WO2009158015A2 - Antagonists of actriib and uses for increasing red blood cell levels - Google Patents
Antagonists of actriib and uses for increasing red blood cell levels Download PDFInfo
- Publication number
- WO2009158015A2 WO2009158015A2 PCT/US2009/003808 US2009003808W WO2009158015A2 WO 2009158015 A2 WO2009158015 A2 WO 2009158015A2 US 2009003808 W US2009003808 W US 2009003808W WO 2009158015 A2 WO2009158015 A2 WO 2009158015A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- actriib
- amino acid
- polypeptide
- seq
- acid sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/179—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/06—Antianaemics
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
Definitions
- the mature red blood cell or erythrocyte, is responsible for oxygen transport in the circulatory systems of vertebrates.
- Red blood cells carry high concentrations of hemoglobin, a protein that binds oxygen in the lungs at relatively high partial pressure of oxygen (p ⁇ 2 ) and delivers oxygen to areas of the body with a relatively low p ⁇ 2 .
- Mature red blood cells are produced from pluripotent hematopoietic stem cells in a process termed erythropoiesis. In post-natal individuals, erythropoiesis occurs primarily in the bone marrow and in the red pulp of the spleen. The coordinated action of various signaling pathways control the balance of cell proliferation, differentiation, survival and death.
- red blood cells are produced at a rate that maintains a constant red cell mass in the body, and production may increase or decrease in response to various stimuli, including increased or decreased oxygen tension or tissue demand.
- the process of erythropoiesis begins with the formation of lineage committed precursor cells and proceeds through a series of distinct precursor cell types. The final stages of erythropoiesis occur as reticulocytes are released into the bloodstream and lose their mitochondria and ribosomes while assuming the morphology of mature red blood cell. An elevated level of reticulocytes, or an elevated reticulocyte:erythrocyte ratio, in the blood is indicative of increased red blood cell production rates.
- Erythropoietin is widely recognized as the most significant positive regulator of erythropoiesis in post-natal vertebrates. Epo regulates the compensatory erythropoietic response to reduced tissue oxygen tension (hypoxia) and low red blood cell levels or low hemoglobin levels. In humans, elevated Epo levels promote red blood cell formation by stimulating the generation of erythroid progenitors in the bone marrow and spleen. In the mouse, Epo enhances erythropoiesis primarily in the spleen. Various forms of recombinant Epo are used by physicians to increase red blood cell levels in a variety of clinical settings, and particularly for the treatment of anemia.
- Anemia is a broadly-defined condition characterized by lower than normal levels of hemoglobin or red blood cells in the blood.
- anemia is caused by a primary disorder in the production or survival of red blood cells. More commonly, anemia is secondary to diseases of other systems (Weatherall & Provan (2000) Lancet 355, 1 169-1 175).
- Anemia may result from a reduced rate of production or increased rate of destruction of red blood cells or by loss of red blood cells due to bleeding.
- Anemia may result from a variety of disorders that include, for example, chronic renal failure, myelodysplastic syndrome, rheumatoid arthritis, and bone marrow transplantation.
- Epo typically causes a rise in hemoglobins by about 1-3 g/dL in healthy humans over a period of weeks. When administered to anemic individuals, this treatment regimen often provides substantial increases in hemoglobin and red blood cell levels and leads to improvements in quality of life and prolonged survival. Epo is not uniformly effective, and many individuals are refractory to even high doses (Horl et al. (2000) Nephrol Dial Transplant 15, 43-50). Over 50% of patients with cancer have an inadequate response to Epo, approximately 10% with end-stage renal disease are hyporesponsive (Glaspy et al. (1997) J Clin Oncol 15, 1218-1234; Demetri et al.
- the disclosure provides ActRIIb antagonists that can be used to increase red blood cell and hemoglobin levels.
- ActRIIb which acts as an inhibitor of activin or myostatin or other ActRIIb ligands, stimulates erythropoiesis activites (e.g., increases reticulocytes, increases mature and immature erythroid progenitors, etc.) when administered in vivo.
- ActRIIb antagonists can be used to promote muscle growth and increase muscle strength. Accordingly, the disclosure provides methods for promoting muscle growth and increasing red blood cell levels, particularly in patients with disorders that are characterized by anemia and loss of muscle, such as cancer- and cancer treatment- related muscle loss, many forms of cachexia and sarcopenia (muscle loss associated with aging). ActRIIb antagonists may also be used to promote bone growth and increase red blood cells in patients in need thereof, such as patients with osteoporosis and anemia, or patients with cancers (or recipients of chemotherapy treatments) associated with bone loss and anemia
- the disclosure provides polypeptides comprising a soluble, ligand-binding ActRIIb polypeptide that binds to activin or myostatin or other ActRIIb ligand.
- ActRIIb polypeptides may be formulated as a pharmaceutical preparation comprising the ligand-binding (e.g. activin-binding) ActRIIb polypeptide and a pharmaceutically acceptable carrier.
- the ligand-binding ActRIIb polypeptide may bind to activin with a K D less than 1 micromolar or less than 100, 10 or 1 nanomolar.
- the composition may be at least 95% pure, with respect to other polypeptide components, as assessed by size exclusion chromatography, and optionally, the composition is at least 98% pure.
- An ActRIIb polypeptide for use in such a preparation may be any of those disclosed herein, such as a polypeptide having an amino acid sequence selected from SEQ ID NOs: 2, 3, 6, 8, or 9 or having an amino acid sequence that is at least 80%, 85%, 90%, 95%, 97% or 99% identical to an amino acid sequence selected from SEQ ID NOs: 2, 3, 6, 8, or 9.
- An active ActRIIb polypeptide may include a functional fragment of a natural ActRIIb polypeptide, such as one comprising at least 10, 20 or 30 amino acids of SEQ ID NOs: 1-3 or a sequence lacking the C-terminal 10 to 15 amino acids (the "tail") such as SEQ ID NO: 3.
- a soluble, ligand-binding (e.g., activin-binding) ActRIIb polypeptide may include one or more alterations in the amino acid sequence (e.g., in the ligand- binding domain) relative to a naturally occurring ActRIIb polypeptide. Examples of altered ActRIIb polypeptides are provided in WO 2006/012627, pp. 59-60 and pp.
- alteration in the amino acid sequence may, for example, alter glycosylation of the polypeptide when produced in a mammalian, insect or other eukaryotic cell or alter proteolytic cleavage of the polypeptide relative to the naturally occurring ActRIIb polypeptide.
- a ligand-binding (e.g., activin-binding) ActRIIb polypeptide may be a fusion protein that has, as one domain, an ActRIIb polypeptide, (e.g., a ligand-binding portion of an ActRIIb) and one or more additional domains that provide a desirable property, such as improved pharmacokinetics, easier purification, targeting to particular tissues, etc.
- a domain of a fusion protein may enhance one or more of in vivo stability, in vivo half life, uptake/administration, tissue localization or distribution, formation of protein complexes, multimerization of the fusion protein, and/or purification.
- a ligand-binding ActRIIb fusion protein may include an immunoglobulin Fc domain (wild-type or mutant) or a serum albumin or other polypeptide portion that provides desirable properties such as improved pharmacokinetics, improved solubility or improved stability.
- an ActRIIb -Fc fusion comprises a relatively unstructured linker positioned between the Fc domain and the extracellular ActRIIb domain.
- This unstructured linker may be an artificial sequence of 1 , 2, 3, 4 or 5 amino acids or a length of between 5 and 15, 20, 30, 50 or more amino acids that are relatively free of secondary structure, or a mixture of both.
- a linker may be rich in glycine and proline residues and may, for example, contain a single sequence of threonine/serine and glycines or repeating sequences of threonine/serine and glycines (e.g., TG 4 (SEQ ID NO: 14) or SG 4 (SEQ ID NO: 15) singlets or repeats).
- a fusion protein may include a purification subsequence, such as an epitope tag, a FLAG tag, a polyhistidine sequence, and a GST fusion.
- a soluble ActRIIb polypeptide includes one or more modified amino acid residues selected from: a glycosylated amino acid, a PEGylated amino acid, a farnesylated amino acid, an acetylated amino acid, a biotinylated amino acid, an amino acid conjugated to a lipid moiety, and an amino acid conjugated to an organic derivatizing agent.
- a pharmaceutical preparation may also include one or more additional compounds such as a compound that is used to treat a bone disorder, muscle disorder or a compound that is used to treat anemia.
- a pharmaceutical preparation is substantially pyrogen free.
- an ActRIIb protein be expressed in a mammalian cell line that mediates suitably natural glycosylation of the ActRIIb protein so as to diminish the likelihood of an unfavorable immune response in a patient.
- Human and CHO cell lines have been used successfully, and it is expected that other common mammalian expression systems will be useful.
- ActRIIb proteins designated ActRIIb-Fc have specific properties, including selective binding to activin versus GDF8 and/or GDFl 1 or vice versa, high affinity ligand binding and serum half life greater than two weeks in animal models and in human patients.
- the invention provides ActRIIb-Fc polypeptides and pharmaceutical preparations comprising such polypeptides and a pharmaceutically acceptable excipient.
- the disclosure provides nucleic acids encoding a soluble ligand-binding ActRIIb polypeptide.
- An isolated polynucleotide may comprise a coding sequence for a soluble, ligand-binding (e.g. activin-binding) ActRIIb polypeptide, such as described above.
- an isolated nucleic acid may include a sequence coding for an extracellular domain (e.g., ligand-binding domain) of an ActRIIb and a sequence that would code for part or all of the transmembrane domain and/or the cytoplasmic domain of an ActRIIb, but for a stop codon positioned within the transmembrane domain or the cytoplasmic domain, or positioned between the extracellular domain and the transmembrane domain or cytoplasmic domain.
- an extracellular domain e.g., ligand-binding domain
- an isolated polynucleotide may comprise a full- length ActRIIb polynucleotide sequence such as SEQ ID NO: 4 or a partially truncated version of ActRIIb, such as a nucleic acid comprising the nucleic acid sequence of SEQ ID NO: 5 4 which corresponds to the extracellular domain of ActRIIb.
- An isolated polynucleotide may further comprise a transcription termination codon at least six hundred nucleotides before the 3 '-terminus or otherwise positioned such that translation of the polynucleotide gives rise to an extracellular domain optionally fused to a truncated portion of a full-length ActRIIb.
- a preferred nucleic acid sequence for ActRIIb is SEQ ID NO: 10.
- Nucleic acids disclosed herein may be operably linked to a promoter for expression, and the disclosure provides cells transformed with such recombinant polynucleotides.
- the cell is a mammalian cell such as a CHO cell.
- the disclosure provides methods for making a soluble, ligand-binding (e.g. activin-binding) ActRIIb polypeptide.
- a method may include expressing any of the nucleic acids (e.g., SEQ ID NOs: 4, 5, or 10) disclosed herein in a suitable cell, such as a Chinese hamster ovary (CHO) cellor a human cell.
- a suitable cell such as a Chinese hamster ovary (CHO) cellor a human cell.
- Such a method may comprise: a) culturing a cell under conditions suitable for expression of the soluble ActRIIb polypeptide, wherein said cell is transformed with a soluble ActRIIb expression construct; and b) recovering the soluble ActRIIb polypeptide so expressed.
- Soluble ActRIIb polypeptides may be recovered as crude, partially purified or highly purified fractions. Purification may be achieved by a series of purification steps, including, for example, one, two or three or more of the following, in any order: protein A chromatography, anion exchange chromatography (e-g-, Q sepharose), hydrophobic interaction chromatography (e.g., phenylsepharose), size exclusion chromatography, and cation exchange chromatography. Soluble ActRIIb polypeptides may be formulated in liquid or solid (e.g., lyophilized) forms.
- an ActRIIb antagonist disclosed herein may be used in a method for promoting red blood cell production or increasing red blood cell levels in a subject.
- the disclosure provides methods for treating a disorder associated with low red blood cell counts or low hemoglobin levels (e.g., an anemia), or to promote red blood cell production, in patients in need thereof.
- a method may comprise administering to a subject in need thereof an effective amount of ActRllb antagonist.
- the disclosure provides methods for increasing red blood cell levels and promoting muscle growth or increasing muscle strength in a patient in need thereof.
- the disclosure demonstrates that, in rodents, ActRllb antagonists increase erythroid precursor cell levels primarily through effects on the spleen.
- the disclosure provides methods for increasing the release of red blood cells from the spleen, the method comprising administering to the patient an effective amount of an ActRllb antagonist.
- the disclosure provides uses of ActRllb antagonists for making a medicament for the treatment of a disorder or condition as described herein.
- the disclosure provides a method for identifying an agent that stimulates production of red blood cells.
- the method comprises: a) identifying a test agent that binds to activin or a ligand-binding domain of an ActRllb polypeptide; and b) evaluating the effect of the agent on the levels of red blood cells, hemoglobin, and/or red blood cell precursor levels (e.g., reticulocyte levels).
- Figure 1 shows an alignment of human ActRIIA and ActRIIB with the residues that are deduced herein, based on composite analysis of multiple ActRIIB and ActRIIA crystal structures to directly contact ligand (the ligand binding pocket) indicated with boxes.
- TGF-beta The transforming growth factor-beta (TGF-beta) superfamily contains a variety of growth factors that share common sequence elements and structural motifs. These proteins are known to exert biological effects on a large variety of cell types in both vertebrates and invertebrates. Members of the superfamily perform important functions during embryonic development in pattern formation and tissue specification and can influence a variety of differentiation processes, including adipogenesis, myogenesis, chondro genesis, cardiogenesis, hematopoiesis, neurogenesis, and epithelial cell differentiation. The family is divided into two general branches: the BMP/GDF and the TGF-beta/Activin/BMPl 0 branches, whose members have diverse, often complementary effects.
- Activins are dimeric polypeptide growth factors that belong to the TGF-beta superfamily. There are three principal activin forms (A, B, and AB) that are homo/heterodimers of two closely related ⁇ subunits (PAPA, PBPB, and PAPB, respectively). The human genome also encodes an activin C and an activin E, which are primarily expressed in the liver, and heterodimeric forms containing p c or p E are also known.
- activins are unique and multifunctional factors that can stimulate hormone production in ovarian and placental cells, support neuronal cell survival, influence cell-cycle progress positively or negatively depending on cell type, and induce mesodermal differentiation at least in amphibian embryos (DePaolo et al., 1991 , Proc Soc Ep Biol Med. 198:500-512; Dyson et al., 1997, Curr Biol. 7:81-84; Woodruff, 1998, Biochem Pharmacol. 55:953-963).
- erythroid differentiation factor isolated from the stimulated human monocytic leukemic cells was found to be identical to activin A (Murata et al., 1988, PNAS, 85:2434). It has been suggested that activin A promotes erythropoiesis in the bone marrow. In several tissues, activin signaling is antagonized by its related heterodimer, inhibin. For example, during the release of follicle-stimulating hormone (FSH) from the pituitary, activin promotes FSH secretion and synthesis, while inhibin prevents FSH secretion and synthesis.
- FSH follicle-stimulating hormone
- Other proteins that may regulate activin bioactivity and/or bind to activin include follistatin (FS), follistatin- related protein (FSRP) and ⁇ 2 -macroglobulin.
- TGF- ⁇ signals are mediated by heteromeric complexes of type I and type II serine/ threonine kinase receptors, which phosphorylate and activate downstream Smad proteins upon ligand stimulation (Massague, 2000, Nat. Rev. MoI. Cell Biol. 1 : 169-178).
- type I and type II receptors are transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity.
- Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors.
- Type I and II activin receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors.
- ActRIIa and ActRIIb Two related type II receptors (ActRII), ActRIIa and ActRIIb, have been identified as the type II receptors for activins (Mathews and Vale, 1991, Cell 65:973- 982; Attisano et al., 1992, Cell 68: 97-108). Besides activins, ActRIIa and ActRIIb can biochemically interact with several other TGF- ⁇ family proteins, including BMP7, Nodal, GDF8, and GDFl 1 (Yamashita et al., 1995, J. Cell Biol. 130:217- 226; Lee and McPherron, 2001 , Proc. Natl. Acad. Sci.
- ALK4 is the primary type I receptor for activins, particularly for activin A, and ALK-7 may serve as a receptor for activins as well, particularly for activin B.
- a soluble ActRIIb polypeptide is effective to increase reticulocyte levels in vivo, an effect which, over a longer time period is expected to cause increased hematocrit levels.
- sActRIIb polypeptides of the disclosure may be used to increase red blood cell levels in vivo.
- ActRIIb antagonists stimulate erythropoiesis in rodents and monkeys.
- hematopoiesis is a complex process, regulated by a variety of factors, including erythropoietin, G-CSF and iron homeostasis.
- the terms " increase red blood cell levels” and "promote red blood cell formation” refer to clinically observable metrics, such as hematocrit, red blood cell counts and hemoglobin measurements, and are intended to be neutral as to the mechanism by which such changes occur.
- ActRIIb antagonists are useful for a variety of therapeutic applications, including, for example, promoting bone growth (see PCT Publication WO 2006/012627, which is hereby incorporated by reference in its entirety) and promoting muscle growth (see PCT Publication No. WO2006/ 012627 and PCT Application No. PCT/US2008/001506, which are hereby incorporated by reference in their entirety).
- ActRIIb antagonists include, for example, ligand-binding (e.g.
- soluble ActRIIb polypeptides include antibodies that bind to ActRIIb and disrupt activin binding, non- antibody proteins selected for ActRIIb binding (see e.g., WO/2002/088171, WO/2006/055689, and WO/2002/032925 for examples of such proteins and methods for design and selection of same), randomized peptides selected for ActRIIb binding, often affixed to an Fc domain.
