WO2011006915A2 - Improved anti-serum albumin binding single variable domains - Google Patents
Improved anti-serum albumin binding single variable domains Download PDFInfo
- Publication number
- WO2011006915A2 WO2011006915A2 PCT/EP2010/060112 EP2010060112W WO2011006915A2 WO 2011006915 A2 WO2011006915 A2 WO 2011006915A2 EP 2010060112 W EP2010060112 W EP 2010060112W WO 2011006915 A2 WO2011006915 A2 WO 2011006915A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- variable domain
- seq
- dom7r
- optionally
- sec
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/31—Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin
Definitions
- the invention relates to improved anti-serum albumin immunoglobulin single variable domains, as well as ligands and drug conjugates comprising such domains, compositions, nucleic acids, vectors and hosts.
- SA anti-serum albumin
- dAbs anti-SA immunoglobulin single variable domains
- dAbs anti-serum albumin binding moieties
- monomer anti-SA dAbs as well as multi-specific ligands comprising such dAbs, eg, ligands comprising an anti-SA dAb and a dAb that specifically binds a target antigen, such as TNFRl .
- Binding moieties are disclosed that specifically bind serum albumins from more than one species, eg human/mouse cross-reactive anti-SA dAbs.
- WO05118642 and WO2006/059106 disclose the concept of conjugating or associating an anti-SA binding moiety, such as an anti-SA immunoglobulin single variable domain, to a drug, in order to increase the half- life of the drug.
- Protein, peptide and NCE (chemical entity) drugs are disclosed and exemplified.
- WO2006/059106 discloses the use of this concept to increase the half-life of insulintropic agents, eg, incretin hormones such as glucagon-like peptide (GLP)-I .
- GLP glucagon-like peptide
- dAbs that specifically bind serum albumin, preferably albumins from human and non-human species, which would provide utility in animal models of disease as well as for human " 1 J Or diagnosis. It would also be desirable to provide for the choice between relatively modest- and high-affinity anti-SA binding moieties (dAbs). Such moieties could be linked to drugs, the anti-SA binding moiety being chosen according to the contemplated end-application. This would allow the drug to be better tailored to treating and/or preventing chronic or acute indications, depending upon the choice of anti-SA binding moiety. It would also be desirable to provide anti-SA dAbs that are monomeric or substantially so in solution.
- the anti-SA dAb is linked to a binding moiety, eg, a dAb, that specifically binds a cell-surface receptor, such as TNFRl, with the aim of antagonizing the receptor.
- a binding moiety eg, a dAb
- the monomeric state of the anti-SA dAb is useful in reducing the chance of receptor cross- linking, since multimers are less likely to form which could bind and cross-link receptors (eg, TNFRl) on the cell surface, thus increasing the likelihood of receptor agonism and detrimental receptor signaling.
- an anti-serum albumin (SA) immunoglobulin single variable domain comprising an amino acid sequence that is at least 80% identical to an amino acid sequence selected from SEQ ID NOs: 97 to 191 and 198 to 203.
- An aspect of the invention provides an anti-serum albumin (SA)
- immunoglobulin single variable domain comprising an amino acid sequence having up to 4 amino acid changes compared to an amino acid sequence selected from SEQ ID NOs: 97 to 191 and 198 to 203.
- An aspect of the invention provides an anti-serum albumin (SA)
- immunoglobulin single variable domain comprising an amino acid sequence that is encoded by a nucleotide sequence which is at least 80% identical to a sequence selected from SEQ ID NOs 1 to 96 and 192-197.
- An aspect of the invention provides a multispecific ligand comprising an anti- SA variable domain of the invention and a binding moiety that specifically binds a target antigen other than SA.
- An aspect of the invention provides an anti-SA single variable domain of the invention, wherein the variable domain is conjugated to a drug (optionally an NCE drug).
- an aspect of the invention provides a fusion product, eg, a fusion protein or fusion with a peptide or NCE (new chemical entity) drug, comprising a polypeptide, protein, peptide or NCE drug fused or conjugated (for an NCE) to any anti-SA variable domain of the invention.
- the variable domain comprises or consists of the amino acid sequence of any one of SEQ ID NOs: 97 to 103 and 198 to 203 (or an amino acid sequence that is at least 95, 96, 97, 98 or 99% identical to the amino acid sequence of any one of SEQ ID NOs: 97 to 103 and 198 to 203).
- An aspect of the invention provides a composition comprising a variable domain, fusion protein or ligand of the invention and a pharmaceutically acceptable diluent, carrier, excipient or vehicle.
- An aspect of the invention provides a nucleic acid comprising a nucleotide sequence encoding a variable domain, or a multispecific ligand or fusion protein of the invention.
- An aspect of the invention provides a nucleic acid comprising a nucleotide sequence that is at least 80% identical to a sequence selected from SEQ ID NOs 1 to 96 and 192-197.
- An aspect of the invention provides a vector comprising the nucleic acid of the invention.
- An aspect of the invention provides an isolated host cell comprising the vector of the invention. - A -
- An aspect of the invention provides a method of treating or preventing a disease or disorder in a patient, comprising administering at least one dose of a variable domain, or a multispecific ligand or fusion protein of the invention to said patient.
- Embodiments of any aspect of the invention provide anti-serum albumin single variable domains of good anti-serum albumin affinities.
- the choice of variable domain can allow for tailoring of half- life according to the desired therapeutic and/or prophylactic setting.
- the affinity of the variable domain for serum albumin is relatively high, such that the variable domain would be useful for inclusion in products that find utility in treating and/or preventing chronic or persistent diseases, conditions, toxicity or other chronic indications.
- the affinity of the variable domain for serum albumin is relatively modest, such that the variable domain would be useful for inclusion in products that find utility in treating and/or preventing acute diseases, conditions, toxicity or other acute indications.
- the affinity of the variable domain for serum albumin is intermediate, such that the variable domain would be useful for inclusion in products that find utility in treating and/or preventing acute or chronic diseases, conditions, toxicity or other acute or chronic indications.
- variable domain with moderate affinity, (but specificity to SA) would only stay in serum circulation for a short time (eg, for a few hours or a few days) allowing for the specific targeting of therapeutic targets involved in acute diseases by the fused therapeutic agent.
- TNFRl "anti-TNFRl antagonist” or the like refers to an agent (e.g., a molecule, a compound) which binds TNFRl and can inhibit a (i.e., one or more) function of TNFRl.
- an antagonist of TNFRl can inhibit the binding of TNF ⁇ to TNFRl and/or inhibit signal transduction mediated through TNFRl.
- TNFRl -mediated processes and cellular responses e.g., TNF ⁇ -induced cell death in a standard L929 cytotoxicity assay
- TNF ⁇ -induced cell death in a standard L929 cytotoxicity assay can be inhibited with an antagonist of TNFRl .
- a “patient” is any animal, eg, a mammal, eg, a non-human primate (such as a baboon, rhesus monkey or Cynomolgus monkey), mouse, human, rabbit, rat, dog, cat or pig. In one embodiment, the patient is a human.
- a mammal eg, a non-human primate (such as a baboon, rhesus monkey or Cynomolgus monkey), mouse, human, rabbit, rat, dog, cat or pig.
- the patient is a human.
- peptide refers to about two to about 50 amino acids that are joined together via peptide bonds.
- polypeptide refers to at least about 50 amino acids that are joined together by peptide bonds. Polypeptides generally comprise tertiary structure and fold into functional domains.
- an antibody refers to IgG, IgM, IgA, IgD or IgE or a fragment (such as a Fab , F(ab')2, Fv, disulphide linked Fv, scFv, closed conformation multispecific antibody, disulphide-linked scFv, diabody) whether derived from any species naturally producing an antibody, or created by recombinant DNA technology; whether isolated from serum, B-cells, hybridomas, transfectomas, yeast or bacteria.
- a fragment such as a Fab , F(ab')2, Fv, disulphide linked Fv, scFv, closed conformation multispecific antibody, disulphide-linked scFv, diabody
- antibody format refers to any suitable polypeptide structure in which one or more antibody variable domains can be incorporated so as to confer binding specificity for antigen on the structure.
- suitable antibody formats are known in the art, such as, chimeric antibodies, humanized antibodies, human antibodies, single chain antibodies, bispecific antibodies, antibody heavy chains, antibody light chains, homodimers and heterodimers of antibody heavy chains and/or light chains, antigen-binding fragments of any of the foregoing (e.g., a Fv fragment
- scFv single chain Fv
- a disulfide bonded Fv a Fab fragment
- a Fab' fragment a F(ab') 2 fragment
- a single antibody variable domain e.g., a dAb, VH, VHH, VL
- modified versions of any of the foregoing e.g., modified by the covalent attachment of polyethylene glycol or other suitable polymer or a humanized V HH ).
