WO2009142810A2 - Methods for treating or preventing colorectal cancer - Google Patents
Methods for treating or preventing colorectal cancer Download PDFInfo
- Publication number
- WO2009142810A2 WO2009142810A2 PCT/US2009/037953 US2009037953W WO2009142810A2 WO 2009142810 A2 WO2009142810 A2 WO 2009142810A2 US 2009037953 W US2009037953 W US 2009037953W WO 2009142810 A2 WO2009142810 A2 WO 2009142810A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- inhibitor
- cdr
- ser
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- DLSYMHBSULCIKN-WDYNHAJCSA-N CC(C)OC(N(CC1)CCN1[C@@H]1c2ncccc2C=C([C@H](c2cnc[n]2C)NC(COC)=O)c2c1ccc(Cl)c2)=O Chemical compound CC(C)OC(N(CC1)CCN1[C@@H]1c2ncccc2C=C([C@H](c2cnc[n]2C)NC(COC)=O)c2c1ccc(Cl)c2)=O DLSYMHBSULCIKN-WDYNHAJCSA-N 0.000 description 1
- XTMKEIYNHKCDOS-WDYNHAJCSA-N CC(C)OC([I](CC1)CCN1[C@@H]1c2ncccc2C=C([C@H](c2cnc[n]2C)NC(COC)=O)c2c1ccc(Cl)c2)=O Chemical compound CC(C)OC([I](CC1)CCN1[C@@H]1c2ncccc2C=C([C@H](c2cnc[n]2C)NC(COC)=O)c2c1ccc(Cl)c2)=O XTMKEIYNHKCDOS-WDYNHAJCSA-N 0.000 description 1
- OPIYGGWYEOSIPY-UHFFFAOYSA-N ONC(c1ccc(-c2ncc(CNCc3ccccc3)cc2)[s]1)=O Chemical compound ONC(c1ccc(-c2ncc(CNCc3ccccc3)cc2)[s]1)=O OPIYGGWYEOSIPY-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/4353—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom ortho- or peri-condensed with heterocyclic ring systems
- A61K31/436—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom ortho- or peri-condensed with heterocyclic ring systems the heterocyclic ring system containing a six-membered ring having oxygen as a ring hetero atom, e.g. rapamycin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
- A61K31/513—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim having oxo groups directly attached to the heterocyclic ring, e.g. cytosine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
Definitions
- the field of the invention relates, genrally, to methods of treating or preventing colorectal cancer by administering an anti-IGF1 R antibody in association with another chemotherapeutic agent.
- Colorectal cancer or cancer of the colon and/or rectum, is the second leading cause of cancer- related deaths in the United States, and the third most common cancer overall.
- the American Cancer Society estimates that, each year, more than 50,000 Americans die from colorectal cancer and approximately 155,000 new cases are diagnosed, accounting for 15% of all types of tumor. Eighty to 90 million Americans (approximately 25% of the U.S. population) are considered at risk because of age or other factors. More women over the age of 75 die from colorectal cancer than from breast cancer. The 5-year survival rate remains at approximately 45%.
- colorectal cancer The occurrence of colorectal appears to be influenced by both inherited and lifestyle factors.
- Predisposing conditions for colorectal cancer include familial adenomatous polyposis (FAP), hereditary nonpolyposis colon cancer (HNPCC) (i.e., Lynch I Syndrome and Lynch Il Syndrome), inflammatory bowel disease, including both chronic ulcerative colitis (UC) and Crohn's disease, other family cancer syndromes (e.g., Peutz-Jegher Syndromem and familial juvenile polyposis), and adenomatous polyps (e.g., sessile, tubular, villous or pendunculated).
- FAP familial adenomatous polyposis
- HNPCC hereditary nonpolyposis colon cancer
- UC chronic ulcerative colitis
- Crohn's disease other family cancer syndromes
- adenomatous polyps e.g., sessile, tubular, villous or pendunculated.
- the present invention addresses the need in the art for colorectal cancer treatments, for example, by provision of highly effective combinations of chemotherapeutic agents for the treatment and prevention of colorectal cancer.
- the combinations includes an anti- IGF1 R antibody or antigen-binding fragment thereof in association with sunitinib or in association with leucovorin and 5-fluorouracil.
- the present invention comprises a method for treating or preventing colorectal cancer in a subject (e.g., a human) comprising administering a therapeutically effective amount an isolated antibody or antigen-binding fragment thereof (e.g., an isolated antibody such as a monoclonal antibody, a labeled antibody, a bivalent antibody, a polyclonal antibody, a bispecific antibody, a chimeric antibody, a recombinant antibody, an anti- idiotypic antibody, a humanized antibody or a bispecific antibody) comprising one or more members selected from the group consisting of: (a) CDR-L1 , CDR-L2 and CDR-L3 of the variable region of light chain C, light chain D, light chain E or light chain F; or (b) CDR-H1 , CDR-H2 and CDR-H3 of the variable region of heavy chain A or heavy chain b; or both; in association with leucovorin and 5-fluorouracil; or in association with sunitinib
- CDR-L1 comprises the amino acid sequence: Arg Ala Ser GIn Ser lie GIy Ser Ser Leu His (SEQ ID NO: 1 );
- CDR-L2 comprises the amino acid sequence: Tyr Ala Ser GIn Ser Leu Ser (SEQ ID NO: 2);
- CDR-L3 comprises the amino acid sequence: His GIn Ser Ser Arg Leu Pro His Thr (SEQ ID NO: 3);
- CDR-H1 comprises the amino acid sequence: Ser Phe Ala Met His (SEQ ID NO: 4) or GIy Phe Thr Phe Ser Ser Phe Ala Met His (SEQ ID NO: 5);
- CDR-H2 comprises the amino acid sequence:
- VaI lie Asp Thr Arg GIy Ala Thr Tyr Tyr Ala Asp Ser VaI Lys GIy (SEQ ID NO: 6);
- CDR-H3 comprises the amino acid sequence:
- the antibody or fragment comprises a light chain variable region comprising amino acids 20-128 of SEQ ID NO: 9, 11 , 13 or 15 and a heavy chain variable region comprising amino acids 20-137 of SEQ ID NO: 17 or 19.
- the antibody or fragment is a fragment and the fragment is a camelized single domain antibody, a diabody, an scfv, an scfv dimer, a dsfv, a (dsfv) 2 , a dsFv-dsfv', a bispecific ds diabody, an Fv, an Fab, an Fab', an F(ab') 2 , or a domain antibody.
- the antibody or fragment is linked to a constant region such as a K light chain, ⁇ 1 heavy chain, ⁇ 2 heavy chain, ⁇ 3 heavy chain or ⁇ 4 heavy chain.
- the subject is administered a further chemotherapeutic agent (e.g., an anti-cancer chemotherapeutic agent) or an anti-cancer therapeutic procedure.
- a further chemotherapeutic agent e.g., an anti-cancer chemotherapeutic agent
- an anti-cancer therapeutic procedure is anti-cancer radiation therapy or surgical tumorectomy.