- Two different proteins (or other moieties) with ActRIIb binding activity may be linked together to create a bifunctional binding molecule.
- Nucleic acid aptamers, small molecules and other agents that inhibit the ActRIIb signaling axis are included as ActRIIb antagonists.
- Various proteins have antagonist that may be similar to ActRIIb antagonists, including inhibin (i.e., inhibin alpha subunit), although inhibin does not universally antagonize activin in all tissues, follistatin (e.g., follistatin-288 and follistatin-315), FSRP, FLRG, activin C, alpha(2)-macroglobulin, and an M108A (methionine to alanine change at position 108) mutant activin A.
- inhibin i.e., inhibin alpha subunit
- follistatin e.g., follistatin-288 and follistatin-315
- FSRP follistatin-288 and follistatin-315
- FLRG activin C
- alpha(2)-macroglobulin alpha(2)-macroglobulin
- M108A methionine to alanine change at position 108 mutant activin A.
- alternative forms of activin particularly
- nucleic acids such as antisense molecules, siRNAs or ribozymes that inhibit ActRIIb expression
- the ActRIIb antagonist to be used may exhibit selectivity for inhibiting activin-mediated signaling versus other members of the TGF-beta family, and particularly with respect to GDF8 and GDFl 1.
- the terms used in this specification generally have their ordinary meanings in the art, within the context of this invention and in the specific context where each term is used. Certain terms are discussed below or elsewhere in the specification, to provide additional guidance to the practitioner in describing the compositions and methods of the invention and how to make and use them. The scope or meaning of any use of a term will be apparent from the specific context in which the term is used.
- “About” and “approximately” shall generally mean an acceptable degree of error for the quantity measured given the nature or precision of the measurements. Typically, exemplary degrees of error are within 20 percent (%), preferably within 10%, and more preferably within 5% of a given value or range of values.
- the terms “about” and “approximately” may mean values that are within an order of magnitude, preferably within 5-fold and more preferably within 2-fold of a given value. Numerical quantities given herein are approximate unless stated otherwise, meaning that the term “about” or “approximately” can be inferred when not expressly stated.
- the methods of the invention may include steps of comparing sequences to each other, including wild-type sequence to one or more mutants (sequence variants).
- Such comparisons typically comprise alignments of polymer sequences, e.g., using sequence alignment programs and/or algorithms that are well known in the art (for example, BLAST, FASTA and MEGALIGN, to name a few).
- sequence alignment programs and/or algorithms that are well known in the art (for example, BLAST, FASTA and MEGALIGN, to name a few).
- sequence alignment programs and/or algorithms that are well known in the art (for example, BLAST, FASTA and MEGALIGN, to name a few).
- sequence similarity in all its grammatical forms, refers to the degree of identity or correspondence between nucleic acid or amino acid sequences that may or may not share a common evolutionary origin.
- homologous when modified with an adverb such as “highly,” may refer to sequence similarity and may or may not relate to a common evolutionary origin.
- the present invention relates to ActRIIb polypeptides.
- ActRIIb refers to a family of activin receptor type lib (ActRIIb) proteins from any species and variants derived from such ActRIIb proteins by mutagenesis or other modification. Reference to ActRIIb herein is understood to be a reference to any one of the currently identified forms.
- ActRIIb family are generally transmembrane proteins, composed of a ligand- binding extracellular domain with a cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine kinase activity.
- ActRIIb polypeptide includes polypeptides comprising any naturally occurring polypeptide of an ActRIIb family member as well as any variants thereof (including mutants, fragments, fusions, and peptidomimetic forms) that retain a useful activity. See, for example, WO/2006/012627. For example,
- ActRIIb polypeptides include polypeptides derived from the sequence of any known ActRIIb having a sequence at least about 80% identical to the sequence of an ActRIIb polypeptide, and optionally at least 85%, 90%, 95%, 97%, 99% or greater identity.
- an ActRIIb polypeptide of the invention may bind to and inhibit the function of an ActRIIb protein and/or a ligand such as activin or myostatin.
- An ActRIIb polypeptide may be selected for activity in promoting red blood cell formation in vivo.
- ActRIIb polypeptides examples include human ActRIIb precursor polypeptide (SEQ ID NO: 1 ) and soluble human ActRIIb polypeptides (e.g., SEQ ID NO: 2, 3, 8 and 9).
- the human ActRIIb precursor protein sequence is as follows: MTAPWVALALLWGSLWPGSGRGEAETRECIYYNANWELERTL ⁇ SGLERCEGEQDKRLHCYASWAJNJSSGTIELVKKGCWLDDFNCYD RQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPP
- the signal peptide is single underlined; the extracellular domain is in bold and the potential N-linked glycosylation sites are in boxes.
- the human ActRIIb soluble (extracellular), processed polypeptide sequence is as follows:
- the protein may be produced with an "SGR" sequence at the N-terminus.
- the C-terminal "tail” of the extracellular domain is underlined.
- the sequence with the "tail” deleted is as follows:
- GNFCNERFTHLPEA SEQ ID NO: 3
- the protein may be produced with an "SGR" sequence at the N-terminus.
- the nucleic acid sequence encoding a human ActRIIb precursor protein is as follows: (nucleotides 5-1543 of Genbank entry NM_001 106) ATGACGGCGCCCTGGGTGGCCCTCGCCCTCCTCTGGGGATCGC
- the nucleic acid sequence encoding a human ActRIIb soluble (extracellular) polypeptide is as follows: TCTGGGCGTGGGGAGGCTGAGACACGGGAGTGCATCTACTACA ACGCCAACTGGGAGCTGGAGCGCACCAACCAGAGCGGCCTGGA GCGCTGCGAAGGCGAGCAGGACAAGCGGCTGCACTGCTACGCC TCCTGGGCCAACAGCTCTGGCACCATCGAGCTCGTGAAGAAGG GCTGCTGGCTAGATGACTTCAACTGCTACGATAGGCAGGAGTG TGTGGCCACTGAGGAGAACCCCCAGGTGTACTTCTGCTGCTGT GAAGGCAACTTCTGCAACGAGCGCTTCACTCATTTGCCAGAGG CTGGGGGCCCGGAAGTCACGTACGAGCCACCCCCGACAGCCCC CACC (SEQ ID NO: 5)
- the invention relates to soluble ActRIIb polypeptides.
- soluble ActRIIb polypeptide generally refers to polypeptides comprising an extracellular domain of an ActRIIb protein.
- soluble ActRIIb polypeptide includes any naturally occurring extracellular domain of an ActRIIb protein as well as any variants thereof (including mutants, fragments and peptidomimetic forms).
- a ligand-binding (e.g. activin-binding) ActRIIb polypeptide is one that retains the ability to bind to activin, including, for example, activin AA, AB, BB, or forms that include a C or E subunit.
- a ligand-binding (e.g. activin-binding) ActRIIb polypeptide will bind to activin AA with a dissociation constant of 1 nM or less.
- the extracellular domain of an ActRIIb protein binds to activin and other ligands, such as myostatin, and is generally soluble in physiological conditions, and thus can be termed a soluble, ligand-binding (e.g. activin-binding) ActRIIb polypeptide.
- soluble, ligand-binding (e.g. activin-binding) ActRIIb polypeptides include the soluble polypeptides illustrated in SEQ ID NOs: 2, 3, 8, and 9.
- SEQ ID NO: 8 is referred to as ActRIIb-hFc, and is described further in the Examples.
- Other examples of soluble, ligand-binding (e.g. activin-binding) ActRIIb polypeptides comprise a signal sequence in addition to the extracellular domain of an ActRIIb protein, for example, the honey bee mellitin leader sequence (SEQ ID NO: 11), the tissue plaminogen activator (TPA) leader (SEQ ID NO: 12) or the native ActRIIb leader (SEQ ID NO: 13).
- the ActRIIb-hFc polypeptide illustrated in SEQ ID NO: 9 uses a TPA leader.
- Figure 1 shows amino acids that are involved in the ligand binding domain. ActRIIb residues likely to be in contact with ligands in the binding pocket have been defined. At these positions, it is expected that conservative mutations will be tolerated, although a K74A mutation is well-tolerated, as are R40A, K55A, F82A and mutations at position L79.
- R40 is a K in Xenopus, indicating that basic amino acids at this position will be tolerated.
- Q53 is R in bovine ActRIIB and K in Xenopus ActRIIB, and therefore amino acids including R, K, Q, N and H will be tolerated at this position.
- an active ActRIIb variant protein is one that comprises amino acids 12-82 of SEQ ID NO: 2 respectively, but optionally beginning at a position ranging from 1 -5 or 3-5 and ending at a position ranging from 1 10-1 16 or 1 10-1 15, respectively, and comprising no more than 1 , 2, 5.
- Such a protein may comprise an amino acid sequence that retains greater than 80%, 90%, 95% or 99% sequence identity to the sequence of amino acids 29-109 of SEQ ID NO: 2.
- Functionally active fragments of ActRIIb polypeptides can be obtained by screening polypeptides recombinantly produced from the corresponding fragment of the nucleic acid encoding an ActRIIb polypeptide.
- fragments can be chemically synthesized using techniques known in the art such as conventional Merrifield solid phase f-Moc or t-Boc chemistry. The fragments can be produced (recombinantly or by chemical synthesis) and tested to identify those peptidyl fragments that can function as antagonists (inhibitors) of ActRIIb protein or signaling mediated by activin.
- a functional variant of the ActRIIb polypeptides can be obtained by screening libraries of modified polypeptides recombinantly produced from the corresponding mutagenized nucleic acids encoding an ActRIIb polypeptide. The variants can be produced and tested to identify those that can function as antagonists (inhibitors) of ActRIIb protein or signaling mediated by activin.
- a functional variant of the ActRIIb polypeptides comprises an amino acid sequence that is at least 75% identical to an amino acid sequence selected from SEQ ID NOs: 2 or 3. In certain cases, the functional variant has an amino acid sequence at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from SEQ ID NOs: 2 or 3.
- Functional variants may be generated by modifying the structure of an ActRIIb polypeptide for such purposes as enhancing therapeutic efficacy, or stability (e.g., ex vivo shelf life and resistance to proteolytic degradation in vivo).
- modified ActRIIb polypeptides when selected to retain activin binding, are considered functional equivalents of the naturally-occurring ActRIIb polypeptides.
- Modified ActRIIb polypeptides can also be produced, for instance, by amino acid substitution, deletion, or addition.
- the present invention contemplates specific mutations of the ActRIIb polypeptides so as to alter the glycosylation of the polypeptide.
- Such mutations may be selected so as to introduce or eliminate one or more glycosylation sites, such as O-linked or N-linked glycosylation sites.
- Asparagine-linked glycosylation recognition sites generally comprise a tripeptide sequence, asparagine-X-threonine or asparagine-X-serine (where "X" is any amino acid) which is specifically recognized by appropriate cellular glycosylation enzymes.
- the alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the wild-type ActRIIb polypeptide (for O-linked glycosylation sites).
- a variety of amino acid substitutions or deletions at one or both of the first or third amino acid positions of a glycosylation recognition site (and/or amino acid deletion at the second position) results in non-glycosylation at the modified tripeptide sequence.
- Another means of increasing the number of carbohydrate moieties on an ActRIIb polypeptide is by chemical or enzymatic coupling of glycosides to the ActRIIb polypeptide.
- the sugar(s) may be attached to (a) arginine and histidine; (b) free carboxyl groups; (c) free sulfhydryl groups such as those of cysteine; (d) free hydroxyl groups such as those of serine, threonine, or hydroxyproline; (e) aromatic residues such as those of phenylalanine, tyrosine, or tryptophan; or (f) the amide group of glutamine. Removal of one or more carbohydrate moieties present on an ActRIIb polypeptide may be accomplished chemically and/or enzymatically.
- Chemical deglycosylation may involve, for example, exposure of the ActRIIb polypeptide to the compound trifluoromethanesulfonic acid, or an equivalent compound. This treatment results in the cleavage of most or all sugars except the linking sugar (N-acetyl glucosamine or N-acetylgalactosamine), while leaving the amino acid sequence intact.
- Enzymatic cleavage of carbohydrate moieties on ActRIIb polypeptides can be achieved by the use of a variety of endo- and exo-glycosidases as described by Thotakura et al.
- ActRIIb polypeptide may be adjusted, as appropriate, depending on the type of expression system used, as mammalian, yeast, insect and plant cells may all introduce differing glycosylation patterns that can be affected by the amino acid sequence of the peptide.
- ActRIIb proteins for use in humans may be expressed in a mammalian cell line that provides proper glycosylation, such as HEK293 or CHO cell lines, although other mammalian expression cell lines are expected to be useful as well.
- Other non- mammalian cell lines may be used (e.g., yeast, E. coli, insect cells), and in some cases, such cell lines may be engineered to include enzymes that confer mammalian- type glycosylation patterns on the expressed proteins.
- This disclosure further contemplates a method of generating mutants, particularly sets of combinatorial mutants of an ActRIIb polypeptide, as well as truncation mutants; pools of combinatorial mutants are especially useful for identifying functional variant sequences.
- the purpose of screening such combinatorial libraries may be to generate, for example, ActRIIb polypeptide variants which bind to activin or other ligands.
- a variety of screening assays are provided below, and such assays may be used to evaluate variants.
- an ActRIIb polypeptide variant may be screened for ability to bind to an ActRIIb ligand, to prevent binding of an ActRIIb ligand to an ActRIIb polypeptide or to interfere with signaling caused by an ActRIIb ligand.
- an ActRIIb polypeptide or its variants may also be tested in a cell-based or in vivo assay. For example, the effect of an ActRIIb polypeptide variant on the expression of genes involved in hematopoiesis may be assessed. This may, as needed, be performed in the presence of one or more recombinant ActRIIb ligand proteins (e.g., activin), and cells may be transfected so as to produce an ActRIIb polypeptide and/or variants thereof, and optionally, an ActRIIb ligand. Likewise, an ActRIIb polypeptide may be administered to a mouse or other animal, and one or more blood measurements, such as an RBC count, hemoglobin, or reticulocyte count may be assessed.
- ActRIIb polypeptide may be administered to a mouse or other animal, and one or more blood measurements, such as an RBC count, hemoglobin, or reticulocyte count may be assessed.
- Combinatorially-derived variants can be generated which have a selective or generally increased potency relative to a naturally occurring ActRIIb polypeptide.
- mutagenesis can give rise to variants which have intracellular half-lives dramatically different than the corresponding a wild-type ActRIIb polypeptide.
- the altered protein can be rendered either more stable or less stable to proteolytic degradation or other cellular processes which result in destruction of, or otherwise inactivation of a native ActRIIb polypeptide.
- Such variants, and the genes which encode them can be utilized to alter ActRIIb polypeptide levels by modulating the half-life of the ActRIIb polypeptides.
- a short half-life can give rise to more transient biological effects and, when part of an inducible expression system, can allow tighter control of recombinant ActRIIb polypeptide levels within the cell.
- mutations may be made in the linker (if any) and/or the Fc portion to alter the half-life of the protein.
- a combinatorial library may be produced by way of a degenerate library of genes encoding a library of polypeptides which each include at least a portion of potential ActRIIb polypeptide sequences.
- a mixture of synthetic oligonucleotides can be enzymatically ligated into gene sequences such that the degenerate set of potential ActRIIb polypeptide nucleotide sequences are expressible as individual polypeptides, or alternatively, as a set of larger fusion proteins (e.g., for phage display).
- the library of potential homologs can be generated from a degenerate oligonucleotide sequence.
- Chemical synthesis of a degenerate gene sequence can be carried out in an automatic DNA synthesizer, and the synthetic genes can then be ligated into an appropriate vector for expression.
- the synthesis of degenerate oligonucleotides is well known in the art (see for example, Narang, SA (1983) Tetrahedron 39:3; ltakura et al., (1981 ) Recombinant DNA, Proc. 3rd Cleveland Sympos. Macromolecules, ed.
- ActRIIb polypeptide variants can be generated and isolated from a library by screening using, for example, alanine scanning mutagenesis and the like (Ruf et al., (1994) Biochemistry 33: 1565-1572; Wang et al., (1994) J. Biol. Chem. 269:3095-3099; Balint et al., (1993) Gene 137:109-1 18; Grodberg et al., (1993) Eur. J. Biochem. 218:597-601 ; Nagashima et al., (1993) J. Biol. Chem.
- a wide range of techniques are known in the art for screening gene products of combinatorial libraries made by point mutations and truncations, and, for that matter, for screening cDNA libraries for gene products having a certain property. Such techniques will be generally adaptable for rapid screening of the gene libraries generated by the combinatorial mutagenesis of ActRIIb polypeptides.
- the most widely used techniques for screening large gene libraries typically comprises cloning the gene library into replicable expression vectors, transforming appropriate cells with the resulting library of vectors, and expressing the combinatorial genes under conditions in which detection of a desired activity facilitates relatively easy isolation of the vector encoding the gene whose product was detected.
- Preferred assays include activin binding assays and activin-mediated cell signaling assays.
- the ActRIIb polypeptides of the invention may further comprise post-translational modifications in addition to any that are naturally present in the ActRIIb polypeptides.
- modifications include, but are not limited to, acetylation, carboxylation, glycosylation, phosphorylation, lipidation, and acylation.
- the modified ActRIIb polypeptides may contain non-amino acid elements, such as polyethylene glycols, lipids, poly- or mono-saccharide, and phosphates. Effects of such non-amino acid elements on the functionality of an ActRIIb polypeptide may be tested as described herein for other ActRIIb polypeptide variants.
- an ActRIIb polypeptide When an ActRIIb polypeptide is produced in cells by cleaving a nascent form of the ActRIIb polypeptide, post-translational processing may also be important for correct folding and/or function of the protein.