- immunoglobulin single variable domain refers to an antibody variable domain (V H , V HH , V L ) that specifically binds an antigen or epitope
- An immunoglobulin single variable domain can be present in a format (e.g., homo- or hetero-multimer) with other variable regions or variable domains where the other regions or domains are not required for antigen binding by the single immunoglobulin variable domain (i.e., where the immunoglobulin single variable domain binds antigen independently of the additional variable domains).
- a “domain antibody” or “dAb” is the same as an "immunoglobulin single variable domain” as the term is used herein.
- a “single immunoglobulin variable domain” is the same as an "immunoglobulin single variable domain" as the term is used herein.
- a “single antibody variable domain” or an “antibody single variable domain” is the same as an "immunoglobulin single variable domain” as the term is used herein.
- An immunoglobulin single variable domain is in one embodiment a human antibody variable domain, but also includes single antibody variable domains from other species such as rodent (for example, as disclosed in WO 00/29004, the contents of which are incorporated herein by reference in their entirety), nurse shark and Camelid V HH dAbs.
- Camelid V HH are immunoglobulin single variable domain polypeptides that are derived from species including camel, llama, alpaca, dromedary, and guanaco, which produce heavy chain antibodies naturally devoid of light chains.
- the V HH may be humanized.
- a “domain” is a folded protein structure which has tertiary structure
- a "single antibody variable domain” is a folded polypeptide domain comprising sequences characteristic of antibody variable domains. It therefore includes complete antibody variable domains and modified variable domains, for example, in which one or more loops have been replaced by sequences which are not characteristic of antibody variable domains, or antibody variable domains which have been truncated or comprise N- or C-terminal extensions, as well as folded fragments of variable domains which retain at least the binding activity and specificity of the full- length domain.
- prevention and “preventing” involves administration of the protective composition prior to the induction of the disease or condition.
- Treatment and “treating” involves administration of the protective composition after disease or condition symptoms become manifest.
- Sylation or “suppressing” refers to administration of the composition after an inductive event, but prior to the clinical appearance of the disease or condition.
- dose refers to the quantity of ligand administered to a subject all at one time (unit dose), or in two or more administrations over a defined time interval.
- dose can refer to the quantity of ligand (e.g., ligand comprising an immunoglobulin single variable domain that binds target antigen) administered to a subject over the course of one day (24 hours) (daily dose), two days, one week, two weeks, three weeks or one or more months (e.g., by a single administration, or by two or more administrations).
- the interval between doses can be any desired amount of time.
- pharmaceutically effective when referring to a dose means sufficient amount of the ligand, domain or pharmaceutically active agent to provide the desired effect.
- the amount that is “effective” will vary from subject to subject, depending on the age and general condition of the individual, the particular drug or pharmaceutically active agent and the like. Thus, it is not always possible to specify an exact “effective” amount applicable for all patients. However, an appropriate “effective” dose in any individual case may be determined by one of ordinary skill in the art using routine experimentation.
- all pharmacokinetic parameters and values quoted herein are to be read as being values in a mouse or rat or Cynomolgus monkey.
- HaIf lives tYi alpha and tVi beta
- AUC can be determined from a curve of serum concentration of ligand against time.
- the WinNonlin analysis package eg version 5.1 (available from Pharsight Corp., Mountain View, CA94040, USA) can be used, for example, to model the curve.
- a first phase the alpha phase
- the ligand is undergoing mainly distribution in the patient, with some elimination.
- a second phase is the phase when the ligand has been distributed and the serum concentration is decreasing as the ligand is cleared from the patient.
- the t alpha half life is the half life of the first phase and the t beta half life is the half life of the second phase.
- the variable domain, fusion protein or ligand has a t ⁇ half-life in the range of (or of about) 15 minutes or more.
- the lower end of the range is (or is about) 30 minutes, 45 minutes, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 10 hours, 11 hours or 12 hours.
- the variable domain, fusion protein or ligand according to the invention will have a t ⁇ half life in the range of up to and including 12 hours (or about 12 hours). In one
- the upper end of the range is (or is about) 11, 10, 9, 8, 7, 6 or 5 hours.
- An example of a suitable range is (or is about) 1 to 6 hours, 2 to 5 hours or 3 to 4 hours.
- the present invention provides the variable domain, fusion protein or ligand according to the invention has a t ⁇ half-life in the range of (or of about) 2.5 hours or more.
- the lower end of the range is (or is about) 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 10 hours , 11 hours, or 12 hours.
- the t ⁇ half-life is (or is about) up to and including 21 or 25 days.
- the upper end of the range is (or is about)12 hours, 24 hours, 2 days, 3 days, 5 days, 10 days, 15 days, 19 days 20 days, 21 days or 22 days.
- variable domain, fusion protein or ligand according to the invention will have a t ⁇ half life in the range 12 to 60 hours (or about 12 to 60 hours). In a further embodiment, it will be in the range 12 to 48 hours (or about 12 to 48 hours). In a further embodiment still, it will be in the range 12 to 26 hours (or about 12 to 26 hours).
- terminal half-life as used herein means a terminal half-life determined using non-compartmental modeling).
- the single variable domain, fusion protein or ligand has a terminal half life of at least (or at least about) 8 hours, 10 hours, 12 hours, 15 hours, 28 hours, 20 hours, 1 day, 2 days, 3 days, 7 days, 14 days, 15 days, 16 days, 17 days, 18 days, 19 days, 20 days, 21 days, 22 days, 23 days, 24 days or 25 days.
- the upper end of this range is (or is about) 24 hours, 48 hours, 60 hours or 72 hours or 120 hours.
- the terminal half-life is (or is about) from 8 hours to 60 hours, or 8 hours to 48 hours or 12 to 120 hours, eg, in man.
- variable domain, fusion protein or ligand according to the invention has an AUC value (area under the curve) in the range of (or of about) 1 mg.min/ml or more.
- the lower end of the range is (or is about) 5, 10, 15, 20, 30, 100, 200 or 300 mg.min/ml.
- variable domain, fusion protein or ligand according to the invention has an AUC in the range of (or of about) up to 600 mg.min/ml.
- the upper end of the range is (or is about) 500, 400, 300, 200, 150, 100, 75 or 50 mg.min/ml.
- variable domain, fusion protein or ligand will have an AUC in (or about in) the range selected from the group consisting of the following: 15 to 150 mg.min/ml, 15 to 100 mg.min/ml, 15 to 75 mg.min/ml, and 15 to 50mg.min/ml.
- “Surface Plasmon Resonance” Competition assays can be used to determine if a specific antigen or epitope, such as human serum albumin, competes with another antigen or epitope, such as cynomolgus serum albumin, for binding to a serum albumin binding ligand described herein, such as a specific dAb. Similarly competition assays can be used to determine if a first ligand such as dAb, competes with a second ligand such as a dAb for binding to a target antigen or epitope.
- a specific antigen or epitope such as human serum albumin
- another antigen or epitope such as cynomolgus serum albumin
- competition assays can be used to determine if a first ligand such as dAb, competes with a second ligand such as a dAb for binding to a target antigen or epitope.
- the term "competes" as used herein refers to substance, such as a molecule, compound, preferably a protein, which is able to interfere to any extent with the specific binding interaction between two or more molecules.
- the phrase “does not competitively inhibit” means that substance, such as a molecule, compound, preferably a protein, does not interfere to any measurable or significant extent with the specific binding interaction between two or more molecules.
- the specific binding interaction between two or more molecules preferably includes the specific binding interaction between a single variable domain and its cognate partner or target.
- the interfering or competing molecule can be another single variable domain or it can be a molecule that that is structurally and/or functionally similar to a cognate partner or target.
- binding moiety refers to a domain that specifically binds an antigen or epitope independently of a different epitope or antigen binding domain.
- a binding moiety may be a domain antibody (dAb) or may be a domain which is a derivative of a non-immunoglobulin protein scaffold, eg, a scaffold selected from the group consisting of CTLA-4, lipocalin, SpA, an adnectin, affibody, an avimer, GroEl, transferrin, GroES and fibronectin, which binds to a ligand other than the natural ligand (in the case of the present invention, the moiety binds serum albumin).
- WO2008/096158 discloses examples of protein scaffolds and methods for selecting antigen or epitope- specif ⁇ c binding domains from repertoires (see Examples 17 to 25). These specific disclosures of WO2008/096158 are expressly incorporated herein by reference as though explicitly written herein and for use with the present invention, and it is contemplated that any part of such disclosure can be incorporated into one or more claims herein).
