WO2010020811A1 - Non-cytotoxic fusion proteins comprising egf muteins - Google Patents
Non-cytotoxic fusion proteins comprising egf muteins Download PDFInfo
- Publication number
- WO2010020811A1 WO2010020811A1 PCT/GB2009/051036 GB2009051036W WO2010020811A1 WO 2010020811 A1 WO2010020811 A1 WO 2010020811A1 GB 2009051036 W GB2009051036 W GB 2009051036W WO 2010020811 A1 WO2010020811 A1 WO 2010020811A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- amino acid
- seq
- egf
- polypeptide according
- acid sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
- C07K14/485—Epidermal growth factor [EGF], i.e. urogastrone
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/06—Antiasthmatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P5/00—Drugs for disorders of the endocrine system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/50—Fusion polypeptide containing protease site
Definitions
- the present invention relates to non-cytotoxic fusion proteins, and to the use thereof as therapeutics for suppressing conditions such as mucus hypersecretion, inflammation, neuroendocrine disorders, and neuroendocrine tumours.
- Non-cytotoxic proteases are a discrete group of proteases, which act on target cells by incapacitating cellular function. Importantly, non-cytotoxic proteases do not kill the target cells upon which they act. Some of the best known examples of non-cytotoxic proteases include clostridial neurotoxins and IgA proteases.
- Non-cytotoxic proteases act by proteolytically-cleaving intracellular transport proteins known as SNARE proteins (e.g. SNAP-25, VAMP, or Syntaxin) - see Gerald K (2002) "Cell and Molecular Biology” (4th edition) John Wiley & Sons, Inc.
- the acronym SNARE derives from the term Soluble ⁇ SF Attachment Receptor, where NSF means ⁇ -ethylmaleimide-Sensitive Factor.
- SNARE proteins are integral to intracellular vesicle formation, and thus to secretion of molecules via vesicle transport from a cell. Accordingly, once delivered to a desired target cell, the non-cytotoxic protease is capable of inhibiting cellular secretion from the target cell.
- non-cytotoxic proteases have been successfully employed in a wide range of therapies, such as: the treatment of pain (see WO96/33274); the treatment of mucus hypersecretion conditions such as COPD, asthma (see WO00/10598); the treatment of non-neuronal conditions such as endocrine conditions, exocrine conditions, immunological conditions, cardiovascular conditions, bone conditions (see WO01/21213); the treatment of neurological disorders such as Parkinson's disease (see US 6,620,415, US 6,306,403); the treatment of neuropsychiatric disorders (see US2004/0180061 , US2003/021 1121 ); the treatment of endocrine disorders (see US 6,827,931 ); the treatment of thyroid disorders (see US 6,740,321 ); the treatment of diabetes (see US 6,337,075, US 6,416,765); and the treatment of pancreatic disorders (see US 6,261 ,572, US 6,143,306).
- therapies such as: the treatment of pain (see WO96/332
- a therapeutic dosing range exists which identifies the lower and upper limits of safe, effective therapy.
- the upper limit is determined by the increasing significance of off-target effects that lead to undesirable (e.g. potentially harmful) side-effects of drug treatment.
- this could lead to the paralysis of cellular secretion in off- target cells, which, in turn, may be fatal.
- EGF epidermal growth factor
- EGF-based non-cytotoxic proteases one problem associated with the therapeutic application of EGF-based non-cytotoxic proteases is that efficacy may require the use of relatively high dosage levels. As mentioned above, this is undesirable for want of increased manufacture costs and/ or potential immunogenicity problems.
- the present invention addresses the above need(s), and solves one or more of the above-mentioned problems.
- the present invention provides alternative and/ or improved EGF re-targeted non-cytotoxic proteases, which are useful for various clinical and therapeutic applications, in particular for treating inflammation, mucus secretion-related disorders such as asthma and COPD, as well as neuroendocrine disorders, and neuroendocrine tumours.
- a first aspect of the present invention provides a polypeptide, comprising:
- a non-cytotoxic protease that is capable of cleaving a SNARE protein b. a translocation peptide that is capable of translocating said non- cytotoxic protease from within an endosome of a mammalian cell, across the endosomal membrane thereof and into the cytosol of the mammalian cell; and c. an epidermal growth factor (EGF) mutein, wherein
- said EGF mutein comprises an amino acid sequence having at least 65% sequence identity to the amino acid sequence of naturally-occurring human EGF (SEQ ID NO: 1 ), and wherein said EGF mutein amino acid sequence differs from the amino acid sequence of SEQ ID NO: 1 by at least one amino acid insertion, deletion or substitution at a position selected from amino acid positions
- said EGF mutein amino acid sequence has an amino acid sequence backbone that retains all 6 cysteine amino acid residues as they appear at positions 6, 14, 20, 31 , 33 and 42 in SEQ ID NO: 1.
- EGF binds to its natural receptor (ie. the EGF receptor; also known as ErbB ⁇ via a binding reaction, which involves two distinct binding interfaces present on the EGF molecule, namely a first binding interface (ie. Binding Interface 1) provided by the sequence of amino acid residues at positions 31-40 of SEQ ID NO: 1 , and a second binding interface (ie. Binding Interface 2) provided the sequence of amino acid residues at positions 41-45 of SEQ ID NO: 1. These two Binding Interfaces are believed to bind to either side of a cleft, which is present in the EGF receptor, and into which a small portion (referred to as the Leading Edge) of the EGF molecule is then inserted.
- the Leading Edge a small portion
- the present inventors have provided a new EGF mutein, which confers improved receptor activation properties on the EGF non-cytotoxic fusion molecules of the present invention when compared with corresponding wild-type EGF fusions.
- the EGF mutein is modified (compared with SEQ ID NO: 1 ) by substitution or deletion of one or more 'bulky' amino acid residues present in the Leading Edge, wherein said 'bulky' amino acid residues are selected from phenylalanine (F), tryptophan (W), or tyrosine (Y).
- suitable substitutions may be selected from the group consisting of: leucine (L), isoleucine (I), valine (V), alanine (A), glycine (G), serine (S), threonine (T), asparagine (N), glutamine (Q), and methionine (M).
- said substitution or deletion is at positions 48-51 , preferably at position 49 and/ or position 50 (compared with SEQ ID NO: 1 ).
- position 49 is preferably substituted (compared with SEQ ID NO: 1 ) to leucine (L), isoleucine (I) or valine (V), preferably to leucine (L); and/ or position 50 is preferably substituted (compared with SEQ ID NO: 1 ) to alanine (A), glycine (G), serine (S), threonine (T) or methionine (M), preferably to alanine (A).
- the EGF mutein may be separately or further modified (compared with SEQ ID NO: 1 ) by substitution or deletion of one or more amino acid residues present at positions 15-17 of the Leading Edge. Modifications within this region are believed to increase the stability of the Leading Edge, for example by introduction of one or more additional inter- or intra- molecular hydrogen bonds.
- suitable substitutions may be selected from the group consisting of: asparagine (N), glutamine (Q), aspartate (D), cysteine (C), glycine (G), leucine (L), serine (S), threonine (T), valine (V), tryptophan (W), and tyrosine (Y).
- position 16 is preferably substituted (compared with SEQ ID NO: 1 ) to asparagine (N) or glutamine (Q).
- the EGF mutein may be further modified (compared with SEQ ID NO: 1 ) by substitution or deletion of one or more amino acid residues present at positions 23-29. These positions are close to the Binding Interface 1 (discussed above), and help provide additional stability to the EGF mutein.
- suitable substitutions may be selected from the group consisting of: glycine (G), alanine (A), serine (S), threonine (T), methionine (M), arginine (R), lysine (K), and histidine (H).
- preferred substitutions are introduced at one or more of positions 24-28.
- position 24 is preferably substituted (compared with SEQ ID NO: 1) to glycine (G), alanine (A), serine (S), threonine (T) or methionine (M), preferably to glycine (G); and/ or position 25 is preferably substituted (compared with SEQ ID NO: 1) to threonine (T), glycine (G), alanine (A), serine (S), or methionine (M), preferably to threonine (T); and/ or position 28 is preferably substituted (compared with SEQ ID NO: 1) to arginine (R), lysine (K) or histidine (H), preferably to arginine (R).
- the EGF mutein may be further modified (compared with SEQ ID NO: 1) by substitution or deletion of one or more amino acid residues present at positions 3-5. These positions are close to where the EGF mutein is typically fused to the larger body of the fusion protein, and help provide additional stability to the EGF mutein.
- suitable substitutions may be selected from the group consisting of: proline (P), arginine (R), lysine (K), and histidine (H).
- position 4 is preferably substituted (compared with SEQ ID NO: 1 ) to proline (P), and/ or position 5 is preferably substituted (compared with SEQ ID NO: 1) to arginine (R), lysine (K) or histidine (H), preferably lysine (K).
- the EGF mutein may be further modified (compared with SEQ ID NO: 1 ) by substitution or deletion of one or more amino acid residues present at positions 10-12. These positions are close to where the EGF mutein is typically fused to the larger body of the fusion protein, and help provide additional stability to the EGF mutein.
- suitable substitutions may be selected from the group consisting of: glutamic acid (E) and aspartic acid (D).
- position 11 is preferably substituted (compared with SEQ ID NO:
- the EGF mutein may be further modified (compared with SEQ ID NO: 1) by substitution or deletion of one or more amino acid residues present at positions 37-39. These positions are close to both the Binding Interface 1 and Binding Interface 2 (discussed above), and help provide additional stability to the EGF mutein.
- suitable substitutions may be selected from the group consisting of: valine (V), leucine (L), and isoleucine (I).
- position 38 is preferably substituted (compared with SEQ ID NO: 1) to valine (V), leucine (L) or isoleucine (I), preferably to valine (V).
- the present inventors have noted that the activation ability of an EGF molecule (for its natural EGF receptor) is significantly reduced when the EGF molecule is present as part of a much larger fusion protein, as is the case when such a molecule is used as a Targeting Moiety in a non-cytotoxic fusion protein.
- This problem is addressed by the present invention by the introduction of one or more mutations, which increase the activation ability of said EGF molecule when it is present as part of a larger non-cytotoxic fusion protein.
- This improves the cell targeting efficiency of the polypeptides of the present invention, and means that lower dosage regimens may be employed. The latter reduces manufacturing costs, and minimises undesirable, patient-related antigenic effects against the polypeptides of the invention.
- EGF mutein of the present invention has improved activation ability for an EGF (eg. ErbB) receptor - by way of example, we refer to Examples 4 & 5.
- EGF eg. ErbB
- the EGF fusions of the present invention demonstrate a binding affinity to an EGF receptor (e.g. ErbB-i) that is greater than 4 or 2nM, or greater than 0.4 or 0.2nM, or greater than 0.04 or 0.02nM.
- an EGF receptor e.g. ErbB-i
- the EGF fusions of the present invention demonstrate a binding activation of an EGF receptor (e.g. ErbB-i) that is greater than 6 pEC 5 o, or greater than 7 pEC 50 , or greater than 8 pEC 50 .
- an EGF receptor e.g. ErbB-i
- the EGF mutein comprises at least one amino acid deletion, substitution or insertion visa-vis naturally-occurring human EGF (SEQ ID NO: 1), though with the proviso that none of the 6 cysteine amino acid residues of naturally-occurring human EGF is so altered.
- the EGF mutein comprises at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 such deletions, substitutions or insertions. Of said modifications, substitutions are the most preferred, as they have less effect on secondary or tertiary structure.
- the EGF mutein preferably has at most 4 or 5, more preferably at most 2 or 3, and particularly preferably at most 1 such deletion and/ or insertion.
- the EGF mutein comprises no more than 15, 14 or 13, preferably no more than 12, 11 or 10 amino acid deletions, substitutions or insertions vis-a-vis naturally- occurring human EGF (SEQ ID NO: 1). Of said modifications, substitutions are the most preferred, as they have less effect on secondary or tertiary structure.
- the EGF mutein preferably has at most 4 or 5, more preferably at most 2 or 3, and particularly preferably at most 1 such deletion and/ or insertion.
- the EGF mutein comprises (or consists of) at least 37 amino acid residues.
- an EGF mutein comprising this length has a primary amino acid sequence that closely mimics the 6 cysteine consensus sequence backbone of naturally- occurring hEGF (eg. SEQ ID NO:1).
- a 37 amino acid sequence is characterised by cysteine residues at positions (in an N-terminal to C-terminal direction) 1 , 9, 15, 26, 28 and 37.
- the EGF mutein comprises at least 39 or 41 , preferably at least 43 or 45, more preferably at least 47 or 49 contiguous amino acid residues.
- the EGF mutein comprises at least 51 , 52 or 53 amino acid residues.
- the EGF mutein differs from naturally-occurring human EGF in that it comprises at least one (or more, as detailed above) deletion, substitution or insertion at any of the positions: D 3 S 4 E 5 , P 7 L 8 S 9 , G 12 Y 13 , L 15 H 16 , M 21 Y 22 I 23 E 24 A 25 , I 3 SG 39 E 40 R 41 , Q 43 Y 44 R 45 D 46 L 47 K 48 W 49 W 50 E 51 L 52 (positions and letters refer to the one-letter amino acid code of naturally-occurring human EGF - SEQ ID NO:1 ).
