccggcagctgggatcctatc acagctgccctgagccagagagccatgatcctgggcaagagcggcgagctgaaa acctggggcctggtgctgaaggccctg
- FIG. 23 shows the status of the ALV Gag protein in each of these transfections.
- transfection with p3.1 -alvGag-dPR resulted in a prominent 61 kD band consistent with expression of the intact Gag-dPR polyprotein (lanes 1 and 2).
- 1 -alv-Gag and p3.1 -alvGag-dPR resulted in a prominent 27 kD band consistent with Gag processing due to the presence of the retroviral protease activity.
- Example 10- RSV F-pseudotyped ALV Gag VLPs induce neutralizing antibody responses in mice.
- ALV Gag VLPs containing RSV "FT” or "FL” were prepared from HE 293 cells following transfection of cells with p3.1-alvGag-dPR along with p3.1 -RSVFT or p3.1 -RSVFL.
- the "Gag” to "F” plasmid DNA transfection ratio was 3: 1 .
- VLPs containing F antigen were pelleted from the growth medium harvested on day 3 by centrifugation at 100,000 x g through a 30% sucrose cushion then banded on 20-60% discontinuous sucrose gradients.
- HSV Herpes Simplex Virus
- gD glycoprotein D
- HSV gD subunit vaccine formulations have been tested in clinical trials for the prevention of HSV infections (D.I. Bernstein, et al., Safety and immunogenicity of glycoprotein D-adjuvant genital herpes vaccine. 2005. Clin Inf Disease 40: 1271 - 1281 ).
- a human HSV type 2 gD gene (GeneBank GenelD: 1487358) was synthesized and cloned into the pcDNA3.1 (-) vector (Invitrogen) to construct plasmid p3.1 -HSVgD.
- the plasmid map is shown in Figure 26.
- the nucleic acid coding sequence is as follows: atgggtagactgacttccggagtgggcaccgccgctctgctggtcgtggctgtgtg ggcctgcgtcgtgtgcgccaagtacgcactggccgatcccccctgaagatg gccgaccctaaccgcttccgcggcaagaacctcccccgtgctggaccagctgacc gctgacc gaccccctggcgtgaagcgcgtaccacatccagccttcccctggccatccccatcaccgtgtactacgcagtgctggaacgcgctggtggaacgcgctgtgtaccacatccagccttccccctccatccccatcaccgtgtactac
- Plasmids p3.1 -HSVgD and p3.1 -alvGag-dPR were transfected into 293F cells either alone or in combination ratios of 1 : 1 , 5.6: 1 , and 2.3: 1 HSVgD-to-ALVGag.
- HEK 293F monolayers in T75 flasks were transfected with the above DNAs using
- LIPOFECTAMINE 2000, incubated 8 hours and switched to fresh serum-free medium for 48 hours.
- the culture supernatants were harvested, centrifuged to pellet cells (3 min at 500 x g) and to pellet cell debris (10 min at 4000 x g) to produce clarified culture supernatant fluids.
- These samples were utilized directly in ELISA screening or overlaid onto a 30% sucrose-TBS cushion for ultracentrifugation (10°C, 100,000 x g, 1 hour) to pellet VLPs and multimeric protein complexes.
- Ultracentrifuge pelleted material i.e., UC pellet
- UC pellet Ultracentrifuge pelleted material
- 4-12% SDS-PAGE NuPAGE Bis-Tris Gels, Invitrogen
- polyvinylidene fluoride membranes for Western blot analysis.
- Expression of the HSVgD and ALV Gag proteins was tracked with specific antibody reagents: anti-HSVgD monoclonal antibody (GeneTex) and a goat anti-p27 alvGAG polyclonal antibody (Synbiotics).
- Direct ELISAs direct ELISAs
- ELISAs were performed by coating Immunon II microtiter plate wells with test or control samples (25 - 100 i of culture supernatant), rinsed in TBS and blocked in fresh milk block (5% w/v skim milk and 1% w/v BSA in TBS containing 0.1 % v/v Tween 20) for 1 hour at room temperature, rinsed in TBS and incubated in primary antibody (anti-HSVgD mAb at 1 g/mL block, anti-ALV Gag Ab at 1 : 1000 dilution in block) overnight at 4°C.