- the further chemotherapeutic agent is one or more members selected from the group consisting of: everolimus, trabectedin, abraxane, TLK 286, AV-299, DN-101 , pazopanib, GSK690693, RTA 744, ON 0910.Na, AZD 6244 (ARRY-142886), AMN-107, TKI-258, GSK461364, AZD 1152, enzastaurin, vandetanib, ARQ-197, MK-0457, MLN8054, PHA-739358, R-763, AT- 9263, a FLT-3 inhibitor, a VEGFR inhibitor, an EGFR TK inhibitor, an aurora kinase inhibitor, a PIK-1 modulator, a Bcl-2 inhibitor, an HDAC inhbitor, a c-MET inhibitor, a PARP inhibitor, a Cdk inhibitor, an EGFR TK inhibitor, an IGFR-TK inhibitor,
- doxorubicin liposomal doxorubicin, 5'-deoxy-5-fluorouridine, vincristine, temozolomide, ZK- 304709, seliciclib; PD0325901 , AZD-6244, capecitabine, L-Glutamic acid, N -[4-[2-(2- amino-4,7-dihydro-4-oxo-1 H -pyrrolo[2,3- d ]pyrimidin-5-yl)ethyl]benzoyl]-, disodium salt, heptahydrate, camptothecin, irinotecan; PEG-labeled irinotecan, tamoxifen, toremifene citrate, anastrazole, exemestane, letrozole, DES(diethylstilbestrol), estradiol, estrogen, conjugated estrogen, bevacizumab, IMC-1 C11 , CHIR-258,
- SU5416 (semaxinib), SU6668 ([(Z)-3-[2,4-dimethyl-5-(2-oxo-1 ,2-dihydro-indol-3- ylidenemethyl)-1 H-pyrrol-3-yl]-propionic acid), EMD121974, interleukin-12, IM862, angiostatin, vitaxin, droloxifene, idoxyfene, spironolactone, finasteride, cimitidine, trastuzumab, denileukin diftitox, gefitinib, bortezimib, paclitaxel, cremophor-free paclitaxel, docetaxel, epithilone B, BMS-247550 (ixabepilone), BMS-310705 droloxifene, 4-hydroxytamoxifen, pipe ⁇ doxifene, ERA-923
- the antibody or fragment, the leucovorin, the 5-fluorouracil and the sunitinib are in separate pharmaceutical compositions, each independently further comprising a pharmaceutically acceptable carrier.
- the subject suffers from one or more conditions selected from the group consisting of: familial adenomatous polyposis, hereditary nonpolyposis colon cancer, Lynch I Syndrome, Lynch Il Syndrome, inflammatory bowel disease, chronic ulcerative colitis (UC), Crohn's disease, a family cancer syndrome, Peutz-Jegher Syndrome, familial juvenile polyposis and one or more adenomatous polyps.
- the present invention further includes within its scope a combination or comnposition comprising an isolated antibody or antigen-binding fragment thereof comprising one or more members selected from the group consisting of: (a) CDR-L1 , CDR- L2 and CDR-L3 of the variable region of light chain C, light chain D, light chain E or light chain F; or (b) CDR-H 1 , CDR-H2 and CDR-H3 of the variable region of heavy chain A or heavy chain B; or both; in association with (i) leucovohn and 5-fluorouracil; (ii) leucovorin; or (iii) sunitinib; optionally in further association with a further chemotherapeutic agent (e.g., a further chemotherapeutic agent set forth herein).
- a further chemotherapeutic agent e.g., a further chemotherapeutic agent set forth herein.
- the antibody or fragment comprises a light chain variable region comprising amino acids 20-128 of SEQ ID NO: 9, 11 , 13 or 15 and/or a heavy chain variable region comprising amino acids 20-137 of SEQ ID NO: 17 or 19.
- the present invention provides, inter alia, methods for treating or preventing colorectal cancer in a subject in need of such treatment or prevention, by administering a
- no other components are administered to a subject as part of a method or therapeutic treatment regimen of the present invention.
- one or more further chemotherapeutic agents are administered to the subject.
- subjects are administered any antibody or antigen- binding fragment thereof, e.g., that specifically binds to IGF1 R, which comprises light chain CDRs or heavy chain CDRs or both, for example, as set forth below:
- CDR-L1 15H12/19D12 light chain immunoglobulin CDRs
- CDR-L2 RASQSIGSSLH (SEQ ID NO: 1 )
- CDR-L2 YASQSLS (SEQ ID NO: 2);
- CDR-L3 HQSSRLPHT (SEQ ID NO: 3); for example, all three light chain immunoglobulin CDRs; and/or
- CDR-H1 SFAMH (SEQ ID NO: 4); or GFTFSSFAMH (SEQ ID NO: 5); CDR-H2: VIDTRGATYYADSVKG (SEQ ID NO: 6);
- CDR-H3 LGNFYYGMDV (SEQ ID NO: 7); for example, all three heavy chain immunoglobulin CDRs.
- the antibody comprises any combination of the following light and heavy chain immunoglobulin chains (e.g., mature fragments thereof). Signal sequences are underscored with dashed lines and CDR sequences are underscored by solid lines. In an embodiment of the invention, mature variable region fragments lack the signal sequences.
- Phe Thr lie Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr Leu GIn Met Asn Ser Leu Arg Ala GIu Asp Thr Ala VaI Tyr Tyr Cys Ala Arg Leu GIy Asn Phe Tyr Tyr GIy Met Asp VaI Trp Gly GIn GIy Thr Thr VaI Thr VaI Ser Ser
- the anti-IGF1 R antibody light chain and/or heavy chain is encoded by any plasmid selected from the group consisting of:
- the antibody is an LCC/HCA, LCD/HCB or
- the anti-IGF1 R antibody or antigen-binding fragment thereof comprises the mature heavy chain immunoglobulin variable region: vqllesggglvqpggslrlsctasgftfssyamnwvrqapgkglewvsaisgsggttfyadsvkgrftisrdnsrtt ylqmnslraedtavyycakdlgwsdsyyyyygmdvwgqgttvtvss
- the anti-IGF1 R antibody or antigen-binding fragment thereof comprises the mature light chain immunoglobulin variable region: diqmtqfpsslsasvgdrvtitcrasqgirndlgwyqqkpgkapkrliyaasrlhrgvpsrfsgsgsgteftltiss lqpedfatyyclqhnsypcsfgqgtkleik
- the present invention includes methods for using anti-IGF1 R antibodies and antigen-binding fragments thereof.
- the invention includes methods for using monoclonal antibodies, camelized single domain antibodies, polyclonal antibodies, bispecific antibodies, chimeric antibodies, recombinant antibodies, anti-idiotypic antibodies, humanized antibodies, bispecific antibodies, diabodies, single chain antibodies, disulfide Fvs (dsfv), Fvs, Fabs, Fab's, F(ab') 2 S and domain antibodies.
- dsfv disulfide Fvs
- Fabs fragment antigen-binding fragments thereof.
- the term "antibody” and the like covers, but is not limited to, monoclonal antibodies, polyclonal antibodies, recombinant antibodies, multispecific antibodies (e.g., bispecific antibodies).