- D 3 can be substituted with G, N, Y, A or F
- S 4 can be substituted with T, P, F, Q or R
- E 5 can be substituted with G, K, or Q
- P 7 can be substituted with S
- L 8 can be substituted with P, S, R or Q
- S 9 can be substituted by P
- Gi 2 can be substituted with E, D, or Q
- Y 13 can be substituted with H or W
- L 15 can be substituted by A, I, M, F or V
- H 16 can be substituted with Q, N, A, E, D or Y, M 21 can be substituted with V, R, or K
- Y 22 can be substituted with H, I 23 can be substituted with V or L
- E 24 can be substituted with K, G or V
- a 25 can be substituted with S, T, or Q
- I 38 can be substituted with T, S, A, N, L, or V
- G 39 can be substituted with E, Q, K,
- Q 18 can be substituted with E, Q, K, F or L; and/ or V 35 can be substituted with E; D17 can be substituted by G; V19 can be substituted by A.
- N 1 can be substituted by S, K, Y, T or H
- S 2 can be substituted by G or R
- E 5 can be substituted by G or K
- H 10 can be substituted by Y
- D 11 can be substituted by N, S, or E
- L 26 can be substituted by V
- K 28 can be substituted by R, S, or T
- a 30 can be substituted by V
- N 32 can be substituted by S
- V 34 can be substituted by A
- V 35 can be substituted by A.
- the EGF mutein differs from naturally-occurring human EGF in that it comprises at least one (or more, as detailed above) deletion, substitution or insertion at any of the positions G 12 Y 13 , H 16 (positions and letters refer to the one-letter amino acid code of naturally-occurring human EGF - SEQ ID NO:1 ).
- G 12 may be substituted by an amino acid residue such as glutamine (Q) or asparagine (N).
- Y 13 may be substituted by a residue such as tryptophan (W) or phenylalanine (F)
- H 16 may be substituted by a residue such as aspartic acid (D), glutamic acid (E), glycine (G), alanine (A), serine (S), or threonine (T).
- the EGF mutein comprises an amino acid sequence as set forth in any of SEQ ID NOs: 6-32, 34, 36, 38, 40, 42, 44, 46, 49, 50, 52, 54, 56, 58, and 60.
- This embodiment embraces variants thereof having at least 80%, at least 85%, at least 90%, at least 95%, or at least 97% sequence identity thereto, though with the proviso that said variants always retain the specific amino acid substitution(s) illustrated in said SEQ ID NOs when compared with wild-type human EGF (ie. SEQ ID NO: 1 ).
- This embodiment also embraces variants thereof having at least 80%, at least 85%, at least 90%, at least 95%, or at least 97% sequence identity thereto, though with the proviso that said variants always retain a conservative amino acid substitution of the specific amino acid substitution(s) illustrated in said SEQ ID NOs when compared with wild-type human EGF (ie. SEQ ID NO: 1 ).
- the biologically active component of the polypeptides of the present invention is a non-cytotoxic protease.
- Non-cytotoxic proteases are produced by a variety of plants, and by a variety of microorganisms such as clostridial sp. and neisserial sp. (e.g. N. gonorrhoeae).
- the non-cytotoxic protease of the present invention is a clostridial neurotoxin protease or a neisserial IgA protease.
- translocation peptide also referred to as the translocation domain
- this component serves to translocate the non-cytotoxic protease across the endosomal membrane and into the cytosol of a target cell, where the protease component may then exert its proteolytic effect on SNARE proteins.
- Translocation peptides are well known in the art, and are produced by a variety of plants and microorganisms.
- the translocation peptide of the present invention is a clostridial neurotoxin translocation peptide (also known as a clostridial translocation domain, or H N ).
- the polypeptide of the present invention comprises a modified EGF molecule, which acts as a Targeting Moiety (TM) to direct the polypeptide to a selected target cell(s), for example by binding to an EGF receptor on a mucus-secreting cell.
- TM Targeting Moiety
- the EGF receptor is an ErbB receptor, preferably an E ⁇ B 1 receptor.
- a non- cytotoxic polypeptide (as defined above), for use in treating a range of medical conditions and diseases.
- the present invention provides use of said non-cytotoxic polypeptides and corresponding methods for the suppression of mucus hypersecretion, in particular conditions or diseases in which mucus hypersecretion is a causative element, such as (chronic) bronchitis, chronic obstructive pulmonary disease (COPD), and asthma.
- a causative element such as (chronic) bronchitis, chronic obstructive pulmonary disease (COPD), and asthma.
- the present invention provides use and corresponding methods for the suppression of inflammation.
- the present invention provides use and corresponding methods for the suppression of endocrine neoplasia such as MEN, thyrotoxicosis and neuroendocrine disorders such as Cushing's disease, acromegaly, hyperandrogenism, chronic anovulation, polycystic ovarian syndrome, carcinoid syndrome, hypoglycaemic syndrome, necrolytic migratory erythema, Zollinger-Ellison syndrome, and Verner-Morrison syndrome.
- endocrine neoplasia such as MEN, thyrotoxicosis and neuroendocrine disorders such as Cushing's disease, acromegaly, hyperandrogenism, chronic anovulation, polycystic ovarian syndrome, carcinoid syndrome, hypoglycaemic syndrome, necrolytic migratory erythema, Zollinger-Ellison syndrome, and Verner-Morrison syndrome.
- the present invention provides use and corresponding methods for the suppression of neuroendocrine tumours such as non-carcinoid gastroenteropancreatic neuroendocrine tumours, carcinoid tumours, pituitary tumours and phaeochromocytomas, and for suppressing cancers such as colorectal cancer, prostate cancer, breast cancer, and lung cancer.
- neuroendocrine tumours such as non-carcinoid gastroenteropancreatic neuroendocrine tumours, carcinoid tumours, pituitary tumours and phaeochromocytomas
- cancers such as colorectal cancer, prostate cancer, breast cancer, and lung cancer.
- a polypeptide of the invention binds to an EGF (eg. ErbB) receptor (the Binding Site), which is present on and preferably characteristic of a target cell.
- EGF eg. ErbB
- the EGF TM binds to mucus-secreting cells (e.g. epithelial goblet cells, or submucosal gland mucus-secreting cells).
- mucus-secreting cells e.g. epithelial goblet cells, or submucosal gland mucus-secreting cells.
- the EGF TM binds to inflammatory leukocyte cells (e.g. neutrophils).
- the EGF TM may bind to a tumour cell itself, or to a growth hormone-secreting cell (eg. a pituitary cell).
- the polypeptide of the invention (at least the non-cytotoxic protease component thereof) becomes endocytosed into a vesicle, and the translocation component then directs transport of the non-cytotoxic protease across the endosomal membrane and into the cytosol of the target cell.
- the non-cytotoxic protease component inhibits the cellular exocytic fusion process, and thereby inhibits release/ secretion from the target cell.
- the polypeptides of the present invention comprise 3 principal components: a 'warhead' (ie. a non-cytotoxic protease); an EGF mutein TM; and a translocation domain.
- a 'warhead' ie. a non-cytotoxic protease
- EGF mutein TM a translocation domain.
- the general technology associated with the preparation of such fusion proteins is often referred to as re-targeted toxin technology.
- WO94/21300 WO96/33273
- WO98/07864 WO00/10598; WO01/21213; WO06/059093; WO00/62814; WO00/04926; WO93/15766; WO00/61192; and WO99/58571. All of these publications are herein incorporated by reference thereto.
- the TM component of the present invention may be fused to either the protease component or the translocation component of the present invention.
- Said fusion is preferably by way of a covalent bond, for example either a direct covalent bond or via a spacer/ linker molecule.
- the protease component and the translocation component are preferably linked together via a covalent bond, for example either a direct covalent bond or via a spacer/ linker molecule.
- Suitable spacer/ linked molecules are well known in the art, and typically comprise an amino acid-based sequence of between 5 and 40, preferably between 10 and 30 amino acid residues in length.
- the polypeptides have a di-chain conformation, wherein the protease component and the translocation component are linked together, preferably via a disulphide bond.
- polypeptides of the present invention may be prepared by conventional chemical conjugation techniques, which are well known to a skilled person.
- chemical conjugation techniques such as Hermanson, GT. (1996), Bioconjugate techniques, Academic Press, and to Wong, S. S. (1991), Chemistry of protein conjugation and cross-linking, CRC Press.
- polypeptides may be prepared by recombinant preparation of a single polypeptide fusion protein (see, for example, WO98/07864). This technique is based on the in vivo bacterial mechanism by which native clostridial neurotoxin (ie. holotoxin) is prepared, and results in a fusion protein having the following 'simplified' structural arrangement:
- the TM is placed towards the C-terminal end of the fusion protein.
- the fusion protein is then activated by treatment with a protease, which cleaves at a site between the protease component and the translocation component.
- a di-chain protein is thus produced, comprising the protease component as a single polypeptide chain covalently attached (via a disulphide bridge) to another single polypeptide chain containing the translocation component plus TM.
- the fusion proteins of the present invention may be prepared according to WO06/05093 such that the TM has an N-terminal domain that is 'free' for interaction with a Binding Site on a target cell.
- the TM component of the fusion protein is located towards the middle of the linear fusion protein sequence, between the protease cleavage site and the translocation component. Subsequent cleavage at the protease cleavage site exposes the N-terminal portion of the TM, and provides the di-chain polypeptide fusion protein.
- protease cleavage sequence(s) may be introduced (and/ or any inherent cleavage sequence removed) at the DNA level by conventional means, such as by site-directed mutagenesis. Screening to confirm the presence of cleavage sequences may be performed manually or with the assistance of computer software (e.g. the MapDraw program by DNASTAR, Inc.). Whilst any protease cleavage site may be employed (ie. clostridial, or non-clostridial), the following are preferred:
- protease cleavage site is an intein, which is a self- cleaving sequence.
- the self-splicing reaction is controllable, for example by varying the concentration of reducing agent present.
- the above-mentioned 'activation' cleavage sites may also be employed as a 'destructive' cleavage site (discussed below) should one be incorporated into a polypeptide of the present invention.
- the fusion protein of the present invention may comprise one or more N-terminal and/ or C-terminal located purification tags. Whilst any purification tag may be employed, the following are preferred:
- His-tag e.g. 6 * histidine
- His-tag preferably as a C-terminal and/ or N-terminal tag
- MBP-tag maltose binding protein
- GST-tag glutthione-S-transferase
- His-MBP-tag preferably as an N-terminal tag
- GST-MBP-tag preferably as an N-terminal tag
- Thioredoxin-tag preferably as an N-terminal tag
- CBD-tag (Chitin Binding Domain), preferably as an N-terminal tag.
- One or more peptide spacer/ linker molecules may be included in the fusion protein.
- a peptide spacer may be employed between a purification tag and the rest of the fusion protein molecule.
- a third aspect of the present invention provides a nucleic acid (e.g. DNA) sequence encoding a polypeptide as described above.
- Said nucleic acid may be included in the form of a vector, such as a plasmid, which may optionally include one or more of an origin of replication, a nucleic acid integration site, a promoter, a terminator, and a ribosome binding site.
- a vector such as a plasmid, which may optionally include one or more of an origin of replication, a nucleic acid integration site, a promoter, a terminator, and a ribosome binding site.
- the present invention also includes a method for expressing the above-described nucleic acid sequence (i.e. the third aspect of the present invention) in a host cell, in particular in E. coli.
- the present invention also includes a method for activating a polypeptide of the present invention, said method comprising contacting the polypeptide with a protease that cleaves the polypeptide at a recognition site (cleavage site) located between the non-cytotoxic protease component and the translocation component, thereby converting the polypeptide into a di-chain polypeptide wherein the non-cytotoxic protease and translocation components are joined together by a disulphide bond.
- the recognition site is not native to a naturally-occurring clostridial neurotoxin and/ or to a naturally-occurring IgA protease.
- the polypeptides of the present invention may be further modified to reduce or prevent unwanted side-effects associated with dispersal into non-targeted areas.
- the polypeptide comprises a destructive cleavage site.
- the destructive cleavage site is distinct from the 'activation' site (i.e. di-chain formation), and is cleavable by a second protease and not by the non-cytotoxic protease.
- the polypeptide has reduced potency (e.g. reduced binding ability to the intended target cell, reduced translocation activity and/ or reduced non-cytotoxic protease activity).
- any of the 'destructive' cleavage sites of the present invention may be separately employed as an 'activation' site in a polypeptide of the present invention.
- the present invention provides a polypeptide that can be controllably inactivated and/ or destroyed at an off-site location.
- the destructive cleavage site is recognised and cleaved by a second protease (i.e. a destructive protease) selected from a circulating protease (e.g. an extracellular protease, such as a serum protease or a protease of the blood clotting cascade), a tissue-associated protease (e.g. a matrix metal loprotease (MMP), such as an MMP of muscle), and an intracellular protease (preferably a protease that is absent from the target cell.
- a circulating protease e.g. an extracellular protease, such as a serum protease or a protease of the blood clotting cascade
- a tissue-associated protease e.g. a matrix metal loprotease (MMP), such as an MMP of muscle
- MMP matrix metal loprotease
- an intracellular protease preferably a protease that is absent
- polypeptide of the present invention when a polypeptide of the present invention become dispersed away from its intended target cell and/ or be taken up by a non-target cell, the polypeptide will become inactivated by cleavage of the destructive cleavage site (by the second protease).
- the destructive cleavage site is recognised and cleaved by a second protease that is present within an off-site cell-type.
- the off-site cell and the target cell are preferably different cell types.
- the destructive cleavage site is recognised and cleaved by a second protease that is present at an off-site location (e.g. distal to the target cell).
- the target cell and the off-site cell may be either the same or different cell-types.
- the target cell and the off-site cell may each possess a receptor to which the same polypeptide of the invention binds.