- test or control samples 25 - 100 i of culture supernatant
- fresh milk block 5% w/v skim milk and 1% w/v BSA in TBS containing 0.1 % v/v Tween 20
- primary antibody anti-HSVgD mAb at 1 g/mL block, anti-ALV Gag Ab at 1 : 1000 dilution in block
- Plates were washed (3 x TBS+0.1%Tween 20 plus 3x TBS), incubated in appropriate secondary antibodies (HRP-conjugated anti-mouse or anti-goat antibodies diluted 1 :2000 in block) for 1 hour at room temperature, washed and o- phenylenediamine substrate in citrate buffer was added. Color development was stopped with 10% sulfuric acid and plates read at 490nm.
- appropriate secondary antibodies HRP-conjugated anti-mouse or anti-goat antibodies diluted 1 :2000 in block
- Blots were washed 3 x 15 min in Tris-NaCl-MgCl 2 pH 9.5 buffer and immersed in NBT-BCIP substrate for color development. The reaction was stopped in 2 mM Na 2 EDTA pH 8.0 buffer and blots dried between fresh 3MM filter paper sheets.
- UC pelleted material from the HSVgD plus alvGag-dPR transfections of HE 293 F cells were applied to nitrocellulose-coated, 300 mesh copper grids and negatively stained with 2% w/v uranyl acetate for analysis by electron microscopy. Particle images were captured as 8-bit data files with embedded scale bars, using the SIS Soft-Imaging Systems software interface. Results
- HSVgD protein was detected in supernatant samples from cells transfected with the p3.1 -HSVgD construct in a dose-dependent fashion. All transfectants receiving the p3.1 -alvGAG-dPR construct showed substantial levels of the ALV Gag protein in supernatant fluids. Despite coating microtiter wells directly with only 25 of a T75 transfectant supernatant volume, even the lowest alvGAG-dPR DNA level (1.5 ⁇ g/flask) in the 5.6: 1 gD:GAG ratio transfection produced strong signals with the polyclonal detection reagent. Because the HSVgD detection antibody is a monoclonal and the ALV Gag is a polyclonal antibody, direct comparison of expression levels was not performed.
- Figure 28 shows the Western blot results of two HEK 293 F transfection studies at the T75-flask size.
- Table 1 below lists the flask labels A - G, the micrograms of DNA added per T75 flask, and the resulting ratio of HSVgD and alvGAG-dPR constructs.
- UC pellet samples representing approximately 10% of the T75 harvest were loaded in duplicate gels, blotted, and probed with the anti-HSVgD and anti-p27 alvGAG antibody reagents. The data demonstrate DNA dose-dependent expression of the both the HSVgD and ALV Gag proteins in the mammalian host cells.
- HEK293F Transfection #314-85 samples A, B, and C
- Transfection #314-91 samples D, E, F, and G Constructs Micrograms DNA of HSVgD to alvGAG- pPR in transfections
- Figure 30 reveals polymorphic, heterogeneously-sized particles formed by HSVgD transfectants in Sample D. Particle sizes for some of the shapes were as follows: large triangular or folded particles were 150 - 200 nm (black line arrows); smaller oval to round particles were 90 - 120 nm (black dotted line arrows). The finding of self-budded HSVgD glycoprotein particles shows behavior similar to results obtained with RSV F alone expression yielding polymorphic self-budded VLPs.
- Figure 31 shows multiple photomicrographs from the Sample F transfection with HSVgD in combination with ALV Gag-dPR. Observation of particles showing a more-organized, rounded structure of even 30-50 nm (black arrows in top two micrographs containing the 1000 nm scale bar) was rare in Sample F. Most of the protein structures appeared disorganized and heterogeneous in sizes smaller than 30 nm. None of the material in Sample F was similar to VLPs observed in the ALV Gag alone or the HSVgD alone samples, despite viewing over 20 EM fields of view during sample screening.
- This example demonstrates that a vector encoding the Gag gene product of simian immunodeficiency virus (African green monkey) (SlVagm) substituted for HIV Gag for the formation of chimeric VLPs containing RSV F.
- SlVagm is also a member of the lentivirus family.
- Figure 32 shows a map of the plasmid p3.1 -SIVagmGag.