- antibody antigen-binding fragment encompasses a fragment or a derivative of an antibody, typically including at least a portion of the antigen-binding or variable region (e.g., one or more CDRs) of the parental antibody, that retains at least some of the binding specificity of the parental antibody.
- antibody antigen-binding fragments include, but are not limited to, Fab, Fab', F(ab') 2 , and Fv fragments; diabodies; single-chain antibody molecules, e.g., sc-Fv; and multispecific antibodies formed from antibody fragments.
- a binding fragment or derivative retains at least 10% of its IGF1 R binding activity when that activity is expressed on a molar basis. In an embodiment of the invention, a binding fragment or derivative retains at least 20%, 50%, 70%, 80%, 90%, 95% or 100% or more of the IGF1 R binding affinity as the parental antibody. It is also intended that an antigen-binding fragment can include conservative amino acid substitutions (referred to as "conservative variants" of the antibody) that do not substantially alter its biologic activity.
- "Fab" refers to a fragment including a single light chain (both variable and constant regions) bound to the variable region and first constant region of a single heavy chain by a disulfide bond. Fab fragments may be produced by, for example, papain digestion of an IgG antibody.
- Fab refers to a Fab fragment that includes a portion of the hinge region.
- F(ab') 2 refers to a dimer of Fab'. F(ab') 2 fragments which may be produced by enzymatic cleavage of an IgG by, for example, pepsin. A Fab' may be generated, for example, by reduction of a F(ab') 2 with, e.g., 2- mercaptoethanol.
- Fc refers to that portion of the antibody consisting of the second and third constant regions of a first heavy chain bound to the second and third constant regions of a second heavy chain via disulfide bonding. The Fc portion of the antibody is responsible for various effector functions such as ADCC, and CDC, but does not function in antigen binding.
- Fv with regards to an antibody, is the variable region of a single light chain bound to the variable region of a single heavy chain.
- a "disulfide stabilized Fv fragment” or “dsFv” comprises molecules having a variable heavy chain (VH) and/or a variable light chain (VL) which are linked by a disulfide bridge.
- the term "single-chain Fv” or “scFv” antibody comprises antibody fragments comprising the V H and V L domains of an antibody, wherein these domains are present in a single polypeptide chain.
- the Fv polypeptide further comprises a polypeptide linker between the VH and V L domains which enables the VH and V L chains to pair and form a binding site (e.g., 5-12 residues long).
- a "single-chain Fv-Fc antibody” or “scFv-Fc” refers to an engineered antibody including a scFv connected to the Fc region of an antibody.
- a "nanobody” the VHH domain of a heavy-chain antibodies.
- Such heavy chain antibodies contain a single variable domain (VHH) and two constant domains (CH2 and CH3).
- a "domain antibody” (e.g., VL domain or V H domain) comprises an immunologically functional immunoglobulin fragment containing only the variable region of a heavy chain or the variable region of a light chain.
- VL domain or V H domain comprises an immunologically functional immunoglobulin fragment containing only the variable region of a heavy chain or the variable region of a light chain.
- two or more V H regions are covalently joined with a peptide linker to create a bivalent domain antibody.
- the two VH regions of a bivalent domain antibody may target the same or different antigens.
- a "bivalent” or “bispecific” antibody comprises two antigen-binding sites. In some instances, the two binding sites have the same antigen specificities. However, bivalent antibodies may be bispecific.
- the present invention comprises full antibodies, scfv dimers and dsfv dimers having a single or different antigen binding specificities.
- a (dsfv) 2 comprises three peptide chains: two V H moieties linked by a peptide linker and bound by disulfide bridges to two V L moieties.
- a bispecific ds diabody comprises a VHrVL 2 (tethered by a peptide linker) linked, by a disulfide bridge between the VHi and VL-i, to a VL 1 -VH 2 moiety (also tethered by a peptide linker).
- a bispecific dsfv- dsfv' also comprises three peptide chains: a VH 1 -VH 2 moiety wherein the heavy chains are linked by a peptide linker (e.g., a long flexible linker) and are bound to VLi and VL 2 moieties, respectively, by disulfide bridges; wherein each disulfide paired heavy and light chain has a different antigen specificity.
- a peptide linker e.g., a long flexible linker
- an scfv dimer (a bivalent diabody) comprises a V H -V L moiety wherein the heavy and light chains are bound to by a peptide linker and dimerized with another such moiety such that V H s of one chain coordinate with the V L s of another chain and form two identical binding sites.
- a bispecific diabody comprises VH 1 -VL 2 moiety (linked by a peptide linker) associated with a VL 1 -VH 2 (linked by a peptide linker), wherein the VH 1 and VL 1 coordinate and the VH 2 and VL 2 coordinate and each coordinated set has diverse antigen specificities.
- the term "monoclonal antibody” comprises an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic epitope. In contrast, conventional (polyclonal) antibody preparations typically include a multitude of antibodies directed against (or specific for) different epitopes.
- the modifier "monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
- the monoclonal antibodies to be used in accordance with the present invention may be made recombinantly or by the hybridoma method first described by Kohler et al. (1975) Nature 256: 495, or may be made by recombinant DNA methods (see, e.g., U.S. Pat. No. 4,816,567).
- the "monoclonal antibodies” may also be isolated from phage antibody libraries using the techniques described in Clackson et al. (1991 ) Nature 352: 624-628 and Marks et al. (1991 ) J. MoI. Biol. 222: 581-597, for example. See also Presta (2005) J. Allergy CHn. Immunol. 116:731.
- Monoclonal antibodies include "chimeric" antibodies (immunoglobulins) in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U.S. Pat. No. 4,816,567; and Morrison et al., (1984) Proc. Natl. Acad. Sci.USA 81 : 6851-6855).
- chimeric antibodies immunoglobulins in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies
- variable domains are obtained from an antibody from an experimental animal (the "parental antibody”), such as a human, and the constant domain sequences are obtained from canine antibodies, so that the resulting chimeric antibody will be less likely to elicit an adverse immune response in a canine subject than the parental human antibody.
- parental antibody an antibody from an experimental animal
- canine antibodies canine antibodies
- a recombinant antibody or antigen-binding fragment thereof of the invention is an antibody which is produced recombinantly, e.g., expressed from a polynucleotide which has been introduced into an organism (e.g., a plasmid containing a polynucleotide encoding the antibody or fragment transformed into a bacterial cell (e.g., E.coli) or a mammalian cell (e.g., CHO cell)), followed by isolation of the antibody or fragment from the organism.
- an organism e.g., a plasmid containing a polynucleotide encoding the antibody or fragment transformed into a bacterial cell (e.g., E.coli) or a mammalian cell (e.g., CHO cell)
- anti-idiotypic antibodies or anti-idiotypes are antibodies directed against the antigen-combining region or variable region (called the idiotype) of another antibody molecule.
- immunization with an antibody molecule expressing a paratope (antigen-combining site) for a given antigen will produce a group of anti-antibodies, some of which share, with the antigen, a complementary structure to the paratope.