- the destructive cleavage site of the present invention provides for inactivation/ destruction of the polypeptide when the polypeptide is in or at an off-site location.
- cleavage at the destructive cleavage site minimises the potency of the polypeptide (when compared with an identical polypeptide lacking the same destructive cleavage site, or possessing the same destructive site but in an uncleaved form).
- reduced potency includes: reduced binding (to a mammalian cell receptor) and/ or reduced translocation (across the endosomal membrane of a mammalian cell in the direction of the cytosol), and/ or reduced SNARE protein cleavage.
- the destructive cleavage site(s) are not substrates for any proteases that may be separately used for post-translational modification of the polypeptide of the present invention as part of its manufacturing process.
- the non- cytotoxic proteases of the present invention typically employ a protease activation event (via a separate 'activation' protease cleavage site, which is structurally distinct from the destructive cleavage site of the present invention).
- the purpose of the activation cleavage site is to cleave a peptide bond between the non-cytotoxic protease and the translocation or the binding components of the polypeptide of the present invention, thereby providing an 'activated' di-chain polypeptide wherein said two components are linked together via a di-sulfide bond.
- the former are preferably introduced into polypeptide of the present invention at a position of at least 20, at least 30, at least 40, at least 50, and more preferably at least 60, at least 70, at least 80 (contiguous) amino acid residues away from the 'activation' cleavage site.
- the destructive cleavage site(s) and the activation cleavage site are preferably exogenous (i.e. engineered/ artificial) with regard to the native components of the polypeptide.
- said cleavage sites are preferably not inherent to the corresponding native components of the polypeptide.
- a protease or translocation component based on BoNT/A L-chain or H-chain may be engineered according to the present invention to include a cleavage site. Said cleavage site would not, however, be present in the corresponding BoNT native L- chain or H-chain.
- the Targeting Moiety component of the polypeptide is engineered to include a protease cleavage site, said cleavage site would not be present in the corresponding native sequence of the corresponding Targeting Moiety.
- the destructive cleavage site(s) and the 'activation' cleavage site are not cleaved by the same protease.
- the two cleavage sites differ from one another in that at least one, more preferably at least two, particularly preferably at least three, and most preferably at least four of the tolerated amino acids within the respective recognition sequences is/ are different.
- a destructive cleavage site that is a site other than a Factor Xa site, which may be inserted elsewhere in the L-chain and/ or H N and/ or TM component(s).
- the polypeptide may be modified to accommodate an alternative 'activation' site between the L-chain and H N components (for example, an enterokinase cleavage site), in which case a separate Factor Xa cleavage site may be incorporated elsewhere into the polypeptide as the destructive cleavage site.
- the existing Factor Xa 'activation' site between the L-chain and H N components may be retained, and an alternative cleavage site such as a thrombin cleavage site incorporated as the destructive cleavage site.
- an alternative cleavage site such as a thrombin cleavage site incorporated as the destructive cleavage site.
- a cleavage site is selected that already possesses (in the correct position(s)) at least one, preferably at least two of the amino acid residues that are required in order to introduce the new cleavage site.
- the Caspase 3 cleavage site may be introduced.
- a preferred insertion position is identified that already includes a primary sequence selected from, for example, Dxxx, xMxx, xxQx, xxxD, DMxx, DxQx, DxxD, xMQx, xMxD, xxQD, DMQx, xMQD, DxQD, and DMxD.
- cleavage sites into surface exposed regions. Within surface exposed regions, existing loop regions are preferred.
- the destructive cleavage site(s) are introduced at one or more of the following position(s), which are based on the primary amino acid sequence of BoNT/A. Whilst the insertion positions are identified (for convenience) by reference to BoNT/A, the primary amino acid sequences of alternative protease domains and/ or translocation domains may be readily aligned with said BoNT/A positions.
- protease component one or more of the following positions is preferred: 27- 31 , 56-63, 73-75, 78-81 , 99-105, 120-124, 137-144, 161-165, 169-173, 187-194, 202-214, 237-241 , 243-250, 300-304, 323-335, 375-382, 391-400, and 413-423.
- the above numbering preferably starts from the N-terminus of the protease component of the present invention.
- the destructive cleavage site(s) are located at a position greater than 8 amino acid residues, preferably greater than 10 amino acid residues, more preferably greater than 25 amino acid residues, particularly preferably greater than 50 amino acid residues from the N-terminus of the protease component.
- the destructive cleavage site(s) are located at a position greater than 20 amino acid residues, preferably greater than 30 amino acid residues, more preferably greater than 40 amino acid residues, particularly preferably greater than 50 amino acid residues from the C-terminus of the protease component.
- one or more of the following positions is preferred: 474.479, 483-495, 507-543, 557-567, 576-580, 618-631 , 643-650, 669-677, 751-767, 823-834, 845-859.
- the above numbering preferably acknowledges a starting position of 449 for the N-terminus of the translocation domain component of the present invention, and an ending position of 871 for the C-terminus of the translocation domain component.
- the destructive cleavage site(s) are located at a position greater than 10 amino acid residues, preferably greater than 25 amino acid residues, more preferably greater than 40 amino acid residues, particularly preferably greater than 50 amino acid residues from the N-terminus of the translocation component.
- the destructive cleavage site(s) are located at a position greater than 10 amino acid residues, preferably greater than 25 amino acid residues, more preferably greater than 40 amino acid residues, particularly preferably greater than 50 amino acid residues from the C-terminus of the translocation component.
- the destructive cleavage site(s) are located at a position greater than 10 amino acid residues, preferably greater than 25 amino acid residues, more preferably greater than 40 amino acid residues, particularly preferably greater than 50 amino acid residues from the N-terminus of the TM component.
- the destructive cleavage site(s) are located at a position greater than 10 amino acid residues, preferably greater than 25 amino acid residues, more preferably greater than 40 amino acid residues, particularly preferably greater than 50 amino acid residues from the C-terminus of the TM component.
- the polypeptide of the present invention may include one or more (e.g. two, three, four, five or more) destructive protease cleavage sites. Where more than one destructive cleavage site is included, each cleavage site may be the same or different. In this regard, use of more than one destructive cleavage site provides improved off-site inactivation. Similarly, use of two or more different destructive cleavage sites provides additional design flexibility.
- the destructive cleavage site(s) may be engineered into any of the following component(s) of the polypeptide: the non-cytotoxic protease component; the translocation component; the Targeting Moiety; or the spacer peptide (if present).
- the destructive cleavage site(s) are chosen to ensure minimal adverse effect on the potency of the polypeptide (for example by having minimal effect on the targeting/ binding regions and/ or translocation domain, and/ or on the non-cytotoxic protease domain) whilst ensuring that the polypeptide is labile away from its target site/ target cell.
- Preferred destructive cleavage sites are listed in the Table immediately below.
- the listed cleavage sites are purely illustrative and are not intended to be limiting to the present invention.
- Matrix metalloproteases are a preferred group of destructive proteases in the context of the present invention.
- ADAM17 EC 3.4.24.86, also known as TACE
- Additional, preferred MMPs include adamalysins, serralysins, and astacins.
- Another group of preferred destructive proteases is a mammalian blood protease, such as Thrombin, Coagulation Factor Vila, Coagulation Factor IXa, Coagulation Factor Xa, Coagulation Factor XIa, Coagulation Factor XIIa, Kallikrein, Protein C, and MBP-associated serine protease.
- said destructive cleavage site comprises a recognition sequence having at least 3 or 4, preferably 5 or 6, more preferably 6 or 7, and particularly preferably at least 8 contiguous amino acid residues.
- the longer (in terms of contiguous amino acid residues) the recognition sequence the less likely nonspecific cleavage of the destructive site will occur via an unintended second protease.
- the destructive cleavage site of the present invention is introduced into the protease component and/ or the Targeting Moiety and/ or into the translocation component and/ or into the spacer peptide.
- the protease component is preferred. Accordingly, the polypeptide may be rapidly inactivated by direct destruction of the non-cytotoxic protease and/ or binding and/ or translocation components.
- the present invention employs a pharmaceutical composition, comprising a polypeptide, together with at least one component selected from a pharmaceutically acceptable carrier, excipient, adjuvant, propellant and/ or salt.
- a pharmaceutically acceptable carrier comprising a polypeptide, together with at least one component selected from a pharmaceutically acceptable carrier, excipient, adjuvant, propellant and/ or salt.
- the polypeptides of the present invention may be formulated for oral, parenteral, continuous infusion, inhalation or topical application.
- Compositions suitable for injection may be in the form of solutions, suspensions or emulsions, or dry powders which are dissolved or suspended in a suitable vehicle prior to use.
- the polypeptide may be formulated as a cream (eg. for topical application), or for sub-dermal injection.
- Local delivery means may include an aerosol, or other spray (eg. a nebuliser).
- an aerosol formulation of a polypeptide enables delivery to the lungs and/or other nasal and/or bronchial or airway passages.
- One route of administration is via laproscopic and/ or localised injection.
- delivery may be systemic such as via intravenous administration.
- a pharmaceutically active substance to assist retention at or reduce removal of the polypeptide from the site of administration.
- a pharmaceutically active substance is a vasoconstrictor such as adrenaline.
- Such a formulation confers the advantage of increasing the residence time of polypeptide following administration and thus increasing and/or enhancing its effect.
- Polypeptides of the invention may be administered to a patient by intrathecal or epidural injection in the spinal column at the level of the spinal segment involved in the innervation of an affected organ.
- the dosage ranges for administration of the polypeptides of the present invention are those to produce the desired therapeutic effect. It will be appreciated that the dosage range required depends on the precise nature of the polypeptide or composition, the route of administration, the nature of the formulation, the age of the patient, the nature, extent or severity of the patient's condition, contraindications, if any, and the judgement of the attending physician. Variations in these dosage levels can be adjusted using standard empirical routines for optimisation. Suitable daily dosages (per kg weight of patient) are in the range 0.0001 -1 ng/kg, preferably 0.0001-0.5 ng/kg, more preferably 0.002-0.5 ng/kg, and particularly preferably 0.004-0.5 ng/kg. The unit dosage can vary from less that 1 picogram to 30 ng, but typically will be in the region of 0.01 to 1 ng per dose, which may be administered daily or preferably less frequently, such as weekly or six monthly.
- a particularly preferred dosing regimen is based on 2.5 ng of polypeptide as the 1X dose.
- preferred dosages are in the range 1X-100X (i.e. 2.5-250 ng).
- Fluid dosage forms are typically prepared utilising the polypeptide and a pyrogen-free sterile vehicle.
- the polypeptide depending on the vehicle and concentration used, can be either dissolved or suspended in the vehicle.
- the polypeptide can be dissolved in the vehicle, the solution being made isotonic if necessary by addition of sodium chloride and sterilised by filtration through a sterile filter using aseptic techniques before filling into suitable sterile vials or ampoules and sealing.
- solution stability is adequate, the solution in its sealed containers may be sterilised by autoclaving.
- Advantageously additives such as buffering, solubilising, stabilising, preservative or bactericidal, suspending or emulsifying agents and or local anaesthetic agents may be dissolved in the vehicle.
- Dry powders which are dissolved or suspended in a suitable vehicle prior to use, may be prepared by filling pre-sterilised ingredients into a sterile container using aseptic technique in a sterile area. Alternatively the ingredients may be dissolved into suitable containers using aseptic technique in a sterile area. The product is then freeze dried and the containers are sealed aseptically.
- Parenteral suspensions suitable for intramuscular, subcutaneous or intradermal injection, are prepared in substantially the same manner, except that the sterile components are suspended in the sterile vehicle, instead of being dissolved and sterilisation cannot be accomplished by filtration.
- the components may be isolated in a sterile state or alternatively it may be sterilised after isolation, e.g. by gamma irradiation.
- a suspending agent for example polyvinylpyrrolidone is included in the composition/s to facilitate uniform distribution of the components.
- Administration in accordance with the present invention may take advantage of a variety of delivery technologies including microparticle encapsulation, viral delivery systems or high-pressure aerosol impingement.
- Targeting Moiety means any chemical structure that functionally interacts with a Binding Site to cause a physical association between the polypeptide of the invention and the surface of a target cell (typically a mammalian cell, especially a human cell).
- the term TM embraces any molecule (ie. a naturally occurring molecule, or a chemically/ physically modified variant thereof) that is capable of binding to a Binding Site on the target cell, which Binding Site is capable of internalisation (eg. endosome formation) - also referred to as receptor-mediated endocytosis.
- the TM may possess an endosomal membrane translocation function, in which case separate TM and Translocation Domain components need not be present in an agent of the present invention.
- TMs have been described, for example by reference to SEQ ID NOs.
- Reference to said TMs is merely exemplary, and the present invention embraces all variants and derivatives thereof, which retain the basic binding (i.e. targeting) ability of the exemplified TMs.
- the TM of the present invention binds (preferably specifically binds) to the target cell in question.
- the term “specifically binds” preferably means that a given TM (e.g. with the additional fusion protein components such as the translocation component and/ or the endopeptidase component) binds to the target cell with a binding affinity (Ka) of 10 8 M “1 or greater, preferably 10 9 M “1 or greater, more preferably 10 10 M "1 or greater, and most preferably, 10 11 M "1 or greater.
- TM in the present specification embraces fragments and variants thereof, which retain an ability to bind to the target cell and/ or EGF (eg. ErbB) receptor in question.
- a variant may have at least 70 % or 75%, or at least 80% or 85%, or at least 90% or 95% amino acid sequence homology with a reference TM (eg. SEQ ID NO: 1 , and/ or the 37 amino acid sequence thereof that comprises the 6-cysteine backbone thereof).