- Different cells such as CHO, HeLa, MDCK, 293, WI38, NIH-3T3 or HEK293 have specific cellular machinery and characteristic mechanisms for such post-translational activities and may be chosen to ensure the correct modification and processing of the ActRIIb polypeptides.
- fusion proteins having at least a portion of the ActRIIb polypeptides and one or more fusion domains.
- fusion domains include, but are not limited to, polyhistidine, Glu-Glu, glutathione S transferase (GST), thioredoxin, protein A, protein G, an immunoglobulin heavy chain constant region (Fc), maltose binding protein (MBP), or human serum albumin.
- a fusion domain may be selected so as to confer a desired property. For example, some fusion domains are particularly useful for isolation of the fusion proteins by affinity chromatography.
- matrices for affinity chromatography such as glutathione-, amylase-, and nickel- or cobalt- conjugated resins are used.
- Many of such matrices are available in "kit” form, such as the Pharmacia GST purification system and the QIAexpressTM system (Qiagen) useful with (HIS 6 ) fusion partners.
- a fusion domain may be selected so as to facilitate detection of the ActRIIb polypeptides. Examples of such detection domains include the various fluorescent proteins (e.g., GFP) as well as "epitope tags," which are usually short peptide sequences for which a specific antibody is available.
- fusion domains have a protease cleavage site, such as for Factor Xa or Thrombin, which allows the relevant protease to partially digest the fusion proteins and thereby liberate the recombinant proteins therefrom. The liberated proteins can then be isolated from the fusion domain by subsequent chromatographic separation.
- an ActRIIb polypeptide is fused with a domain that stabilizes the ActRIIb polypeptide in vivo (a "stabilizer" domain).
- stabilizing is meant anything that increases serum half life, regardless of whether this is because of decreased destruction, decreased clearance by the kidney, or other pharmacokinetic effect. Fusions with the Fc portion of an immunoglobulin are known to confer desirable pharmacokinetic properties on a wide range of proteins. Constant domains from an immunoglobulin, particularly an IgG heavy chain, may also be used as stabilizing domains. Likewise, fusions to human serum albumin can confer desirable properties. Other types of fusion domains that may be selected include multimerizing (e.g., dimerizing, tetramerizing) domains and functional domains (that confer an additional biological function, such as further stimulation of muscle growth).
- the present invention provides a fusion protein comprising a soluble extracellular domain of ActRIIb fused to an Fc domain (Fc portion underlined)(SEQ ID NO:6):
- IgGl Fc domain is shown below (SEQ ID NO: 7).
- THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD (A) VSHEDPEVKF
- the Fc domain has one or more mutations at residues such as
- the mutant Fc domain having one or more of these mutations has reduced ability of binding to the Fc ⁇ receptor relative to a wildtype Fc domain.
- the mutant Fc domain having one or more of these mutations has increased ability of binding to the MHC class I-related Fc-receptor (FcRN) relative to a wildtype Fc domain.
- Fc domains from IgG2, IgG3 and IgG4 may also be used.
- an ActRIIb polypeptide may be placed C-terminal to a heterologous domain, or, alternatively, a heterologous domain may be placed C-terminal to an ActRIIb polypeptide.
- the ActRIIb polypeptide domain and the heterologous domain need not be adjacent in a fusion protein, and additional domains or amino acid sequences may be included C- or N-terminal to either domain or between the domains.
- the ActRIIb polypeptides of the present invention contain one or more modifications that are capable of stabilizing the ActRIIb polypeptides.
- modifications enhance the in vitro half life of the ActRIIb polypeptides, enhance circulatory half life of the ActRIIb polypeptides or reducing proteolytic degradation of the ActRIIb polypeptides.
- stabilizing modifications include, but are not limited to, fusion proteins (including, for example, fusion proteins comprising an ActRIIb polypeptide and a stabilizer domain), modifications of a glycosylation site (including, for example, addition of a glycosylation site to an ActRIIb polypeptide), and modifications of carbohydrate moiety (including, for example, removal of carbohydrate moieties from an ActRIIb polypeptide).
- fusion proteins including, for example, fusion proteins comprising an ActRIIb polypeptide and a stabilizer domain
- modifications of a glycosylation site including, for example, addition of a glycosylation site to an ActRIIb polypeptide
- carbohydrate moiety including, for example, removal of carbohydrate moieties from an ActRIIb polypeptide.
- stabilizer domain not only refers to a fusion domain (e.g., Fc) as in the case of fusion proteins, but also includes nonproteinaceous modifications such as a carbohydrate moiety, or nonproteinace
- the present invention makes available isolated and/or purified forms of the ActRIIb polypeptides, which are isolated from, or otherwise substantially free of, other proteins.
- ActRIIb polypeptides will generally be produced by expression from recombinant nucleic acids. 3. Nucleic Acids Encoding ActRIIb Polypeptides
- the invention provides isolated and/or recombinant nucleic acids encoding any of the ActRIIb polypeptides (e.g., full-length and soluble ActRIIb polypeptides), including fragments, functional variants and fusion proteins disclosed herein.
- SEQ ID NO: 4 encodes the naturally occurring human ActRIIb precursor polypeptide
- SEQ ID NO: 5 encodes the processed extracellular domain of ActRIIb.
- the subject nucleic acids may be single-stranded or double stranded.
- Such nucleic acids may be DNA or RNA molecules. These nucleic acids may be used, for example, in methods for making ActRIIb polypeptides or as direct therapeutic agents (e.g., in a gene therapy approach).
- the subject nucleic acids encoding ActRIIb polypeptides are further understood to include nucleic acids that are variants of SEQ ID NO: 4 or 5.
- Variant nucleotide sequences include sequences that differ by one or more nucleotide substitutions, additions or deletions, such as allelic variants.
- the invention provides isolated or recombinant nucleic acid sequences that are at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to SEQ ID NOs: 4, 5, or 10.
- nucleic acid sequences complementary to SEQ ID NOs: 4, 5, or 10 and variants of SEQ ID NOs: 4, 5, or 10 are also within the scope of this invention.
- the nucleic acid sequences of the invention can be isolated, recombinant, and/or fused with a heterologous nucleotide sequence, or in a DNA library.
- nucleic acids of the invention also include nucleotide sequences, and the ActRIIb polypeptides encoded by such nucleic acids, that hybridize under highly stringent conditions to the nucleotide sequence designated in SEQ ID NOs: 4, 5, or 10, the complement sequence of SEQ ID NOs: 4, 5, or 10, or fragments of any of the foregoing.
- appropriate stringency conditions which promote DNA hybridization can be varied.
- appropriate stringency conditions which promote DNA hybridization can be varied.
- the hybridization at 6.0 x sodium chloride/sodium citrate (SSC) at about 45 °C, followed by a wash of 2.0 x SSC at 50 0 C.
- the salt concentration in the wash step can be selected from a low stringency of about 2.0 x SSC at 50 °C to a high stringency of about 0.2 x SSC at 50 °C.
- the temperature in the wash step can be increased from low stringency conditions at room temperature, about 22 °C, to high stringency conditions at about 65 °C. Both temperature and salt may be varied, or temperature or salt concentration may be held constant while the other variable is changed.
- the invention provides nucleic acids which hybridize under low stringency conditions of 6 x SSC at room temperature followed by a wash at 2 x SSC at room temperature.
- Isolated nucleic acids which differ from the nucleic acids as set forth in SEQ ID NOs: 4, 5, or 10 due to degeneracy in the genetic code are also within the scope of the invention.
- a number of amino acids are designated by more than one triplet. Codons that specify the same amino acid, or synonyms (for example, CAU and CAC are synonyms for histidine) may result in "silent" mutations which do not affect the amino acid sequence of the protein.
- CAU and CAC are synonyms for histidine
- nucleotides up to about 3-5% of the nucleotides
- nucleic acids encoding a particular protein may exist among individuals of a given species due to natural allelic variation. Any and all such nucleotide variations and resulting amino acid polymorphisms are within the scope of this invention.
- the recombinant nucleic acids of the invention may be operably linked to one or more regulatory nucleotide sequences in an expression construct.
- Regulatory nucleotide sequences will generally be appropriate to the host cell used for expression. Numerous types of appropriate expression vectors and suitable regulatory sequences are known in the art for a variety of host cells.
- said one or more regulatory nucleotide sequences may include, but are not limited to, promoter sequences, leader or signal sequences, ribosomal binding sites, transcriptional start and termination sequences, translational start and termination sequences, and enhancer or activator sequences. Constitutive or inducible promoters as known in the art are contemplated by the invention.
- the promoters may be either naturally occurring promoters, or hybrid promoters that combine elements of more than one promoter.
- An expression construct may be present in a cell on an episome, such as a plasmid, or the expression construct may be inserted in a chromosome.
- the expression vector contains a selectable marker gene to allow the selection of transformed host cells. Selectable marker genes are well known in the art and will vary with the host cell used.
- the subject nucleic acid is provided in an expression vector comprising a nucleotide sequence encoding an ActRIIb polypeptide and operably linked to at least one regulatory sequence. Regulatory sequences are art-recognized and are selected to direct expression of the ActRIIb polypeptide.
- regulatory sequence includes promoters, enhancers, and other expression control elements.
- Exemplary regulatory sequences are described in Goeddel; Gene Expression Technology: Methods in En ⁇ ymology, Academic Press, San Diego, CA (1990).
- any of a wide variety of expression control sequences that control the expression of a DNA sequence when operatively linked to it may be used in these vectors to express DNA sequences encoding an ActRIIb polypeptide.
- Such useful expression control sequences include, for example, the early and late promoters of SV40, tet promoter, adenovirus or cytomegalovirus immediate early promoter, RSV promoters, the lac system, the trp system, the TAC or TRC system, T7 promoter whose expression is directed by T7 RNA polymerase, the major operator and promoter regions of phage lambda , the control regions for fd coat protein, the promoter for 3-phosphoglycerate kinase or other glycolytic enzymes, the promoters of acid phosphatase, e.g., Pho5, the promoters of the yeast ⁇ -mating factors, the polyhedron promoter of the baculovirus system and other sequences known to control the expression of genes of prokaryotic or eukaryotic cells or their viruses, and various combinations thereof.
- the design of the expression vector may depend on such factors as the choice of the host cell to be transformed and/or the type of protein desired to be expressed. Moreover, the vector's copy number, the ability to control that copy number and the expression of any other protein encoded by the vector, such as antibiotic markers, should also be considered.
- a recombinant nucleic acid of the invention can be produced by ligating the cloned gene, or a portion thereof, into a vector suitable for expression in either prokaryotic cells, eukaryotic cells (yeast, avian, insect or mammalian), or both.
- Expression vehicles for production of a recombinant ActRIIb polypeptide include plasmids and other vectors.
- suitable vectors include plasmids of the types: pBR322-derived plasmids, pEMBL-derived plasmids, pEX-derived plasmids, pBTac-derived plasmids and pUC-derived plasmids for expression in prokaryotic cells, such as E. coli.
- Some mammalian expression vectors contain both prokaryotic sequences to facilitate the propagation of the vector in bacteria, and one or more eukaryotic transcription units that are expressed in eukaryotic cells.
- the pcDNAI/amp, pcDNAI/neo, pRc/CMV, pSV2gpt, pSV2neo, pSV2-dhfr, pTk2, pRSVneo, pMSG, pSVT7, pko-neo and pHyg derived vectors are examples of mammalian expression vectors suitable for transfection of eukaryotic cells.
- vectors are modified with sequences from bacterial plasmids, such as pBR322, to facilitate replication and drug resistance selection in both prokaryotic and eukaryotic cells.
- bacterial plasmids such as pBR322
- derivatives of viruses such as the bovine papilloma virus (BPV-I), or Epstein-Barr virus (pHEBo, pREP-derived and p205) can be used for transient expression of proteins in eukaryotic cells.
- BBV-I bovine papilloma virus
- pHEBo Epstein-Barr virus
- pREP-derived and p205 Epstein-Barr virus
- examples of other viral (including retroviral) expression systems can be found below in the description of gene therapy delivery systems.
- the various methods employed in the preparation of the plasmids and in transformation of host organisms are well known in the art.
- baculovirus expression systems include pVL-derived vectors (such as pVL1392, pVL1393 and pVL941 ), pAcUW-derived vectors (such as pAcUWl ), and pBlueBac-derived vectors (such as the ⁇ -gal containing pBlueBac III).
- a vector will be designed for production of the subject ActRIIb polypeptides in CHO cells, such as a Pcmv-Script vector (Stratagene, La Jolla, Calif), pcDNA4 vectors (Invitrogen, Carlsbad, Calif.) and pCI-neo vectors (Promega, Madison, Wise).
- the subject gene constructs can be used to cause expression of the subject ActRIIb polypeptides in cells propagated in culture, e.g., to produce proteins, including fusion proteins or variant proteins, for purification.
- This disclosure also pertains to a host cell transfected with a recombinant gene including a coding sequence (e.g., SEQ ID NOs: 4, 5, or 10) for one or more of the subject ActRIIb polypeptides.
- the host cell may be any prokaryotic or eukaryotic cell.
- an ActRIIb polypeptide of the invention may be expressed in bacterial cells such as E. coli, insect cells (e.g., using a baculovirus expression system), yeast, or mammalian cells. Other suitable host cells are known to those skilled in the art. Accordingly, the present invention further pertains to methods of producing the subject ActRIIb polypeptides.
- a host cell transfected with an expression vector encoding an ActRIIb polypeptide can be cultured under appropriate conditions to allow expression of the ActRIIb polypeptide to occur.
- the ActRIIb polypeptide may be secreted and isolated from a mixture of cells and medium containing the ActRIIb polypeptide.
- the ActRIIb polypeptide may be retained cytoplasmically or in a membrane fraction and the cells harvested, lysed and the protein isolated.
- a cell culture includes host cells, media and other byproducts. Suitable media for cell culture are well known in the art.
- the subject ActRIIb polypeptides can be isolated from cell culture medium, host cells, or both, using techniques known in the art for purifying proteins, including ion-exchange chromatography, gel filtration chromatography, ultrafiltration, electrophoresis, immunoaffinity purification with antibodies specific for particular epitopes of the ActRIIb polypeptides and affinity purification with an agent that binds to a domain fused to the ActRIIb polypeptide (e.g., a protein A column may be used to purify an ActRIIb-Fc fusion).
- the ActRIIb polypeptide is a fusion protein containing a domain which facilitates its purification.
- purification is achieved by a series of column chromatography steps, including, for example, three or more of the following, in any order: protein A chromatography, Q sepharose chromatography, phenyl sepharose chromatography, size exclusion chromatography, and cation exchange chromatography.
- the purification could be completed with viral filtration and buffer exchange.
- a fusion gene coding for a purification leader sequence such as a poly-(His)/enterokinase cleavage site sequence at the N- terminus of the desired portion of the recombinant ActRIIb polypeptide, can allow purification of the expressed fusion protein by affinity chromatography using a Ni 2+ metal resin.
- the purification leader sequence can then be subsequently removed by treatment with enterokinase to provide the purified ActRIIb polypeptide (e.g., see Hochuli et al., (1987) J. Chromatography 411 : 177; and Janknecht et al., PNAS USA 88:8972).
- fusion genes are well known. Essentially, the joining of various DNA fragments coding for different polypeptide sequences is performed in accordance with conventional techniques, employing blunt-ended or stagger- ended termini for ligation, restriction enzyme digestion to provide for appropriate termini, filling-in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and enzymatic ligation.
- the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers.
- PCR amplification of gene fragments can be carried out using anchor primers which give rise to complementary overhangs between two consecutive gene fragments which can subsequently be annealed to generate a chimeric gene sequence (see, for example, Current Protocols in Molecular Biology, eds. Ausubel et al., John Wiley & Sons: 1992).
- an ActRIIb polypeptide is effective to increase reticulocyte levels in vivo, an effect which, over a longer time period leads to increased hematocrit levels in certain species, and is likely to do so in humans.
- ActRIIb antagonists of the disclosure may be used increase red blood cell levels in vivo.
- soluble ActRIIb polypeptides and particularly ActRIIb-Fc, are preferred antagonists, and although such antagonists may affect red blood cell levels through a mechanism other than activin antagonism (e.g., activin inhibition may be an indicator of the tendency of an agent to inhibit the activities of a spectrum of molecules, including, perhaps, other members of the TGF-beta superfamily, and such collective inhibition may lead to the desired effect on hematopoiesis), other types of ActRIIb antagonists are expected to be useful, including anti-ActRIIb antibodies, antisense, RNAi or ribozyme nucleic acids that inhibit the production of ActRIIb, and other inhibitors of ActRIIb, particularly those that disrupt ActRIIb binding.
- activin inhibition may be an indicator of the tendency of an agent to inhibit the activities of a spectrum of molecules, including, perhaps, other members of the TGF-beta superfamily, and such collective inhibition may lead to the desired effect on hematopoiesis
- An antibody that is specifically reactive with an ActRIIb polypeptide e.g., a soluble ActRIIbpolypeptide
- an ActRIIb polypeptide e.g., a soluble ActRIIbpolypeptide
- which either binds competitively to ligand with the ActRIIb polypeptide or otherwise inhibits ActRIIb -mediated signaling may be used as an antagonist of ActRIIb polypeptide activities.
- anti- protein/anti-peptide antisera or monoclonal antibodies can be made by standard protocols (see, for example, Antibodies: A Laboratory Manual ed. by Harlow and Lane (Cold Spring Harbor Press: 1988)).
- a mammal such as a mouse, a hamster or rabbit can be immunized with an immunogenic form of the ActRIIb polypeptide, an antigenic fragment which is capable of eliciting an antibody response, or a fusion protein.