- variable domain of the invention comprises one or more of the following kinetic characteristics :-
- variable domain comprises a binding site that specifically binds human SA with a dissociation constant (KD) from (or from about) 0.1 to (or to about) 10000 nM, optionally from (or from about) 1 to (or to about) 6000 nM, as determined by surface plasmon resonance;
- the variable domain comprises a binding site that specifically binds human SA with an off-rate constant (K d ) from (or from about) 1.5 x 10 ⁇ 4 to (or to about) 0.1 sec "1 , optionally from (or from about) 3 x 10 ⁇ 4 to (or to about) 0.1 sec "1 as determined by surface plasmon resonance;
- the variable domain comprises a binding site that specifically binds human SA with an on-rate constant (K a ) from (or from about)2 x 10 6 to (or to about) 1 x 10 4 M -1 SeC "1 , optionally from (or from about) 1 x 10 6 to (or to about) 2 x 10 4
- variable domain comprises a binding site that specifically binds
- KD dissociation constant
- variable domain of any preceding claim wherein the variable domain
- a binding site that specifically binds Cynomolgus monkey SA with an off-rate constant (Kd) from (or from about) 1.5 x 10 "4 to (or to about) 0.1 sec “1 , optionally from (or from about) 3 x 10 " to (or to about) 0.1 sec " as determined by surface plasmon resonance;
- Kd off-rate constant
- variable domain of any preceding claim wherein the variable domain
- a binding site that specifically binds Cynomolgus monkey SA with an on-rate constant (K a ) from (or from about) 2 x 10 6 to (or to about) 1 x 10 4 M " 1 SeC "1 , optionally from (or from about) 1 x 10 6 to (or to about) 5 x 10 3 M -1 SeC "1 as determined by surface plasmon resonance;
- variable domain comprises a binding site that specifically binds rat SA with a dissociation constant (KD) from (or from about) 1 to (or to about) 10000 nM, optionally from (or from about) 20 to (or to about) 6000 nM, as determined by surface plasmon resonance;
- the variable domain comprises a binding site that specifically binds rat SA with an off-rate constant (K d ) from (or from about) 2 x 10 ⁇ 3 to (or to about) 0.15 sec "1 , optionally from (or from about) 9 x 10 ⁇ 3 to (or to about) 0.14 sec "1 as determined by surface plasmon resonance;
- the variable domain comprises a binding site that specifically binds rat SA with an on-rate constant (K a ) from (or from about) 2 x 10 6 to (or to about) 1 x 10 4 M " 1 SeC "1 , optionally from (or from about) 1 x 10 6 to (or to about) 3 x
- variable domain comprises a binding site that specifically binds mouse SA with a dissociation constant (KD) from (or from about) 1 to (or to about) 10000 nM as determined by surface plasmon resonance;
- KD dissociation constant
- the variable domain comprises a binding site that specifically binds mouse SA with an off-rate constant (K d ) from (or from about) 2 x 10 "3 to (or to about) 0.15 sec " as determined by surface plasmon resonance; and/or (1)
- the variable domain comprises a binding site that specifically binds mouse SA with an on-rate constant (K 3 ) from (or from about) 2 x 10 6 to (or to about) 1 x 10 4 M -1 SeC "1 , optionally from (or from about) 2 x 10 6 to (or to about) 1.5 x 10 4 M -1 SeC "1 as determined by surface plasmon resonance.
- variable domain has I: a KD according to (a) and (d), a K d according to (b) and (e), and a K 3 according to (c) and (f); or
- III a KD according to (a) and (j), a K d according to (b) and (k), and a K a according to (c) and (1); or IV: kinetics according to I and II; or V: kinetics according to I and III; or VI: kinetics according to I, II and III.
- the invention also provides a ligand comprising a variable domain of any preceding aspect or embodiment of the invention.
- the ligand can be a dual-specific ligand (see WO04003019 for examples of dual-specific ligands).
- the invention provides a multispecific ligand comprising an anti-SA variable domain of any preceding aspect or embodiment of the invention and a binding moiety that specifically binds a target antigen other than SA.
- the binding moiety can be any binding moiety that specifically binds a target, eg, the moiety is an antibody, antibody fragment, scFv, Fab, dAb or a binding moiety comprising a non-immunoglobulin protein scaffold.
- non-immunoglobulin scaffolds are CTLA-4, lipocallin, staphylococcal protein A (spA), AffibodyTM, AvimersTM, adnectins, GroEL and fibronectin.
- a linker is provided between the anti-target binding moiety and the anti-SA variable domain, the linker comprising the amino acid sequence AST, optionally ASTSGPS.
- Alternative linkers are described in WO2007085814
- the target antigen may be, or be part of, polypeptides, proteins or nucleic acids, which may be naturally occurring or synthetic.
- the ligand of the invention may bind the target antigen and act as an antagonist or agonist (e.g., EPO receptor agonist).
- EPO receptor agonist e.g., EPO receptor agonist
- One skilled in the art will appreciate that the choice is large and varied. They may be for instance, human or animal proteins, cytokines, cytokine receptors, where cytokine receptors include receptors for cytokines, enzymes, co-factors for enzymes or DNA binding proteins.
- Suitable cytokines and growth factors include, but are preferably not limited to: ApoE, Apo-SAA, BDNF, Cardiotrophin-1, EGF, EGF receptor, ENA-78, Eotaxin, Eotaxin-2, Exodus-2, EpoR, FGF-acidic, FGF-basic, fibroblast growth factor- 10, FLT3 ligand, Fractalkine (CX3C), GDNF, G-CSF, GM-CSF, GF- ⁇ l, insulin, IFN- ⁇ , IGF-I, IGF-II, IL-I ⁇ , IL-l ⁇ , IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8 (72 a.a.), IL-8 (77 a.a.), IL-9, IL- 10, IL-I l, IL-12, IL-13, IL-15, IL-16, IL-17, IL-18 (IGIF), Inhibin ⁇ , Inhibi
- pylori TB, influenza, Hepatitis E, MMP-12, internalizing receptors that are over-expressed on certain cells, such as the epidermal growth factor receptor (EGFR), ErBb2 receptor on tumor cells, an internalising cellular receptor, LDL receptor, FGF2 receptor, ErbB2 receptor, transferrin receptor, PDGF receptor, VEGF receptor, PsmAr, an extracellular matrix protein, elastin, fibronectin, laminin, ⁇ l- antitrypsin, tissue factor protease inhibitor, PDKl, GSKl, Bad, caspase-9, Forkhead, an antigen of Helicobacter pylori, an antigen of Mycobacterium tuberculosis, and an antigen of influenza virus.
- EGFR epidermal growth factor receptor
- ErBb2 receptor ErBb2 receptor on tumor cells
- an internalising cellular receptor LDL receptor
- FGF2 receptor ErbB2 receptor
- transferrin receptor PDGF receptor
- the multispecific ligand comprises an anti-SA dAb variable domain of the invention and an anti-TNFRl binding moiety, eg, an anti-TNFRl dAb.
- the ligand has only one anti-TNFRl binding moiety (eg, dAb) to reduce the chance of receptor cross-linking.
- the anti-SA dAb comprises or consists of the amino acid sequence of any one of SEQ ID NOs: 97 to 103 and 198 to 203 (or an amino acid sequence that is at least 95, 96, 97, 98 or 99% identical to the amino acid sequence of any one of SEQ ID NOs: 97 to 103 and 198 to 203).
- the anti-TNFRl binding moiety is DOM lh-131-206 disclosed in WO2008149148 (the amino acid sequence of which and the nucleotide sequence of which, as disclosed in that PCT application, are expressly incorporated herein by reference as though explicitly written herein and for use with the present invention, and it is contemplated that any part of such disclosure can be incorporated into one or more claims herein).
- the multispecific ligand comprises or consists of the amino acid sequence of DOMlh-131-206 and the amino acid sequence of any one of SEQ ID NOs: 97 to 103 and 198 to 203 (or an amino acid sequence that is at least 95, 96, 97, 98 or 99% identical to the amino acid sequence of any one of SEQ ID NOs: 97 to 103 and 198 to 203).
- the anti-TNFRl binding moiety or dAb is any such moiety or dAb disclosed in co-pending application USSN 61/153,746, the disclosure of which is incorporated herein by reference.
- the anti-TNFRl binding moiety comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of DOMlh-574-156, DOMlh-574-72, DOMlh-574-109, DOMlh-574- 138, DOMlh-574-162 or DOMlh-574-180 or the amino acid sequence of any anti- TNFRl dAb disclosed herein.
- the multispecific ligand comprises or consists of the amino acid sequence of DOMlh-574-156 and the amino acid sequence of any one of SEQ ID NOs: 97 to 103 and 198 to 203 (or an amino acid sequence that is at least 95, 96, 97, 98 or 99% identical to the amino acid sequence of any one of SEQ ID NOs: 97 to 103 and 198 to 203).