- a variant may include one or more analogues of an amino acid (e.g. an unnatural amino acid), or a substituted linkage.
- fragment when used in relation to a TM, means a peptide having at least thirty seven, or at least forty, or at least forty five, or at least fifty amino acid residues of the reference TM.
- the term fragment also relates to the above-mentioned variants.
- a fragment of the present invention may comprise a peptide sequence having at least 37, 40, 45 or 50 amino acids, wherein the peptide sequence has at least 80% sequence homology over a corresponding peptide sequence (of contiguous) amino acids of the reference peptide.
- the EGF TM of the present invention has 99% or less, 97% or less, 95% or less, 93% or less, 91 % or less, 89% or less, 87% or less, 85% or less, 83% or less, 81% or less, 79% or less, 77% or less, 75% or less, 73% or less, 71 % or less sequence identity to naturally-occurring human EGF (SEQ ID NO: 1 , and/ or the 37 amino acid sequence thereof that comprises the 6-cysteine backbone thereof).
- TM binds to the selected target cell.
- tissue or cells representative of a target cell e.g. a mucus-secreting cell, or an inflammatory cell
- labelled (eg. tritiated) TM in the presence of an excess of unlabelled TM.
- the relative proportions of non-specific and specific binding may be assessed, thereby allowing confirmation that the TM binds to the target cell.
- the assay may include one or more binding antagonists, and the assay may further comprise observing a loss of TM binding. Examples of this type of experiment can be found in Hulme, E. C. (1990), Receptor-binding studies, a brief outline, pp. 303-311 , In Receptor biochemistry, A Practical Approach, Ed. E. C. Hulme, Oxford University Press.
- the polypeptides of the present invention may lack a functional H c domain of a clostridial neurotoxin. Accordingly, said polypeptides are not able to bind rat synaptosomal membranes (via a clostridial H c component) in binding assays as described in Shone et al. (1985) Eur. J. Biochem. 151 , 75-82.
- the polypeptides preferably lack the last 50 C-terminal amino acids of a clostridial neurotoxin holotoxin.
- the polypeptides preferably lack the last 100, preferably the last 150, more preferably the last 200, particularly preferably the last 250, and most preferably the last 300 C-terminal amino acid residues of a clostridial neurotoxin holotoxin.
- the Hc binding activity may be negated/ reduced by mutagenesis - by way of example, referring to BoNT/ A for convenience, modification of one or two amino acid residue mutations (W1266 to L and Y1267 to F) in the ganglioside binding pocket causes the H c region to lose its receptor binding function.
- Analogous mutations may be made to non-serotype A clostridial peptide components, e.g.
- botulinum B with mutations (W1262 to L and Y1263 to F) or botulinum E (W1224 to L and Y1225 to F).
- Other mutations to the active site achieve the same ablation of H c receptor binding activity, e.g. Y1267S in botulinum type A toxin and the corresponding highly conserved residue in the other clostridial neurotoxins. Details of this and other mutations are described in Rummel et al (2004) (Molecular Microbiol. 51 :631-634), which is hereby incorporated by reference thereto.
- the Hc peptide of a native clostridial neurotoxin comprises approximately 400-440 amino acid residues, and consists of two functionally distinct domains of approximately 25kDa each, namely the N-terminal region (commonly referred to as the HcN peptide or domain) and the C-terminal region (commonly referred to as the Hcc peptide or domain).
- This fact is confirmed by the following publications, each of which is herein incorporated in its entirety by reference thereto: Umland TC (1997) Nat. Struct. Biol. 4: 788-792; Herreros J (2000) Biochem. J. 347: 199-204; Halpern J (1993) J. Biol. Chem. 268: 15, pp.
- H C c which constitutes the C- terminal 160-200 amino acid residues, is responsible for binding of a clostridial neurotoxin to its natural cell receptors, namely to nerve terminals at the neuromuscular junction - this fact is also confirmed by the above publications.
- a clostridial heavy-chain lacking a functional heavy chain H c peptide (or domain) such that the heavy-chain is incapable of binding to cell surface receptors to which a native clostridial neurotoxin binds means that the clostridial heavy-chain simply lacks a functional H C c peptide.
- the H C c peptide region is either partially or wholly deleted, or otherwise modified (e.g. through conventional chemical or proteolytic treatment) to inactivate its native binding ability for nerve terminals at the neuromuscular junction.
- a clostridial H N peptide of the present invention lacks part of a C-terminal peptide portion (H C c) of a clostridial neurotoxin and thus lacks the H c binding function of native clostridial neurotoxin.
- the C-terminally extended clostridial H N peptide lacks the C-terminal 40 amino acid residues, or the C-terminal 60 amino acid residues, or the C-terminal 80 amino acid residues, or the C-terminal 100 amino acid residues, or the C-terminal 120 amino acid residues, or the C-terminal 140 amino acid residues, or the C-terminal 150 amino acid residues, or the C-terminal 160 amino acid residues of a clostridial neurotoxin heavy-chain.
- the clostridial H N peptide of the present invention lacks the entire C-terminal peptide portion (H C c) of a clostridial neurotoxin and thus lacks the H c binding function of native clostridial neurotoxin.
- the clostridial H N peptide lacks the C-terminal 165 amino acid residues, or the C-terminal 170 amino acid residues, or the C-terminal 175 amino acid residues, or the C-terminal 180 amino acid residues, or the C-terminal 185 amino acid residues, or the C-terminal 190 amino acid residues, or the C-terminal 195 amino acid residues of a clostridial neurotoxin heavy-chain.
- the clostridial H N peptide of the present invention lacks a clostridial H C c reference sequence selected from the group consisting of:
- Botulinum type A neurotoxin - amino acid residues (Y 11 1 1-L1296)
- Botulinum type B neurotoxin - amino acid residues (Y1098-E1291 )
- Botulinum type C neurotoxin - amino acid residues (Y1 112-E1291 )
- Botulinum type D neurotoxin - amino acid residues (Y1099-E1276)
- Botulinum type E neurotoxin - amino acid residues (Y1086-K1252)
- Botulinum type F neurotoxin - amino acid residues (Y1106-E1274)
- Botulinum type G neurotoxin - amino acid residues (Y 1 106-E1297) Tetanus neurotoxin - amino acid residues (Y1128-D1315).
- the protease of the present invention embraces all non-cytotoxic proteases that are capable of cleaving one or more SNARE proteins of the exocytic fusion apparatus in eukaryotic cells.
- the protease of the present invention is preferably a bacterial protease (or fragment thereof). More preferably the bacterial protease is selected from the genera Clostridium (e.g. a clostridial L-chain). The protease of the present invention preferably demonstrates a serine or metalloprotease activity (e.g. endopeptidase activity).
- the present invention also embraces variant non-cytotoxic proteases (ie. variants of naturally-occurring protease molecules), so long as the variant proteases still demonstrate the requisite protease activity.
- a variant may have at least 70%, preferably at least 80%, more preferably at least 90%, and most preferably at least 95 or at least 98% amino acid sequence homology with a reference protease sequence.
- the term variant includes non-cytotoxic proteases having enhanced (or decreased) endopeptidase activity - particular mention here is made to the increased K cat /K m of BoNT/A mutants Q161A, E54A, and K165L see Ahmed, S.A. (2008) Protein J.
- fragment when used in relation to a protease, typically means a peptide having at least 150, preferably at least 200, more preferably at least 250, and most preferably at least 300 amino acid residues of the reference protease.
- protease 'fragments' of the present invention embrace fragments of variant proteases based on a reference sequence.
- protease domains of neurotoxins for example the protease domains of bacterial neurotoxins.
- the present invention embraces the use of neurotoxin domains, which occur in nature, as well as recombinantly prepared versions of said naturally-occurring neurotoxins.
- Exemplary neurotoxins are produced by Clostridia, and the term clostridial neurotoxin embraces neurotoxins produced by C. tetani (TeNT), and by C. botulinum (BoNT) serotypes A-G, as well as the closely related BoNT-like neurotoxins produced by C. baratii and C. butyricum.
- TeNT C. tetani
- BoNT botulinum
- BoNT/A denotes the source of neurotoxin as BoNT (serotype A).
- Corresponding nomenclature applies to other BoNT serotypes.
- BoNTs are the most potent toxins known, with median lethal dose (LD50) values for mice ranging from 0.5 to 5 ng/kg depending on the serotype. BoNTs are adsorbed in the gastrointestinal tract, and, after entering the general circulation, bind to the presynaptic membrane of cholinergic nerve terminals and prevent the release of their neurotransmitter acetylcholine.
- LD50 median lethal dose
- BoNTs share a common structure, being di-chain proteins of -150 kDa, consisting of a heavy chain (H-chain) of -100 kDa covalently joined by a single disulphide bond to a light chain (L-chain) of -50 kDa.
- the H-chain consists of two domains, each of -50 kDa.
- the C-terminal domain (H c ) is required for the high-affinity neuronal binding, whereas the N-terminal domain (H N ) is proposed to be involved in membrane translocation.
- the L-chain is a zinc-dependent metalloprotease responsible for the cleavage of the substrate SNARE protein.
- L-chain fragment means a component of the L-chain of a neurotoxin, which fragment demonstrates a metalloprotease activity and is capable of proteolytically cleaving a non-neuronal SNARE protein.
- protease (reference) sequences examples include:
- Botulinum type A neurotoxin - amino acid residues (1-448)
- Botulinum type B neurotoxin - amino acid residues (1-440)
- Botulinum type C neurotoxin - amino acid residues (1-441 )
- Botulinum type D neurotoxin - amino acid residues (1-445)
- Botulinum type E neurotoxin - amino acid residues (1-422)
- Botulinum type F neurotoxin - amino acid residues (1-439)
- Botulinum type G neurotoxin - amino acid residues (1-441 )
- Tetanus neurotoxin - amino acid residues (1-457)
- the above-identified reference sequence should be considered a guide as slight variations may occur according to sub-serotypes.
- US 2007/0166332 (hereby incorporated by reference thereto) cites slightly different clostridial sequences:
- Botulinum type A neurotoxin - amino acid residues (M1-K448)
- Botulinum type B neurotoxin - amino acid residues (M1-K441 )
- Botulinum type C neurotoxin - amino acid residues (M1-K449)
- Botulinum type D neurotoxin - amino acid residues (M1-R445)
- Botulinum type E neurotoxin - amino acid residues M1-R422)
- Botulinum type F neurotoxin - amino acid residues (M1-K439)
- Botulinum type G neurotoxin - amino acid residues (M1-K446)
- Tetanus neurotoxin - amino acid residues (M1-A457)
- a variety of clostridial toxin fragments comprising the light chain can be useful in aspects of the present invention with the proviso that these light chain fragments can specifically target the core components of the neurotransmitter release apparatus and thus participate in executing the overall cellular mechanism whereby a clostridial toxin proteolytically cleaves a substrate.
- the light chains of clostridial toxins are approximately 420-460 amino acids in length and comprise an enzymatic domain. Research has shown that the entire length of a clostridial toxin light chain is not necessary for the enzymatic activity of the enzymatic domain. As a non-limiting example, the first eight amino acids of the BoNT/A light chain are not required for enzymatic activity.
- the first eight amino acids of the TeNT light chain are not required for enzymatic activity.
- the carboxyl- terminus of the light chain is not necessary for activity.
- the last 32 amino acids of the BoNT/A light chain are not required for enzymatic activity.
- the last 31 amino acids of the TeNT light chain are not required for enzymatic activity.
- aspects of this embodiment can include clostridial toxin light chains comprising an enzymatic domain having a length of, for example, at least 350 amino acids, at least 375 amino acids, at least 400 amino acids, at least 425 amino acids and at least 450 amino acids.
- Other aspects of this embodiment can include clostridial toxin light chains comprising an enzymatic domain having a length of, for example, at most 350 amino acids, at most 375 amino acids, at most 400 amino acids, at most 425 amino acids and at most 450 amino acids.
- the non-cytotoxic protease component of the present invention preferably comprises a BoNT/A, C or D serotype L-chain (or fragment or variant thereof).
- the polypeptides of the present invention may be PEGylated - this may help to increase stability, for example duration of action of the protease component.
- PEGylation is particularly preferred when the protease comprises a BoNT/E protease.
- PEGylation preferably includes the addition of PEG to the N-terminus of the protease component.
- the N- terminus of a protease may be extended with one or more amino acid (e.g. cysteine) residues, which may be the same or different.
- One or more of said amino acid residues may have its own PEG molecule attached (e.g. covalently attached) thereto.
- An example of this technology is described in WO2007/104567, which is incorporated in its entirety by reference thereto.
- the polypeptides of the present invention may include mutations and/ deletions at one or more "secondary modification sites" - these sites are targeted and acted upon by enzymes (such as intracellular enzymes), which alter the biological persistence of the polypeptides of the invention.
- Such mutations/ deltions may comprise the mutation or deletion of part or all of said one or more secondary modification sites.
- Such an increase in biological persistence is particular desired when longevity of action of the non-cytotoxic protease component of the present invention is desired.
- the polypeptides of the invention may include the addition of one or more secondary modification site.
- the mutation or deletion of part or all of a secondary modification site found in a polypeptide of the present invention, or the addition of a secondary modification site to a polypeptide of the present invention, may lead to an enhanced biological persistence of the polypeptide.
- the biological persistence of the polypeptide may be about 20% to about 300% greater than in the absence of any structural modification to a secondary modification site.
- inhibition of secretion from target cells is increased by about 20% to about 300%.