- Techniques for conferring immunogenicity on a protein or peptide include conjugation to carriers or other techniques well known in the art.
- An immunogenic portion of an ActRIIb polypeptide can be administered in the presence of adjuvant. The progress of immunization can be monitored by detection of antibody titers in plasma or serum. Standard ELISA or other immunoassays can be used with the immunogen as antigen to assess the levels of antibodies.
- antibody-producing cells can be harvested from an immunized animal and fused by standard somatic cell fusion procedures with immortalizing cells such as myeloma cells to yield hybridoma cells.
- Hybridoma cells can be screened immunochemically for production of antibodies specifically reactive with an ActRIIb polypeptide and monoclonal antibodies isolated from a culture comprising such hybridoma cells.
- antibody as used herein is intended to include whole antibodies, e.g., of any isotype (IgG, IgA, IgM, IgE, etc), and includes fragments or domains of immunoglobulins which are reactive with a selected antigen.
- Antibodies can be fragmented using conventional techniques and the fragments screened for utility and/or interaction with a specific epitope of interest.
- the term includes segments of proteolytically-cleaved or recombinantly-prepared portions of an antibody molecule that are capable of selectively reacting with a certain protein.
- Non-limiting examples of such proteolytic and/or recombinant fragments include Fab, F(ab')2, Fab' , Fv, and single chain antibodies (scFv) containing a V[L] and/or V[H] domain joined by a peptide linker.
- the scFv's may be covalently or non- covalently linked to form antibodies having two or more binding sites.
- the term antibody also includes polyclonal, monoclonal, or other purified preparations of antibodies and recombinant antibodies.
- recombinant antibody means an antibody, or antigen binding domain of an immunoglobulin, expressed from a nucleic acid that has been constructed using the techniques of molecular biology, such as a humanized antibody or a fully human antibody developed from a single chain antibody. Single domain and single chain antibodies are also included within the term “recombinant antibody”.
- an antibody of the invention is a monoclonal antibody
- the invention makes available methods for generating novel antibodies.
- a method for generating a monoclonal antibody that binds specifically to an ActRIIb polypeptide may comprise administering to a mouse an amount of an immunogenic composition comprising the antigen polypeptide effective to stimulate a detectable immune response, obtaining antibody-producing cells (e.g., cells from the spleen) from the mouse and fusing the antibody-producing cells with myeloma cells to obtain antibody-producing hybridomas, and testing the antibody-producing hybridomas to identify a hybridoma that produces a monocolonal antibody that binds specifically to the antigen.
- antibody-producing cells e.g., cells from the spleen
- a hybridoma can be propagated in a cell culture, optionally in culture conditions where the hybridoma-derived cells produce the monoclonal antibody that binds specifically to the antigen.
- the monoclonal antibody may be purified from the cell culture.
- the adjective "specifically reactive with” as used in reference to an antibody is intended to mean, as is generally understood in the art, that the antibody is sufficiently selective between the antigen of interest (e.g., an ActRIIb polypeptide) and other antigens that are not of interest that the antibody is useful for, at minimum, detecting the presence of the antigen of interest in a particular type of biological sample. In certain methods employing the antibody, such as therapeutic applications, a higher degree of specificity in binding may be desirable. Monoclonal antibodies generally have a greater tendency (as compared to polyclonal antibodies) to discriminate effectively between the desired antigens and cross-reacting polypeptides. One characteristic that influences the specificity of an antibody:antigen interaction is the affinity of the antibody for the antigen. Although the desired specificity may be reached with a range of different affinities, generally preferred antibodies will have an affinity (a dissociation constant) of about 10 ⁇ 6 , 10 ⁇ 7 , 10 ⁇ 8 , 10 "9 M or less.
- the techniques used to screen antibodies in order to identify a desirable antibody may influence the properties of the antibody obtained. For example, if an antibody is to be used for binding an antigen in solution, it may be desirable to test solution binding.
- a variety of different techniques are available for testing interaction between antibodies and antigens to identify particularly desirable antibodies. Such techniques include ELISAs, surface plasmon resonance binding assays (e.g., the BiacoreTM binding assay, Biacore AB, Uppsala, Sweden), sandwich assays (e.g., the paramagnetic bead system of IGEN International, Inc., Gaithersburg, Maryland), western blots, immunoprecipitation assays, and immunohistochemistry.
- a nucleic acid compound may be single or double stranded.
- a double stranded compound may also include regions of overhang or non- complementarity, where one or the other of the strands is single stranded.
- a single stranded compound may include regions of self-complementarity, meaning that the compound forms a so-called "hairpin” or "stem-loop” structure, with a region of double helical structure.
- a nucleic acid compound may comprise a nucleotide sequence that is complementary to a region consisting of no more than 1000, no more than 500, no more than 250, no more than 100, or no more than 50, 35, 25, 22, 20, 18 or 15 nucleotides of the full-length ActRIIb nucleic acid sequence.
- the region of complementarity will preferably be at least 8 nucleotides, and optionally about 18 to 35 nucleotides.
- a region of complementarity may fall within an intron, a coding sequence or a noncoding sequence of the target transcript, such as the coding sequence portion.
- a nucleic acid compound will have a length of about 8 to about 500 nucleotides or base pairs in length, and optionally the length will be about 14 to about 50 nucleotides.
- a nucleic acid may be a DNA (particularly for use as an antisense), RNA or RNA:DNA hybrid. Any one strand may include a mixture of DNA and RNA, as well as modified forms that cannot readily be classified as either DNA or RNA.
- a double stranded compound may be DNA:DNA, DNA:RNA or RNA:RNA, and any one strand may also include a mixture of DNA and RNA, as well as modified forms that cannot readily be classified as either DNA or RNA.
- a nucleic acid compound may include any of a variety of modifications, including one or modifications to the backbone (the sugar-phosphate portion in a natural nucleic acid, including internucleotide linkages) or the base portion (the purine or pyrimidine portion of a natural nucleic acid).
- An antisense nucleic acid compound will preferably have a length of about 15 to about 30 nucleotides and will often contain one or more modifications to improve characteristics such as stability in the serum, in a cell or in a place where the compound is likely to be delivered, such as the stomach in the case of orally delivered compounds and the lung for inhaled compounds.
- the strand complementary to the target transcript will generally be RNA or modifications thereof.
- the other strand may be RNA, DNA or any other variation.
- the duplex portion of double stranded or single stranded "hairpin" RNAi construct will generally have a length of 18 to 40 nucleotides in length and optionally about 21 to 23 nucleotides in length, so long as it serves as a Dicer substrate.
- Catalytic or enzymatic nucleic acids may be ribozymes or DNA enzymes and may also contain modified forms.
- Nucleic acid compounds may inhibit expression of the target by about 50%, 75%, 90% or more when contacted with cells under physiological conditions and at a concentration where a nonsense or sense control has little or no effect. Preferred concentrations for testing the effect of nucleic acid compounds are 1, 5 and 10 micromolar. Nucleic acid compounds may also be tested for effects on, for example, red blood cell levels.
- an antagonist may be a follistatin polypeptide that antagonizes activin bioactivity and/or binds to activin and/or myostatin.
- follistatin polypeptide includes polypeptides comprising any naturally occurring polypeptide of follistatin as well as any variants thereof
- follistatin polypeptides that retain activin binding properties can be identified based on previous studies involving follistatin and activin interactions. For example, WO2008/030367 discloses specific follistatin domains ("FSDs") that are shown to be important for activin binding.
- the N-terminus follistatin domain (“FSND” SEQ ID NO: 18), FSD2 (SEQ ID NO: 19), and to a lesser extent FSDl (SEQ ID NO: 20) represent exemplary domains within follistatin important for activin binding.
- FSDl SEQ ID NO: 20
- methods for making and testing libraries of polypeptides are described above in the context of ActRIIb polypeptides and such methods also pertain to making and testing variants of follistatin.
- follistatin that bind myostatin preferentially (with reduced activin binding) are also known and may be used as antagonists herein that may exhibit properties similar to those of ActRIIb antagonists; such follistatin fo ⁇ ns may be found in, for example, WO/2005/100563 and WO/2008/030367).
- Follistatin polypeptides include polypeptides derived from the sequence of any known follistatin having a sequence at least about 80% identical to the sequence of a follistatin polypeptide, and optionally at least 85%, 90%, 95%, 97%, 99% or greater identity.
- follistatin polypeptides include the mature follistatin polypeptide or shorter isoforms or other variants of the human follistatin precursor polypeptide (SEQ ID NO: 16) as described, for example, in WO2005/025601.
- the human follistatin precursor polypeptide isoform FST344 is as follows:
- the signal peptide is single underlined; the last 27 residues in bold represent additional amino acids as compared to a shorter follistatin isoform FST317 (NPJ306341) below.
- the human follistatin precursor polypeptide isoform FST317 is as follows:
- N-terminus follistatin domain sequence is as follows: GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDN TLFKWMIFNGGAPNCIPCK (SEQIDNO: 18; FSND)
- FSDl and FSD2 sequences are as follows: ETCENVDCGPGKKCRMNKKNKPRCV (SEQIDNO: 19; FSDl) KTCRDVFCPGSSTCVVDQTNNAYCVT (SEQ ID NO: 20; FSD2)
- an antagonist similar to an ActRIIb antagonist may be a follistatin-like related gene (FLRG) that antagonizes activin bioactivity and/or binds to activin.
- FLRG polypeptide includes polypeptides comprising any naturally occurring polypeptide of FLRG as well as any variants thereof (including mutants, fragments, fusions, and peptidomimetic forms) that retain a useful activity. Variants of FLRG polypeptides that retain activin or myostatin binding properties can be identified using routine methods to assay FLRG and activin or myostatin interactions. See, for example, US 6,537,966.
- FLRG polypeptides include polypeptides derived from the sequence of any known FLRG having a sequence at least about 80% identical to the sequence of an FLRG polypeptide, and optionally at least 85%, 90%, 95%, 97%, 99% or greater identity.
- the human FLRG precursor polypeptide is as follows:
- the signal peptide is single underlined.
- follistatin polypeptides and FLRG polypeptides include fusion protein having at least a portion of the follistatin polypeptides or FLRG polypeptides and one or more fusion domains, such as, for example, domains that facilitate isolation, detection, stabilization or multimerization of the polypeptide. Suitable fusion domains are discussed in detail above with reference to the ActRIIb polypeptides.
- an antagonist is a fusion protein comprising a ligand binding (e.g. activin binding) portion of a follistaton polypeptide fused to an Fc domain.
- an antagonist is a fusion protein comprising a ligand binding (e.g.
- the present invention relates to the use of ActRIIb polypeptides and activin polypeptides to identify compounds (agents) which are agonist or antagonists of the ActRIIb signaling pathway.
- Compounds identified through this screening can be tested to assess their ability to modulate red blood cell, hemoglobin and/or reticulocyte levels in vivo or in vitro. These compounds can be tested, for example, in animal models.
- high-throughput screening of compounds can be carried out to identify agents that perturb activin/myostatin or ActRIIb-mediated effects on a selected cell line.
- the assay is carried out to screen and identify compounds that specifically inhibit or reduce binding of an ActRIIb polypeptide to activin, myostatin or other ligands.
- the assay can be used to identify compounds that enhance binding of an ActRIIb polypeptide to activin, myostatin or other ligands.
- the compounds can be identified by their ability to interact with an activin or ActRIIb polypeptide.
- a variety of assay formats will suffice and, in light of the present disclosure, those not expressly described herein will nevertheless be comprehended by one of ordinary skill in the art.
- the test compounds (agents) of the invention may be created by any combinatorial chemical method.
- the subject compounds may be naturally occurring biomolecules synthesized in vivo or in vitro.
- Test compounds contemplated by the present invention include non-peptidyl organic molecules, peptides, polypeptides, peptidomimetics, sugars, hormones, and nucleic acid molecules.
- the test agent is a small organic molecule having a molecular weight of less than about 2,000 Daltons.
- test compounds of the invention can be provided as single, discrete entities, or provided in libraries of greater complexity, such as made by combinatorial chemistry.
- libraries can comprise, for example, alcohols, alkyl halides, amines, amides, esters, aldehydes, ethers and other classes of organic compounds.
- Presentation of test compounds to the test system can be in either an isolated form or as mixtures of compounds, especially in initial screening steps.
- the compounds may be optionally derivatized with other compounds and have derivatizing groups that facilitate isolation of the compounds.
- Non-limiting examples of derivatizing groups include biotin, fluorescein, digoxygenin, green fluorescent protein, isotopes, polyhistidine, magnetic beads, glutathione S transferase (GST), photoactivatible crosslinkers or any combinations thereof.
- high throughput assays are desirable in order to maximize the number of compounds surveyed in a given period of time.
- Assays which are performed in cell-free systems such as may be derived with purified or semi- purified proteins, are often preferred as "primary" screens in that they can be generated to permit rapid development and relatively easy detection of an alteration in a molecular target which is mediated by a test compound.
- test compound can be generally ignored in the in vitro system, the assay instead being focused primarily on the effect of the drug on the molecular target as may be manifest in an alteration of binding affinity between an ActRIIb polypeptide and a ligand such as activin or myostatin.
- the compound of interest is contacted with an isolated and purified ActRIIb polypeptide which is ordinarily capable of binding to a ligand such as activin or myostatin.
- a ligand such as activin or myostatin.
- a composition containing an ActRIIb ligand e.g., activin, myostatin.
- the efficacy of the compound can be assessed by generating dose response curves from data obtained using various concentrations of the test compound.
- a control assay can also be performed to provide a baseline for comparison.
- isolated and purified activin is added to a composition containing the ActRIIb polypeptide, and the formation of ActRIIb/ligand complex is quantitated in the absence of the test compound.
- the order in which the reactants may be admixed can be varied, and can be admixed simultaneously.
- cellular extracts and lysates may be used to render a suitable cell-free assay system.
- Complex formation between the ActRIIb polypeptide and activin may be detected by a variety of techniques. For instance, modulation of the formation of complexes can be quantitated using, for example, detectably labeled proteins such as radiolabeled (e.g., 32 P, 35 S, 14 C or 3 H), fluorescently labeled (e.g., FITC), or enzymatically labeled ActRIIb polypeptide or ligand, by immunoassay, or by chromatographic detection.
- detectably labeled proteins such as radiolabeled (e.g., 32 P, 35 S, 14 C or 3 H), fluorescently labeled (e.g., FITC), or enzymatically labeled ActRIIb polypeptide or ligand
- the present invention contemplates the use of fluorescence polarization assays and fluorescence resonance energy transfer (FRET) assays in measuring, either directly or indirectly, the degree of interaction between an ActRIIb polypeptide and its binding protein.
- FRET fluorescence resonance energy transfer
- other modes of detection such as those based on optical waveguides (PCT Publication WO 96/26432 and U.S. Pat. No. 5,677,196), surface plasmon resonance (SPR), surface charge sensors, and surface force sensors, are compatible with many embodiments of the invention.
- an interaction trap assay also known as the "two hybrid assay," for identifying agents that disrupt or potentiate interaction between an ActRIIb polypeptide and its binding protein. See for example, U.S. Pat. No. 5,283,317; Zervos et al. (1993) Cell 72:223-232; Madura et al. (1993) J Biol Chem 268: 12046-12054; Bartel et al. (1993) Biotechniques 14:920-924; and Iwabuchi et al. (1993) Oncogene 8:1693-1696).
- the present invention contemplates the use of reverse two hybrid systems to identify compounds (e.g., small molecules or peptides) that dissociate interactions between an ActRIIb polypeptide and its binding protein. See for example, Vidal and Legrain, (1999) Nucleic Acids Res 27:919-29; Vidal and Legrain, (1999) Trends Biotechnol 17:374-81 ; and U.S. Pat. Nos. 5,525,490; 5,955,280; and 5,965,368.
- the subject compounds are identified by their ability to interact with an ActRIIb or ligand polypeptide of the invention.
- the interaction between the compound and the ActRIIb or ligand polypeptide may be covalent or non-covalent.
- such interaction can be identified at the protein level using in vitro biochemical methods, including photo-crosslinking, radiolabeled ligand binding, and affinity chromatography (Jakoby WB et al., 1974, Methods in Enzymology 46: 1).
- the compounds may be screened in a mechanism based assay, such as an assay to detect compounds which bind to a ligand or ActRIIb polypeptide. This may include a solid phase or fluid phase binding event.
- the gene encoding an ActRIIb polypeptide can be transfected with a reporter system (e.g., ⁇ -galactosidase, luciferase, or green fluorescent protein) into a cell and screened against the library optionally by a high throughput screening or with individual members of the library.
- a reporter system e.g., ⁇ -galactosidase, luciferase, or green fluorescent protein
- Other mechanism based binding assays may be used, for example, binding assays which detect changes in free energy. Binding assays can be performed with the target fixed to a well, bead or chip or captured by an immobilized antibody or resolved by capillary electrophoresis. The bound compounds may be detected usually using colorimetric or fluorescence or surface plasmon resonance. 6.
- ActRIIb antagonists e.g., ActRIIb polypeptides
- the present invention provides methods of treating or preventing anemia in an individual in need thereof by administering to the individual a therapeutically effective amount of an ActRIIb antagonist, such as an ActRIIb polypeptide.
- the present invention provides methods of promoting red blood cell formation in an individual by administering to the individual a therapeutically effective amount of an ActRIIb antagonist, particularly an ActRIIb polypeptide. These methods may be used for therapeutic and prophylactic treatments of mammals, and particularly humans.