- the synthetic coding sequence for SlVagm Gag is as follows: atgggtgctgctacctccgctctgaaccgtcgtcagctggaccagttcgagaag atccgtctgcgtcccaacggcaagaagaagtaccagatcaagcacctgatctgg gctggcaaggaaatggaacgtttcggtctgcacgagcgtctgctggaaaccgag gaaggttgcaagcgtatcatcgaggtgctgtaccccctggaacccaccggttcc gagggcctgaagtcctgtactgcctgcacaag gaa
- amino acid sequence ofSIVagmGag encoded by p3.1-SIVagmGag is as follows: mgaatsalnrrqldqfekirlrpngkkkyqikhliwagkemerfglherllete egckriievlypleptgseglkslfnlvcvlyclhkeqkvkdteeavatvrqhc hlvekeksatetssgqkkndkgiaappggsqnfpaqqqgnawvhvplsprtlna wvkaveekkfgaeivpmfqalsegctpydinqmlnvlgdhqgalqivkeiinee aaqwdvthplpagplpagqlrdprgsdiagttssvqeqlewiytanprvdvgai yrrwiilglq
- the transfection medium (DMEM + 10% FBS) was replaced with CD293 medium. Seventy-two hours post-transfection the growth medium was collected, clarified of debris and centrifuged at 100,000 x g for 1 hour at 10°C through a 20% sucrose cushion to pellet VLPs. The VLP pellet was resuspended in TBS then layered onto a 20-60% sucrose step gradient and centrifuged at 100,000 x g for 1 hour at 10°C. Gradient fractions were analyzed by SDS-PAGE to identify Gag- containing fractions.
- Peak Gag-containing fractions were pooled, sucrose was diluted two-fold with TBS, and VLPs were concentrated by centrifugation once again at 100,000 x g for 1 hour at 10°C then resuspended in TBS for analysis by ELISA using the Synagis monoclonal antibody (Palivizumab).
- ELISA data are shown in Figure 33 in which the sucrose-banded VLPs elicited a signal similar to that of live RSV virus in their reactivity to the Synagis antibody. These data are similar to the example above employing the p3.1 -HIVGag expression vector demonstrating the SIVagm Gag can substitute for HIV Gag for the generation of F-containing chimeric VLPs.
- Example 13 Pseudotyped RSV F + AL V Gag VLP production via adenovirus vector transduction.
- the adenovirus shuttle vector pShuttle-CMV which is used to derive replication-defective adenovirus vectors, was modified by insertion of two copies of the tetracycline operator sequence into its CMV promoter. This strategy was designed to cause the inhibition of F expression when an F-containing adenovirus vector is propagated on an HEK293-based helper cell line expressing the tetracycline repressor.
- the modified shuttle vector was named pShuttle-CMV-TO and the functional map of this vector is shown in Figure 34 and the sequence of this vector is as follows: catcatcaataatataccttatttttggattgaagccaatatgataatgaggggg tggagtttgtgacgtggcgcggggcgtgggaacggggcgggtgggaacggggcgggtgggaacggggcgggtgacgtagtagtg tggcggaagtgtggcggaacacatgtaagcgacggatgtg gcaaaagtgacgtttttggtgtgcgccggtgtacacaggaagtgacaattttcg cgcggtgtacacaggaagtgacaattttcg cgcggttgtacacagga
- Gag plus F shuttle vector was derived from them.
- T-Rex 293 cells are HEK293 cells containing the Tet repressor gene.
- the El gene contained within all 293 cell lines allows for the replication of replication-defective adenovirus vectors and the Tet repressor in the T-Rex 293 line prevents F gene expression during virus propagation.
- this vector was used to transduce Vero cells for VLP production.
- Vero cells growing in T175 culture flasks in DMEM medium containing 10% fetal bovine serum were washed with serum-free VP-SFM medium then established in VP-SFM medium and then transduced with the Gag + F double adenovirus vector at a multiplicity of infection of 70: 1.
- the transduced Vero cells began to show cytopathic effects (CPE) consisting mainly of massive syncytia formation. By 72 hours extensive CPE were present with many large, floating syncytia observed.
- CPE cytopathic effects
- VLPs purified in this manner from several T175 flasks were diluted 2-fold in tris-buffered saline then subjected to 3 Joules of long wave UV radiation in the presence of 50 mcg/ml aminomethyl-trimethyl psoralen in order to inactivate any residual adenovirus vector not taken up into the Vero cells. Following residual vector inactivation, VLPs were rebanded on 30-60% sucrose step gradients as a final purification step.