- the enhanced biological persistence may take the form of an increased biological half-life of the polypeptide.
- the biological half-life of the polypeptide is preferably increased by about 10%; more preferably, the biological half-life of the polypeptide is increased by about 100%.
- botulinum neurotoxin A and botulinum neurotoxin E have the following potential secondary modification sites, as shown in Tables A and B, respectively. These sites may be targeted for mutation or deletion of all or part of the site.
- Casein kinase Il (CK-2) phosphorylation sites: 51-TNPE; 70-SYYD; 79-TDNE; 120- STID; 253-SGLE; 258-SFEE; 275-SLQE; 384-TIYD
- N-terminal myristylation sites 15-GVDIAY; 141-GSYRSE; 254-GLEVSF
- PKC Protein kinase C
- Tyrosine phosphorylation sites 92-KLFERIY; 334-KLKFDKLY
- Casein kinase Il (CK-2) phosphorylation sites: 51-TPQD; 67-SYYD; 76-SDEE; 130-
- N-terminal myristylation sites 220-GLYGAK; 257-GTDLNI; 386-GQNANL
- PKC Protein kinase C
- a further example is the addition of a casein kinase Il phosphorylation site, such as TDNE to a polypeptide of the present invention.
- the polypeptides of the present invention may comprise one or more tyrosine phosphorylation sites in addition to any naturally existing tyrosine phosphorylation sites already present.
- the one or more additional tyrosine phosphorylation sites may be present in the non-cytotoxic protease component of the polypeptide, in the translocating domain of the polypeptide, or in the targeting domain of the polypeptide.
- Such sites may be added to the polypeptide as an addition to the polypeptide sequence, or may be substituted into the polypeptide sequence.
- the tyrosine phosphorylation site may substitute about 1-8, or about 1-4, consecutive amino acids of the non-cytotoxic protease component.
- the additional presence of such sites may increase the biological persistence of the polypeptides.
- increased biological persistence may result in an increased duration of action of the polypeptide, or an increased half-life of the polypeptide, or both.
- tyrosine phosphorylation site is suitable for use in the polypeptides of the present invention.
- suitable tyrosine phosphorylation sites include KLFERIY and KLKFDKLY.
- the polypeptides of the present invention may also have their biological persistence enhanced by the presence within the polypeptide of leucine-based motifs.
- the leucine-based motifs may be added in addition to the polypeptide sequence or included as a substitution.
- a leucine-based motif may comprise seven contiguous amino acids. These may be further described as consisting of a group of five amino acids (a quintet) and a group immediately adjacent of two amino acids (a duplet). The duplet of amino acids may be located at either the N-terminal or C-terminal end of the leucine-based motif.
- the quintet of amino acids may include at least one acidic amino acid selected from the group consisting of glutamic acid and aspartic acid.
- the duplet of amino acids includes at least one hydrophobic acid; examples of such hydrophobic amino acids include leucine, isoleucine, methionine, alanine, phenylalanine, tryptophan, valine and tyrosine.
- the duplet of amino acids is preferably a leucine-leucine, a leucine-isoleucine, an isoleucine-leucine, an isoleucine-isoleucine or a leucine-methionine.
- the duplet of amino acids is even more preferably a leucine-leucine.
- the quintet of amino acids may comprise at least one amino acid containing a hydroxyl group; examples of such amino acids include serine, threonine and tyrosine.
- the hydroxyl-containing amino acid is preferably phosphorylated. Even more preferably, the hydroxyl-containing amino acid is a serine which can be phosphorylated to allow for the binding of adapter proteins.
- leucine-based motifs may also comprise modified amino acids.
- a leucine-based motif may include a halogenated leucine, preferably a fluorinated leucine.
- leucine-based motifs examples include (where x can be any amino acid) xDxxxLL, xExxxLL, xDxxxLI, xDxxxLM, xExxxLI, xExxxIL, xExxxLM.
- a suitable leucine-based motif is phenylalanine-glutamate-phenylalanine-tyrosine- lysine-leucine-leucine.
- VMAT vesicular monoamine transporter.
- VAChT vesicular acetylcholine transporter.
- S. cerevisiae Vam3p a yeast homologue of synaptobrevin. Underlined serine residues are potential sites of phosphorylation.
- the polypeptides of the present invention may also comprise tyrosine-based motifs.
- the presence of a tyrosine-based motif may act to increase the biological persistence of the polypeptide.
- Tyrosine-based motifs suitable for use in the present invention comprise the sequence Y-X-X-Hy, where Y is tyrosine, X is any amino acid, and Hy is a hydrophobic amino acid.
- YKLL is YKLL.
- a Translocation Domain is a molecule that enables translocation of a protease into a target cell such that a functional expression of protease activity occurs within the cytosol of the target cell. Whether any molecule (e.g. a protein or peptide) possesses the requisite translocation function of the present invention may be confirmed by any one of a number of conventional assays.
- Shone C. (1987) describes an in vitro assay employing liposomes, which are challenged with a test molecule. Presence of the requisite translocation function is confirmed by release from the liposomes of K + and/ or labelled NAD, which may be readily monitored [see Shone C. (1987) Eur. J. Biochem; vol. 167(1 ): pp. 175- 180].
- Blaustein R. (1987) describes a simple in vitro assay employing planar phospholipid bilayer membranes. The membranes are challenged with a test molecule and the requisite translocation function is confirmed by an increase in conductance across said membranes [see Blaustein (1987) FEBS Letts; vol. 226, no. 1 : pp. 1 15-120].
- a variant may have at least 70%, preferably at least 80%, more preferably at least 90%, and most preferably at least 95% or at least 98% amino acid sequence homology with a reference translocation domain.
- the term fragment when used in relation to a translocation domain, means a peptide having at least 20, preferably at least 40, more preferably at least 80, and most preferably at least 100 amino acid residues of the reference translocation domain.
- the fragment preferably has at least 100, preferably at least 150, more preferably at least 200, and most preferably at least 250 amino acid residues of the reference translocation domain (eg. H N domain).
- translocation 'fragments' of the present invention embrace fragments of variant translocation domains based on the reference sequences.
- the Translocation Domain is preferably capable of formation of ion-permeable pores in lipid membranes under conditions of low pH. Preferably it has been found to use only those portions of the protein molecule capable of pore-formation within the endosomal membrane.
- the Translocation Domain may be obtained from a microbial protein source, in particular from a bacterial or viral protein source.
- the Translocation Domain is a translocating domain of an enzyme, such as a bacterial toxin or viral protein.
- the Translocation Domain may be of a clostridial origin, such as the H N domain (or a functional component thereof).
- H N means a portion or fragment of the H-chain of a clostridial neurotoxin approximately equivalent to the amino-terminal half of the H- chain, or the domain corresponding to that fragment in the intact H-chain.
- the H- chain lacks the natural binding function of the H c component of the H-chain.
- the H c function may be removed by deletion of the H c amino acid sequence (either at the DNA synthesis level, or at the post-synthesis level by nuclease or protease treatment). Alternatively, the H c function may be inactivated by chemical or biological treatment.
- the H-chain is incapable of binding to the Binding Site on a target cell to which native clostridial neurotoxin (i.e. holotoxin) binds.
- Examples of suitable (reference) Translocation Domains include:
- Botulinum type A neurotoxin - amino acid residues (A449-K871 )
- Botulinum type B neurotoxin - amino acid residues A442-S858
- Botulinum type C neurotoxin - amino acid residues T450-N866
- Botulinum type D neurotoxin - amino acid residues (D446-N862)
- Botulinum type E neurotoxin - amino acid residues (K423-K845)
- Botulinum type F neurotoxin - amino acid residues A440-K864
- Botulinum type G neurotoxin - amino acid residues S447-S863
- Clostridial toxin H N regions comprising a translocation domain can be useful in aspects of the present invention with the proviso that these active fragments can facilitate the release of a non- cytotoxic protease (e.g. a clostridial L-chain) from intracellular vesicles into the cytoplasm of the target cell and thus participate in executing the overall cellular mechanism whereby a clostridial toxin proteolytically cleaves a substrate.
- the H N regions from the heavy chains of Clostridial toxins are approximately 410-430 amino acids in length and comprise a translocation domain.
- aspects of this embodiment can include clostridial toxin H N regions comprising a translocation domain having a length of, for example, at least 350 amino acids, at least 375 amino acids, at least 400 amino acids and at least 425 amino acids.
- Other aspects of this embodiment can include clostridial toxin H N regions comprising translocation domain having a length of, for example, at most 350 amino acids, at most 375 amino acids, at most 400 amino acids and at most 425 amino acids.
- H N embraces naturally-occurring neurotoxin H N portions, and modified H N portions having amino acid sequences that do not occur in nature and/ or synthetic amino acid residues, so long as the modified H N portions still demonstrate the above- mentioned translocation function.
- the Translocation Domain may be of a non-clostridial origin.
- the Translocation Domain may mirror the Translocation Domain present in a naturally-occurring protein, or may include amino acid variations so long as the variations do not destroy the translocating ability of the Translocation Domain.
- viral (reference) Translocation Domains suitable for use in the present invention include certain translocating domains of virally expressed membrane fusion proteins.
- translocation i.e. membrane fusion and vesiculation
- the translocation i.e. membrane fusion and vesiculation function of a number of fusogenic and amphiphilic peptides derived from the N-terminal region of influenza virus haemagglutinin.
- virally expressed membrane fusion proteins known to have the desired translocating activity are a translocating domain of a fusogenic peptide of Semliki Forest Virus (SFV), a translocating domain of vesicular stomatitis virus (VSV) glycoprotein G, a translocating domain of SER virus F protein and a translocating domain of Foamy virus envelope glycoprotein.
- SFV Semliki Forest Virus
- VSV vesicular stomatitis virus
- SER virus F protein a translocating domain of Foamy virus envelope glycoprotein.
- Virally encoded Aspike proteins have particular application in the context of the present invention, for example, the E1 protein of SFV and the G protein of the G protein of VSV.
- a variant may comprise one or more conservative nucleic acid substitutions and/ or nucleic acid deletions or insertions, with the proviso that the variant possesses the requisite translocating function.
- a variant may also comprise one or more amino acid substitutions and/ or amino acid deletions or insertions, so long as the variant possesses the requisite translocating function.
- the polypeptides of the present invention may further comprise a translocation facilitating domain.
- Said domain facilitates delivery of the non-cytotoxic protease into the cytosol of the target cell and are described, for example, in WO 08/008803 and WO 08/008805, each of which is herein incorporated by reference thereto.
- suitable translocation facilitating domains include an enveloped virus fusogenic peptide domain
- suitable fusogenic peptide domains include influenzavirus fusogenic peptide domain (eg. influenza A virus fusogenic peptide domain of 23 amino acids), alphavirus fusogenic peptide domain (eg. Semliki Forest virus fusogenic peptide domain of 26 amino acids), vesiculovirus fusogenic peptide domain (eg. vesicular stomatitis virus fusogenic peptide domain of 21 amino acids), respirovirus fusogenic peptide domain (eg. Sendai virus fusogenic peptide domain of 25 amino acids), morbiliivirus fusogenic peptide domain (eg.
- influenza virus fusogenic peptide domain eg. influenza A virus fusogenic peptide domain of 23 amino acids
- alphavirus fusogenic peptide domain eg. Semliki Forest virus fusogenic peptide domain of 26 amino acids
- Canine distemper virus fusogenic peptide domain of 25 amino acids canine distemper virus fusogenic peptide domain of 25 amino acids
- avulavirus fusogenic peptide domain eg. Newcastle disease virus fusogenic peptide domain of 25 amino acids
- henipavirus fusogenic peptide domain eg. Hendra virus fusogenic peptide domain of 25 amino acids
- metapneumovirus fusogenic peptide domain eg. Human metapneumovirus fusogenic peptide domain of 25 amino acids
- spumavirus fusogenic peptide domain such as simian foamy virus fusogenic peptide domain; or fragments or variants thereof.
- a translocation facilitating domain may comprise a Clostridial toxin H CN domain or a fragment or variant thereof.
- a Clostridial toxin H CN translocation facilitating domain may have a length of at least 200 amino acids, at least 225 amino acids, at least 250 amino acids, at least 275 amino acids.
- a Clostridial toxin H CN translocation facilitating domain preferably has a length of at most 200 amino acids, at most 225 amino acids, at most 250 amino acids, or at most 275 amino acids.
- Botulinum type A neurotoxin - amino acid residues (872-1 1 10)
- Botulinum type B neurotoxin - amino acid residues (859-1097)
- Botulinum type C neurotoxin - amino acid residues (867-1 1 1 1 )
- Botulinum type D neurotoxin - amino acid residues (863-1098)
- Botulinum type E neurotoxin - amino acid residues (846-1085)
- Clostridial toxin H CN domains include: Botulinum type A neurotoxin - amino acid residues (874-1 1 10) Botulinum type B neurotoxin - amino acid residues (861-1097) Botulinum type C neurotoxin - amino acid residues (869-1 1 1 1 ) Botulinum type D neurotoxin - amino acid residues (865-1098)
- Botulinum type E neurotoxin - amino acid residues (848-1085)
- Botulinum type F neurotoxin - amino acid residues (867-1 105)
- Botulinum type G neurotoxin - amino acid residues (866-1 105) Tetanus neurotoxin - amino acid residues (882-1 127)
- any of the above-described facilitating domains may be combined with any of the previously described translocation domain peptides that are suitable for use in the present invention.
- a non-clostridial facilitating domain may be combined with non-clostridial translocation domain peptide or with clostridial translocation domain peptide.