- a therapeutic that "prevents" a disorder or condition refers to a compound that, in a statistical sample, reduces the occurrence of the disorder or condition in the treated sample relative to an untreated control sample, or delays the onset or reduces the severity of one or more symptoms of the disorder or condition relative to the untreated control sample.
- treating includes prophylaxis of the named condition or amelioration or elimination of the condition once it has been established. In either case, prevention or treatment may be discerned in the diagnosis provided by a physician or other health care provider and the intended result of administration of the therapeutic agent.
- ActRIIb antagonists may be used to increase red blood cell, hemoglobin or reticulocyte levels in healthy individuals, and such antagonists may be used in selected patient populations.
- appropriate patient populations include those with undesirably low red blood cell or hemoglobin levels, such as patients having an anemia, and those that are at risk for developing undesirably low red blood cell or hemoglobin levels, such as those patients that are about to undergo major surgery or other procedures that may result in substantial blood loss.
- a patient with adequate red blood cell levels is treated with an ActRIIb antagonist to increase red blood cell levels, and then blood is drawn and stored for later use in transfusions.
- ActRIIb antagonists may stimulate red blood cell production by activation of splenic erythropoiesis. This novel mechanism indicates that these antagonists are likely to work synergistically with other anemia treatments, such as erythropoietin agonists (e.g., Epogen, Procrit, Aranesp, Epo mimics, Epo receptor agonists, etc.).
- erythropoietin agonists e.g., Epogen, Procrit, Aranesp, Epo mimics, Epo receptor agonists, etc.
- ActRIIb antagonists disclosed herein, and particularly ActRIIb-Fc proteins may be used to increase red blood cell levels in patients having an anemia.
- a level of less than normal for the appropriate age and gender category may be indicative of anemia, although individual variations are taken into account.
- a hemoglobin level of 12 g/dl is generally considered the lower limit of normal in the general adult population.
- Potential causes include blood-loss, nutritional deficits, medication reaction, various problems with the bone marrow and many diseases. More particularly, anemia has been associated with a variety of disorders that include, for example, chronic renal failure, myelodysplastic syndrome, myelofibrosis, rheumatoid arthritis, bone marrow transplantation.
- Anemia may also be associated with the following conditions: solid tumors (e.g. breast cancer, lung cancer, colon cancer); tumors of the lymphatic system (e.g. chronic lymphocyte leukemia, non- Hodgkins and Hodgkins lymphomas); tumors of the hematopoietic system (eg. leukemia, myelodysplastic syndrome, multiple myeloma); radiation therapy; chemotherapy (e.g. platinum containing regimens); inflammatory and autoimmune diseases, including, but not limited to, rheumatoid arthritis, other inflammatory arthritides, systemic lupus erythematosis (SLE), acute or chronic skin diseases (e.g. psoriasis), inflammatory bowel disease (e.g.
- solid tumors e.g. breast cancer, lung cancer, colon cancer
- tumors of the lymphatic system e.g. chronic lymphocyte leukemia, non- Hodgkins and Hodgkins lymphomas
- ActRIIb antagonists e.g., ActRIIb polypeptides
- Hypoproliferative anemias include: 1) anemia of chronic disease, 2) anemia of kidney disease, and 3) anemia associated with hypometabolic states. In each of these types, endogenous erythropoietin levels are inappropriately low for the degree of anemia observed.
- Other hypoproliferative anemias include: 4) early-stage iron-deficient anemia, and 5) anemia caused by damage to the bone marrow. In these types, endogenous erythropoietin levels are appropriately elevated for the degree of anemia observed.
- anemia of chronic disease which encompasses inflammation, infection, tissue injury, and conditions such as cancer, and is distinguished by both low erythropoietin levels and an inadequate response to erythropoietin in the bone marrow (Adamson, 2008, Harrison's Principles of Internal Medicine, 17th ed.; McGraw Hill, New York, pp 628-634).
- Many factors can contribute to cancer-related anemia. Some are associated with the disease process itself and the generation of inflamatory cytokines such as interleukin-1 , interferon-gamma, and tumor necrosis factor (Bron et al., 2001 , Semin Oncol
- Chronic kidney disease is associated with hypoproliferative anemia that varies in severity with the degree of renal impairment. Such anemia is primarily due to inadequate production of erythropoietin and reduced survival of red blood cells.
- Chronic kidney disease usually proceeds gradually over a period of years or decades to end-stage (Stage-5) disease, at which point dialysis or kidney transplantation is required for patient survival. Anemia often develops early in this process and worsens as disease progresses.
- kidney disease The clinical consequences of anemia of kidney disease are well-documented and include development of left ventricular hypertrophy, impaired cognitive function, reduced quality of life, and altered immune function (Levin et al., 1999, Am J Kidney Dis 27:347-354; Nissenson, 1992, Am J Kidney Dis 20(Suppl l):21 -24; Revicki et al., 1995, Am J Kidney Dis 25:548-554; Gafter et al., 1994, Kidney Int 45:224-231). Many conditions resulting in a hypometabolic rate can produce a mild-to- moderate hypoproliferative anemia. Among such conditions are endocrine deficiency states.
- anemia can occur in Addison's disease, hypothyroidism, hyperparathyroidism, or males who are castrated or treated with estrogen. Mild-to-moderate anemia can also occur with reduced dietary intake of protein, a condition particularly prevalent in the elderly. Finally, anemia can develop in patients with chronic liver disease arising from nearly any cause (Adamson, 2008, Harrison's Principles of Internal Medicine, 17th ed.; McGraw Hill, New York, pp 628-634).
- Iron-deficiency anemia is the final stage in a graded progression of increasing iron deficiency which includes negative iron balance and iron-deficient erythropoiesis as intermediate stages. Iron deficiency can result from increased iron demand, decreased iron intake, or increased iron loss, as exemplified in conditions such as pregnancy, inadequate diet, intestinal malabsorption, acute or chronic inflammation, and acute or chronic blood loss.
- An ActRIIb polypeptide, or other ActRIIb antagonist could be used to treat chronic iron-deficiency anemias alone or in combination with conventional therapeutic approaches, particularly to treat anemias of multifactorial origin.
- Hypoproliferative anemias can result from primary dysfunction or failure of the bone marrow, instead of dysfunction secondary to inflammation, infection, or cancer progression.
- Prominent examples would be myelosuppression caused by cancer chemotherapeutic drugs or cancer radiation therapy.
- a broad review of clinical trials found that mild anemia can occur in 100% of patients after chemotherapy, while more severe anemia can occur in up to 80% of such patients (Groopman et al., 1999, J Natl Cancer Inst 91 : 1616-1634).
- Myelosuppressive drugs include: 1) alkylating agents such as nitrogen mustards (e.g., melphalan) and nitrosoureas (e.g., streptozocin); 2) antimetabolites such as folic acid antagonists (e.g., methotrexate), purine analogs (e.g., thioguanine), and pyrimidine analogs (e.g., gemcitabine); 3) cytotoxic antibotics such as anthracyclines (e.g., doxorubicin); 4) kinase inhibitors (e.g., gefitinib); 5) mitotic inhibitors such as taxanes (e.g., paclitaxel) and vinca alkaloids (e.g., vinorelbine); 6) monoclonal antibodies (e.g., rituximab); and 7) topoisomerase inhibitors (e.g., topotecan and etoposide).
- ActRIIb antagonists e.g., ActRIIb polypeptides
- anemias of disordered RBC maturation which are characterized in part by undersized (microcytic), oversized (macrocytic), misshapen, or abnormally colored (hypochromic) RBCs.
- Patients may be treated with a dosing regimen intended to restore the patient to a target hemoglobin level, usually between about 10 g/dl and about 12.5 g/dl, and typically about 1 1.0 g/dl (see also Jacobs et al. (2000) Nephrol Dial Transplant 15, 15-19), although lower target levels may cause fewer cardiovascular or other side effects.
- hematocrit levels (percentage of the volume of a blood sample occupied by the cells) can be used as a measure for the condition of red blood cells. Hematocrit levels for healthy individuals range from 41 to 51% for adult males and from 35 to 45% for adult females. Target hematocrit levels are usually around 30-33%. Moreover, hemoglobin/hematocrit levels vary from person to person. Thus, optimally, the target hemoglobin/hematocrit level can be individualized for each patient. ActRIIb antagonists disclosed herein may be useful for increasing red blood cell and hemoglobin levels in patients that do not respond well to Epo.
- an ActRIIb antagonist may be beneficial for a patient in which administering of a normal to increased (>300 lU/kg/week) dose of Epo does not result in the increase of hemoglobin level up to the target level.
- Patients with an inadequate Epo response are found for all types of anemia, but higher numbers of non-responders have been observed particularly frequently in patients with cancers and patients with end-stage renal disease.
- An inadequate response to Epo can be either constitutive (i.e. observed upon the first treatment with Epo) or acquired (e.g. observed upon repeated treatment with Epo).
- the ActRIIb antagonists may also be used to treat patients that are susceptible to adverse effects of Epo.
- Epo The primary adverse effects of Epo are an excessive increase in the hematocrit or hemoglobin levels and polycythemia. Elevated hematocrit levels can lead to hypertension (more particularly aggravation of hypertension) and vascular thrombosis.
- ActRIIb antagonists can be used to promote muscle growth and increase muscle strength.
- ActRIIb antagonists can be used to increase red blood cell levels and promote muscle growth.
- ActRIIb antagonists may be particularly helpful to patients with a disorder that is associated with muscle loss and anemia. Examples include cancer- and cancer treatments, many forms of cachexia (muscle wasting) and sarcopenia (muscle loss associated with aging).
- ActRIIb antagonists e.g., ActRIIb polypeptides
- a pharmaceutically acceptable carrier for example, an ActRIIb polypeptide can be administered alone or as a component of a pharmaceutical formulation (therapeutic composition).
- the subject compounds may be formulated for administration in any convenient way for use in human or veterinary medicine.
- the therapeutic method of the invention includes administering the composition systemically, or locally as an implant or device.
- the therapeutic composition for use in this invention is, of course, in a pyrogen-free, physiologically acceptable form.
- Therapeutically useful agents other than the ActRIIb antagonists which may also optionally be included in the composition as described above, may be administered simultaneously or sequentially with the subject compounds (e.g., ActRIIb polypeptides) in the methods of the invention.
- ActRIIb antagonists will be administered parenterally.
- Pharmaceutical compositions suitable for parenteral administration may comprise one or more ActRIIb-polypeptides in combination with one or more pharmaceutically acceptable sterile isotonic aqueous or nonaqueous solutions, dispersions, suspensions or emulsions, or sterile powders which may be reconstituted into sterile injectable solutions or dispersions just prior to use, which may contain antioxidants, buffers, bacteriostats, solutes which render the formulation isotonic with the blood of the intended recipient or suspending or thickening agents.
- aqueous and nonaqueous carriers examples include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
- polyols such as glycerol, propylene glycol, polyethylene glycol, and the like
- vegetable oils such as olive oil
- injectable organic esters such as ethyl oleate.
- Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
- compositions of the present invention may include a matrix capable of delivering one or more therapeutic compounds (e.g., ActRIIb polypeptides) to a target tissue site (e.g., bone marrow), providing a structure for the developing tissue and optimally capable of being resorbed into the body.
- the matrix may provide slow release of the ActRIIb polypeptides.
- Such matrices may be formed of materials presently in use for other implanted medical applications.
- matrix material is based on biocompatibility, biodegradability, mechanical properties, cosmetic appearance and interface properties.
- the particular application of the subject compositions will define the appropriate formulation.
- Potential matrices for the compositions may be biodegradable and chemically defined calcium sulfate, tricalciumphosphate, hydroxyapatite, polylactic acid and polyanhydrides.
- Other potential materials are biodegradable and biologically well defined, such as bone or dermal collagen.
- Further matrices are comprised of pure proteins or extracellular matrix components.
- Other potential matrices are nonbiodegradable and chemically defined, such as sintered hydroxyapatite, bioglass, aluminates, or other ceramics.
- Matrices may be comprised of combinations of any of the above mentioned types of material, such as polylactic acid and hydroxyapatite or collagen and tricalciumphosphate.
- the bioceramics may be altered in composition, such as in calcium-aluminate-phosphate and processing to alter pore size, particle size, particle shape, and biodegradability.
- methods of the invention can be administered for orally, e.g., in the form of capsules, cachets, pills, tablets, lozenges (using a flavored basis, usually sucrose and acacia or tragacanth), powders, granules, or as a solution or a suspension in an aqueous or non-aqueous liquid, or as an oil-in-water or water- in-oil liquid emulsion, or as an elixir or syrup, or as pastilles (using an inert base, such as gelatin and glycerin, or sucrose and acacia) and/or as mouth washes and the like, each containing a predetermined amount of an agent as an active ingredient.
- An agent may also be administered as a bolus, electuary or paste.
- one or more therapeutic compounds of the present invention may be mixed with one or more pharmaceutically acceptable carriers, such as sodium citrate or dicalcium phosphate, and/or any of the following: (1) fillers or extenders, such as starches, lactose, sucrose, glucose, mannitol, and/or silicic acid; (2) binders, such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinyl pyrrolidone, sucrose, and/or acacia; (3) humectants, such as glycerol; (4) disintegrating agents, such as agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate; (5) solution retarding agents, such as paraffin; (6) absorption accelerators, such as quaternary ammonium compounds; (7) wetting agents, such as
- compositions may also comprise buffering agents.
- Solid compositions of a similar type may also be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugars, as well as high molecular weight polyethylene glycols and the like.
- Liquid dosage forms for oral administration include pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups, and elixirs.
- the liquid dosage forms may contain inert diluents commonly used in the art, such as water or other solvents, solubilizing agents and emulsifiers, such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1 ,3-butylene glycol, oils (in particular, cottonseed, groundnut, com, germ, olive, castor, and sesame oils), glycerol, tetrahydrofuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof.
- inert diluents commonly used in the art, such as water or other solvents, solubilizing agents and emulsifiers, such as
- the oral compositions can also include adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, coloring, perfuming, and preservative agents.
- Suspensions in addition to the active compounds, may contain suspending agents such as ethoxylated isostearyl alcohols, polyoxyethylene sorbitol, and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth, and mixtures thereof.
- the compositions of the invention may also contain adjuvants, such as preservatives, wetting agents, emulsifying agents and dispersing agents.
- microorganisms Prevention of the action of microorganisms may be ensured by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption, such as aluminum monostearate and gelatin.
- agents which delay absorption such as aluminum monostearate and gelatin.
- the dosage regimen will be determined by the attending physician considering various factors which modify the action of the subject compounds of the invention (e.g., ActRIIb polypeptides).
- the various factors include, but are not limited to, the patient's red blood cell count, hemoglobin level or other diagnostic assessments, the desired target red blood cell count, the patient's age, sex, and diet, the severity of any disease that may be contributing to a depressed red blood cell level, time of administration, and other clinical factors.
- the addition of other known growth factors to the final composition may also affect the dosage. Progress can be monitored by periodic assessment of red blood cell and hemoglobin levels, as well as assessments of reticulocyte levels and other indicators of the hematopoietic process.
- the present invention also provides gene therapy for the in vivo production of ActRIIb polypeptides.
- Such therapy would achieve its therapeutic effect by introduction of the ActRIIb polynucleotide sequences into cells or tissues having the disorders as listed above.
- Delivery of ActRIIb polynucleotide sequences can be achieved using a recombinant expression vector such as a chimeric virus or a colloidal dispersion system.
- Preferred for therapeutic delivery of ActRIIb polynucleotide sequences is the use of targeted liposomes.
- Various viral vectors which can be utilized for gene therapy as taught herein include adenovirus, herpes virus, vaccinia, or an RNA virus such as a retrovirus.
- the retroviral vector may be a derivative of a murine or avian retrovirus.
- retroviral vectors in which a single foreign gene can be inserted include, but are not limited to: Moloney murine leukemia virus (MoMuLV), Harvey murine sarcoma virus (HaMuSV), murine mammary tumor virus (MuMTV), and Rous Sarcoma Virus (RSV).
- MoMuLV Moloney murine leukemia virus
- HaMuSV Harvey murine sarcoma virus
- MuMTV murine mammary tumor virus
- RSV Rous Sarcoma Virus
- retroviral vectors can incorporate multiple genes. All of these vectors can transfer or incorporate a gene for a selectable marker so that transduced cells can be identified and generated.
- Retroviral vectors can be made target-specific by attaching, for example, a sugar, a glycolipid, or a protein. Preferred targeting is accomplished by using an antibody.
- tissue culture cells can be directly transfected with plasmids encoding the retroviral structural genes gag, pol and env, by conventional calcium phosphate transfection. These cells are then transfected with the vector plasmid containing the genes of interest. The resulting cells release the retroviral vector into the culture medium.
- Another targeted delivery system for ActRIlb polynucleotides is a colloidal dispersion system.
- Colloidal dispersion systems include macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
- the preferred colloidal system of this invention is a liposome.
- Liposomes are artificial membrane vesicles which are useful as delivery vehicles in vitro and in vivo. RNA, DNA and intact virions can be encapsulated within the aqueous interior and be delivered to cells in a biologically active form (see e.g., Fraley, et al., Trends Biochem. Sci., 6:77, 1981 ).
- compositions of the liposome is usually a combination of phospholipids, usually in combination with steroids, especially cholesterol. Other phospholipids or other lipids may also be used.
- the physical characteristics of liposomes depend on pH, ionic strength, and the presence of divalent cations.
- lipids useful in liposome production include phosphatidyl compounds, such as phosphatidylglycerol, phosphatidylcholine, phosphatidylserine, phosphatidylethanolamine, sphingolipids, cerebrosides, and gangliosides.
- Illustrative phospholipids include egg phosphatidylcholine, dipalmitoylphosphatidylcholine, and distearoylphosphatidylcholine.