- Immunization with a subpopulation of the anti- idiotypic antibodies will, in turn, produce a subpopulation of antibodies or immune cell subsets that are reactive to the initial antigen.
- the present invention also includes camelized single domain antibodies. See, e.g., Muyldermans et al. (2001 ) Trends Biochem. Sci. 26:230; Reichmann et al. (1999) J. Immunol. Methods 231 :25; WO 94/04678; WO 94/25591 ; U.S. Pat. No. 6,005,079, which are hereby incorporated by reference in their entireties).
- Camelidae (camels, dromedaries and llamas) comprise IgG antibodies in which are devoid of light chains and therefore called 'heavy-chain' IgGs or HCAb (for heavy-chain antibody).
- HCAbs typically have a molecular weight of -95 kDa since they consist only of the heavy-chain variable domains. Although the HCAbs are devoid of light chains, they have an authentic antigen-binding repertoire (Hamers-Casterman et al., Nature (1993) 363:446-448; Nguyen et a/., Adv. Immunol. (2001 ) 79:261-296; Nguyen et al., Immunogenetics. (2002) 54:39-47). In one embodiment, the present invention provides single domain antibodies comprising two V H domains with modifications such that single domain antibodies are formed.
- the term "diabodies” includes small antibody fragments with two antigen-binding sites, which fragments comprise a heavy chain variable domain (V H ) connected to a light chain variable domain (V L ) in the same polypeptide chain (V H -VL or V L -V H ).
- V H heavy chain variable domain
- V L light chain variable domain
- the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites.
- Diabodies are described more fully in, e.g., EP 404,097; WO 93/11161 ; and Holliger et al. (1993) Proc. Natl. Acad. Sci. USA 90: 6444-6448.
- humanized antibody comprises forms of antibodies that contain sequences from both human and non-human (e.g., murine, rat) antibodies.
- the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin, and all or substantially all of the framework (FR) regions are those of a human immunoglobulin sequence.
- the humanized antibody may optionally comprise at least a portion of a human immunoglobulin constant region (Fc).
- the present invention comprises any humanized antibody comprising the CDRs of 15H12/19D12, e.g., wherein identical CDRs were originally isolated from a non-human species antibody and incorporated into a human antibody framework.
- the antibodies of the present invention also include antibodies with modified (or blocked) Fc regions to provide altered effector functions. See, e.g., U.S. Pat. No. 5,624,821 ; W 02003/086310; WO2005/120571 ; WO2006/0057702. Such modifications can be used to enhance or suppress various reactions of the immune system, with possible beneficial effects in diagnosis and therapy. Alterations of the Fc region include amino acid changes (substitutions, deletions and insertions), glycosylation or deglycosylation, and adding multiple Fc. Changes to the Fc can also alter the half-life of antibodies in therapeutic antibodies, enabling less frequent dosing and thus increased convenience and decreased use of material. See Presta (2005) J. Allergy Clin. Immunol.
- the anti-IGF1 R antibodies and antigen-binding fragments thereof of the invention are, in an embodiment of the invention, conjugated to a chemical moiety.
- the chemical moiety may be, inter alia, a polymer, a radionuclide or a cytotoxic factor.
- the chemical moiety is a polymer which increases the half-life of the antibody or fragment in the body of a subject to whom it is administered.
- Polymers include, but are not limited to, polyethylene glycol (PEG) (e.g., PEG with a molecular weight of 2kDa, 5 kDa, 10 kDa, 12kDa, 20 kDa, 3OkDa or 4OkDa), dextran and monomethoxypolyethylene glycol (mPEG).
- PEG polyethylene glycol
- mPEG monomethoxypolyethylene glycol
- the antibodies and antigen-binding fragments of the invention are, in an embodiment of the invention, conjugated with labels such as 99m Tc, 99 Tc 90 Y, 111 In, 32 P, 14 C, 125 1, 3 H, 131 I 1 123 I, 11 C, 15 O, 13 N, 18 F, 35 S, 51 Cr, 57 To, 226 Ra, 60 Co, 59 Fe, 57 Se, 152 Eu, 67 CU, 217 Ci, 211 At, 212 Pb, 47 Sc, 109 Pd, 234 Th, and 40 K 1 157 Gd, 55 Mn, 52 Tr and 56 Fe.
- labels such as 99m Tc, 99 Tc 90 Y, 111 In, 32 P, 14 C, 125 1, 3 H, 131 I 1 123 I, 11 C, 15 O, 13 N, 18 F, 35 S, 51 Cr, 57 To, 226 Ra, 60 Co, 59 Fe, 57 Se, 152 Eu, 67 CU, 217 Ci, 211 At, 212 Pb,
- the antibodies and antigen-binding fragments of the invention may also be conjugated with fluorescent or chemilluminescent labels, including fluorophores such as rare earth chelates, fluorescein and its derivatives, rhodamine and its derivatives, isothiocyanate, phycoerythrin, phycocyanin, allophycocyanin, o-phthaladehyde, fluorescamine, 152 Eu, dansyl, umbelliferone, luciferin, luminal label, isoluminal label, an aromatic acridinium ester label, an imidazole label, an acridimium salt label, an oxalate ester label, an aequorin label, 2,3-dihydrophthalazinediones, biotin, avidin, peroxidase such as horseradish peroxidase, alkaline phosphatase (e.g., calf, shrimp or bacterial), spin labels and stable free radicals.
- the antibodies and antigen-binding fragments of the invention may also be conjugated to a cytotoxic factor such as diptheria toxin, Pseudomonas aeruginosa exotoxin A chain, ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleuhtes fordii proteins and compounds (e.g., fatty acids), dianthin proteins, Phytolacca americana proteins PAPI, PAPII, and PAP-S, momordica charantia inhibitor, curcin, crotin, saponaria officinalis inhibitor, mitogellin, restrictocin, phenomycin, and enomycin.
- a cytotoxic factor such as diptheria toxin, Pseudomonas aeruginosa exotoxin A chain, ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleuhtes fordii proteins and compounds (
- any method known in the art for conjugating the antibodies and antigen-binding fragments of the invention to the various moieties may be employed, including those methods described by Hunter, et al., (1962) Nature 144:945; David, et al., (1974) Biochemistry 13:1014; Pain, et al., (1981 ) J. Immunol. Meth. 40:219; and Nygren, J., (1982) Histochem. and Cytochem. 30:407. Methods for conjugating antibodies are conventional and very well known in the art.
- Any suitable method for generating antibodies or antigen-binding fragments thereof, e.g., monoclonal antibodies, may be used.
- the present invention includes both recombinant and non-recombinant methods of production, e.g., as discussed herein.
- Non- recombinant methods include immunization of animals and subsequent isolation of antibodies or splenocytes (e.g., followed by hybridoma production) from the immunized animal.
- a recipient may be immunized with a linked or unlinked (e.g., naturally occurring) form of IGF1 R, or a fragment thereof.
- Any suitable method of immunization can be used. Such methods can include adjuvants, other immunostimulants, repeated booster immunizations, and the use of one or more immunization routes.
- human monoclonal antibodies directed against IGF1 R are generated using transgenic mice carrying parts of the human immune system rather than the mouse system.