- a Clostridial toxin H CN translocation facilitating domain may be combined with a non-clostridial translocation domain peptide.
- a Clostridial toxin H CN facilitating domain may be combined or with a clostridial translocation domain peptide, examples of which include:
- Botulinum type C neurotoxin - amino acid residues (450-1 1 1 1 )
- Botulinum type D neurotoxin - amino acid residues (446-1098)
- Botulinum type E neurotoxin - amino acid residues (423-1085)
- Botulinum type F neurotoxin - amino acid residues (440-1 105)
- Botulinum type G neurotoxin - amino acid residues (447-1 105)
- Tetanus neurotoxin - amino acid residues (458-1 127)
- Sequence homology Any of a variety of sequence alignment methods can be used to determine percent identity, including, without limitation, global methods, local methods and hybrid methods, such as, e.g., segment approach methods. Protocols to determine percent identity are routine procedures within the scope of one skilled in the art. Global methods align sequences from the beginning to the end of the molecule and determine the best alignment by adding up scores of individual residue pairs and by imposing gap penalties. Non-limiting methods include, e.g., CLUSTAL W, see, e.g., Julie D.
- Mon-lirniting methods include, e.g., Match-box, see, e g.. E ⁇ c Depiereux and Ernest Feytmans. Match-Box.
- Match-box see, e g.. E ⁇ c Depiereux and Ernest Feytmans. Match-Box.
- percent sequence identity is determined by conventional methods. See, for example, Altschul et al., Bull. Math. Bio. 48: 603-16, 1986 and Henikoff and Henikoff, Proc. Natl. Acad. Sci. USA 89:10915-19, 1992. Briefly, two amino acid sequences are aligned to optimize the alignment scores using a gap opening penalty of 10, a gap extension penalty of 1 , and the "blosum 62" scoring matrix of Henikoff and Henikoff (ibid.) as shown below (amino acids are indicated by the standard one-letter codes). Alignment scores for determining sequence identity
- Substantially homologous polypeptides are characterized as having one or more amino acid substitutions, deletions or additions. These changes are preferably of a minor nature, that is conservative amino acid substitutions (see below) and other substitutions that do not significantly affect the folding or activity of the polypeptide; small deletions, typically of one to about 30 amino acids; and small amino- or carboxyl-terminal extensions, such as an amino-terminal methionine residue, a small linker peptide of up to about 20-25 residues, or an affinity tag.
- Aromatic phenylalanine tryptophan tyrosine
- non-standard amino acids such as 4- hydroxyproline, 6- ⁇ /-methyl lysine, 2-aminoisobutyric acid, isovaline and ⁇ -methyl serine
- a limited number of non-conservative amino acids, amino acids that are not encoded by the genetic code, and unnatural amino acids may be substituted for clostridial polypeptide amino acid residues.
- the polypeptides of the present invention can also comprise non-naturally occurring amino acid residues.
- Non-naturally occurring amino acids include, without limitation, trans-3-methylproline, 2,4-methano-proline, cis-4-hydroxyproline, trans-4-hydroxy-proline, N-methylglycine, allo-threonine, methyl-threonine, hydroxy-ethylcysteine, hydroxyethylhomo-cysteine, nitro-glutamine, homoglutamine, pipecolic acid, tert-leucine, norvaline, 2- azaphenylalanine, 3-azaphenyl-alanine, 4-azaphenyl-alanine, and 4- fluorophenylalanine.
- Several methods are known in the art for incorporating non- naturally occurring amino acid residues into proteins.
- an in vitro system can be employed wherein nonsense mutations are suppressed using chemically aminoacylated suppressor tRNAs.
- Methods for synthesizing amino acids and aminoacylating tRNA are known in the art. Transcription and translation of plasmids containing nonsense mutations is carried out in a cell free system comprising an E. coli S30 extract and commercially available enzymes and other reagents. Proteins are purified by chromatography. See, for example, Robertson et al., J. Am. Chem. Soc. 11 ⁇ :2722, 1991 ; Ellman et al., Methods Enzymol.
- coli cells are cultured in the absence of a natural amino acid that is to be replaced (e.g., phenylalanine) and in the presence of the desired non-naturally occurring amino acid(s) (e.g., 2-azaphenylalanine, 3-azaphenylalanine, 4-azaphenylalanine, or 4- fluorophenylalanine).
- the non-naturally occurring amino acid is incorporated into the polypeptide in place of its natural counterpart. See, Koide et al., Biochem. 33:7470- 6, 1994.
- Naturally occurring amino acid residues can be converted to non-naturally occurring species by in vitro chemical modification. Chemical modification can be combined with site-directed mutagenesis to further expand the range of substitutions (Wynn and Richards, Protein Sci. 2:395-403, 1993).
- a limited number of non-conservative amino acids, amino acids that are not encoded by the genetic code, non-naturally occurring amino acids, and unnatural amino acids may be substituted for amino acid residues of polypeptides of the present invention.
- Essential amino acids in the polypeptides of the present invention can be identified according to procedures known in the art, such as site-directed mutagenesis or alanine-scanning mutagenesis (Cunningham and Wells, Science 244: 1081-5, 1989).
- Sites of biological interaction can also be determined by physical analysis of structure, as determined by such techniques as nuclear magnetic resonance, crystallography, electron diffraction or photoaffinity labeling, in conjunction with mutation of putative contact site amino acids.
- Example 2 Construction of LH N /A-EGFv1 fusion protein
- Example 3 Expression and purification of a LH N /A-CT-EGF v1 fusion protein
- Example 6 Treatment of a patient suffering from chronic bronchitis
- Example 7 Method for treating acromegalic patients resistant to somatostatin analogues
- Example 1 Treatment of a patient suffering from rhinitis
- Example 12 Treatment of a patient suffering from asthma
- Example 13 Treatment of a patient suffering from COPD
- Example 14 Treatment of a patient suffering from asthma
- Example 15 Treatment of a patient suffering from colon cancer
- Example 16 Treatment of a patient suffering from psoriasis
- Example 17 Treatment of a patient suffering from eczema
- Example 18 Treatment of a patient suffering from colorectal cancer
- Example 19 Treatment of a patient suffering from prostate cancer
- Example 20 Treatment of a patient suffering from nsc lung cancer
- Example 21 Treatment of a patient suffering from breast cancer
- K28R_S4P SEQ ID 57 Protein sequence of LHC-EGFvI 3
- Fig. 1 illustrates the data generated in Example 10 in which EGF, EGF mutein, or EGF mutein fusion protein is tested for its ability (at increasing concentrations) to activate an EGF receptor.
- a low pEC 5 o value indicates relatively poor receptor activation.
- Fig. 2 illustrates a 3D model of EGF-EGF R binding, in which Binding Interface 1 (residues 31-40 of EGF), Binding Interface 2 (residues 41-45 of EGF), and the Leading Edge (residues 48-51 in combination with 15-17 of EGF) are identified.
- Example 1 Preparation of a LHA backbone construct The following procedure creates a clone for use as an expression backbone for multidomain protein expression. This example is based on preparation of a serotype A based clone (SEQ ID 2), though the procedures and methods are equally applicable to other LH N serotypes such as serotype B (SEQ ID 3), serotype C (SEQ ID 4) and serotype D (SEQ ID 5)
- pCR 4 (Invitrogen) is the chosen standard cloning vector chosen due to the lack of restriction sequences within the vector and adjacent sequencing primer sites for easy construct confirmation.
- the expression vector is based on the pET (Novagen) expression vector which has the desired restriction sequences within the multiple cloning site in the correct orientation for construct insertion (Ndel-BamHI-Sall-Pstl- Spel-Xbal-Hindlll). A fragment of the expression vector has been removed to create a non-mobilisable plasmid and a variety of different fusion tags have been inserted to increase purification options.
- the DNA sequence is designed by back translation of the LC/A amino acid sequence (obtained from freely available database sources such as GenBank (accession number P10845) using one of a variety of reverse translation software tools (for example Backtranslation tool v2.0 (Entelechon)). SamHI/Sa/l recognition sequences are incorporated at the 5' and 3' ends respectively of the sequence maintaining the correct reading frame.
- the DNA sequence is screened (using software such as
- E. coli codon usage is assessed by reference to software programs such as
- Entelechon, Geneart or Sigma-Genosys is provided in the pCR 4 vector.
- the DNA sequence is designed by back translation of the H N /A amino acid sequence (obtained from freely available database sources such as GenBank (accession number P10845) using one of a variety of reverse translation software tools (for example Back translation tool v2.0 (Entelechon)).
- a Pstl restriction sequence added to the N-terminus and Xbal-stop codon-/-//ndlll to the C-terminus ensuring the correct reading frame in maintained.
- the DNA sequence is screened (using software such as SeqBuilder, DNASTAR Inc.) for restriction enzyme cleavage sequences incorporated during the back translation. Any sequences that are found to be common to those required by the cloning system are removed by the Backtranslation tool from the proposed coding sequence ensuring common E.
- E. coli codon usage is maintained. E. coli codon usage is assessed by reference to software programs such as Graphical Codon Usage Analyser (Geneart), and the %GC content and codon usage ratio assessed by reference to published codon usage tables (for example GenBank Release 143, September 13 2004). This optimised DNA sequence is then commercially synthesized (for example by Entelechon, Geneart or Sigma-Genosys) and is provided in the pCR 4 vector.
- the LC-H N linker can be designed from first principle, using the existing sequence information for the linker as the template.
- the serotype A linker in this case defined as the inter-domain polypeptide region that exists between the cysteines of the disulphide bridge between LC and H N ) has the sequence VRGIIPFKTKSLDEGYNKALNDL.
- This sequence information is freely available from available database sources such as GenBank (accession number P10845).
- GenBank accession number P10845
- An alternative linker can be used for example composed of a Glycine-Serine linker (GGGGS 3 ).
- the native recognition sequence for Factor Xa (IEGR or IDGR) can be used for example in the modified sequence VDGIITSKTKSLIDGR or GGGGSGGGGSGGGGSIEGRGGGGSGGGGSGGGGS or
- GGGGSGGGGSGGGGSIEGR or the recognition sequence for the Light Chain of Enterokinase can be inserted, for example into the activation loop to generate the sequence VDGIITSKTKSLDDDDK or
- the DNA sequence encoding the linker region is determined.
- SamHI/Sa/l and Pst ⁇ /Xba ⁇ /stop codon//-//ndlll restriction enzyme sequences are incorporated at either end, in the correct reading frames.
- the DNA sequence is screened (using software such as Seqbuilder, DNASTAR Inc.) for restriction enzyme cleavage sequences incorporated during the back translation. Any sequences that are found to be common to those required by the cloning system are removed by the Backtranslation tool from the proposed coding sequence ensuring common E. coli codon usage is maintained.
- coli codon usage is assessed by reference to software programs such as Graphical Codon Usage Analyser (Geneart), and the %GC content and codon usage ratio assessed by reference to published codon usage tables (for example GenBank Release 143, September 13 2004).
- This optimised DNA sequence is then commercially synthesized (for example by Entelechon, Geneart or Sigma-Genosys) and is provided in the pCR 4 vector. If it is desired to clone the linker out of pCR 4 vector, the vector is cleaved with either BamYW + Sal ⁇ or Pst ⁇ + Xba ⁇ combination restriction enzymes.
- This cleaved vector then serves as the recipient vector for insertion and ligation of either the LC DNA (cleaved with SamHI/Sa/l) or H N DNA (cleaved with Pst ⁇ /Xba ⁇ ) from (SEQ ID 2).
- the LC or the H N encoding DNA is inserted upstream or downstream of the linker DNA, the entire LC-linker or Iinker-H N DNA fragment can the be isolated and transferred to the backbone clone.
- the LC-linker or the Iinker-H N is cut out from the pCR 4 cloning vector using BamH ⁇ /Pst1 or Sal1/Xba1 restriction enzymes or Xhol/Notl digests respectively.
- the pET expression vector containing LH N /A (SEQ ID 2) is digested with the same enzymes but is also treated with antarctic phosphatase as an extra precaution to prevent re-circularisation.
- the LC-linker or Iinker-H N region and the pET vector backbone are gel purified.
- the purified insert and vector backbone are ligated together using T4 DNA ligase and the product is transformed with TOP10 cells which are then screened for LC-linker or Iinker-H N insertion using SamHI/Sa/l or BamY ⁇ IPst ⁇ or Xhoi/Notl restriction enzymes to ensure the final backbone is correct.
- the integrity of the ORF DNA is checked by sequencing.
- Example 2 Construction of LH N /A-EGFv3 expression vector The following procedure creates a clone for use as an expression construct for multidomain fusion expression.
- This example is based on preparation of an EGFv3 fusion protein (eg. SEQ ID 37), though the procedures and methods are equally applicable to all EGF variants of the present invention, as well as to other LH N serotypes such as serotype B (SEQ ID 3), serotype C (SEQ ID 4) and serotype D (SEQ ID 5) fusion proteins of the present invention.
- a DNA sequence is designed to flank the spacer and targeting moiety (TM) regions allowing incorporation into the backbone clone (SEQ ID 1 ).
- the DNA sequence can be arranged as SamHI-Sa/l-Psfl-Xfc>al-spacer-EGF ⁇ /3-stop codon-H/ndlll.
- the DNA sequence can be designed using one of a variety of reverse translation software tools (for example EditSeq best E. coli reverse translation (DNASTAR Inc.), or Backtranslation tool v2.0 (Entelechon)).
- TM DNA is designed, the additional DNA required to encode the preferred spacer is created in silico.