- the ligand of the invention is a fusion protein comprising a variable domain of the invention fused directly or indirectly to one or more
- the fusion protein can be a "drug fusion" as disclosed in WO2005/118642 (the disclosure of which is incorporated herein by reference), comprising a variable domain of the invention and a polypeptide drug as defined in that PCT application.
- drug refers to any compound (e.g., small organic molecule, nucleic acid, polypeptide) that can be administered to an individual to produce a beneficial, therapeutic or diagnostic effect through binding to and/or altering the function of a biological target molecule in the individual.
- the target molecule can be an endogenous target molecule encoded by the individual's genome (e.g. an enzyme, receptor, growth factor, cytokine encoded by the individual's genome) or an exogenous target molecule encoded by the genome of a pathogen (e. g. an enzyme encoded by the genome of a virus, bacterium, fungus, nematode or other pathogen).
- Suitable drugs for use in fusion proteins and conjugates comprising an anti-SA dAb domain of the invention are disclosed in WO2005/118642 and WO2006/059106 (the entire disclosures of which are incorporated herein by reference, and including the entire list of specific drugs as though this list were expressly written herein, and it is contemplated that such incorporation provides disclosure of specific drugs for inclusion in claims herein).
- the drug can be glucagon-like peptide 1 (GLP- 1 ) or a variant, interferon alpha 2b or a variant or exendin-4 or a variant.
- the invention provides a drug conjugate as defined and disclosed in WO2005/118642 and WO2006/059106, wherein the conjugate comprises a variable domain of the invention.
- the drug is covalently linked to the variable domain (eg, the variable domain and the drug are expressed as part of a single polypeptide).
- the drug is non-covalently bonded or associated with the variable domain.
- the drug can be covalently or noncovalently bonded to the variable domain directly or indirectly (e.g., through a suitable linker and/or noncovalent binding of complementary binding partners (e.g., biotin and avidin)).
- one of the binding partners can be covalently bonded to the drug directly or through a suitable linker moiety, and the complementary binding partner can be covalently bonded to the variable domain directly or through a suitable linker moiety.
- the drug is a polypeptide or peptide
- the drug composition can be a fusion protein, wherein the polypeptide or peptide, drug and the polypeptide binding moiety are discrete parts (moieties) of a continuous polypeptide chain.
- the polypeptide binding moieties and polypeptide drug moieties can be directly bonded to each other through a peptide bond, or linked through a suitable amino acid, or peptide or polypeptide linker.
- a ligand which contains one single variable domain (eg, monomer) of the invention or more than one single variable domain (multimer, fusion protein, conjugate, and dual specific ligand as defined herein) which specifically binds to serum albumin can further comprise one or more entities selected from, but preferably not limited to a label, a tag , an additional single variable domain, a dAb, an antibody, and antibody fragment, a marker and a drug.
- One or more of these entities can be located at either the COOH terminus or at the N terminus or at both the N terminus and the COOH terminus of the ligand comprising the single variable domain, (either immunoglobulin or non- immuno globulin single variable domain).
- One or more of these entities can be located at either the COOH terminus, or the N terminus, or both the N terminus and the COOH terminus of the single variable domain which specifically binds serum albumin of the ligand which contains one single variable domain (monomer) or more than one single variable domains (multimer, fusion protein, conjugate, and dual specific ligand as defined herein).
- Non-limiting examples of tags which can be positioned at one or both of these termini include a HA, his or a myc tag.
- the entities can be bound to the ligand which contains one single variable domain (monomer) or more than one single variable domain (multimer, fusion protein, conjugate, and dual specific ligand as defined herein), which binds serum albumin, either directly or through linkers as described above.
- An aspect of the invention provides a fusion product, eg, a fusion protein or fusion with a peptide or conjugate with an NCE (new chemical entity) drug, comprising a polypeptide drug fused or conjugated (for an NCE) to any variable domain as described above, optionally wherein the variable domain comprises or consists of the amino acid sequence of any one of SEQ ID NOs: 97 to 103 and 198 to 203 (or an amino acid sequence that is at least 95, 96, 97, 98 or 99% identical to the amino acid sequence of any one of SEQ ID NOs: 97 to 103 and 198 to 203).
- the invention provides a composition comprising a variable domain, fusion protein, conjugate or ligand of any aspect of the invention and a pharmaceutically acceptable diluent, carrier, exipient or vehicle.
- variable domain e.g., a ligand which contains one single variable domain (eg, monomer) of the invention or more than one single variable domain (e.g., multimer, fusion protein, conjugate, and dual specific ligand as defined herein) which specifically binds to serum albumin, or which specifically binds both human serum albumin and at least one non-human serum albumin, or functionally active fragments thereof.
- a ligand which contains one single variable domain (eg, monomer) of the invention or more than one single variable domain e.g., multimer, fusion protein, conjugate, and dual specific ligand as defined herein
- a vector and/or an expression vector comprising the vector, e.g., a plant or animal cell and/or cell line transformed with a vector, a method of expressing and/or producing one or more variable domains, fusion proteins or ligands which contains one single variable domain (monomer) or more than one single variable domains (e.g., multimer, fusion protein, conjugate, and dual specific ligand as defined herein) which specifically binds to serum albumin, or fragment(s) thereof encoded by said vectors, including in some instances culturing the host cell so that the one or more variable domains, fusion proteins or ligands or fragments thereof are expressed and optionally recovering the ligand which contains one single variable domain (monomer) or more than one single variable domain (e.g., multimer, fusion protein, conjugate, and dual specific ligand as
- variable domains, fusion proteins or ligands described herein are administered to an individual host animal or cell in vivo and/or ex vivo.
- administering ligands described herein which comprises a single variable domain (immunoglobulin or non-immunoglobulin) directed to serum albumin and/or non-human serum albumin(s), and one or more domains directed to one or more targets other than serum albumin will increase the half life, including the T beta and/or terminal half life, of the anti-target ligand.
- Nucleic acid molecules encoding the domains, fusion proteins or single domain containing ligands or fragments thereof, including functional fragments thereof, are contemplated herein.
- Vectors encoding the nucleic acid molecules are contemplated herein, as are host cells from a cell line or organism containing one or more of these expression vectors. Also contemplated are methods of producing any domain, fusion protein or ligand, including, but preferably not limited to any of the aforementioned nucleic acids, vectors and host cells.
- An aspect of the invention provides a nucleic acid comprising a nucleotide sequence encoding a variable domain according to the invention or a multispecific ligand of the invention or fusion protein of the invention.
- An aspect of the invention provides a nucleic acid comprising the nucleotide sequence selected from any one of SEQ ID NOs: 1 to 96 and 192-197, or a nucleotide sequence that is at least 70, 75, 80, 85, 90, 95, 96, 97, 98 or 99% identical to said selected sequence.
- An aspect of the invention provides a vector comprising the nucleic acid of the invention.
- An aspect of the invention provides an isolated host cell comprising the vector.
- variable domains bind at least one species of serum albumin as determined by SPR.
- AACCCTGGTCACCGTCTCGAGC DOM7r-42 SEQ ID NO: 41
- AACCCTGGTCACCGTCTCGAGC DOM7r-83 SEQ ID NO: 83
- AACCCTGGTCACCGTCTCGAGC DOM7r-84 SEQ ID NO: 84
- DOM7h-33 SEQ ID NO: 105 EVQLLESGGGLVQPGGSLRLSCAASGFTFMAYQMAWVRQAPGKGLEWVSTIHQTGFSTYYADSVKGRFTI SRDNSKNTLYLQMNSLRAEDTAVYYCAKVRSMRPYKFDYWGQGTLVTVSS
- DOM7r-78 SEQ ID NO: 173 EVQLLESGGGLVQPGGSLRLSCAASGFTFDDSHMAWVRQAPGKGLEWVSRISREGKATYYADSVKGRFTI SRDNSKNTLYLQMNSLRAEDTAVYYCAAPNDQSAAFDYWGQGTLVTVSS
- the routine bacterial expression level in 2.5L shake flasks was determined following culture in Onex media at 3O 0 C for 48hrs at 250rpm.
- the biophysical characteristics were determined by SEC MALLS and DSC.
- SEC MALLS size exclusion chromatography with multi-angle-LASER-light- scattering
- TSK3000 size exclusion chromatography
- S200 size exclusion chromatography
- DSC Different Scanning Calorimetry: briefly, the protein is heated at a constant rate of 180 degrees C/hrs (at lmg/mL in PBS) and a detectable heat change associated with thermal denaturation measured.
- the transition midpoint ( app T m ) is determined, which is described as the temperature where 50% of the protein is in its native conformation and the other 50% is denatured.