- transgenic mice which may be referred to, herein, as "HuMAb” mice, contain human immunoglobulin gene miniloci that encodes unrearranged human heavy ( ⁇ and ⁇ ) and K light chain immunoglobulin sequences, together with targeted mutations that inactivate the endogenous ⁇ and K chain loci (Lonberg, N., et ai, (1994) Nature 368(6474): 856-859).
- mice exhibit reduced expression of mouse IgM or K, and in response to immunization, the introduced human heavy and light chain transgenes undergo class switching and somatic mutation to generate high affinity human lgG ⁇ monoclonal antibodies (Lonberg, N., et al., (1994), supra; reviewed in Lonberg, N. (1994) Handbook of Experimental Pharmacology 113:49-101 ; Lonberg, N., et al., (1995) Intern. Rev. Immunol. 13:65-93, and Harding, F., et al., (1995) Ann. N. Y Acad. Sci 764:536- 546).
- HuMab mice The preparation of HuMab mice is commonly known in the art and is described, for example, in Taylor, L., et al., (1992) Nucleic Acids Research 20:6287-6295; Chen, J., et al., (1993) International Immunology 5: 647-656; Tuaillon, et al., (1993) Proc. Natl. Acad. Sci USA 90:3720-3724; Choi, et al., (1993) Nature Genetics 4:117-123; Chen, J., et al., (1993)EMBO J. 12: 821- 830; Tuaillon, et al., (1994) J Immunol.
- HuMAb mice are commercially available from Medarex, Inc. (Princeton, NJ).
- HuMab mice can be immunized with an antigenic IGF1 R polypeptide, as described by Lonberg, N., et al., (1994) Nature 368(6474): 856-859; Fishwild, D., et al., (1996) Nature Biotechnology 14: 845-851 and WO 98/24884.
- the mice will be 6-16 weeks of age upon the first immunization.
- a purified preparation of IGF1 R or slGF1 R can be used to immunize the HuMab mice intrapehtoneally.
- mice can also be immunized with whole HEK293 cells which are stably transformed or transfected with an IGF1R gene.
- HuMAb transgenic mice respond well when initially immunized intraperitoneally (i.p.) with antigen in complete Freund's adjuvant, followed by every other week IP immunizations (usually, up to a total of 6) with antigen in incomplete Freund's adjuvant.
- Mice can be immunized, first, with cells expressing IGF1 R (e.g., stably transformed HEK293 cells), then with a soluble fragment of IGF1 R and continually receive alternating immunizations with the two antigens.
- the immune response can be monitored over the course of the immunization protocol with plasma samples being obtained by retroorbital bleeds.
- the plasma can be screened for the presence of anti-IGF1 R antibodies, for example by ELISA, and mice with sufficient titers of immunoglobulin can be used for fusions. Mice can be boosted intravenously with antigen 3 days before sacrifice and removal of the spleen. Several mice can be immunized for each antigen.
- Hybridoma cells which produce the monoclonal, fully human anti-IGF1 R antibodies may be produced by methods which are commonly known in the art. These methods include, but are not limited to, the hybridoma technique originally developed by Kohler, et al., (1975) (Nature 256:495-497), as well as the trioma technique (Hering, et al., (1988) Biomed. Biochim. Acta. 47:211-216 and Hagiwara, et al., (1993) Hum. Antibod. Hybridomas 4:15), the human B-cell hybridoma technique (Kozbor, et al., (1983) Immunology Today 4:72 and Cote, et al., (1983) Proc. Natl.
- mouse splenocytes are isolated and fused with PEG to a mouse myeloma cell line based upon standard protocols. The resulting hybridomas are then screened for the production of antigen-specific antibodies.
- single cell suspensions of splenic lymphocytes from immunized mice may by fused to one-sixth the number of P3X63- Ag8.653 nonsecreting mouse myeloma cells (ATCC, CRL 1580) with 50% PEG.
- Cells are plated at approximately 2 x 10 5 cells/mL in a flat bottom microtiter plate, followed by a two week incubation in selective medium containing 20% fetal Clone Serum, 18% "653" conditioned media, 5% origen (IGEN), 4 mM L-glutamine, 1 mM L-glutamine, 1 mM sodium pyruvate, 5mM HEPES, 0.055 mM 2-mercaptoethanol, 50 units/ml penicillin, 50 mg/ml streptomycin, 50 mg/ml gentamycin and 1X HAT (Sigma; the HAT is added 24 hours after the fusion). After two weeks, cells are cultured in medium in which the HAT is replaced with HT.
- selective medium containing 20% fetal Clone Serum, 18% "653" conditioned media, 5% origen (IGEN), 4 mM L-glutamine, 1 mM L-glutamine, 1 mM sodium pyruvate, 5mM
- a nucleic acid encoding it is isolated and inserted into a replicable vector for further cloning (amplification of the DNA) and/or for expression.
- DNA encoding the chain is readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
- Many vectors are available.
- the vector components generally include, but are not limited to, one or more of the following: a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence.
- Recombinant immunoglobulins may be produced, e.g., by the method of Cabilly U.S. Patent No. 4,816,567; and Queen et al. (1989) Proc. Nat'l Acad. Sci. USA 86:10029-10033; or made in transgenic mice, see Mendez et al. (1997) Nature Genetics 15:146-156.
- a recombinant method may comprise preparing a DNA sequence encoding an immunoglobulin heavy or light chain having specificity for a particular antigen; inserting the sequence into a replicable expression vector operably linked to a suitable promoter compatible with a host cell (e.g., bacterial cell such as E.coli or a mammalian cell); transforming the host cell with the vector; culturing the host cell; and recovering the heavy or light chain from the host cell culture.
- a host cell e.g., bacterial cell such as E.coli or a mammalian cell
- the antibodies or fragments of the present invention are produced in yeast according to the methods described in published international patent application no. WO2005/040395. Briefly, vectors encoding the individual light or heavy chains of an antibody of interest are introduced into different yeast haploid cells, e.g. different mating types of the yeast Pichia pastoris, which yeast haploid cells are optionally complementary auxotrophs. The transformed haploid yeast cells can then be mated or fused to give a diploid yeast cell capable of producing both the heavy and the light chains. The diploid strain is then able to secrete the fully assembled and biologically active antibody.
- yeast haploid cells e.g. different mating types of the yeast Pichia pastoris, which yeast haploid cells are optionally complementary auxotrophs.
- the transformed haploid yeast cells can then be mated or fused to give a diploid yeast cell capable of producing both the heavy and the light chains.
- the diploid strain is then able to secrete the fully assembled and biologically active antibody.
- the relative expression levels of the two chains can be optimized, for example, by using vectors with different copy numbers, using transcriptional promoters of different strengths, or inducing expression from inducible promoters driving transcription of the genes encoding one or both chains.
- the respective heavy and light chains of a plurality of different anti-IGF1 R antibodies are introduced into yeast haploid cells to create a library of haploid yeast strains of one mating type expressing a plurality of light chains, and a library of haploid yeast strains of a different mating type expressing a plurality of heavy chains.