- Figure 38(b) shows a silver-stained SDS-PAGE analysis of the final purified VLP preparation and Figure 39 shows an RSV-specific Western blot demonstrating the presence of the F l fragment (reducing conditions). Finally, an electron micrograph ( Figure 40) shows the presence of enveloped VLPs in the final preparation. The adenoviral expression produced at least a ten-fold higher yield than the previous examples, showing that the viral expression is superior.
- Example 14 Immunogenicity of Pseudotyped ALV Gag + RSV F VLPs
- This example further demonstrates the immunogenic and protective properties of RSV F-pseudotyped ALV Gag VLPs.
- VLPs were prepared as described in the previous example using the adenovirus expression system and were employed in a cotton rat vaccination and challenge model.
- a sample of Gag-only VLPs was also produced using an adenovirus vector containing only the ALV Gag gene. This latter batch of "naked" VLPs lacking the RSV F antigen was produced and purified in a manner similar to that for the F- pseudotyped Gag VLPs and they served as a negative control vaccine.
- VLP (3 ⁇ g F antigen, 30 ⁇ g total VLP protein per dose)
- VLP + MPL adjuvant (3 ⁇ g F antigen, 30 ⁇ g total VLP protein, 50 ⁇ g
- Gag-only VLP 60 ⁇ g total VLP protein per dose
- Vaccination groups 1 -3 received primary and booster vaccination on days 0 and 21 as described above. Group 4 animals only received a single live RSV vaccination of day 0 and were not boosted on day 21. Naive animals in group 5 received no vaccine administrations. [0309] Serum samples were collected 2 weeks following the booster immunization (day 35) to analyze RSV-specific neutralizing antibody responses in a standard virus microneutralization assay.
- Nasal-associated lymphoid tissue is a site of long- term virus-specific antibody production following respiratory virus infection of mice. J Virol 75:5416.
- Papillomavirus pseudovirus a novel vaccine to induce mucosal and systemic cytotoxic T-lymphocyte responses. J Virol 75: 10139.
- MPL monophosphoryl lipid A
- Influenza viruslike particles comprised of the HA, NA, and M l proteins of H9N2 influenza virus induce protective immune responses in BALB/c mice.
- Influenza virus matrix protein is the major driving force in virus budding. J Virol 74: 1 1538.
- Toll-like receptor 5 recognizes a conserved site on flagellin required for protofilament formation and bacterial motility. Nat Immunol 4: 1247.
- Influenza virus M2 integral membrane protein is a homotetramer stabilized by formation of disulfide bonds.
- Influenza virus M2 protein is an integral membrane protein expressed on the infected-cell surface. Cell 40:627.
- mice Protection of mice against influenza A virus challenge by vaccination with baculovirus- expressed M2 protein. Vaccine 13: 1399.
- Chimeric influenza virus hemagglutinin proteins containing large domains of the Bacillus anthracis protective antigen protein characterization, incorporation into infectious influenza viruses, and antigenicity. J Virol 79:10003.
- DNA vaccines a novel approach to immunization. Int J Immunopharmacol 17:79. 99. Fynan, E. F., R. G. Webster, D. H. Fuller, J. R. Haynes, J. C. Santoro, and H. L. Robinson. 1993. DNA vaccines: protective immunizations by parenteral, mucosal, and gene-gun inoculations. Proc Natl Acad Sci U S A 90:11478.
- Epidermal DNA vaccine for influenza is immunogenic in humans. Vaccine in press.