- DSC determined the apparent transition midpoint (appTm) as most of the proteins examined do not fully refold. The higher the Tm, the more stable the molecule.
- the software package used was Origin R v7.0383. Characteristics of the VH dAbs are summarised in Table 1 below.
- AlbudAbsTM anti-serum albumin dAbs
- SPR surface plasmon resonance
- BiacoreTM was used.
- the epitope mapping to domain 1, 2 and/or 3 (D 1,2,3) of human serum albumin (HSA) was performed using SPR and purified individual domains of HSA (in-house) covalently coupled to a CM5 chip (amine coupling).
- the expression was in 2.5L baffled glass flasks in a volume of 50OmL in OverNight ExpressTM at 30C, 250rpm.
- MALLS results: A single VH AlbudAb is 14kDa in size. Any value between 14 and 28kDa as determined by MALLS is indicative of varying degrees of self- association or dimer formation (i.e 16kDa predominately monomeric under the conditions tested whereas 22kDa indicates a strong propensity to dimerise under MALLS conditions).
- DSC results The concentration of protein in a DSC experiment is much higher at lmg/mL in the actual reaction cell compared to MALLS. This higher concentration could explain in part the presence of two appTms for some AlbudAbs as seen in table 1; the first Tm constitutes the dissociation of the dimeric complex, whereas the second Tm represents the unfolding of the actual AlbudAb protein.
- AlbudAbs leads are fully cross-reactive between the four species of serum albumin. All identified AlbudAbs bind Domain2 of HSA and express reasonably well in shake flasks under non-optimised conditions. 5 out of 7 AlbudAbs are monomeric as determined by MALLS, whereas DOM7r-35 shows a significant propensity to dimerise under the MALLS conditions. Monomeric state is advantageous because it avoids dimerisation and the risk of products that may cross-link targets such as cell-surface receptors.
- DOM7r-36 shows some degree of aggregate formation (less than 10% when quantified on MALLS).
- 2 appTms can be determined. This is due to the higher experimental concentration in DSC experiments and slightly different in-solution state of the dAb at this elevated concentration (for details, see explanation also above).
- AlbudAbs were cloned into the pDOM5 vector.
- the pDOM5 vector is a pUCl 19-based expression vector where protein expression is driven by the LacZ promoter.
- a GAS 1 leader sequence (see WO 2005/093074) ensures secretion of isolated, soluble dAbs into the periplasm and culture supernatant of E. coli.
- dAbs are cloned Sall/Notl in this vector, which appends a myc tag at the C-terminus of the dAb.
- 20- 50mg quantities were expressed in E. coli and purified from bacterial culture supernatant using protein A affinity resin and eluted with 10OmM glycine pH2.
- the proteins were concentrated to greater than lmg/ml, buffer exchanged into PBS and endotoxin depleted using using Q spin columns (Vivascience).
- PK pharmacokinetic
- AlbudAbs were dosed as single i.v injections at 2.5mg/kg using 3 rats per compound.
- Serum samples were taken at 0.16, 1, 4, 12, 24, 48, 72, 96, 120, 168hrs. Analysis of serum levels was by anti-myc capture followed by anti-VH detection ELISA as per the method described below.
- Results are shown in table 2. All tested AlbudAbs show a serum-half life extending ability (negative control HEL4 dAb with T 1/2 of 20mins in rat) to varying degrees; this trend can also be seen in the calculated AUC being the highest value for the longest tl/2. The longest serum half-life with 34.5hrs approximates the serum half- life of rat serm albumin.
- T Vi is a measure of the circulation time of the molecule in the subjects.
- AUC area under the curve, which is a PK profile parameter
- the AlbudAb concentration in serum was measured by anti- myc ELISA. Briefly, goat anti- myc polyclonal antibody (1:500; Abeam, catalogue number ab9132) was coated overnight onto Nunc 96-well Maxisorp plates and blocked with 5% BSA/PBS + 1 % TWEENTM. Serum samples were added at a range of dilutions alongside a standard at known concentrations. Bound myc-tagged AlbudAb was then detected using a rabbit polyclonal anti-VH directly labelled with the MSD sulfo-tag. Each dAb was diluted in assay buffer containing 10% control rat serum
- MesoScale.com utilizes electrochemiluminescence detection of the sulfo-tag after electrochemical stimulus.
- PK parameters were estimated by the software to give terminal half-lives. Dosing information and time points were selected to reflect the terminal phase of each PK profile.
- Example 3 Affinity maturation of na ⁇ ve VH AlbudAbsTM 12 VH AlbudAb leads isolated from na ⁇ ve selection were taken forward for affinity maturation.
- Individual error prone libraries (EP) of DOM7r-36, DOM7r-35, DOM7r-31, DOM7h-98, DOM7h-l 12, DOM7r-38 and DOM7r-29 were made, whereas the following parental clones were pooled and combined in a single EP library and screened together: DOM7r-83, DOM7r-85, DOM7r-92, DOM7r-94 and DOM7r-95.
- AU libraries were greater than 2xlO 9 CFU/mL.
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Engineering & Computer Science (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Immunology (AREA)
- Biomedical Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Microbiology (AREA)
- Veterinary Medicine (AREA)
- Mycology (AREA)
- Physics & Mathematics (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Plant Pathology (AREA)
- Animal Behavior & Ethology (AREA)
- Epidemiology (AREA)
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (14)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2010272590A AU2010272590B2 (en) | 2009-07-16 | 2010-07-14 | Improved anti-serum albumin binding single variable domains |
| EP10734965A EP2454285A2 (en) | 2009-07-16 | 2010-07-14 | Improved anti-serum albumin binding single variable domains |
| US13/384,316 US8679496B2 (en) | 2009-07-16 | 2010-07-14 | Anti-serum albumin single variable domains |
| CA2768462A CA2768462A1 (en) | 2009-07-16 | 2010-07-14 | Improved anti-serum albumin binding single variable domains |
| IN640DEN2012 IN2012DN00640A (OSRAM) | 2009-07-16 | 2010-07-14 | |
| EA201270174A EA201270174A1 (ru) | 2009-07-16 | 2010-07-14 | Отдельные связывающиеся вариабельные домены с улучшенными свойствами, направленные против сывороточного альбумина |
| CN2010800414331A CN102574914A (zh) | 2009-07-16 | 2010-07-14 | 改进的抗血清清蛋白结合性单可变区 |
| JP2012520016A JP2012532620A (ja) | 2009-07-16 | 2010-07-14 | 改良型抗血清アルブミン結合単一可変ドメイン |
| MX2012000765A MX2012000765A (es) | 2009-07-16 | 2010-07-14 | Dominios variables sencillos de union de albumina anti-suero mejorados. |
| BR112012001681A BR112012001681A2 (pt) | 2009-07-16 | 2010-07-14 | domínios variáveis de ligação de anti-albumina sérica aperfeiçoados |
| SG2012001855A SG177601A1 (en) | 2009-07-16 | 2010-07-14 | Improved anti-serum albumin binding single variable domains |
| IL217520A IL217520A0 (en) | 2009-07-16 | 2012-01-12 | Improved anti-serum albumin binding single variable domains |
| ZA2012/00276A ZA201200276B (en) | 2009-07-16 | 2012-01-13 | Improved anti-serum albumin binding variable domains |
| US14/168,168 US20140140996A1 (en) | 2009-07-16 | 2014-01-30 | Anti-serum albumin biding variable domains |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US22602809P | 2009-07-16 | 2009-07-16 | |