- haploid strains can be mated (or fused as spheroplasts) to produce a series of dipoid yeast cells expressing a combinatorial library of antibodies comprised of the various possible permutations of light and heavy chains.
- the combinatorial library of antibodies can then be screened to determine whether any of the antibodies has properties that are superior (e.g., higher affinity for IGF1 R) to those of the original antibodies.
- immunoglobulin chains are generated by any of the recombinant immunoglobulin production methods set forth in published U.S. patent application no. US2005/0176099 to D. Saha (see also U.S. patent no. 7,326,567).
- chemotherapeutic agents The present invention comprises methods where a subject is administered an anti-
- the present invention further comprises combinations including such antibodies or fragments in association with (i) leucovorin, (ii) sunitinib or (iii) leucovorin and 5-fluorouracil; optionally in further association with a further chemotherapeutic agent.
- Further therapeutic agents include, e.g., one or more anti-cancer therapeutic agents or one or more of: a FLT-3 inhibitor, a VEGFR inhibitor, an EGFR TK inhibitor, an aurora kinase inhibitor, an mTOR inhibitor, a PIK-1 modulator, a Bcl-2 inhibitor, an HDAC inhbitor, a c-MET inhibitor, a PARP inhibitor, a Cdk inhibitor, an EGFR TK inhibitor, an IGFR-TK inhibitor, an anti-HGF antibody, a PI3 kinase inhibitors, an AKT inhibitor, a JAK/STAT inhibitor, a checkpoint-1 or 2 inhibitor, a focal adhesion kinase inhibitor, a Map kinase kinase (mek) inhibitor or a VEGF trap antibody.
- a FLT-3 inhibitor e.g., a FLT-3 inhibitor, a VEGFR inhibitor, an EGFR TK inhibitor, an aurora kinase inhibitor
- the further chemotherapeutic agent is one or more of: everolimus, trabectedin, abraxane, TLK 286, AV-299, DN-101 , pazopanib, GSK690693, RTA 744, ON 0910.Na, AZD 6244 (ARRY-142886), AMN-107, TKI-258, GSK461364, AZD 1152, enzastaurin, vandetanib, ARQ-197, MK-0457, MLN8054, PHA- 739358, R-763, AT-9263, pemetrexed, erlotinib, dasatanib, nilotinib, decatanib, panitumumab, amrubicin, oregovomab, Lep-etu, nolatrexed, azd2171 , batabulin, ofatumumab, zanolimumab, edotecarin, t
- doxorubicin liposomal doxorubicin, 5'-deoxy-5-fluorouridine, vincristine, temozolomide, ZK- 304709, seliciclib; PD0325901 , AZD-6244, capecitabine, L-Glutamic acid, N -[4-[2-(2- amino-4,7-dihydro-4-oxo-1 H -pyrrolo[2,3- d ]pyrimidin-5-yl)ethyl]benzoyl]-, disodium salt, heptahydrate, camptothecin, irinotecan; PEG-labeled irinotecan, tamoxifen, toremifene citrate, anastrazole, exemestane, letrozole, DES(diethylstilbestrol), estradiol, estrogen, conjugated estrogen, bevacizumab, IMC-1 C11 , CHIR-258,
- GW-572016 Ionafarnib, BMS- 214662, tipifarnib; amifostine, NVP-LAQ824, suberoyl analide hydroxamic acid, valproic acid, t ⁇ chostatin A, FK-228, SU11248, sorafenib, KRN951 , aminoglutethimide, amsac ⁇ ne, anagrelide, L-asparaginase, Bacillus Calmette-Gue ⁇ n (BCG) vaccine, bleomycin, buserelin, busulfan, carboplatin, carmustine, chlorambucil, cisplatin, cladribine, clodronate, cyclophosphamide, cyproterone, cytarabine, dacarbazine, dactinomycin, daunorubicin, diethylstilbestrol, epirubicin, fludarabine, fludrocortisone, fluoxymesterone
- the scope of the present invention also includes methods wherein a subject is administered an ant ⁇ -IGF1 R antibody or antigen-binding fragment thereof in association with leucovorin and 5-fluorourac ⁇ l or in association with sunitinib; further in association with one or more antiemetics.
- Antiemetics include, but are not limited to, casopitant (GlaxoSmithKline), Netupitant (MGI-Helsinn) and other NK-1 receptor antagonists, palonosetron (sold as Aloxi by MGI Pharma), aprepitant (sold as Emend by Merck and Co.; Rahway, NJ), diphenhydramine (sold as Benadryl® by Pfizer; New York, NY), hydroxyzine (sold as Atarax® by Pfizer; New York, NY), metoclopramide (sold as Reglan® by AH Robins Co 1 ; Richmond, VA), lorazepam (sold as Ativan® by Wyeth; Madison, NJ), alprazolam (sold as Xanax® by Pfizer; New York, NY), haloperidol (sold as Haldol® by Ortho-McNeil; Rantan, NJ), droperidol (Inapsine®), dronabinol (sold as Marino
- the present invention includes methods wherein the subject is administered an ant ⁇ -IGF1 R antibody or antigen-binding fragment thereof in association with leucovorin and 5-fluorourac ⁇ l or in association with sunitinib; further in association with an agent which treats or prevents such a deficiency, such as, e.g., pegfilgrastim, erythropoietin, epoetin alfa or darbepoetin alfa.
- an agent which treats or prevents such a deficiency such as, e.g., pegfilgrastim, erythropoietin, epoetin alfa or darbepoetin alfa.
- each component can be administered to a subject at a different time than when the other component is administered; for example, each administration may be given non-simultaneously (e.g., separately or sequentially) at one or more intervals over a given period of time.
- the separate components may be administered to a subject by the same or by a different route.
- a subject is administered an anti-IGF1 R antibody or antigen-binding fragment thereof of the invention in association with leucovorin and 5-fluorouracil or in association with sunitinib and, optionally in association with a further chemotherapeutic agent, such as a further anti-IGF1 R antibody or antigen- binding fragment thereof.
- said further chemotherapeutic agent is another anti-IGF1 R antibody or antigen binding fragment thereof with the proviso that the antibody or fragment does not comprise a 2C6 light chain or heavy chain immunoglobulin or a 9H2 light chain or heavy chain immunoglobulin or any CDR thereof or fragment thereof, e.g., antigen-binding fragment thereof.
- 2C6 CDR-H1 GFTFDDYAMH (SEQ ID NO: 23)
- 2C6 CDR-H2 GISWNSGSKGYVDSVKG (SEQ ID NO: 24)
- 2C6 CDR-H3 DIRIGVAASYYFGMDV (SEQ ID NO: 25)
- 2C6 CDR-L1 RASQGISSVLA (SEQ ID NO: 27)
- 2C6 CDR-L2 DASSLES (SEQ ID NO: 28)
- 2C6 CDR-L3 QQFNSYPYT (SEQ ID NO: 29)
- 9H2 CDR-L1 RASQSVSRSYLA (SEQ ID NO: 35)
- 9H2 CDR-L2 GASSRAT (SEQ ID NO: 36)
- 9H2 CDR-L3 QQYGSSPWT (SEQ ID NO: 37)
- the present invention includes combinations including anti-IGF1 R antibodies or fragments as discussed herein in association with (i) leucovorin, (ii) sunitinib or (iii) leucovorin and 5-fluorouracil; optionally in further association with a further chemotherapeutic agent; as well as methods of treating colorectal cancer with such combinations.