- VLP Virus-like particle
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Virology (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Pulmonology (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Gastroenterology & Hepatology (AREA)
- Microbiology (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Priority Applications (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US13/505,250 US8920812B2 (en) | 2009-11-03 | 2010-11-03 | Chimeric RSV-F polypeptide and lentivirus or alpha-retrovirus Gag-based VLPS |
| JP2012537218A JP5917402B2 (ja) | 2009-11-03 | 2010-11-03 | キメラRSV−Fポリペプチド、およびレンチウイルスGagまたはアルファレトロウイルスGagに基づくVLP |
| EP10829045.3A EP2496609A4 (en) | 2009-11-03 | 2010-11-03 | CHIMERIC RSV-F POLYPEPTIDE AND VLPS ON LENTIVIREN OR ALPHA RETROVIRUS GAG BASE |
| CN2010800499077A CN102753582A (zh) | 2009-11-03 | 2010-11-03 | 嵌合RSV-F多肽、和慢病毒或α-反转录病毒GAG基VLP |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US25776609P | 2009-11-03 | 2009-11-03 | |
| US61/257,766 | 2009-11-03 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2011056899A2 true WO2011056899A2 (en) | 2011-05-12 |
| WO2011056899A3 WO2011056899A3 (en) | 2011-09-29 |
Family
ID=43970730
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2010/055334 Ceased WO2011056899A2 (en) | 2009-11-03 | 2010-11-03 | Chimeric rsv-f polypeptide and lentivirus or alpha-retrovirus gag-based vlps |
Country Status (5)
| Country | Link |
|---|---|
| US (1) | US8920812B2 (enExample) |
| EP (1) | EP2496609A4 (enExample) |
| JP (1) | JP5917402B2 (enExample) |
| CN (1) | CN102753582A (enExample) |
| WO (1) | WO2011056899A2 (enExample) |
Cited By (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2636413A1 (en) * | 2012-03-09 | 2013-09-11 | Ecole Normale Superieure De Lyon | Chimeric virus-like particles (VLP) containing functional hMPV proteins |
| WO2015066715A1 (en) * | 2013-11-04 | 2015-05-07 | Viracell Advanced Products, Llc | Virus-like particles and methods related thereto |
| JP2015527296A (ja) * | 2012-03-26 | 2015-09-17 | アメリカ合衆国 | 哺乳動物細胞へのパッケージングされたrnaの新規の送達 |
| CN105431169A (zh) * | 2012-03-22 | 2016-03-23 | 克鲁塞尔荷兰公司 | 抗rsv疫苗 |
| US10016496B2 (en) | 2013-02-01 | 2018-07-10 | Medimmune, Llc | Respiratory syncytial virus F protein epitopes |
| WO2019183228A1 (en) * | 2018-03-21 | 2019-09-26 | The University Of North Carolina At Chapel Hill | Compositions and methods for inhibiting pathogen infection |
| US10577397B2 (en) | 2008-10-03 | 2020-03-03 | The Usa, As Represented By The Secretary, Dept. Of Health And Human Services | Methods and compositions for protein delivery |
| US11718861B2 (en) | 2013-12-16 | 2023-08-08 | The Usa, As Represented By The Secretary, Dept. Of Health And Human Services | Cancer immunotherapy by delivering class II MHC antigens using a VLP-replicon |
Families Citing this family (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN104450631A (zh) * | 2014-11-11 | 2015-03-25 | 中国人民解放军第四军医大学 | 肠道病毒ev71型vp1基因病毒样颗粒及其制备方法和应用 |
| AU2017298576B2 (en) | 2016-07-18 | 2023-04-13 | Variation Biotechnologies Inc. | Vaccine compositions for treatment of Zika virus |
| LT3606942T (lt) | 2017-04-04 | 2025-10-10 | Savaiminės sąrankos baltymų nanostruktūros, eksponuojančios paramiksoviruso ir (arba) pneumoviruso f baltymus ir jų naudojimas | |
| JP7277466B2 (ja) | 2017-09-01 | 2023-05-19 | インプラザー エー・ペー・エス | 疾患の予防および/または治療における使用のためのワクチン |
| AU2019228551B2 (en) * | 2018-02-28 | 2025-07-24 | University Of Washington | Self-assembling nanostructure vaccines |
| WO2020092365A1 (en) | 2018-10-29 | 2020-05-07 | Binh Ha | Rsv virus-like particles and methods of use thereof |
| KR20230008707A (ko) | 2020-03-30 | 2023-01-16 | 배리에이션 바이오테크놀로지스 아이엔씨. | 코로나바이러스 치료용 백신 조성물 |
| EP4351660A2 (en) | 2021-06-09 | 2024-04-17 | Scribe Therapeutics Inc. | Particle delivery systems |