| US61/226,028 | 2009-07-16 | ||
| US30755410P | 2010-02-24 | 2010-02-24 | |
| US61/307,554 | 2010-02-24 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/384,316 A-371-Of-International US8679496B2 (en) | 2009-07-16 | 2010-07-14 | Anti-serum albumin single variable domains |
| US14/168,168 Continuation US20140140996A1 (en) | 2009-07-16 | 2014-01-30 | Anti-serum albumin biding variable domains |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2011006915A2 true WO2011006915A2 (en) | 2011-01-20 |
| WO2011006915A3 WO2011006915A3 (en) | 2011-03-03 |
Family
ID=42829253
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2010/060112 Ceased WO2011006915A2 (en) | 2009-07-16 | 2010-07-14 | Improved anti-serum albumin binding single variable domains |
Country Status (15)
| Country | Link |
|---|---|
| US (2) | US8679496B2 (OSRAM) |
| EP (1) | EP2454285A2 (OSRAM) |
| JP (1) | JP2012532620A (OSRAM) |
| KR (1) | KR20120038494A (OSRAM) |
| CN (1) | CN102574914A (OSRAM) |
| AU (1) | AU2010272590B2 (OSRAM) |
| BR (1) | BR112012001681A2 (OSRAM) |
| CA (1) | CA2768462A1 (OSRAM) |
| EA (1) | EA201270174A1 (OSRAM) |
| IL (1) | IL217520A0 (OSRAM) |
| IN (1) | IN2012DN00640A (OSRAM) |
| MX (1) | MX2012000765A (OSRAM) |
| SG (1) | SG177601A1 (OSRAM) |
| WO (1) | WO2011006915A2 (OSRAM) |
| ZA (1) | ZA201200276B (OSRAM) |
Cited By (31)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2012020143A1 (en) * | 2010-08-13 | 2012-02-16 | Glaxo Group Limited | Improved anti-serum albumin binding variants |
| WO2012072731A3 (en) * | 2010-12-01 | 2012-09-07 | Glaxo Group Limited | Improved anti-serum albumin binding single variable domains |
| WO2013068571A1 (en) | 2011-11-11 | 2013-05-16 | Ucb Pharma S.A. | Albumin binding antibodies and binding fragments thereof |
| WO2013104918A3 (en) * | 2012-01-13 | 2013-08-29 | Imperial Innovations Limited | Binding molecule |
| WO2017080850A1 (en) | 2015-11-13 | 2017-05-18 | Ablynx Nv | Improved serum albumin-binding immunoglobulin variable domains |
| WO2017085172A2 (en) | 2015-11-18 | 2017-05-26 | Ablynx Nv | Improved serum albumin binders |
| WO2017087589A2 (en) | 2015-11-18 | 2017-05-26 | Merck Sharp & Dohme Corp. | Pd1 and/or lag3 binders |
| WO2017087587A1 (en) | 2015-11-18 | 2017-05-26 | Merck Sharp & Dohme Corp. | PD1/CTLA4 Binders |
| WO2017087588A1 (en) | 2015-11-18 | 2017-05-26 | Merck Sharp & Dohme Corp. | Ctla4 binders |
| EP3266798A2 (en) | 2015-11-12 | 2018-01-10 | Ablynx NV | Improved tnf binders |
| WO2018104444A1 (en) | 2016-12-07 | 2018-06-14 | Ablynx Nv | Improved serum albumin binding immunoglobulin single variable domains |
| WO2018134234A1 (en) | 2017-01-17 | 2018-07-26 | Ablynx Nv | Improved serum albumin binders |
| WO2018134235A1 (en) | 2017-01-17 | 2018-07-26 | Ablynx Nv | Improved serum albumin binders |
| EP3470426A1 (en) | 2017-10-10 | 2019-04-17 | Numab Therapeutics AG | Multispecific antibody |
| WO2019072868A1 (en) | 2017-10-10 | 2019-04-18 | Numab Therapeutics AG | MULTISPECIFIC ANTIBODIES |
| EP3816185A1 (en) | 2019-11-04 | 2021-05-05 | Numab Therapeutics AG | Multispecific antibody directed against pd-l1 and a tumor-associated antigen |
| WO2021123186A1 (en) | 2019-12-20 | 2021-06-24 | UCB Biopharma SRL | Multi-specific antibody with binding specificity for human il-13 and il-17 |
| WO2021205184A1 (en) | 2020-04-09 | 2021-10-14 | Autolus Limited | Polypeptide |
| WO2021234383A1 (en) | 2020-05-19 | 2021-11-25 | Autolus Limited | Single domain antibodies against hace2 and their use to prevent sars-cov-2 infection |
| EP3915580A1 (en) | 2020-05-29 | 2021-12-01 | Numab Therapeutics AG | Multispecific antibody |
| EP3988568A1 (en) | 2020-10-21 | 2022-04-27 | Numab Therapeutics AG | Combination treatment |
| WO2022122654A1 (en) | 2020-12-07 | 2022-06-16 | UCB Biopharma SRL | Multi-specific antibodies and antibody combinations |
| WO2022167460A1 (en) | 2021-02-02 | 2022-08-11 | Numab Therapeutics AG | Multispecific antibodies having specificity for ror1 and cd3 |
| CN115698308A (zh) * | 2020-06-01 | 2023-02-03 | 拜瑞威有限责任公司 | 用于通过二氧化碳的吸收和生物转化来生物产生氢气和/或甲烷的工艺 |
| EP3927740A4 (en) * | 2019-02-22 | 2023-03-01 | Anwita Biosciences, Inc. | ALBUMIN-BINDING ANTIBODIES AND USE THEREOF |
| EP4183800A1 (en) | 2021-11-19 | 2023-05-24 | Medizinische Hochschule Hannover | Novel sars-cov-2 neutralizing antibodies |
| WO2024038095A1 (en) | 2022-08-16 | 2024-02-22 | Iome Bio | NOVEL ANTI-RGMb ANTIBODIES |
| WO2024170756A1 (en) | 2023-02-17 | 2024-08-22 | Ablynx N.V. | Polypeptides binding to the neonatal fc receptor |
| US12103955B2 (en) | 2016-05-18 | 2024-10-01 | Modernatx, Inc. | Polynucleotides encoding relaxin |
| WO2025061919A1 (en) | 2023-09-22 | 2025-03-27 | Ablynx Nv | Bi- and multivalent albumin binders |
| US12459994B2 (en) | 2024-04-12 | 2025-11-04 | Paragon Therapeutics, Inc. | Albumin binding proteins and methods of use |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| BRPI1008014A2 (pt) * | 2009-02-19 | 2016-10-04 | Glaxo Group Ltd | domínio variável simples, ligante multiespecífico, antagonistas de tnfr1, e de receptor de tnf-alfa, uso do agonista de tnfr, antagonista anti-tnfr1, polipeptídeo ou ligante multiespecífico, método para tratar e/ou prevenir uma condição ou doença, ácido nucleico, vetor, e, hospedeiro |
| BR112012001681A2 (pt) * | 2009-07-16 | 2019-09-24 | Graxo Group Ltd | domínios variáveis de ligação de anti-albumina sérica aperfeiçoados |
| WO2017041114A2 (en) * | 2015-09-03 | 2017-03-09 | The Children's Mercy Hospital | Anti-nicotinamide phosphoribosyltransferase antibody genes and methods of use thereof |
| AU2018220516B2 (en) | 2017-02-16 | 2025-03-06 | Sonnet BioTherapeutics, Inc. | Albumin binding domain fusion proteins |
| US12134635B1 (en) | 2023-12-29 | 2024-11-05 | Sonnet BioTherapeutics, Inc. | Interleukin 18 (IL-18) variants and fusion proteins comprising same |
Citations (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2000029004A1 (en) | 1998-11-18 | 2000-05-25 | Peptor Ltd. | Small functional units of antibody heavy chain variable regions |
| WO2004003019A2 (en) | 2002-06-28 | 2004-01-08 | Domantis Limited | Immunoglobin single variant antigen-binding domains and dual-specific constructs |
| WO2005093074A1 (en) | 2004-03-24 | 2005-10-06 | Domantis Limited | Gas1 universal leader |
| WO2005118642A2 (en) | 2004-06-01 | 2005-12-15 | Domantis Limited | Bispecific fusion antibodies with enhanced serum half-life |
| WO2006059106A2 (en) | 2004-12-02 | 2006-06-08 | Domantis Limited | Bispecific domain antibodies targeting serum albumin and glp-1 or pyy |
| WO2007085814A1 (en) | 2006-01-24 | 2007-08-02 | Domantis Limited | Fusion proteins that contain natural junctions |
| WO2008096158A2 (en) | 2007-02-08 | 2008-08-14 | Domantis Limited | Antibody single variable domains against serum albumin |
| WO2008149148A2 (en) | 2007-06-06 | 2008-12-11 | Domantis Limited | Polypeptides, antibody variable domains and antagonists |
Family Cites Families (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| IL159177A0 (en) * | 2001-06-20 | 2004-06-01 | Prochon Biotech Ltd | Antibodies that block receptor protein tyrosine kinase activation, methods of screening for and uses thereof |