- EGFv3 and restriction sequences It is important to ensure the correct reading frame is maintained for the spacer, EGFv3 and restriction sequences and that the Xba ⁇ sequence is not preceded by the bases, TC which would result in DAM methylation.
- the DNA sequence is screened for restriction sequence incorporated and any additional sequences are removed manually from the remaining sequence ensuring common E. coli codon usage is maintained.
- E. coli codon usage is assessed by reference to software programs such as Graphical Codon Usage Analyser (Geneart), and the %GC content and codon usage ratio assessed by reference to published codon usage tables (for example GenBank Release 143, September 13 2004). This optimised DNA sequence is then commercially synthesized (for example by Entelechon, Geneart or Sigma-Genosys) and is provided in the pCR 4 vector.
- the following two-step method is employed. Firstly, the H N domain is excised from the backbone clone using restriction enzymes Pst ⁇ and Xba ⁇ and ligated into similarly digested pCR 4-spacer-EGFv3 vector. This creates an H N -spacer-EGFv3 ORF in pCR 4 that can be excised from the vector using restriction enzymes Pst ⁇ and Hind ⁇ for subsequent ligation into similarly cleaved backbone or expression construct. The final construct contains the LC-linker-H N -spacer-EGFv3 ORF for transfer into expression vectors for expression to result in a fusion protein of the sequence (eg. SEQ ID 37).
- CT-EGF v3-A fusion activated by Factor Xa fusion protein is achieved using the following protocol. Inoculate 100 ml of modified TB containing 0.2% glucosamine and 30 ⁇ g/ml kanamycin in a 250 ml flask with a single colony from the CT-EGF v3-A fusion. Grow the culture at 37 0 C, 225 rpm for 16 hours. Inoculate 1 L of modified TB containing 0.2% glucosamine and 30 ⁇ g/ml kanamycin in a 2L flask with 10ml of overnight culture.
- Defrost falcon tube containing 35 ml 50 mM HEPES pH 7.2, 200 mM NaCI and approximately 10 g of £. coli BL21 (DE3) cell paste. Sonicate the cell paste on ice 30 seconds on, 30 seconds off for 10 cycles at a power of 22 microns ensuring the sample remains cool. Spin the lysed cells at 18 000 rpm, 4 0 C for 30 minutes. Load the supernatant onto a 0.1 M NiSO 4 charged Chelating column (20-30 ml column is sufficient) equilibrated with 50 mM HEPES pH 7.2 200 mM NaCI.
- a cell NR6, a murine 3T3- derived fibroblast cell line; WT - EGF
- WT - EGF a murine 3T3- derived fibroblast cell line
- ErbB endogenous EGF receptor
- WT+EGF a cell that lacks endogenous EGF receptor
- WT-EGF cells Prior to performing binding assays, confluent WT-EGF cells were dislodged from tissue culture plates with Versene. EGF competition binding was measured in two ways to insure that equilibrium had been reached: 5 x 10 4 NR6 WT cells were incubated with Alexa-488 labelled EGF wild-type for 30 min at 4°C.
- Example 6 Treatment of a patient suffering from chronic bronchitis.
- a 62 year old male suffering from chronic bronchitis presents at his GP.
- the GP prescribes a 6-month course of an EGF mutein fusion protein according to the present invention in nebuliser form, 80 ⁇ g to be taken monthly.
- the patient selects the most appropriate nebuliser for their personal situation from a range of suitable devices.
- Example 7 Method for treating acromegalic patients resistant to somatostatin analogues
- the consultant notices abnormal bone growth and, on questioning, the man reports increasing incidents of sleep apnoea and also increasingly oily skin.
- the physician recommends measurement of circulating IGF-1 and these are found to be elevated. Subsequent tests also show above-normal circulating GH levels so a cranial MRI scan is carried out. This shows a pituitary tumour of 9 mm diameter.
- the patient is treated with an EGF mutein fusion protein of the present invention by injection. At intervals of 1 week circulating IGF-1 levels are measured and are seen to be lower at the first measurement and to reduce steadily to 15% above normal over the following six weeks.
- the level of circulating GH is found to be normal at this time.
- a further dose of the medication with two-weekly IGF-1 measurements shows this hormone to have stabilised at the upper end of normal.
- a cranial MRI scan reveals shrinkage of the tumour to 6 mm.
- the therapy is continued at a reduced dosage at two-monthly intervals with IGF-1 and GH levels measured on the seventh week. These are both stable in the normal range and the sleep apnoea and oily skin are now absent.
- a spinal X-ray at one year following the first treatment shows no increased bone size from the original observation.
- A431 cells (1 x 10 5 ) were incubated with increasing concentrations of EGF, SXN100516 (LH N /A-EGF), SXN100988 (LH N /B-EGF) or SXN100501 (LH N /C-EGF) for 20 min at 37 0 C.
- A431 cells (1 x 10 5 ) were incubated with increasing concentrations of Syntaxin EGF mutein fusion or EGF for 20min at 37 0 C in triplicate eppendorf tubes. After washing, the cells were lysed and the lysates added to MSD 96 well plates coated with a capture antibody specific for phosphoY1068 of the EGF receptor.
- MSD Read buffer was added to the plate and the light emitted from each well of the plate (RLU) measured on the MSD sector imager 6000.
- Example 11 Treatment of a patient suffering from rhinitis
- a 43 years old female with a reduced quality of life due to chronic asthma is treated with by systemic injection of an EGF mutein fusion protein of the present invention.
- the symptoms of the patient have cleared and the patient can breathe more freely.
- the effect is sustained for 2 to 3 months, whereupon the treatment is repeated and the improvement to the quality of the patient's life is sustained.
- Example 13 Treatment of a patient suffering from COPD
- a 64 years old male with chronic obstructive pulmonary disease who has a reduced quality of life due to inability to breath effectively is treated by local administration (by aerosol) of an EGF mutein fusion protein of the present invention.
- the patient Within 2 to 5 days the patient has cleared most of the excess airway mucus and can breathe more freely. The effect is sustained for 2 to 3 months, whereupon the treatment is repeated and the improvement to the quality of the patient's life is sustained.
- Example 14 Treatment of a patient suffering from asthma
- a 25 years old male with severe exacerbation of his asthmatic symptoms due to a rhinovirus infection is treated by local administration (inhalation by aerosol) with an EGF mutein fusion protein of the present invention. Within 2 to 7 days the patient reports reduced airway mucus and the exacerbation subsides.
- Example 15 Treatment of a patient suffering from colon cancer A 32 years old male patient with jaundice is diagnosed with advanced hepatocellular carcinoma which has spread to the colon. The patient is treated with a systemic injection of an EGF mutein fusion protein of the present invention. Within two to three weeks the growth of the metastasized tumours has been arrested. Two months after the treatment the tumours have decreased in size and the jaundice has gone. A second application of treatment continues the decrease in tumour size and maintains the alleviation of symptoms.
- Example 16 Treatment of a patient suffering from psoriasis
- a 32 years old male patient diagnosed with psoriasis and who is experiencing significant physical discomfort from itching and scratching the affected areas of his back and arms is treated by topical administration with an EGF mutein fusion protein of the present invention. Within 2 to 7 days the symptoms are relieved and the effect lasts for 1 to 2 months. A second application of treatment maintains the alleviation of symptoms.
- Example 17 Treatment of a patient suffering from eczema
- a 45 years old male patient diagnosed with eczema and who is experiencing significant physical discomfort from itching and scratching the affected areas of his buttocks and legs is treated by topical administration with an EGF mutein fusion protein of the present invention. Within 2 to 7 days the symptoms are relieved and the effect lasts for 1 to 2 months. A second application of treatment maintains the alleviation of symptoms.
- Example 18 Treatment of a patient suffering from colorectal cancer
- a 70 years old male patient is diagnosed with (stage IV) colorectal cancer. Surgery is not recommended.
- the metastasised tumours have stopped increasing in size. Within one month the tumours have decreased in size and the patient reports feeling better.
- a second application of treatment further reduces the tumour size and maintains the alleviation of symptoms.
- Example 19 Treatment of a patient suffering from prostate cancer
- a 46 years old male patient is diagnosed with prostate cancer which has metastasized to the vertebrae. He complains of pains in the spine and pelvis. As surgery is inappropriate the patient is treated with a systemic injection of an EGF mutein fusion protein of the present invention. Within two weeks the tumours have decreased in size and the patient reports less pain. A second application of treatment continues the decrease in tumour size and maintains the alleviation of symptoms.
- Example 20 Treatment of a patient suffering from nsc lung cancer
- a 46 years old female patient is diagnosed with (stage IV) non-small cell lung carcinoma with a prognosis of 2% chance of living two years.
- the patient is treated with a systemic injection of an EGF mutein fusion protein of the present invention.
- the growth rate of the metastasized tumours has been arrested.
- Two months after the treatment the tumours have decreased in size and the patient feels better.
- a second application of treatment continues to decrease the tumour size and maintains the alleviation of symptoms. The patient increases her chances of survival beyond two years.
- Example 21 Treatment of a patient suffering from breast cancer
- a 36 years old female patient with jaundice is diagnosed with advanced breast cancer which has spread to the liver.
- the patient is treated with a systemic injection of an EGF mutein fusion protein of the present invention.
- the growth rate of the metastasized tumour has been arrested.
- Two months after the treatment the tumours have decreased in size and the jaundice has gone.
- a second application of treatment continues the decrease in tumour size and maintains the alleviation of symptoms.
- SEQ ID 1 Amino acid sequence for naturally-occurring, human epidermal growth factor (EGF) NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
- SEQ ID1 1 Protein sequence of a EGF variant targeting moiety v3 NSDPKCPLSHEGYCLNDGVCMYIGTLDRYACNCVVGYVGERCQYRDLKLAELR SEQ ID12 EGFW49I NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKIWELR
- NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCAYRDLKWWELR SEQ ID24 EGFW49N NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKNWELR
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- General Chemical & Material Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Gastroenterology & Hepatology (AREA)
- Pulmonology (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Biochemistry (AREA)
- Diabetes (AREA)
- Endocrinology (AREA)
- Pain & Pain Management (AREA)
- Rheumatology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Enzymes And Modification Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicinal Preparation (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2011523457A JP5658152B2 (ja) | 2008-08-21 | 2009-08-19 | 非細胞毒性融合タンパク質 |
| PL09785502T PL2326665T3 (pl) | 2008-08-21 | 2009-08-19 | Niecytotoksyczne białka fuzyjne obejmujące muteinę EGF |
| US13/059,695 US8614069B2 (en) | 2008-08-21 | 2009-08-19 | Non-cytotoxic fusion proteins comprising EGF muteins |
| EP09785502.7A EP2326665B1 (en) | 2008-08-21 | 2009-08-19 | Non-cytotoxic fusion proteins comprising egf muteins |
| DK09785502.7T DK2326665T3 (da) | 2008-08-21 | 2009-08-19 | Ikke-cytotoksiske fusionproteiner, omfattende egf-muteiner |
| ES09785502.7T ES2436816T3 (es) | 2008-08-21 | 2009-08-19 | Proteínas de fusión no citotóxicas que comprenden muteínas de EGF |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GBGB0815264.7A GB0815264D0 (en) | 2008-08-21 | 2008-08-21 | Non-cytotoxic proteins |