| WO2024254544A2 (en) * | 2023-06-07 | 2024-12-12 | Nvelop Therapeutics, Inc. | Compositions and methods for promoting payload delivery in cells |
| CN117777314B (zh) * | 2024-02-26 | 2024-05-14 | 赛德特生物制药有限公司 | 慢病毒载体及其应用 |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1999052549A1 (en) | 1998-04-09 | 1999-10-21 | Smithkline Beecham Biologicals S.A. | Adjuvant compositions |
Family Cites Families (22)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DK0941315T3 (da) | 1996-11-26 | 2006-05-15 | Stressgen Biotechnologies Corp | Fusionsproteiner indeholdende stressproteiner til induktion af immunreaktioner |
| US6099847A (en) | 1997-05-15 | 2000-08-08 | The United States Of America As Represented By The Department Of Health And Human Services | Chimeric Gag pseudovirions |
| GB9727262D0 (en) | 1997-12-24 | 1998-02-25 | Smithkline Beecham Biolog | Vaccine |
| EP1294892B1 (en) | 2000-06-23 | 2007-10-17 | Wyeth Holdings Corporation | Assembly of wild-type and chimeric influenza virus-like particles (vlps) |
| EP1294858B1 (en) | 2000-06-23 | 2008-12-03 | THE GOVERNMENT OF THE UNITED STATES OF AMERICA, represented by THE DEPARTMENT OF HEALTH & HUMAN SERVICES | Respiratory syncytial virus vaccines expressing protective antigens from promotor-proximal genes |
| EP1201750A1 (en) | 2000-10-26 | 2002-05-02 | Genopoietic | Synthetic viruses and uses thereof |
| US6818216B2 (en) | 2000-11-28 | 2004-11-16 | Medimmune, Inc. | Anti-RSV antibodies |
| US20030049607A1 (en) | 2001-03-12 | 2003-03-13 | Tsvika Greener | Compositions and methods for the modulation of viral maturation |
| JP4302513B2 (ja) | 2001-07-05 | 2009-07-29 | ノバルティス バクシンズ アンド ダイアグノスティックス,インコーポレーテッド | 抗原性b型hivポリペプチドおよび/または抗原性c型hivポリペプチドをコードするポリヌクレオチド、それらのポリペプチドおよびそれらの使用 |
| DK1506223T3 (da) | 2002-05-16 | 2006-04-10 | Bavarian Nordic As | Fusionsprotein af regulatoriske/accessoriske HIV-proteiner |
| US9045727B2 (en) | 2002-05-17 | 2015-06-02 | Emory University | Virus-like particles, methods of preparation, and immunogenic compositions |
| WO2004042001A2 (en) | 2002-05-17 | 2004-05-21 | Emory University | Virus-like particles, methods of preparation, and immonogenic compositions |
| ATE489969T1 (de) | 2002-06-20 | 2010-12-15 | Cytos Biotechnology Ag | Verpackte virusartige partikel in kombination mit cpg zur verwendung als adjuvantien mit allergenen. herstellungsverfahren und verwendung |
| GB0226722D0 (en) | 2002-11-15 | 2002-12-24 | Glaxo Group Ltd | Vaccine |
| US8592197B2 (en) | 2003-07-11 | 2013-11-26 | Novavax, Inc. | Functional influenza virus-like particles (VLPs) |
| US8574590B2 (en) | 2003-07-30 | 2013-11-05 | Integral Molecular, Inc. | Lipoparticles comprising proteins, methods of making, and using the same |
| US8437251B2 (en) | 2005-12-22 | 2013-05-07 | Qualcomm Incorporated | Methods and apparatus for communicating transmission backlog information |
| WO2008094197A2 (en) | 2006-07-27 | 2008-08-07 | Ligocyte Pharmaceuticals, Inc. | Chimeric influenza virus-like particles |
| WO2008094200A2 (en) * | 2006-07-27 | 2008-08-07 | Ligocyte Pharmaceuticals, Inc | Chimeric virus-like particles |
| US20080233150A1 (en) * | 2006-11-16 | 2008-09-25 | Gale Smith | Respiratory syncytial virus-virus like particle (vlps) |
| DE102006060799A1 (de) * | 2006-12-21 | 2008-06-26 | RUHR-UNIVERSITäT BOCHUM | RSV F-Protein und seine Verwendung |
| US20100247574A1 (en) * | 2007-02-21 | 2010-09-30 | Kutub Mahmood | CHIMERIC NEWCASTLE DISEASE VIRUS VLPs |
-
2010
- 2010-11-03 WO PCT/US2010/055334 patent/WO2011056899A2/en not_active Ceased
- 2010-11-03 JP JP2012537218A patent/JP5917402B2/ja not_active Expired - Fee Related
- 2010-11-03 EP EP10829045.3A patent/EP2496609A4/en not_active Withdrawn
- 2010-11-03 US US13/505,250 patent/US8920812B2/en not_active Expired - Fee Related
- 2010-11-03 CN CN2010800499077A patent/CN102753582A/zh active Pending