| US20100081792A1 (en) * | 2001-06-28 | 2010-04-01 | Smithkline Beecham Corporation | Ligand |
| US7563443B2 (en) * | 2004-09-17 | 2009-07-21 | Domantis Limited | Monovalent anti-CD40L antibody polypeptides and compositions thereof |
| GB0521621D0 (en) * | 2005-10-24 | 2005-11-30 | Domantis Ltd | Tumor necrosis factor receptor 1 antagonists for treating respiratory diseases |
| KR20080077238A (ko) * | 2005-12-01 | 2008-08-21 | 도만티스 리미티드 | 인터루킨 1 수용체 타입 1에 결합하는 비경쟁적 도메인항체 포맷 |
| EP1957537A2 (en) * | 2005-12-01 | 2008-08-20 | Domantis Limited | Competitive domain antibody formats that bind interleukin 1 receptor type 1 |
| BRPI0619463A2 (pt) * | 2005-12-06 | 2013-01-08 | Domantis Ltd | ligando, uso do mesmo, mÉtodos para tratar cÂncer e para administrar um tratamento anti-vegf e tratamento anti-egfr a um indivÍduo, composiÇço, dispositivo de dispensaÇço de droga, Ácido nucleico isolado ou recombinante, vetor, cÉlula hospedeira, mÉtodo para produzir um ligando, polipeptÍdeo de domÍnio variÁvel simples de imunoglobulina, e, antagonista de egfr |
| AU2007209202A1 (en) * | 2006-01-24 | 2007-08-02 | Domantis Limited | Ligands that bind IL-4 and/or IL-13 |
| WO2009149143A1 (en) * | 2008-06-03 | 2009-12-10 | E. I. Du Pont De Nemours And Company | Adhesion of polyamides to epoxy resins |
| US8906035B2 (en) * | 2008-06-04 | 2014-12-09 | Ethicon Endo-Surgery, Inc. | Endoscopic drop off bag |
| MX2010013121A (es) * | 2008-06-06 | 2011-01-21 | Danisco Inc | Composiciones y metodos que comprenden proteasas microbianas variantes. |
| US10198891B2 (en) * | 2008-06-06 | 2019-02-05 | Epona Llc | System and method for regulating fuel transactions |
| BR112012001681A2 (pt) * | 2009-07-16 | 2019-09-24 | Graxo Group Ltd | domínios variáveis de ligação de anti-albumina sérica aperfeiçoados |
-
2010
- 2010-07-14 BR BR112012001681A patent/BR112012001681A2/pt not_active IP Right Cessation
- 2010-07-14 SG SG2012001855A patent/SG177601A1/en unknown
- 2010-07-14 US US13/384,316 patent/US8679496B2/en not_active Expired - Fee Related
- 2010-07-14 IN IN640DEN2012 patent/IN2012DN00640A/en unknown
- 2010-07-14 JP JP2012520016A patent/JP2012532620A/ja active Pending
- 2010-07-14 CA CA2768462A patent/CA2768462A1/en not_active Abandoned
- 2010-07-14 EA EA201270174A patent/EA201270174A1/ru unknown
- 2010-07-14 AU AU2010272590A patent/AU2010272590B2/en not_active Ceased
- 2010-07-14 EP EP10734965A patent/EP2454285A2/en not_active Withdrawn
- 2010-07-14 CN CN2010800414331A patent/CN102574914A/zh active Pending
- 2010-07-14 KR KR1020127003939A patent/KR20120038494A/ko not_active Withdrawn
- 2010-07-14 MX MX2012000765A patent/MX2012000765A/es not_active Application Discontinuation
- 2010-07-14 WO PCT/EP2010/060112 patent/WO2011006915A2/en not_active Ceased
-
2012
- 2012-01-12 IL IL217520A patent/IL217520A0/en unknown
- 2012-01-13 ZA ZA2012/00276A patent/ZA201200276B/en unknown
-
2014
- 2014-01-30 US US14/168,168 patent/US20140140996A1/en not_active Abandoned
Patent Citations (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2000029004A1 (en) | 1998-11-18 | 2000-05-25 | Peptor Ltd. | Small functional units of antibody heavy chain variable regions |
| WO2004003019A2 (en) | 2002-06-28 | 2004-01-08 | Domantis Limited | Immunoglobin single variant antigen-binding domains and dual-specific constructs |
| WO2005093074A1 (en) | 2004-03-24 | 2005-10-06 | Domantis Limited | Gas1 universal leader |
| WO2005118642A2 (en) | 2004-06-01 | 2005-12-15 | Domantis Limited | Bispecific fusion antibodies with enhanced serum half-life |
| WO2006059106A2 (en) | 2004-12-02 | 2006-06-08 | Domantis Limited | Bispecific domain antibodies targeting serum albumin and glp-1 or pyy |
| WO2007085814A1 (en) | 2006-01-24 | 2007-08-02 | Domantis Limited | Fusion proteins that contain natural junctions |
| WO2008096158A2 (en) | 2007-02-08 | 2008-08-14 | Domantis Limited | Antibody single variable domains against serum albumin |
| WO2008149148A2 (en) | 2007-06-06 | 2008-12-11 | Domantis Limited | Polypeptides, antibody variable domains and antagonists |
Non-Patent Citations (7)
| Title |
|---|
| AUSUBEL: "Short Protocols in Molecular Biology,4th Ed,", 1999, JOHN WILEY & SONS, INC. |
| HOLT ET AL.: "Anti-Serum albumin domain antibodies for extending the half-lives of short lived drugs", PROTEIN ENGINEERING, DESIGN & SELECTION, vol. 21, no. 5, 2008, pages 283 - 288 |
| KENNETH, A ET AL.: "Chemical Stability of Pharmaceuticals: A Handbook for Pharmacists" |
| M GIBALDI; D PERRON: "Pharmacokinetics, 2'" Rev. ex edition", 1982, MARCEL DEKKER |
| PETERS ET AL., PHARMACOKINETC ANALYSIS: A PRACTICAL APPROACH, 1996 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual, 2d ed.", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| TOMLINSON, NATURE BIOTECHNOLOGY, vol. 22, 2004, pages 521 - 522 |
Cited By (64)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9012609B2 (en) | 2010-08-13 | 2015-04-21 | Glaxosmithkline Intellectual Property Development Limited | Anti-serum albumin binding variants |
| WO2012020143A1 (en) * | 2010-08-13 | 2012-02-16 | Glaxo Group Limited | Improved anti-serum albumin binding variants |
| WO2012072731A3 (en) * | 2010-12-01 | 2012-09-07 | Glaxo Group Limited | Improved anti-serum albumin binding single variable domains |
| EA033766B1 (ru) * | 2011-11-11 | 2019-11-22 | Ucb Biopharma Sprl | Альбуминсвязывающие антитела и их связывающие фрагменты |
| WO2013068571A1 (en) | 2011-11-11 | 2013-05-16 | Ucb Pharma S.A. | Albumin binding antibodies and binding fragments thereof |
| US9803004B2 (en) | 2011-11-11 | 2017-10-31 | Ucb Biopharma Sprl | Albumin binding antibodies and binding fragments thereof |
| US10023631B2 (en) | 2011-11-11 | 2018-07-17 | Ucb Biopharma Sprl | Albumin binding antibodies and binding fragments thereof |
| WO2013104918A3 (en) * | 2012-01-13 | 2013-08-29 | Imperial Innovations Limited | Binding molecule |
| EP3266798A2 (en) | 2015-11-12 | 2018-01-10 | Ablynx NV | Improved tnf binders |
| AU2016351710B2 (en) * | 2015-11-13 | 2023-08-03 | Ablynx Nv | Improved serum albumin-binding immunoglobulin variable domains |
| WO2017080850A1 (en) | 2015-11-13 | 2017-05-18 | Ablynx Nv | Improved serum albumin-binding immunoglobulin variable domains |
| US11142569B2 (en) | 2015-11-13 | 2021-10-12 | Ablynx N.V. | Serum albumin-binding immunoglobulin variable domains |
| CN115925919A (zh) * | 2015-11-13 | 2023-04-07 | 埃博灵克斯股份有限公司 | 改进的血清白蛋白结合免疫球蛋白可变结构域 |
| EP3974449A1 (en) | 2015-11-13 | 2022-03-30 | Ablynx NV | Improved serum albumin-binding immunoglobulin variable domains |
| WO2017087588A1 (en) | 2015-11-18 | 2017-05-26 | Merck Sharp & Dohme Corp. | Ctla4 binders |
| US11649290B2 (en) | 2015-11-18 | 2023-05-16 | Merck Sharp & Dohme Llc | CTLA4 binders |
| US12351630B2 (en) | 2015-11-18 | 2025-07-08 | Merck Sharp & Dohme Llc | PD1 and/or LAG3 binders |
| US10323090B2 (en) | 2015-11-18 | 2019-06-18 | Merck Sharp & Dohme Corp. | PD1 and/or LAG3 binders |
| US10501542B2 (en) | 2015-11-18 | 2019-12-10 | Merck Sharp & Dohme Corp. | CTLA4 binders |
| US11168136B2 (en) | 2015-11-18 | 2021-11-09 | Merck Sharp & Dohme Corp. | PD1 and/or LAG3 binders |
| WO2017087589A2 (en) | 2015-11-18 | 2017-05-26 | Merck Sharp & Dohme Corp. | Pd1 and/or lag3 binders |