- leucovorin also known as folinic acid and citrovorum factor
- folinic acid and citrovorum factor is represented by the following structural formula:
- the term includes the salt calcium folinate (or leucovorin calcium).
- a leucovorin calcium formulation is sold as Wellcovorin® by GlaxoSmithKline.
- 5-fluorouracil is represented by the following structural formula: .
- a 5-fluorouracil formulation is sold as Adrucil.
- sunitinib is represented by the following structural formula:
- a sunitinib malate formulation is sold as Sutent®, by Pfizer, Inc.
- Methods of the present invention include administration of a therapeutically effective dosage of an IGF1 R antibody or antigen-binding fragment thereof of the invention in association with leucovorin and 5-fluorouracil or in association with sunitinib.
- the administration and dosage of leucovorin and 5- fluorouracil or of sunitinib is, when possible, done according to the schedule listed in the product information sheet of the approved agents, in the Physicians' Desk Reference 2003 (Physicians' Desk Reference, 57th Ed); Medical Economics Company; ISBN: 1563634457; 57th edition (November 2002), as well as therapeutic protocols well known in the art.
- leucovorin is administered intravenously or orally. In general, leucovorin should not be administered intrathecally.
- 5-fluorouracil is, in an embodiment of the invention, administered intravenously by bolus or infusion.
- sunitinib is administered orally.
- an anti-IGF1 R antibody or antigen-binding fragment thereof of the invention is administered parenterally (e.g., intravenous, intraarterially, subcutaneously, intramuscularly or intratumorally).
- the scope of the present invention further includes methods for preventing or treating any medical disorder mediated by IGF1 R expression or activity or the expression or activity of any ligand of IGF1 R such as IGF-1 or IGF-2, for example, osteosarcoma, rhabdomyosarcoma, neuroblastoma, any pediatric cancer, kidney cancer, leukemia, renal transitional cell cancer, Werner-Morrison syndrome, acromegaly, bladder cancer, Wilm's cancer, ovarian cancer, pancreatic cancer, benign prostatic hyperplasia, breast cancer, prostate cancer, bone cancer, lung cancer, gastric cancer, cervical cancer, synovial sarcoma, diarrhea associated with metastatic carcinoid, vasoactive intestinal peptide secreting tumors, gigantism, psoriasis, atherosclerosis, smooth muscle restenosis of blood vessels and inappropriate microvascular proliferation, head and neck cancer, squamous cell carcinoma, multiple myeloma, solitary plasmacytoma, renal cell cancer,
- colorectal cancer includes all cancers of the colon and/or rectum.
- the term includes adenocarcinoma of the colon (e.g., mucinous (colloid) adenocarcinoma or signet ring adenocarcinoma).
- adenocarcinoma of the colon e.g., mucinous (colloid) adenocarcinoma or signet ring adenocarcinoma
- Other types of colorectal cancer included by the term include the following varieties of colon cancer: neuroendocrine, lymphoma, melanoma, squamous cell, sarcoma and carcinoid.
- colorectal cancer also includes all stages of colorectal cancer; for example, under the Modified Duke Staging System or TNM system (Tumor, Node, Metastisis). The stages associated with these systems are well known by practitioners of ordinary skill in the art.
- the IGF1 R antibody or antigen-binding fragment thereof of the invention in association with leucovorin and 5-fluorouracil or in association with sunitinib is administered to a subject to treat or prevent colorectal cancer wherein the subject is predisposed to colorectal cancer.
- the patient has familial adenomatous polyposis (FAP), hereditary nonpolyposis colon cancer (HNPCC) (i.e., Lynch I Syndrome or Lynch Il Syndrome), inflammatory bowel disease, such as chronic ulcerative colitis (UC) or Crohn's disease, other family cancer syndromes (e.g., Koz-Jegher Syndromem and Familial Juvenile Polyposis), or adenomatous polyps (e.g., sessile (flat with a broad base and no stalk); tubular (composed of tubular glands extending downward from the outer surface of the polyp); villous (composed of fingerlike epithelial projections extending outward from the surface of the bowel mucosa); pedunculated (attached by a narrow base and a long stalk)).
- FAP familial adenomatous polyposis
- HNPCC hereditary nonpolyposis colon cancer
- UC chronic ulcerative colitis
- Crohn's disease other family cancer syndromes
- HNPCC is, in an embodiment of the invention, mediated by one or more genes such as MLH1, MSH2, PMS1, PMS2, and MSH6 and is characterized by an increased risk of several cancers such as colorectal cancer.
- HNPCC is inherited as an autosomal dominant trait and includes Lynch I syndrome and Lynch Il syndrome.
- Lynch I syndrome is characterized by a familial predisposition to colorectal cancer with right-sided predominance and predominantly early-onset proximal colon carcinomas.
- Lynch syndrome Il is characterized by a familial predisposition for other primary cancers in addition to the predisposition for colon cancer.
- familial adenomatous polyposis is an inherited condition in which numerous polyps form mainly in the epithelium of the large intestine. In general, while these polyps start out benign, malignant transformation into colon cancer occurs when not treated.
- inflammatory bowel disease is the name of a group of disorders that cause the intestines to become inflamed (e.g., red and swollen). Typically, ulcerative colitis and Crohn's disease are classified as inflammatory bowel diseases. Ulcerative colitis is a form of colitis that includes characteristic ulcers or open sores, in the colon.
- Crohn's disease is a chronic inflammatory disease of the intestines. It primarily causes ulcerations (breaks in the lining) of the small and large intestines, but can affect the digestive system anywhere from the mouth to the anus. Crohn's disease is also called granulomatous enteritis or colitis, regional enteritis, ileitis, or terminal ileitis.
- PJ Koz-Jegher's
- PJ is hereditary condition that results in gastrointestinal polyps and freckles on the skin. The cause for Koz-Jegher's is an inherited mutation in a gene on chromosome 19, LKB1 or STK 11. The mutation seems to result in a predisposition to benign and cancerous tumors.
- familial juvenile polyposis is an autosomal dominant condition characterized by multiple juvenile polyps of the gastrointestinal (Gl) tract. Kindreds have been described in which there is involvement of the colon only, the upper Gl tract or both upper and lower Gl tracts.
- FJP is a hamartomatous polyposis syndrome. Although the polyps in PJS are true hamartomata, some may undergo adenomatous change, and these family members are at increased risk for gastrointestinal malignancy.
- the PJS gene was mapped to chromosome 19p by comparative genomic hybridization and linkage and germline mutations were identified in the serine threonine kinase gene, LKB1.
- adenomatous polyps (adenomas) of the colon and rectum are benign (noncancerous) growths that may be precursor lesions to colorectal cancer.