- the targeting of liposomes is also possible based on, for example, organ-specificity, cell- specificity, and organelle-specif ⁇ city and is known in the art.
- the constructs are referred to as ActRIIb-hFc and ActRIIb-mFc, respectively.
- ActRIIb-hFc is shown below as purified from CHO cell lines (SEQ ID NO: 8):
- HBML Honey bee mellitin
- TPA Tissue Plasminogen Activator
- the selected form employs the TPA leader and has the following unprocessed amino acid sequence (SEQ ID NO: 9): MDAMKRGLCCVLLLCGAVFVSPGASGRGEAETRECIYYNANWELERTNOS GLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATE ENPOVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTGGGTHTCPPCPA PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEOYNSTYRVVSVLTVLHODWLNGKEYKCKVSNKALPVPIE KTISKAKGOPREPOVYTLPPSREEMTKNOVSLTCLVKGFYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWOOGNVFSCSVMHEALHNH YTOKSLSLSPGK
- This polypeptide is encoded by the following nucleic acid sequence (SEQ ID NO: 10): A TGGATGCAAT GAAGAGAGGG CTCTGCTGTG TGCTGCTGCT GTGTGGAGCA
- Purification could be achieved by a series of column chromatography steps, including, for example, three or more of the following, in any order: protein A chromatography. Q sepharose chromatography, phenylsepharose chromatography, size exclusion chromatography, and cation exchange chromatography. The purification could be completed with viral filtration and buffer exchange.
- ActRIIb-Fc fusion proteins were also expressed in HEK293 cells and COS cells. Although material from all cell lines and reasonable culture conditions provided protein with muscle-building activity in vivo, variability in potency was observed perhaps relating to cell line selection and/or culture conditions.
- the background ActRIIB-Fc fusion has the sequence of SEQ ID NO:6.
- HEK293T cells were produced in HEK293T cells by transient transfection.
- HEK293T cells were set up at 6x10 5 cells/ml in Freestyle (Invitrogen) media in 250ml volume and grown overnight. Next day, these cells were treated with DNA:PEI (1 :1) complex at 0.5 ug/ml final DNA concentration. After 4 hrs, 250 ml media was added and cells were grown for 7 days. Conditioned media was harvested by spinning down the cells and concentrated. Mutants were purified using a variety of techniques, including, for example, protein A column and eluted with low pH (3.0) glycine buffer . After neutralization, these were dialyzed against PBS.
- Mutants were also produced in CHO cells by similar methodology.
- ActRIIb variants were tested in binding assays and/or bioassays described. Characteristics of various ActRIIb variants are described in WO/2008/097541 and WO/2006/012627, incorporated by reference herein. In some instances, assays were performed with conditioned medium rather than purified proteins. Additional variations of ActRIIb are described in US Application Serial No. 12/012,652.
- ActRIIb-hFc (IgGl ) was administered once a week for 1 -month to male and female cynomolgus monkeys by subcutaneous injection. Forty-eight cynomolgus monkeys (24/sex) were assigned to one of four treatment groups (6 animals/sex/group) and were administered subcutaneous injections of either vehicle or ActRIIb-hFc at 3, 10, or 30 mg/kg once weekly for 4 weeks (total of 5 doses). Parameters evaluated included general clinical pathology (hematology, clinical chemistry, coagulation, and urinalysis). ActRIIb-hFc caused statistically significant elevated mean absolute reticulocyte values by day 15 in treated animals.
- ActRIIb-hFc caused several hematological changes, including elevated mean absolute reticulocyte and red blood cell distribution width values and lower mean corpuscular hemoglobin concentration. All treated groups and both sexes were affected. These effects are consistent with a positive effect of ActRIIb-hFc on the release of immature reticulocytes from the bone marrow. This effect was reversed after drug was washed out of the treated animals (by study day 56). Accordingly, we conclude that ActRIIb-hFc stimulates ervthropoiesis.
- Example 3 ActRIIb-mFc Promotes Aspects of Erythropoiesis in Mice by Stimulation of Splenic Erythropoietic Activities
- mice with ActRIIb-mFc did not result in significant increases in red blood cell or hemoglobin content.
- the compound treated group experienced a statistically significant increase in the nucleated cell number before red blood cell lysis and in the mature erythroid progenitor (CFU-E) colony number per dish, frequency and total progenitor number per spleen.
- CFU-GM myeloid
- BFU-E immature erythroid
- total progenitor number per spleen an increase was seen in the number of myeloid (CFU-GM), immature erythroid (BFU-E) and total progenitor number per spleen. Accordingly, it is expected that over a longer time course, ActRIIb-mFc treatment may result in elevated red blood cell and hemoglobin content.
- ActRIIb-Fc has a statistically significant effect on hematologic parameters in rodents.
- significant increases in hemoglobin concentration or RBC count were observed, and reticulocyte concentrations increased in a dose-dependent manner.
- ActRIIb-mFc is effective to promote growth of muscle mass in a variety of mouse models of human muscle disorders, including muscle dystrophy, amyotrophic lateral sclerosis and cancer cachexia.
- mice were subcutaneously dosed daily for 13 days with either PBS or dexamethasone (2mg/kg) to induce muscle wasting. Over the same 13 days, PBS- and dexamethosone-treated groups received vehicle or ActRIIB (R64 20-134)-mFc (lOmg/kg; i.p.; twice/week) such that all combinations of treatments were represented. Mice were NMR scanned at days 0 and 13 to determine changes in lean tissue mass across the groups. NMR results are outlined in Table 6, below. Table 6: Lean tissue mass of vehicle- and murine ActRIIB (R64 20-134)-Fc -treated mice
- NMR scanning showed a significant 2.5% decrease in lean tissue mass in the dexamethasone:PBS group compared to the PBS:PBS cohort.
- the dexamethasone: ActRIIB (R64 20-134)-mFc group exhibited a 13.5% increase in lean tissue mass, a significant increase when compared to both the PBSrPBS and the dexamethasone:PBS groups.
- Cachexia is an undesirable side effect for a variety of therapeutic treatments, including chronic glucocorticoid therapy. Therefore it could be of clinical importance that treatment with a human ActRIIB (R64 20-134)-mFc protein can attenuate the muscle wasting associated with cachexia.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Epidemiology (AREA)
- Engineering & Computer Science (AREA)
- Immunology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Marine Sciences & Fisheries (AREA)
- Organic Chemistry (AREA)
- Hematology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Diabetes (AREA)
- Cell Biology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicinal Preparation (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Priority Applications (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP20195139.9A EP3804746A1 (en) | 2008-06-26 | 2009-06-26 | Antagonists of actriib and uses for increasing red blood cell levels |
| ES09770553T ES2852699T3 (es) | 2008-06-26 | 2009-06-26 | Antagonistas de ActRIIb y usos para aumentar los niveles de glóbulos rojos |
| CA2729054A CA2729054C (en) | 2008-06-26 | 2009-06-26 | Antagonists of actriib and uses for increasing red blood cell levels |
| EP09770553.7A EP2303917B1 (en) | 2008-06-26 | 2009-06-26 | Antagonists of actriib and uses for increasing red blood cell levels |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US13336808P | 2008-06-26 | 2008-06-26 | |
| US61/133,368 | 2008-06-26 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2009158015A2 true WO2009158015A2 (en) | 2009-12-30 |
| WO2009158015A3 WO2009158015A3 (en) | 2010-03-04 |
Family
ID=41445146
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2009/003838 Ceased WO2009158033A2 (en) | 2008-06-26 | 2009-06-26 | Antagonists of activin-actriia and uses for increasing red blood cell levels |
| PCT/US2009/003808 Ceased WO2009158015A2 (en) | 2008-06-26 | 2009-06-26 | Antagonists of actriib and uses for increasing red blood cell levels |
Family Applications Before (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2009/003838 Ceased WO2009158033A2 (en) | 2008-06-26 | 2009-06-26 | Antagonists of activin-actriia and uses for increasing red blood cell levels |
Country Status (10)
| Country | Link |
|---|---|
| EP (4) | EP2318028B1 (enExample) |
| JP (8) | JP5773868B2 (enExample) |
| KR (4) | KR20210047374A (enExample) |
| CN (2) | CN107252486B (enExample) |
| AU (4) | AU2009262968A1 (enExample) |
| CA (3) | CA2729054C (enExample) |
| DK (1) | DK2318028T3 (enExample) |
| ES (2) | ES2852699T3 (enExample) |
| NZ (2) | NZ590326A (enExample) |
| WO (2) | WO2009158033A2 (enExample) |
Cited By (36)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2011020045A1 (en) * | 2009-08-13 | 2011-02-17 | Acceleron Pharma Inc. | Combined use of gdf traps and erythropoietin receptor activators to increase red blood cell levels |
| US8128933B2 (en) | 2005-11-23 | 2012-03-06 | Acceleron Pharma, Inc. | Method of promoting bone growth by an anti-activin B antibody |
| US8138142B2 (en) | 2009-01-13 | 2012-03-20 | Acceleron Pharma Inc. | Methods for increasing adiponectin in a patient in need thereof |
| US8173601B2 (en) | 2007-02-09 | 2012-05-08 | Acceleron Pharma, Inc. | Activin-ActRIIa antagonists and uses for treating multiple myeloma |
| US8178488B2 (en) | 2009-06-08 | 2012-05-15 | Acceleron Pharma, Inc. | Methods for increasing thermogenic adipocytes |
| US8216997B2 (en) | 2008-08-14 | 2012-07-10 | Acceleron Pharma, Inc. | Methods for increasing red blood cell levels and treating anemia using a combination of GDF traps and erythropoietin receptor activators |
| US8293881B2 (en) | 2009-06-12 | 2012-10-23 | Acceleron Pharma Inc. | Isolated nucleic acid encoding a truncated ActRIIB fusion protein |
| US8343933B2 (en) | 2007-02-02 | 2013-01-01 | Acceleron Pharma, Inc. | Variants derived from ActRIIB and uses therefor |
| US8361957B2 (en) | 2008-08-14 | 2013-01-29 | Acceleron Pharma, Inc. | Isolated GDF trap polypeptide |
| US8367611B2 (en) | 2007-09-18 | 2013-02-05 | Acceleron Pharma Inc. | Activin-actriia antagonists for inhibiting germ cell maturation |
| GR1007832B (el) * | 2011-11-21 | 2013-02-14 | Ιδρυμα Ιατροβιολογικων Ερευνων Ακαδημιας Αθηνων, | Αδρανοποιητες της ακτιβινης και χρηση τους για την θεραπεια ασθενειων που σχετιζονται με παρεκκλινουσα ενεργοποιηση της "αμυντικης αποκρισης του ξενιστη" |
| US8629109B2 (en) | 2005-11-23 | 2014-01-14 | Acceleron Pharma Inc. | Method for promoting bone growth using activin-actriia antagonists |
| US8710016B2 (en) | 2009-11-17 | 2014-04-29 | Acceleron Pharma, Inc. | ActRIIB proteins and variants and uses therefore relating to utrophin induction for muscular dystrophy therapy |
| WO2014116981A1 (en) * | 2013-01-25 | 2014-07-31 | Shire Human Genetic Therapies, Inc. | Follistatin in treating duchenne muscular dystrophy |
| US8895016B2 (en) | 2006-12-18 | 2014-11-25 | Acceleron Pharma, Inc. | Antagonists of activin-actriia and uses for increasing red blood cell levels |
| US9138459B2 (en) | 2004-07-23 | 2015-09-22 | Acceleron Pharma Inc. | ACTRIIB-FC polynucleotides, polypeptides, and compositions |
| WO2015161220A1 (en) * | 2014-04-18 | 2015-10-22 | Acceleron Pharma, Inc. | Methods for increasing red blood cell levels and treating sickle-cell disease |
| EP2844272A4 (en) * | 2012-04-06 | 2015-11-04 | Acceleron Pharma Inc | METHOD AND COMPOSITIONS FOR INCREASING RED BLOOD BODIES |
| WO2015192111A1 (en) * | 2014-06-13 | 2015-12-17 | Acceleron Pharma, Inc. | Methods and compositions for treating ulcers |
| US9493556B2 (en) | 2010-11-08 | 2016-11-15 | Acceleron Pharma Inc. | Actriia binding agents and uses thereof |
| US9526759B2 (en) | 2007-02-01 | 2016-12-27 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for treating or preventing breast cancer |
| US10195249B2 (en) | 2012-11-02 | 2019-02-05 | Celgene Corporation | Activin-ActRII antagonists and uses for treating bone and other disorders |
| US10550170B2 (en) | 2015-11-23 | 2020-02-04 | Acceleron Pharma Inc. | Methods for treating vascular eye disorders with actrii antagonists |
| EP3523328A4 (en) * | 2016-10-05 | 2020-04-01 | Acceleron Pharma Inc. | VARIANT ACTRIIB PROTEINS AND USES THEREOF |
| EP3439741A4 (en) * | 2016-04-06 | 2020-05-06 | Acceleron Pharma Inc. | ALK7 ANTAGONISTS AND USES THEREOF |
| US10913782B2 (en) | 2015-04-22 | 2021-02-09 | Biogen Ma Inc. | Hybrid ActRIIB ligand trap proteins for treating muscle wasting diseases |
| US11013785B2 (en) | 2016-11-10 | 2021-05-25 | Keros Therapeutics, Inc. | Activin receptor type IIA variants and methods of use thereof |
| AU2019204127B2 (en) * | 2009-08-13 | 2021-08-12 | Acceleron Pharma Inc. | Combined use of GDF traps and erythropoietin receptor activators to increase red blood cell levels |
| US11471510B2 (en) | 2014-12-03 | 2022-10-18 | Celgene Corporation | Activin-ActRII antagonists and uses for treating anemia |
| US11484573B2 (en) | 2017-11-09 | 2022-11-01 | Keros Therapeutics, Inc. | Activin receptor type IIa variants and methods of use thereof |
| US11813308B2 (en) | 2014-10-09 | 2023-11-14 | Celgene Corporation | Treatment of cardiovascular disease using ActRII ligand traps |
| US11884715B2 (en) | 2018-01-12 | 2024-01-30 | Keros Therapeutics, Inc. | Activin receptor type IIB variants and methods of use thereof |
| US12187783B2 (en) | 2016-10-20 | 2025-01-07 | Alivegen Inc | Methods for treating muscle wasting and bone disease using novel hybrid ActRIIB ligand trap proteins |
| US12194076B2 (en) | 2016-07-27 | 2025-01-14 | Acceleron Pharma Inc. | Methods and compositions for treating myelofibrosis |
| US12364737B2 (en) | 2018-05-09 | 2025-07-22 | Keros Therapeutics, Inc. | Activin receptor type IIA variants and methods of use thereof |
| US12440539B2 (en) | 2020-03-20 | 2025-10-14 | Keros Therapeutics, Inc. | Methods of using activin receptor type IIB variants |
Families Citing this family (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN112957462A (zh) * | 2012-10-24 | 2021-06-15 | 细胞基因公司 | 用于治疗贫血的方法 |
| KR102305109B1 (ko) * | 2014-06-04 | 2021-09-27 | 악셀레론 파마 인코포레이티드 | 폴리스타틴 폴리펩티드를 이용한 장애의 치료방법 및 치료를 위한 조성물 |
| AU2016246602B2 (en) * | 2015-04-06 | 2020-11-19 | Acceleron Pharma Inc. | Single-arm type I and type II receptor fusion proteins and uses thereof |
| CN113015743B (zh) * | 2018-11-15 | 2025-06-24 | 三菱化学株式会社 | 改变型激活素a |
| KR20220049568A (ko) * | 2019-08-22 | 2022-04-21 | 더 리전츠 오브 더 유니버시티 오브 캘리포니아 | 엔젤만 증후군의 치료를 위한 ube3a |