| GB0815264.7 | 2008-08-21 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2010020811A1 true WO2010020811A1 (en) | 2010-02-25 |
Family
ID=39812369
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/GB2009/051036 Ceased WO2010020811A1 (en) | 2008-08-21 | 2009-08-19 | Non-cytotoxic fusion proteins comprising egf muteins |
Country Status (9)
| Country | Link |
|---|---|
| US (1) | US8614069B2 (https=) |
| EP (1) | EP2326665B1 (https=) |
| JP (1) | JP5658152B2 (https=) |
| DK (1) | DK2326665T3 (https=) |
| ES (1) | ES2436816T3 (https=) |
| GB (1) | GB0815264D0 (https=) |
| PL (1) | PL2326665T3 (https=) |
| PT (1) | PT2326665E (https=) |
| WO (1) | WO2010020811A1 (https=) |
Cited By (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20090246827A1 (en) * | 1996-08-23 | 2009-10-01 | Syntaxin Limited | Recombinant toxin fragments |
| JP2013540816A (ja) * | 2010-10-25 | 2013-11-07 | ニッキ ファーマ インク. | 神経内分泌腫瘍を治療する方法 |
| US20150031611A1 (en) * | 2013-07-23 | 2015-01-29 | PnP Biopharm Co., Ltd. | Highly Stabilized Epidermal Growth Factor Mutants |
| WO2016156466A1 (en) * | 2015-03-31 | 2016-10-06 | Vhsquared Limited | Peptide construct having a protease-cleavable linker |
| WO2018050699A1 (en) | 2016-09-16 | 2018-03-22 | Ipsen Biopharm Limited | Method for producing di-chain clostridial neurotoxins |
| WO2018060351A1 (en) | 2016-09-29 | 2018-04-05 | Ipsen Biopharm Limited | Hybrid neurotoxins |
| WO2018073288A1 (en) | 2016-10-18 | 2018-04-26 | Ipsen Biopharm Limited | Cellular vamp cleavage assay |
| WO2019145577A1 (en) | 2018-01-29 | 2019-08-01 | Ipsen Biopharm Limited | Non-neuronal snare-cleaving botulinum neurotoxins |
| WO2020065336A1 (en) * | 2018-09-28 | 2020-04-02 | Ipsen Biopharm Limited | Clostridial neurotoxins comprising an exogenous activation loop |
| US10633438B2 (en) | 2015-03-31 | 2020-04-28 | Vhsquared Limited | Polypeptides |
| WO2020219599A1 (en) * | 2019-04-23 | 2020-10-29 | Aurora Oncology | Compositions and methods for treatment of distentable tissues |
| US11623952B2 (en) | 2019-06-21 | 2023-04-11 | Sorriso Pharmaceuticals, Inc. | IL-23 and TNF-alpha binding bi-specific heavy chain polypeptides |
| US11667719B2 (en) | 2019-06-21 | 2023-06-06 | Sorriso Pharmaceuticals, Inc. | VHH immunoglobulin chain variable domain that binds to IL-7R and methods of use thereof for treating autoimmune and/or inflammatory diseases |
| US11684677B2 (en) | 2016-09-30 | 2023-06-27 | Sorriso Pharmaceuticals, Inc. | Compositions |
| US12173054B2 (en) | 2015-03-31 | 2024-12-24 | Sorriso Pharmaceuticals, Inc. | Polypeptides |
| US12570736B2 (en) | 2019-06-21 | 2026-03-10 | Sorriso Pharmaceuticals, Inc. | Compositions |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8790897B2 (en) * | 1998-08-25 | 2014-07-29 | Syntaxin Ltd. | Treatment of mucus hypersecretion |
| JP5799397B2 (ja) | 2008-06-12 | 2015-10-28 | イプセン・バイオイノベーション・リミテッドIpsen Bioinnovation Limited | 癌の抑制 |
| US11241480B2 (en) * | 2017-01-26 | 2022-02-08 | Washington University | Methods for modulation of dietary and microbial exposure with compositions comprising an EGFR ligand |
| GB201900621D0 (en) * | 2019-01-16 | 2019-03-06 | Ipsen Biopharm Ltd | Labelled polypeptides |
| WO2024249812A2 (en) * | 2023-06-01 | 2024-12-05 | Blaze Bioscience, Inc. | Egf variants and methods of use thereof |
Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2003040310A2 (en) * | 2001-10-23 | 2003-05-15 | Waratah Pharmaceuticals, Inc. | Novel epidermal growth factor protein and gene, and methods of use therefor |
| EP1479693A1 (en) * | 2002-02-05 | 2004-11-24 | Japan Science and Technology Agency | Egf/egfr complex |
| WO2007109673A2 (en) * | 2006-03-20 | 2007-09-27 | Stanford University | Mutant epidermal growth factor polypeptides, nucleic acids, and uses therefor |
| US20080032928A1 (en) | 1998-08-25 | 2008-02-07 | Syntaxin Ltd. | Treatment of mucus hypersecretion |
| US20080038274A1 (en) | 1999-09-23 | 2008-02-14 | Foster Keith A | Inhibition of secretion from non-neuronal cells |
| WO2009083738A2 (en) * | 2007-12-31 | 2009-07-09 | Syntaxin Limited | Rna delivery vehicles |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8003A (en) * | 1851-03-25 | Improvement in scythe-tastenings | ||
| GB9818548D0 (en) * | 1998-08-25 | 1998-10-21 | Microbiological Res Authority | Treatment of mucas hypersecretion |
-
2008
- 2008-08-21 GB GBGB0815264.7A patent/GB0815264D0/en not_active Ceased
-
2009
- 2009-08-19 WO PCT/GB2009/051036 patent/WO2010020811A1/en not_active Ceased
- 2009-08-19 ES ES09785502.7T patent/ES2436816T3/es active Active
- 2009-08-19 JP JP2011523457A patent/JP5658152B2/ja not_active Expired - Fee Related
- 2009-08-19 PT PT97855027T patent/PT2326665E/pt unknown
- 2009-08-19 DK DK09785502.7T patent/DK2326665T3/da active
- 2009-08-19 PL PL09785502T patent/PL2326665T3/pl unknown
- 2009-08-19 EP EP09785502.7A patent/EP2326665B1/en active Active
- 2009-08-19 US US13/059,695 patent/US8614069B2/en active Active
Patent Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20080032928A1 (en) | 1998-08-25 | 2008-02-07 | Syntaxin Ltd. | Treatment of mucus hypersecretion |
| US20080038274A1 (en) | 1999-09-23 | 2008-02-14 | Foster Keith A | Inhibition of secretion from non-neuronal cells |
| WO2003040310A2 (en) * | 2001-10-23 | 2003-05-15 | Waratah Pharmaceuticals, Inc. | Novel epidermal growth factor protein and gene, and methods of use therefor |
| EP1479693A1 (en) * | 2002-02-05 | 2004-11-24 | Japan Science and Technology Agency | Egf/egfr complex |
| WO2007109673A2 (en) * | 2006-03-20 | 2007-09-27 | Stanford University | Mutant epidermal growth factor polypeptides, nucleic acids, and uses therefor |
| WO2009083738A2 (en) * | 2007-12-31 | 2009-07-09 | Syntaxin Limited | Rna delivery vehicles |
Non-Patent Citations (6)
| Title |
|---|
| "Harnessing toxins", 1 October 2006, MANUFACTURING CHEMIST, MORGAN-GRAMPIAN LTD. LONDON, GB, PAGE(S) 23 - 26, ISSN: 0262-4230, XP002497767 * |
| FOSTER K A ET AL., RE-ENGINEERING THE TARGET SPECIFICITY OF CLOSTRIDIAL NEUROTOXINS - A ROUTE TO NOVEL THERAPEUTICS, 2006 |
| FOSTER K A ET AL: "Re-engineering the target specificity of Clostridial neurotoxins - a route to novel therapeutics", NEUROTOXICITY RESEARCH, HARWOOD ACADEMIC PUBLISHERS, LAUSANNE, CH, vol. 9, no. 2-3, 1 April 2006 (2006-04-01), pages 101 - 107, XP009089826, ISSN: 1029-8428 * |
| FOSTER KEITH ET AL: "Engineered toxins: New therapeutics", TOXICON, vol. 51, no. Suppl. 1, June 2008 (2008-06-01), & 6TH INTERNATIONAL CONFERENCE ON BASIC AND THERAPEUTIC ASPECTS OF BOTULINUM AND TETANUS TOXINS; BAVENO, ITALY; JUNE 12 -15, 2008, pages 47 - 48, XP002560001, ISSN: 0041-0101 * |
| JORISSEN R N ET AL: "Modeling the epidermal growth factor - epidermal growth factor receptor L2 domain interaction: Implications for the ligand binding process", JOURNAL OF BIOMOLECULAR STRUCTURE & DYNAMICS, ADENINE PRESS, NEW YORK, NY, US, vol. 19, no. 6, 1 June 2002 (2002-06-01), pages 961 - 972, XP008115678, ISSN: 0739-1102 * |
| MAKINO K ET AL: "PROTON NMR STUDY ON THE SOLUTION CONFORMATION OF HUMAN EPIDERMAL GROWTH FACTOR", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, vol. 84, no. 22, 1987, pages 7841 - 7845, XP002560002, ISSN: 0027-8424 * |
Cited By (27)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20090246827A1 (en) * | 1996-08-23 | 2009-10-01 | Syntaxin Limited | Recombinant toxin fragments |
| US8454976B2 (en) * | 1996-08-23 | 2013-06-04 | Syntaxin Limited | Recombinant toxin fragments |
| JP2013540816A (ja) * | 2010-10-25 | 2013-11-07 | ニッキ ファーマ インク. | 神経内分泌腫瘍を治療する方法 |
| US9102755B2 (en) * | 2013-07-23 | 2015-08-11 | PnP Biopharm Co., Ltd. | Highly stabilized epidermal growth factor mutants |
| US20150031611A1 (en) * | 2013-07-23 | 2015-01-29 | PnP Biopharm Co., Ltd. | Highly Stabilized Epidermal Growth Factor Mutants |
| US10633438B2 (en) | 2015-03-31 | 2020-04-28 | Vhsquared Limited | Polypeptides |
| CN107427577A (zh) * | 2015-03-31 | 2017-12-01 | 韦斯夸尔德有限公司 | 具有蛋白酶可切割接头的肽构建体 |
| JP2018515596A (ja) * | 2015-03-31 | 2018-06-14 | ブイエイチスクエアード リミテッド | プロテアーゼで切断可能なリンカーを有するペプチド構築体 |
| WO2016156466A1 (en) * | 2015-03-31 | 2016-10-06 | Vhsquared Limited | Peptide construct having a protease-cleavable linker |
| US12234279B2 (en) | 2015-03-31 | 2025-02-25 | Sorriso Pharmaceuticals, Inc. | Peptide construct having a protease-cleavable linker |
| US12173054B2 (en) | 2015-03-31 | 2024-12-24 | Sorriso Pharmaceuticals, Inc. | Polypeptides |
| JP7064670B2 (ja) | 2015-03-31 | 2022-05-11 | ソリッソ ファーマシューティカルズ,インク. | プロテアーゼで切断可能なリンカーを有するペプチド構築体 |
| WO2018050699A1 (en) | 2016-09-16 | 2018-03-22 | Ipsen Biopharm Limited | Method for producing di-chain clostridial neurotoxins |
| WO2018060351A1 (en) | 2016-09-29 | 2018-04-05 | Ipsen Biopharm Limited | Hybrid neurotoxins |
| US11684677B2 (en) | 2016-09-30 | 2023-06-27 | Sorriso Pharmaceuticals, Inc. | Compositions |
| WO2018073288A1 (en) | 2016-10-18 | 2018-04-26 | Ipsen Biopharm Limited | Cellular vamp cleavage assay |
| WO2019145577A1 (en) | 2018-01-29 | 2019-08-01 | Ipsen Biopharm Limited | Non-neuronal snare-cleaving botulinum neurotoxins |
| WO2020065336A1 (en) * | 2018-09-28 | 2020-04-02 | Ipsen Biopharm Limited | Clostridial neurotoxins comprising an exogenous activation loop |
| CN113164565A (zh) * | 2018-09-28 | 2021-07-23 | 益普生生物制药有限公司 | 包含外源性活化环的梭菌神经毒素 |
| TWI869353B (zh) * | 2018-09-28 | 2025-01-11 | 英商艾普森生物製藥有限公司 | 包含外源性活化圈之梭狀芽孢桿菌神經毒素、其製造方法、及其相關應用 |
| US12589139B2 (en) | 2018-09-28 | 2026-03-31 | Ipsen Biopharm Limited | Clostridial neurotoxins comprising an exogenous activation loop |
| WO2020219599A1 (en) * | 2019-04-23 | 2020-10-29 | Aurora Oncology | Compositions and methods for treatment of distentable tissues |
| US11667719B2 (en) | 2019-06-21 | 2023-06-06 | Sorriso Pharmaceuticals, Inc. | VHH immunoglobulin chain variable domain that binds to IL-7R and methods of use thereof for treating autoimmune and/or inflammatory diseases |
| US11623952B2 (en) | 2019-06-21 | 2023-04-11 | Sorriso Pharmaceuticals, Inc. | IL-23 and TNF-alpha binding bi-specific heavy chain polypeptides |
| US12247079B2 (en) | 2019-06-21 | 2025-03-11 | Sorriso Pharmaceuticals, Inc. | Polynucleotides encoding, and method of making, a polypeptide comprising a VHH which binds interleukin-receptor (IL-7R) |
| US12559552B2 (en) | 2019-06-21 | 2026-02-24 | Sorriso Pharmaceuticals, Inc. | IL-23 and TNF-alpha binding bi-specific heavy chain polypeptides |
| US12570736B2 (en) | 2019-06-21 | 2026-03-10 | Sorriso Pharmaceuticals, Inc. | Compositions |
Also Published As
| Publication number | Publication date |
|---|---|
| ES2436816T3 (es) | 2014-01-07 |
| PL2326665T3 (pl) | 2014-03-31 |
| US20110177056A1 (en) | 2011-07-21 |
| EP2326665B1 (en) | 2013-10-09 |
| JP2012500018A (ja) | 2012-01-05 |
| GB0815264D0 (en) | 2008-09-24 |
| EP2326665A1 (en) | 2011-06-01 |
| JP5658152B2 (ja) | 2015-01-21 |
| PT2326665E (pt) | 2013-12-23 |
| US8614069B2 (en) | 2013-12-24 |
| DK2326665T3 (da) | 2013-11-25 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US8614069B2 (en) | Non-cytotoxic fusion proteins comprising EGF muteins | |
| AU2009340404B2 (en) | Modified non-cytotoxic proteases | |
| EP2310028B1 (en) | Fusion proteins for use in the treatment of acromegaly | |
| US8796216B2 (en) | Suppression of neuroendocrine diseases | |
| JP2012500018A5 (https=) | ||
| JP2012518403A5 (https=) | ||
| US20110158973A1 (en) | Suppression of cancers | |
| EP2958629A1 (en) | Therapeutics for suppressing osteoporosis | |
| AU2014200449B2 (en) | Suppression of neuroendocrine diseases | |
| HK40020225A (en) | Suppression of neuroendocrine diseases | |
| HK1154512A (en) | Fusion proteins for use in the treatment of acromegaly | |
| HK1154512B (en) | Fusion proteins for use in the treatment of acromegaly | |
| HK1190946B (en) | Fusion proteins for use in the treatment of acromegaly | |
| HK1190946A (en) | Fusion proteins for use in the treatment of acromegaly |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 09785502 Country of ref document: EP Kind code of ref document: A1 |
|
| DPE1 | Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101) | ||
| ENP | Entry into the national phase |
Ref document number: 2011523457 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2009785502 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 13059695 Country of ref document: US |