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1999052549A1 (en) | 1998-04-09 | 1999-10-21 | Smithkline Beecham Biologicals S.A. | Adjuvant compositions |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP2496609A4 |
Cited By (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10577397B2 (en) | 2008-10-03 | 2020-03-03 | The Usa, As Represented By The Secretary, Dept. Of Health And Human Services | Methods and compositions for protein delivery |
| WO2013132107A1 (en) * | 2012-03-09 | 2013-09-12 | Ecole Normale Superieure De Lyon | Chimeric virus -like particles (vlp) containing functional hmpv proteins |
| EP2636413A1 (en) * | 2012-03-09 | 2013-09-11 | Ecole Normale Superieure De Lyon | Chimeric virus-like particles (VLP) containing functional hMPV proteins |
| CN105431169B (zh) * | 2012-03-22 | 2019-04-02 | 扬森疫苗与预防公司 | 抗rsv疫苗 |
| CN105431169A (zh) * | 2012-03-22 | 2016-03-23 | 克鲁塞尔荷兰公司 | 抗rsv疫苗 |
| JP2015527296A (ja) * | 2012-03-26 | 2015-09-17 | アメリカ合衆国 | 哺乳動物細胞へのパッケージングされたrnaの新規の送達 |
| US10538743B2 (en) | 2012-03-26 | 2020-01-21 | The Usa, As Represented By The Secretary, Dept. Of Health And Human Services | Delivery of packaged RNA to mammalian cells |
| US10016496B2 (en) | 2013-02-01 | 2018-07-10 | Medimmune, Llc | Respiratory syncytial virus F protein epitopes |
| EP2950886B1 (en) * | 2013-02-01 | 2019-12-18 | Medlmmune, LLC | Respiratory syncytial virus f protein epitopes |
| WO2015066715A1 (en) * | 2013-11-04 | 2015-05-07 | Viracell Advanced Products, Llc | Virus-like particles and methods related thereto |
| US11718861B2 (en) | 2013-12-16 | 2023-08-08 | The Usa, As Represented By The Secretary, Dept. Of Health And Human Services | Cancer immunotherapy by delivering class II MHC antigens using a VLP-replicon |
| US12049639B2 (en) | 2013-12-16 | 2024-07-30 | The Usa, As Represented By The Secretary, Dept. Of Health And Human Services | Cancer immunotherapy by delivering class II MHC antigens using a VLP-replicon |
| WO2019183228A1 (en) * | 2018-03-21 | 2019-09-26 | The University Of North Carolina At Chapel Hill | Compositions and methods for inhibiting pathogen infection |
| US12115219B2 (en) | 2018-03-21 | 2024-10-15 | The University Of North Carolina At Chapel Hill | Compositions and methods for inhibiting pathogen infection |
Also Published As
| Publication number | Publication date |
|---|---|
| EP2496609A4 (en) | 2013-05-08 |
| US20120213817A1 (en) | 2012-08-23 |
| EP2496609A2 (en) | 2012-09-12 |
| WO2011056899A3 (en) | 2011-09-29 |
| US8920812B2 (en) | 2014-12-30 |
| JP2013510091A (ja) | 2013-03-21 |
| CN102753582A (zh) | 2012-10-24 |
| JP5917402B2 (ja) | 2016-05-11 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US8920812B2 (en) | Chimeric RSV-F polypeptide and lentivirus or alpha-retrovirus Gag-based VLPS | |
| AU2009316680B2 (en) | RSV F VLPs and methods of manufacture and use thereof | |
| AU2009319979B2 (en) | Improved methods for isolating enveloped virus-based VLPs free of infectious agents | |
| AU2007345682B2 (en) | Chimeric virus-like particles | |
| CA2659275C (en) | Chimeric influenza virus-like particles | |
| JP6643239B2 (ja) | 免疫原性の中東呼吸器症候群コロナウイルス(MERS−CoV)組成物および方法 | |
| US20140186396A1 (en) | Methods for stabilizing influenza antigen enveloped virus-based virus-like particle solutions | |
| US20140227309A1 (en) | Combination vaccine for respiratory syncytial virus and influenza | |
| AU2013201495A1 (en) | Recombinant nanoparticle RSV F vaccine for respiratory syncytial virus |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 201080049907.7 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 10829045 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2012537218 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 13505250 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2010829045 Country of ref document: EP |