| CA3228901A1 (en) * | 2021-09-03 | 2023-03-09 | Chris Xiangyang Lu | Anti-acvr2a antibodies and uses thereof |
Citations (18)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US1265208A (en) | 1915-09-07 | 1918-05-07 | Edward C Kahn | Liquid-fuel burner. |
| US5096815A (en) | 1989-01-06 | 1992-03-17 | Protein Engineering Corporation | Generation and selection of novel dna-binding proteins and polypeptides |
| US5198346A (en) | 1989-01-06 | 1993-03-30 | Protein Engineering Corp. | Generation and selection of novel DNA-binding proteins and polypeptides |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5283317A (en) | 1987-08-03 | 1994-02-01 | Ddi Pharmaceuticals, Inc. | Intermediates for conjugation of polypeptides with high molecular weight polyalkylene glycols |
| US5525490A (en) | 1994-03-29 | 1996-06-11 | Onyx Pharmaceuticals, Inc. | Reverse two-hybrid method |
| WO1996026432A1 (en) | 1995-02-23 | 1996-08-29 | University Of Utah Research Foundation | Composite waveguide for solid phase binding assays |
| US5677196A (en) | 1993-05-18 | 1997-10-14 | University Of Utah Research Foundation | Apparatus and methods for multi-analyte homogeneous fluoro-immunoassays |
| US5955280A (en) | 1995-04-11 | 1999-09-21 | The General Hospital Corporation | Reverse two-hybrid system |
| WO2002032925A2 (en) | 2000-10-16 | 2002-04-25 | Phylos, Inc. | Protein scaffolds for antibody mimics and other binding proteins |
| WO2002088171A2 (en) | 2001-04-26 | 2002-11-07 | Avidia Research Institute | Combinatorial libraries of monomer domains |
| US6537966B1 (en) | 1997-08-29 | 2003-03-25 | Human Genome Sciences, Inc. | Follistatin-3 |
| WO2005025601A1 (en) | 2003-09-15 | 2005-03-24 | Monash University | Follistatin isoforms and uses thereof |
| WO2005100563A1 (ja) | 2004-04-15 | 2005-10-27 | Techno Network Shikoku Co., Ltd. | フォリスタチン変異体ポリペプチド |
| WO2006012627A2 (en) | 2004-07-23 | 2006-02-02 | Acceleron Pharma Inc. | Actrii receptor polypeptides, methods and compositions |
| WO2006055689A2 (en) | 2004-11-16 | 2006-05-26 | Avidia Research Institute | Protein scaffolds and uses thereof |
| WO2008030367A2 (en) | 2006-09-01 | 2008-03-13 | The General Hospital Corporation | Selective myostatin inhibitors |
| WO2008097541A2 (en) | 2007-02-02 | 2008-08-14 | Acceleron Pharma Inc. | Variants derived from actriib and uses therefor |
Family Cites Families (18)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1992004913A1 (en) * | 1990-09-13 | 1992-04-02 | Children's Hospital Medical Center Of Northern California | Method for increasing red blood cell production by treatment with activin or activin-related peptides |
| US6231880B1 (en) * | 1997-05-30 | 2001-05-15 | Susan P. Perrine | Compositions and administration of compositions for the treatment of blood disorders |
| US6953662B2 (en) * | 1997-08-29 | 2005-10-11 | Human Genome Sciences, Inc. | Follistatin-3 |
| US6468543B1 (en) * | 1999-05-03 | 2002-10-22 | Zymogenetics, Inc. | Methods for promoting growth of bone using ZVEGF4 |
| IL159015A0 (en) * | 2001-05-25 | 2004-05-12 | Genset Sa | Polypeptides, their preparation and use |
| US6855344B2 (en) * | 2001-07-17 | 2005-02-15 | Integrated Chinese Medicine Holdings, Ltd. | Compositions and methods for prostate and kidney health and disorders, an herbal preparation |
| US20040223966A1 (en) * | 2002-10-25 | 2004-11-11 | Wolfman Neil M. | ActRIIB fusion polypeptides and uses therefor |
| US20070184052A1 (en) * | 2003-05-09 | 2007-08-09 | Lin Herbert Y | Soluble tgf-b type III receptor fusion proteins |
| JP2008509927A (ja) * | 2004-08-12 | 2008-04-03 | ワイス | Gdf−8阻害剤を使用する、糖尿病、肥満、および心臓血管疾患のための併用療法 |
| EA201692543A1 (ru) | 2005-11-23 | 2017-08-31 | Акселерон Фарма Инк. | Антагонисты активина-actriia и их применение для стимулирования роста кости |
| EA200802213A1 (ru) * | 2006-05-09 | 2009-10-30 | Химекуэст Фармасьютикалз, Инк. | Способы лечения заболеваний крови |
| SI2043802T1 (sl) * | 2006-07-13 | 2012-11-30 | Basf Se | Termoplastične mase ki vsebujejo vezalna sredstva za proizvodnjo kovinskih kalupov |
| ES2382993T3 (es) * | 2006-07-21 | 2012-06-15 | Lyne Laboratories, Inc. | Composición líquida de acetato de calcio |
| US7547781B2 (en) * | 2006-09-11 | 2009-06-16 | Curis, Inc. | Quinazoline based EGFR inhibitors containing a zinc binding moiety |
| EP2124999B1 (en) * | 2006-12-18 | 2012-10-03 | Acceleron Pharma, Inc. | Activin-actrii antagonists and uses for treating anemia |
| KR20160129095A (ko) | 2007-02-09 | 2016-11-08 | 악셀레론 파마 인코포레이티드 | 액티빈-ActRⅡA 길항제 및 암 환자에서 골 생장을 촉진시키기 위한 이의 용도 |
| CA2699936A1 (en) * | 2007-09-18 | 2009-03-26 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for decreasing or inhibiting fsh secretion |
| DE102008016742B4 (de) * | 2008-03-31 | 2010-01-14 | Thyssenkrupp Presta Ag | Lenksäule für ein Kraftfahrzeug |
-
2009
- 2009-06-26 EP EP09770571.9A patent/EP2318028B1/en active Active
- 2009-06-26 JP JP2011516323A patent/JP5773868B2/ja active Active
- 2009-06-26 NZ NZ590326A patent/NZ590326A/xx unknown
- 2009-06-26 CA CA2729054A patent/CA2729054C/en active Active
- 2009-06-26 DK DK09770571.9T patent/DK2318028T3/da active
- 2009-06-26 EP EP09770553.7A patent/EP2303917B1/en active Active
- 2009-06-26 CN CN201710403739.0A patent/CN107252486B/zh active Active
- 2009-06-26 NZ NZ602471A patent/NZ602471A/en unknown
- 2009-06-26 CN CN200980133280.0A patent/CN102131515B/zh active Active
- 2009-06-26 WO PCT/US2009/003838 patent/WO2009158033A2/en not_active Ceased
- 2009-06-26 KR KR1020217011646A patent/KR20210047374A/ko not_active Ceased
- 2009-06-26 AU AU2009262968A patent/AU2009262968A1/en not_active Abandoned
- 2009-06-26 CA CA3049354A patent/CA3049354A1/en not_active Abandoned
- 2009-06-26 ES ES09770553T patent/ES2852699T3/es active Active
- 2009-06-26 KR KR1020117001139A patent/KR20110031951A/ko not_active Withdrawn
- 2009-06-26 WO PCT/US2009/003808 patent/WO2009158015A2/en not_active Ceased
- 2009-06-26 KR KR1020177008278A patent/KR102024444B1/ko active Active
- 2009-06-26 EP EP20195139.9A patent/EP3804746A1/en not_active Withdrawn
- 2009-06-26 ES ES09770571T patent/ES2791699T3/es active Active
- 2009-06-26 EP EP19191414.2A patent/EP3620795A1/en not_active Withdrawn
- 2009-06-26 CA CA2729098A patent/CA2729098C/en active Active
- 2009-06-26 KR KR1020197012336A patent/KR20190049912A/ko not_active Ceased
-
2014
- 2014-02-07 JP JP2014022289A patent/JP2014088438A/ja not_active Withdrawn
-
2015
- 2015-07-23 JP JP2015145499A patent/JP2015187180A/ja not_active Withdrawn
-
2016
- 2016-05-12 AU AU2016203098A patent/AU2016203098B2/en active Active
- 2016-11-11 JP JP2016220297A patent/JP2017036331A/ja not_active Withdrawn
-
2018
- 2018-06-08 AU AU2018204105A patent/AU2018204105A1/en not_active Abandoned
- 2018-09-03 JP JP2018164196A patent/JP2018184484A/ja not_active Withdrawn
- 2018-09-03 JP JP2018164195A patent/JP6643432B2/ja active Active
-
2019
- 2019-12-23 JP JP2019231523A patent/JP2020041002A/ja not_active Withdrawn
-
2020
- 2020-08-17 AU AU2020220046A patent/AU2020220046A1/en not_active Abandoned
-
2021
- 2021-10-28 JP JP2021176418A patent/JP2022023184A/ja not_active Withdrawn
Patent Citations (20)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US1265208A (en) | 1915-09-07 | 1918-05-07 | Edward C Kahn | Liquid-fuel burner. |
| US5283317A (en) | 1987-08-03 | 1994-02-01 | Ddi Pharmaceuticals, Inc. | Intermediates for conjugation of polypeptides with high molecular weight polyalkylene glycols |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5096815A (en) | 1989-01-06 | 1992-03-17 | Protein Engineering Corporation | Generation and selection of novel dna-binding proteins and polypeptides |
| US5198346A (en) | 1989-01-06 | 1993-03-30 | Protein Engineering Corp. | Generation and selection of novel DNA-binding proteins and polypeptides |
| US5677196A (en) | 1993-05-18 | 1997-10-14 | University Of Utah Research Foundation | Apparatus and methods for multi-analyte homogeneous fluoro-immunoassays |
| US5525490A (en) | 1994-03-29 | 1996-06-11 | Onyx Pharmaceuticals, Inc. | Reverse two-hybrid method |
| WO1996026432A1 (en) | 1995-02-23 | 1996-08-29 | University Of Utah Research Foundation | Composite waveguide for solid phase binding assays |
| US5955280A (en) | 1995-04-11 | 1999-09-21 | The General Hospital Corporation | Reverse two-hybrid system |
| US5965368A (en) | 1995-04-11 | 1999-10-12 | The General Hospital Corporation | Reverse two-hybrid systems |
| US6537966B1 (en) | 1997-08-29 | 2003-03-25 | Human Genome Sciences, Inc. | Follistatin-3 |
| WO2002032925A2 (en) | 2000-10-16 | 2002-04-25 | Phylos, Inc. | Protein scaffolds for antibody mimics and other binding proteins |
| WO2002088171A2 (en) | 2001-04-26 | 2002-11-07 | Avidia Research Institute | Combinatorial libraries of monomer domains |
| WO2005025601A1 (en) | 2003-09-15 | 2005-03-24 | Monash University | Follistatin isoforms and uses thereof |
| WO2005100563A1 (ja) | 2004-04-15 | 2005-10-27 | Techno Network Shikoku Co., Ltd. | フォリスタチン変異体ポリペプチド |
| WO2006012627A2 (en) | 2004-07-23 | 2006-02-02 | Acceleron Pharma Inc. | Actrii receptor polypeptides, methods and compositions |
| WO2006055689A2 (en) | 2004-11-16 | 2006-05-26 | Avidia Research Institute | Protein scaffolds and uses thereof |
| WO2008030367A2 (en) | 2006-09-01 | 2008-03-13 | The General Hospital Corporation | Selective myostatin inhibitors |
| WO2008097541A2 (en) | 2007-02-02 | 2008-08-14 | Acceleron Pharma Inc. | Variants derived from actriib and uses therefor |
| US20090005308A1 (en) | 2007-02-02 | 2009-01-01 | Acceleron Pharma Inc. | Variants derived from ACTRIIB and uses therefor |
Non-Patent Citations (63)
| Title |
|---|
| ADAMSON: "Harrison's Principles of Internal Medicine", 2008, MCGRAW HILL, pages: 628 - 634 |
| ATTISANO ET AL., CELL, vol. 68, 1992, pages 97 - 108 |
| BALINT ET AL., GENE, vol. 137, 1993, pages 109 - 118 |
| BARTEL ET AL., BIOTECHNIQUES, vol. 14, 1993, pages 920 - 924 |
| BRON ET AL., SEMIN ONCOL, vol. 28, no. 8, 2001, pages 1 - 6 |
| BROWN ET AL., MOL. CELL BIOL., vol. 12, 1992, pages 2644 - 2652 |
| BUNN, N ENGL J MED, vol. 346, no. 7, 2002, pages 522 - 523 |
| COLE ET AL.: "Monoclonal Antibodies and Cancer Therapy", 1985, ALAN R. LISS, INC., pages: 77 - 96 |
| CUNNINGHAM ET AL., SCIENCE, vol. 244, 1989, pages 1081 - 1085 |
| CWIRLA ET AL., PNAS USA, vol. 87, 1990, pages 6378 - 6382 |
| DELANTY ET AL., NEUROLOGY, vol. 49, 1997, pages 686 - 689 |
| DEMETRI ET AL., J CLIN ONCOL, vol. 16, 1998, pages 3412 - 3425 |
| DEPAOLO ET AL., PROC SOC EP BIOL MED., vol. 198, 1991, pages 500 - 512 |
| DEVLIN ET AL., SCIENCE, vol. 249, 1990, pages 404 - 406 |
| DYSON ET AL., CURR BIOL., vol. 7, 1997, pages 81 - 84 |
| ESTEY, CURR OPIN HEMATOL, vol. 10, 2003, pages 60 - 67 |
| FRALEY ET AL., TRENDS BIOCHEM. SCI., vol. 6, 1981, pages 77 |
| GAFTER ET AL., KIDNEY INT, vol. 45, 1994, pages 224 - 231 |
| GANZ, J AM SOC NEPHROL, vol. 18, 2007, pages 394 - 400 |
| GLASPY ET AL., J CLIN ONCOL, vol. 15, 1997, pages 1218 - 1234 |
| GREENER ET AL., STRATEGIES IN MOL BIOL, vol. 7, 1994, pages 32 - 34 |
| GROBET ET AL., NAT GENET., vol. 17, no. l, 1997, pages 71 - 4 |
| GRODBERG ET AL., EUR. J. BIOCHEM., vol. 218, 1993, pages 597 - 601 |
| GROOPMAN ET AL., J NATL CANCER INST, vol. 91, 1999, pages 1616 - 1634 |
| GUSTIN ET AL., VIROLOGY, vol. 193, 1993, pages 653 - 660 |
| HOCHULI ET AL., J. CHROMATOGRAPHY, vol. 411, 1987, pages 177 |
| IKE ET AL., NUCLEIC ACID RES., vol. 11, 1983, pages 477 |
| ITAKURA ET AL., ANNU. REV. BIOCHEM., vol. 53, 1984, pages 323 |
| ITAKURA ET AL., SCIENCE, vol. 198, 1984, pages 1056 |
| ITAKURA ET AL.: "Macromolecules", 1981, ELSEVIER, article "Recombinant DNA, Proc. 3rd Cleveland Sympos", pages: 273 - 289 |
| IWABUCHI ET AL., ONCOGENE, vol. 8, 1993, pages 1693 - 1696 |
| JACOBS ET AL., NEPHROL DIAL TRANSPLANT, vol. 15, no. 4, 2000, pages 51 - 56 |
| JANKNECHT ET AL., PNAS USA, vol. 88, pages 8972 |
| KOHLERMILSTEIN, NATURE, vol. 256, 1975, pages 495 - 497 |
| KOZBAR ET AL., IMMUNOLOGY TODAY, vol. 4, 1983, pages 72 |
| LEEMCPHERRON, PROC. NATL. ACAD. SCI., vol. 98, 2001, pages 9306 - 9311 |
| LEUNG ET AL., METHOD CELL MOL BIOL, vol. 1, 1989, pages 11 - 19 |
| LEVIN ET AL., AM J KIDNEY DIS, vol. 27, 1999, pages 347 - 354 |
| LOWMAN ET AL., BIOCHEMISTRY, vol. 30, 1991, pages 10832 - 10838 |
| MADURA ET AL., J BIOL CHEM, vol. 268, 1993, pages 12046 - 12054 |
| MANNINO ET AL., BIOTECHNIQUES, vol. 6, 1988, pages 682 |
| MASSAGUE, NAT. REV. MOL. CELL BIOL., vol. 1, 2000, pages 169 - 178 |
| MATHEWSVALE, CELL, vol. 65, 1991, pages 973 - 982 |
| MCKNIGHT ET AL., SCIENCE, vol. 232, 1982, pages 316 |
| MEYERS ET AL., SCIENCE, vol. 232, 1986, pages 613 |
| MURATA ET AL., PNAS, vol. 85, 1988, pages 2434 |
| NAGASHIMA ET AL., J. BIOL. CHEM., vol. 268, 1993, pages 2888 - 2892 |
| NARANG, SA, TETRAHEDRON, vol. 39, 1983, pages 3 |
| NISSENSON, AM J KIDNEY DIS, vol. 20, no. 1, 1992, pages 21 - 24 |
| OH ET AL., GENES DEV., vol. 16, 2002, pages 2749 - 54 |
| REVICKI ET AL., AM J KIDNEY DIS, vol. 25, 1995, pages 548 - 554 |
| ROBERTS ET AL.: "89", PNAS USA, 1992, pages 2429 - 2433 |
| RUF ET AL., BIOCHEMISTRY, vol. 33, 1994, pages 1565 - 1572 |
| SCHUELKE ET AL., N ENGL J MED, vol. 350, 2004, pages 2682 - 8 |
| SINGIBARTI, J. CLIN INVESTIG, vol. 72, no. 6, 1994, pages S36 - S43 |
| VIDALLEGRAIN, NUCLEIC ACIDS RES, vol. 27, 1999, pages 919 - 29 |
| VIDALLEGRAIN, TRENDS BIOTECHNOL, vol. 17, 1999, pages 374 - 81 |
| WANG ET AL., J. BIOL. CHEM., vol. 269, 1994, pages 3095 - 3099 |
| WEATHERALLPROVAN, LANCET, vol. 355, 2000, pages 1169 - 1175 |
| WOODRUFF, BIOCHEM PHARMACOL., vol. 55, 1998, pages 953 - 963 |
| YAMASHITA ET AL., J. CELL BIOL., vol. 130, 1995, pages 217 - 226 |
| YEOWHITMAN, MOL. CELL, vol. 7, 2001, pages 949 - 957 |
| ZERVOS ET AL., CELL, vol. 72, 1993, pages 223 - 232 |
Cited By (100)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9138459B2 (en) | 2004-07-23 | 2015-09-22 | Acceleron Pharma Inc. | ACTRIIB-FC polynucleotides, polypeptides, and compositions |
| US8486403B2 (en) | 2005-11-23 | 2013-07-16 | Acceleron Pharma, Inc. | Method of promoting bone growth by an anti-activin A antibody |
| US9572865B2 (en) | 2005-11-23 | 2017-02-21 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for treating multiple myeloma |
| US8128933B2 (en) | 2005-11-23 | 2012-03-06 | Acceleron Pharma, Inc. | Method of promoting bone growth by an anti-activin B antibody |
| US9163075B2 (en) | 2005-11-23 | 2015-10-20 | Acceleron Pharma Inc. | Isolated polynucleotide that encodes an ActRIIa-Fc fusion polypeptide |
| US10239940B2 (en) | 2005-11-23 | 2019-03-26 | Acceleron Pharma Inc. | Method of promoting bone growth by an anti-actriia antibody |