| US11168135B2 (en) | 2015-11-18 | 2021-11-09 | Merck Sharp & Dohme Corp. | PD1 and/or LAG3 binders |
| WO2017087587A1 (en) | 2015-11-18 | 2017-05-26 | Merck Sharp & Dohme Corp. | PD1/CTLA4 Binders |
| US11155619B2 (en) | 2015-11-18 | 2021-10-26 | Merck Sharp & Dohme Corp. | PD1 and/or LAG3 binders |
| WO2017085172A2 (en) | 2015-11-18 | 2017-05-26 | Ablynx Nv | Improved serum albumin binders |
| US12103955B2 (en) | 2016-05-18 | 2024-10-01 | Modernatx, Inc. | Polynucleotides encoding relaxin |
| IL266907B2 (en) * | 2016-12-07 | 2024-07-01 | Ablynx Nv | Immunoglobulin sites with a single variable enhance serum albumin binding |
| IL266907B1 (en) * | 2016-12-07 | 2024-03-01 | Ablynx Nv | Improved serum albumin binding immunoglobulin single variable domains |
| US11414480B2 (en) | 2016-12-07 | 2022-08-16 | Ablynx N.V. | Serum albumin binding immunoglobulin single variable domains |
| WO2018104444A1 (en) | 2016-12-07 | 2018-06-14 | Ablynx Nv | Improved serum albumin binding immunoglobulin single variable domains |
| CN110049997B (zh) * | 2016-12-07 | 2023-09-22 | 埃博灵克斯股份有限公司 | 改进的血清白蛋白结合免疫球蛋白单可变结构域 |
| CN110049997A (zh) * | 2016-12-07 | 2019-07-23 | 埃博灵克斯股份有限公司 | 改进的血清白蛋白结合免疫球蛋白单可变结构域 |
| US11897944B2 (en) | 2017-01-17 | 2024-02-13 | Ablynx N.V. | Immunoglobulin single variable domain (ISVD) capable of binding to serum albumin |
| EP4442708A2 (en) | 2017-01-17 | 2024-10-09 | Ablynx NV | Improved serum albumin binders |
| WO2018134235A1 (en) | 2017-01-17 | 2018-07-26 | Ablynx Nv | Improved serum albumin binders |
| US11414481B2 (en) | 2017-01-17 | 2022-08-16 | Ablynx N.V. | Serum albumin binders |
| WO2018134234A1 (en) | 2017-01-17 | 2018-07-26 | Ablynx Nv | Improved serum albumin binders |
| EP4471058A2 (en) | 2017-01-17 | 2024-12-04 | Ablynx NV | Improved serum albumin binders |
| EP4442707A2 (en) | 2017-01-17 | 2024-10-09 | Ablynx NV | Improved serum albumin binders |
| EP4442709A2 (en) | 2017-01-17 | 2024-10-09 | Ablynx NV | Improved serum albumin binders |
| EP3470426A1 (en) | 2017-10-10 | 2019-04-17 | Numab Therapeutics AG | Multispecific antibody |
| WO2019072868A1 (en) | 2017-10-10 | 2019-04-18 | Numab Therapeutics AG | MULTISPECIFIC ANTIBODIES |
| EP3927740A4 (en) * | 2019-02-22 | 2023-03-01 | Anwita Biosciences, Inc. | ALBUMIN-BINDING ANTIBODIES AND USE THEREOF |
| US12479909B2 (en) | 2019-02-22 | 2025-11-25 | Anwita Biosciences, Inc. | Albumin binding antibodies and use thereof |
| EP3816185A1 (en) | 2019-11-04 | 2021-05-05 | Numab Therapeutics AG | Multispecific antibody directed against pd-l1 and a tumor-associated antigen |
| WO2021089609A1 (en) | 2019-11-04 | 2021-05-14 | Numab Therapeutics AG | Multispecific antibody |
| WO2021123186A1 (en) | 2019-12-20 | 2021-06-24 | UCB Biopharma SRL | Multi-specific antibody with binding specificity for human il-13 and il-17 |
| WO2021205184A1 (en) | 2020-04-09 | 2021-10-14 | Autolus Limited | Polypeptide |
| WO2021205183A1 (en) | 2020-04-09 | 2021-10-14 | Autolus Limited | Polypeptide |
| WO2021234383A1 (en) | 2020-05-19 | 2021-11-25 | Autolus Limited | Single domain antibodies against hace2 and their use to prevent sars-cov-2 infection |
| EP3915580A1 (en) | 2020-05-29 | 2021-12-01 | Numab Therapeutics AG | Multispecific antibody |
| WO2021239987A1 (en) | 2020-05-29 | 2021-12-02 | Numab Therapeutics AG | Multispecific antibody |
| CN115698308A (zh) * | 2020-06-01 | 2023-02-03 | 拜瑞威有限责任公司 | 用于通过二氧化碳的吸收和生物转化来生物产生氢气和/或甲烷的工艺 |
| EP3988568A1 (en) | 2020-10-21 | 2022-04-27 | Numab Therapeutics AG | Combination treatment |
| WO2022084440A2 (en) | 2020-10-21 | 2022-04-28 | Numab Therapeutics AG | Combination treatment |
| WO2022122654A1 (en) | 2020-12-07 | 2022-06-16 | UCB Biopharma SRL | Multi-specific antibodies and antibody combinations |
| WO2022167460A1 (en) | 2021-02-02 | 2022-08-11 | Numab Therapeutics AG | Multispecific antibodies having specificity for ror1 and cd3 |
| WO2023089107A1 (en) | 2021-11-19 | 2023-05-25 | Medizinische Hochschule Hannover | Novel sars-cov-2 neutralizing antibodies |
| EP4183800A1 (en) | 2021-11-19 | 2023-05-24 | Medizinische Hochschule Hannover | Novel sars-cov-2 neutralizing antibodies |
| DE112022005522T5 (de) | 2021-11-19 | 2025-01-23 | Twincore Zentrum Für Experimentelle Und Klinische Infektionsforschung Gmbh | Neue sars-cov-2-neutralisierende antikörper |
| WO2024038095A1 (en) | 2022-08-16 | 2024-02-22 | Iome Bio | NOVEL ANTI-RGMb ANTIBODIES |
| WO2024170756A1 (en) | 2023-02-17 | 2024-08-22 | Ablynx N.V. | Polypeptides binding to the neonatal fc receptor |
| WO2025061919A1 (en) | 2023-09-22 | 2025-03-27 | Ablynx Nv | Bi- and multivalent albumin binders |
| US12459994B2 (en) | 2024-04-12 | 2025-11-04 | Paragon Therapeutics, Inc. | Albumin binding proteins and methods of use |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2010272590B2 (en) | 2013-10-10 |
| SG177601A1 (en) | 2012-02-28 |
| IN2012DN00640A (OSRAM) | 2015-08-21 |
| EA201270174A1 (ru) | 2012-07-30 |
| KR20120038494A (ko) | 2012-04-23 |
| BR112012001681A2 (pt) | 2019-09-24 |
| JP2012532620A (ja) | 2012-12-20 |
| MX2012000765A (es) | 2012-02-13 |
| US20140140996A1 (en) | 2014-05-22 |
| US20120114647A1 (en) | 2012-05-10 |
| EP2454285A2 (en) | 2012-05-23 |
| CA2768462A1 (en) | 2011-01-20 |
| IL217520A0 (en) | 2012-02-29 |
| US8679496B2 (en) | 2014-03-25 |
| CN102574914A (zh) | 2012-07-11 |
| AU2010272590A1 (en) | 2012-02-02 |
| ZA201200276B (en) | 2012-09-26 |
| WO2011006915A3 (en) | 2011-03-03 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US8679496B2 (en) | Anti-serum albumin single variable domains | |
| EP2398825B1 (en) | Single variable domain against serum albumin | |
| US10696738B2 (en) | Anti-serum albumin binding variants | |
| US9040668B2 (en) | Anti-serum albumin binding variants | |
| US20130266567A1 (en) | Anti-serum albumin binding single variable domains | |
| AU2014200157A1 (en) | Improved anti-serum albumin binding single variable domains | |
| HK40023197A (en) | Improved anti-serum albumin binding variants |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 201080041433.1 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 10734965 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2010272590 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 217520 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2768462 Country of ref document: CA Ref document number: 2012520016 Country of ref document: JP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 13384316 Country of ref document: US Ref document number: MX/A/2012/000765 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 640/DELNP/2012 Country of ref document: IN |
|
| ENP | Entry into the national phase |
Ref document number: 2010272590 Country of ref document: AU Date of ref document: 20100714 Kind code of ref document: A |
|
| REEP | Request for entry into the european phase |
Ref document number: 2010734965 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2010734965 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 20127003939 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 201270174 Country of ref document: EA |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112012001681 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112012001681 Country of ref document: BR Kind code of ref document: A2 Effective date: 20120116 |