| US9480742B2 (en) | 2005-11-23 | 2016-11-01 | Acceleron Pharma Inc. | Method of promoting bone growth by an anti-actriia antibody |
| US8629109B2 (en) | 2005-11-23 | 2014-01-14 | Acceleron Pharma Inc. | Method for promoting bone growth using activin-actriia antagonists |
| US10071135B2 (en) | 2005-11-23 | 2018-09-11 | Acceleron Pharma Inc. | Method of identifying an agent that promotes bone growth or increases bone density |
| US11129873B2 (en) | 2005-11-23 | 2021-09-28 | Acceleron Pharma Inc. | Method for promoting bone growth using activin-actriia antagonists |
| US10093707B2 (en) | 2006-12-18 | 2018-10-09 | Acceleron Pharma Inc. | Antagonists of activin-ActRIIa and uses for increasing red blood cell levels |
| US8895016B2 (en) | 2006-12-18 | 2014-11-25 | Acceleron Pharma, Inc. | Antagonists of activin-actriia and uses for increasing red blood cell levels |
| US9526759B2 (en) | 2007-02-01 | 2016-12-27 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for treating or preventing breast cancer |
| US8343933B2 (en) | 2007-02-02 | 2013-01-01 | Acceleron Pharma, Inc. | Variants derived from ActRIIB and uses therefor |
| US9399669B2 (en) | 2007-02-02 | 2016-07-26 | Acceleron Pharma Inc. | Variants derived from ActRIIB |
| US10259861B2 (en) | 2007-02-02 | 2019-04-16 | Acceleron Pharma Inc. | Variants derived from ActRIIB and uses therefor |
| US8173601B2 (en) | 2007-02-09 | 2012-05-08 | Acceleron Pharma, Inc. | Activin-ActRIIa antagonists and uses for treating multiple myeloma |
| US8367611B2 (en) | 2007-09-18 | 2013-02-05 | Acceleron Pharma Inc. | Activin-actriia antagonists for inhibiting germ cell maturation |
| US9353356B2 (en) | 2007-09-18 | 2016-05-31 | Acceleron Pharma Inc. | Activin-actriia antagonists for treating a follicle-stimulating horomone-secreting pituitary tumor |
| US11155791B2 (en) | 2008-08-14 | 2021-10-26 | Acceleron Pharma Inc. | Methods for treating anemia in a subject in need thereof |
| US10689427B2 (en) | 2008-08-14 | 2020-06-23 | Acceleron Pharma Inc. | Combined use of GDF traps and erythropoietin receptor activators to increase red blood cell levels |
| US11168311B2 (en) | 2008-08-14 | 2021-11-09 | Acceleron Pharma Inc. | Methods for treating anemia in a subject in need thereof |
| US10889626B2 (en) | 2008-08-14 | 2021-01-12 | Acceleron Pharma Inc. | Combined use of GDF traps and erythropoietin receptor activators to increase red blood cell levels |
| US11162085B2 (en) | 2008-08-14 | 2021-11-02 | Acceleron Pharma Inc. | Methods for treating anemia in a subject in need thereof |
| US10377996B2 (en) | 2008-08-14 | 2019-08-13 | Acceleron Pharma Inc. | Methods of identifying ActRIIB variants |
| EP2340031B1 (en) * | 2008-08-14 | 2019-04-24 | Acceleron Pharma Inc. | Gdf traps for use to treat anemia |
| US8361957B2 (en) | 2008-08-14 | 2013-01-29 | Acceleron Pharma, Inc. | Isolated GDF trap polypeptide |
| US8216997B2 (en) | 2008-08-14 | 2012-07-10 | Acceleron Pharma, Inc. | Methods for increasing red blood cell levels and treating anemia using a combination of GDF traps and erythropoietin receptor activators |
| US9932379B2 (en) | 2008-08-14 | 2018-04-03 | Acceleron Pharma Inc. | Isolated nucleotide sequences encoding GDF traps |
| US9439945B2 (en) | 2008-08-14 | 2016-09-13 | Acceleron Pharma Inc. | Isolated nucleotide sequences encoding GDF traps |
| US8703927B2 (en) | 2008-08-14 | 2014-04-22 | Acceleron Pharma Inc. | Isolated nucleotide sequences encoding GDF traps |
| US10829533B2 (en) | 2008-08-14 | 2020-11-10 | Acceleron Pharma Inc. | Combined use of GDF traps and erythropoietin receptor activators to increase red blood cell levels |
| US9505813B2 (en) | 2008-08-14 | 2016-11-29 | Acceleron Pharma Inc. | Use of GDF traps to treat anemia |
| US10131700B2 (en) | 2008-08-14 | 2018-11-20 | Acceleron Pharma Inc. | Methods for treating refractory anemia with ringed sideroblasts |
| US10829532B2 (en) | 2008-08-14 | 2020-11-10 | Acceleron Pharma Inc. | Combined use of gdf traps and erythropoietin receptor activators to increase red blood cell levels |
| US8138142B2 (en) | 2009-01-13 | 2012-03-20 | Acceleron Pharma Inc. | Methods for increasing adiponectin in a patient in need thereof |
| US8765663B2 (en) | 2009-01-13 | 2014-07-01 | Acceleron Pharma Inc. | Methods for increasing adiponectin |
| US8703694B2 (en) | 2009-06-08 | 2014-04-22 | Acceleron Pharma, Inc. | Methods for increasing thermogenic adipocytes |
| US8178488B2 (en) | 2009-06-08 | 2012-05-15 | Acceleron Pharma, Inc. | Methods for increasing thermogenic adipocytes |
| US9790284B2 (en) | 2009-06-08 | 2017-10-17 | Acceleron Pharma Inc. | Methods for increasing thermogenic adipocytes |
| US10968282B2 (en) | 2009-06-08 | 2021-04-06 | Acceleron Pharma Inc. | Methods for screening compounds for increasing thermogenic adipocytes |
| US11066654B2 (en) | 2009-06-12 | 2021-07-20 | Acceleron Pharma Inc. | Methods and compositions for reducing serum lipids |
| US9745559B2 (en) | 2009-06-12 | 2017-08-29 | Acceleron Pharma Inc. | Method for decreasing the body fat content in a subject by administering an ActRIIB protein |
| US8293881B2 (en) | 2009-06-12 | 2012-10-23 | Acceleron Pharma Inc. | Isolated nucleic acid encoding a truncated ActRIIB fusion protein |
| US10358633B2 (en) | 2009-06-12 | 2019-07-23 | Acceleron Pharma Inc. | Method for producing an ActRIIB-Fc fusion polypeptide |
| US9181533B2 (en) | 2009-06-12 | 2015-11-10 | Acceleron Pharma, Inc. | Truncated ACTRIIB-FC fusion protein |
| WO2011020045A1 (en) * | 2009-08-13 | 2011-02-17 | Acceleron Pharma Inc. | Combined use of gdf traps and erythropoietin receptor activators to increase red blood cell levels |
| AU2019204127B2 (en) * | 2009-08-13 | 2021-08-12 | Acceleron Pharma Inc. | Combined use of GDF traps and erythropoietin receptor activators to increase red blood cell levels |
| AU2010282361B2 (en) * | 2009-08-13 | 2015-03-19 | Acceleron Pharma Inc. | Combined use of GDF traps and erythropoietin receptor activators to increase red blood cell levels |
| US9617319B2 (en) | 2009-11-17 | 2017-04-11 | Acceleron Pharma Inc. | ActRIIB proteins and variants and uses therefore relating to utrophin induction for muscular dystrophy therapy |
| US8710016B2 (en) | 2009-11-17 | 2014-04-29 | Acceleron Pharma, Inc. | ActRIIB proteins and variants and uses therefore relating to utrophin induction for muscular dystrophy therapy |
| US10968262B2 (en) | 2009-11-17 | 2021-04-06 | Acceleron Pharma Inc. | Methods of increasing sarcolemmal utrophin |
| US9493556B2 (en) | 2010-11-08 | 2016-11-15 | Acceleron Pharma Inc. | Actriia binding agents and uses thereof |
| EP2594280A1 (en) * | 2011-11-21 | 2013-05-22 | Biomedical Research Foundation of the Academy of Athens | Activin neutralisers and uses thereof for treatment of diseases associated with aberrant "host defence response" activation |
| GR1007832B (el) * | 2011-11-21 | 2013-02-14 | Ιδρυμα Ιατροβιολογικων Ερευνων Ακαδημιας Αθηνων, | Αδρανοποιητες της ακτιβινης και χρηση τους για την θεραπεια ασθενειων που σχετιζονται με παρεκκλινουσα ενεργοποιηση της "αμυντικης αποκρισης του ξενιστη" |
| US10829534B2 (en) | 2012-04-06 | 2020-11-10 | Acceleron Pharma Inc. | Methods and compositions for increasing red blood cells |
| US11807673B2 (en) | 2012-04-06 | 2023-11-07 | Acceleron Pharma Inc. | Methods and compositions for increasing red blood cells |
| EP2844272A4 (en) * | 2012-04-06 | 2015-11-04 | Acceleron Pharma Inc | METHOD AND COMPOSITIONS FOR INCREASING RED BLOOD BODIES |
| US9809636B2 (en) | 2012-04-06 | 2017-11-07 | Acceleron Pharma Inc. | Methods for increasing red blood cell levels comprising administering BMP9 |
| EP3351260A1 (en) * | 2012-04-06 | 2018-07-25 | Acceleron Pharma Inc. | Methods and compositions for increasing red blood cells |
| US10344066B2 (en) | 2012-04-06 | 2019-07-09 | Acceleron Pharma Inc. | Methods and compositions for increasing red blood cells |
| US10195249B2 (en) | 2012-11-02 | 2019-02-05 | Celgene Corporation | Activin-ActRII antagonists and uses for treating bone and other disorders |
| WO2014116981A1 (en) * | 2013-01-25 | 2014-07-31 | Shire Human Genetic Therapies, Inc. | Follistatin in treating duchenne muscular dystrophy |
| AU2014209178B2 (en) * | 2013-01-25 | 2018-11-08 | Takeda Pharmaceutical Company Limited | Follistatin in treating Duchenne muscular dystrophy |
| US10723772B2 (en) | 2013-01-25 | 2020-07-28 | Shire Human Genetic Therapies, Inc. | Follistatin in treating duchenne muscular dystrophy |
| AU2019200797B2 (en) * | 2013-01-25 | 2021-03-04 | Takeda Pharmaceutical Company Limited | Follistatin in treating duchenne muscular dystrophy |
| US9957309B2 (en) | 2013-01-25 | 2018-05-01 | Shire Human Genetic Therapies, Inc. | Follistatin in treating duchenne muscular dystrophy |
| WO2015161220A1 (en) * | 2014-04-18 | 2015-10-22 | Acceleron Pharma, Inc. | Methods for increasing red blood cell levels and treating sickle-cell disease |
| AU2021202382B2 (en) * | 2014-04-18 | 2023-06-29 | Acceleron Pharma, Inc. | Methods for increasing red blood cell levels and treating sickle-cell disease |
| US11260107B2 (en) | 2014-06-13 | 2022-03-01 | Acceleron Pharma Inc. | Methods and compositions for treating ulcers |
| CN107135646B (zh) * | 2014-06-13 | 2022-03-15 | 阿塞勒隆制药公司 | 用于治疗溃疡的方法和组合物 |
| US9850298B2 (en) | 2014-06-13 | 2017-12-26 | Acceleron Pharma Inc. | Methods for treating ulcers in thalassemia syndrome with an ActRIIB polypeptide |
| CN107135646A (zh) * | 2014-06-13 | 2017-09-05 | 阿塞勒隆制药公司 | 用于治疗溃疡的方法和组合物 |
| WO2015192111A1 (en) * | 2014-06-13 | 2015-12-17 | Acceleron Pharma, Inc. | Methods and compositions for treating ulcers |
| AU2015274277B2 (en) * | 2014-06-13 | 2021-03-18 | Acceleron Pharma, Inc. | Methods and compositions for treating ulcers |
| US10487144B2 (en) | 2014-06-13 | 2019-11-26 | Acceleron Pharma Inc. | Methods for treating ulcers in a hemoglobinopathy anemia with a soluble actRIIB polypeptide |
| CN114699529A (zh) * | 2014-06-13 | 2022-07-05 | 阿塞勒隆制药公司 | 用于治疗溃疡的方法和组合物 |
| US11813308B2 (en) | 2014-10-09 | 2023-11-14 | Celgene Corporation | Treatment of cardiovascular disease using ActRII ligand traps |
| US11471510B2 (en) | 2014-12-03 | 2022-10-18 | Celgene Corporation | Activin-ActRII antagonists and uses for treating anemia |
| US11932677B2 (en) | 2015-04-22 | 2024-03-19 | Alivegen Inc. | Hybrid ActRIIB ligand trap proteins for treating muscle wasting diseases |
| US11292826B2 (en) | 2015-04-22 | 2022-04-05 | Biogen Ma Inc. | Hybrid ActRIIB ligand trap proteins for treating muscle wasting diseases |
| US10913782B2 (en) | 2015-04-22 | 2021-02-09 | Biogen Ma Inc. | Hybrid ActRIIB ligand trap proteins for treating muscle wasting diseases |
| US10550170B2 (en) | 2015-11-23 | 2020-02-04 | Acceleron Pharma Inc. | Methods for treating vascular eye disorders with actrii antagonists |
| US11524990B2 (en) | 2015-11-23 | 2022-12-13 | Acceleron Pharma Inc. | Methods for treating vascular eye disorders with ActRII antagonists |
| US12024563B2 (en) | 2016-04-06 | 2024-07-02 | Acceleron Pharma Inc. | ALK7 antagonists and uses thereof |
| EP3439741A4 (en) * | 2016-04-06 | 2020-05-06 | Acceleron Pharma Inc. | ALK7 ANTAGONISTS AND USES THEREOF |
| US12194076B2 (en) | 2016-07-27 | 2025-01-14 | Acceleron Pharma Inc. | Methods and compositions for treating myelofibrosis |
| US12240887B2 (en) | 2016-10-05 | 2025-03-04 | Acceleron Pharma Inc. | Variant ActRIIB proteins and uses thereof |
| EP3523328A4 (en) * | 2016-10-05 | 2020-04-01 | Acceleron Pharma Inc. | VARIANT ACTRIIB PROTEINS AND USES THEREOF |
| US11267865B2 (en) | 2016-10-05 | 2022-03-08 | Acceleron Pharma Inc. | Variant ActRIIB proteins and uses thereof |
| US12187783B2 (en) | 2016-10-20 | 2025-01-07 | Alivegen Inc | Methods for treating muscle wasting and bone disease using novel hybrid ActRIIB ligand trap proteins |
| US11090361B2 (en) | 2016-11-10 | 2021-08-17 | Keros Therapeutics, Inc. | Activin receptor type IIa variants and methods of use thereof |
| US11013785B2 (en) | 2016-11-10 | 2021-05-25 | Keros Therapeutics, Inc. | Activin receptor type IIA variants and methods of use thereof |
| US11717558B2 (en) | 2016-11-10 | 2023-08-08 | Keros Therapeutics, Inc. | Nucleic acid molecules encoding activin receptor type IIA variants |
| US12350313B2 (en) | 2016-11-10 | 2025-07-08 | Keros Therapeutics, Inc. | Activin receptor type IIa variants and methods of use thereof |
| US11484573B2 (en) | 2017-11-09 | 2022-11-01 | Keros Therapeutics, Inc. | Activin receptor type IIa variants and methods of use thereof |
| US11884715B2 (en) | 2018-01-12 | 2024-01-30 | Keros Therapeutics, Inc. | Activin receptor type IIB variants and methods of use thereof |
| US12269858B2 (en) | 2018-01-12 | 2025-04-08 | Keros Therapeutics, Inc. | Activin receptor type IIB variants and methods of use thereof |
| US12364737B2 (en) | 2018-05-09 | 2025-07-22 | Keros Therapeutics, Inc. | Activin receptor type IIA variants and methods of use thereof |
| US12440539B2 (en) | 2020-03-20 | 2025-10-14 | Keros Therapeutics, Inc. | Methods of using activin receptor type IIB variants |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20200255495A1 (en) | Antagonists of actriib and uses for increasing red blood cell levels | |
| US20220118049A1 (en) | Methods for dosing an actriib antagonist and monitoring of treated patients | |
| CA2729054C (en) | Antagonists of actriib and uses for increasing red blood cell levels | |
| US11168311B2 (en) | Methods for treating anemia in a subject in need thereof | |
| US20210355181A1 (en) | Antagonists of activin-actriia and uses for increasing red blood cell levels | |
| AU2007334333B2 (en) | Activin-ActRII antagonists and uses for increasing red blood cell levels | |
| WO2011020045A9 (en) | Combined use of gdf traps and erythropoietin receptor activators to increase red blood cell levels | |
| HK40051596A (en) | Antagonists of actriib and uses for increasing red blood cell levels | |
| AU2021209153A1 (en) | Combined use of GDF traps and erythropoietin receptor activators to increase red blood cell levels | |
| HK1156057B (en) | Antagonists of actriib and uses for increasing red blood cell levels | |
| HK1156057A (en) | Antagonists of actriib and uses for increasing red blood cell levels | |
| AU2017204230A1 (en) | Use of GDF traps to increase red blood cell levels | |
| HK1172547B (en) | Activin-actrii antagonists for use in treating anemia | |
| HK1172547A1 (en) | Activin-actrii antagonists for use in treating anemia |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 09770553 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2729054 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2009770553 Country of ref document: EP |