- polyps greater than one centimeter in diameter are associated with a greater risk of cancer. If polyps are not removed, they typically continue to grow and can become cancerous.
- the present invention comprises methods for treating or preventing colorectal cancer comprising administering a therapeutically effective amount or dosage of anti-IGF1 R or an antigen-binding fragment thereof in association with sunitinib or in association with leucovorin and 5-fluorouracil.
- terapéuticaally effective amount or “therapeutically effective dosage” means that amount or dosage of an antibody or antigen-binding fragment thereof or other therapeutic agent or combination thereof of the invention or composition thereof that will elicit a biological or medical response of a tissue, system, patient, subject or host that is being sought by the administrator (such as a researcher, doctor or veterinarian) which includes any measurable alleviation of the signs, symptoms and/or clinical indicia of colorectal cancer (e.g., tumor growth and/or metastasis) including the prevention, slowing or halting of progression of the colorectal cancer to any degree whatsoever.
- the administrator such as a researcher, doctor or veterinarian
- a therapeutically effective dose of sunitinib is about one 50 mg oral dose taken once daily, e.g., on a schedule of 4 weeks on treatment followed by 2 weeks off, e.g., taken with or without food.
- a therapeutically effective dosage of leucovorin is about 200 mg/m 2 , e.g., by intravenous infusion.
- a therapeutically effective dosage of 5- fluorouracil is about 400 mg/m 2 -600 mg/m 2 , e.g., by intravenous bolus or infusion.
- a "therapeutically effective dosage" of any anti-IGF1 R antibody or antigen-binding fragment thereof of the present invention is between about 0.3 and 20 mg/kg of body weight (e.g., about 0.3 mg/kg of body weight, about 0.6 mg/kg of body weight, about 0.9 mg/kg of body weight, about 1 mg/kg of body weight, about 2 mg/kg of body weight, about 3 mg/kg of body weight, about 4 mg/kg of body weight, about 5 mg/kg of body weight, about 6 mg/kg of body weight, about 7 mg/kg of body weight, about 8 mg/kg of body weight, about 9 mg/kg of body weight, about 10 mg/kg of body weight, about 11 mg/kg of body weight, about 12 mg/kg of body weight, about 13 mg/kg of body weight, about 14 mg/kg of body weight, about 15
- Dosage regimens may be adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single dose may be administered or several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies or the particular circumstances or requirements of the therapeutic situation. For example, dosage may be determined or adjusted, by a practitioner of ordinary skill in the art (e.g., physician or veterinarian) according to the patient's age, weight, height, past medical history, present medications and the potential for cross-reaction, allergies, sensitivities and adverse side-effects.
- a practitioner of ordinary skill in the art e.g., physician or veterinarian
- the physician or veterinarian could start doses of the antibody or antigen-binding fragment of the invention or composition thereof at levels lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved.
- the effectiveness of a given dose or treatment regimen of an antibody or combination of the invention can be determined, for example, by determining whether a tumor being treated in the subject shrinks or ceases to grow.
- the size and progress of a tumor can be easily determined, for example, by X-ray, magnetic resonance imaging (MRI) or visually in a surgical procedure.
- tumor size and proliferation can be measured by use of a thymidine PET scan (see e.g., Wells et a/., Clin. Oncol. 8: 7-14 (1996)).
- the thymidine PET scan includes the injection of a radioactive tracer, such as [2- 11 C]-thymidine, followed by a PET scan of the patient's body (Vander Borght et ai, Gastroenterology 101 : 794-799, 1991 ; Vander Borght et al., J. Radiat. Appl. Instrum. Part A, 42: 103-104 (1991 )).
- a radioactive tracer such as [2- 11 C]-thymidine
- tracers that can be used include [ 18 F]-FDG (18-fluorodeoxyglucose), [ 124 I]IUdR (5- [124l]iodo-2'-deoxyuridine), [ 76 Br]BrdUrd (Bromodeoxyuridine), [ 18 F]FLT (3'-deoxy- 3'fluorothymidine) or [ 11 C]FMAU (2'-fluoro-5-methyl-1 - ⁇ -D-arabinofuranosyluracil).
- colorectal or colon cancer progress can be monitored, by the physician, by a variety of methods, and the dosing regimen can be altered accordingly.
- Methods by which to monitor colorectal or colon cancer include CT scan, MRI scan, chest X-ray, PET scan, fecal occult blood tests (FOBTs), flexible proctosigmoidoscopy, total colonoscopy, and barium enema.
- subject or patient includes any mammal (e.g., primate, dog, horse, rat, mouse, cat, rabbit) including a human.
- a "subject" or “patient” is an adult human (e.g., 18 years or older) or a human child (e.g., under 18 years of age, for example, less than 1 , 1 , 2, 3, 4, 5, 6, 7,8, 9 or 10 years of age); or a female or a male.
- compositions comprising an anti-IGF1 R antibody or antigen-binding fragment thereof of the invention in association with a pharmaceutically acceptable carrier are also within the scope of the present invention (e.g., in a single composition or separately in a kit) as are combinations and compositions including such pharmaceutical compositions.
- the pharmaceutical compositions may be prepared by any methods well known in the art of pharmacy; see, e.g., Gilman, et al., (eds.) (1990), The Pharmacological Bases of Therapeutics, 8th Ed., Pergamon Press; A.
- the antibody or antigen-binding fragment thereof is administered to a subject as part of a pharmaceutical composition
- a pharmaceutical composition comprising sodium acetate (e.g., Trihydrate USP) at 2.30 mg/ml; glacial acetic acid (e.g., USP/Ph. Eur) at 0.18 mg/ml; sucrose (e.g., extra pure NF, Ph. Eur, BP) at 70.0 mg/ml; anti- IGF1 R antibody or an antigen-binding fragment thereof at 20.0 mg/ml and water, for example, sterile water (e.g., for injection USP/Ph.
- sodium acetate e.g., Trihydrate USP
- glacial acetic acid e.g., USP/Ph. Eur
- sucrose e.g., extra pure NF, Ph. Eur, BP
- anti- IGF1 R antibody or an antigen-binding fragment thereof at 20.0 mg/ml
- water for example, sterile water
- a pharmaceutical composition containing an antibody or antigen-binding fragment thereof of the invention, which is optionally in association with a further chemotherapeutic agent can be prepared using conventional pharmaceutically acceptable excipients and additives and conventional techniques.
- pharmaceutically acceptable excipients and additives include non-toxic compatible fillers, binders, disintegrants, buffers, preservatives, anti-oxidants, lubricants, flavorings, thickeners, coloring agents, emulsifiers and the like.
- parenteral e.g., subcutaneous, intravenous, intraperitoneal, intramuscular, topical, intra-peritoneal, inhalation, intra-cranial
- non-parenteral e.g., oral, transdermal, intranasal, intraocular, sublingual, rectal and topical
- Injectables can be prepared in conventional forms, either as liquid solutions or suspensions, solid forms suitable for solution or suspension in liquid prior to injection, or as emulsions.
- the injectables, solutions and emulsions can also contain one or more excipients.
- Excipients include, for example, water, saline, dextrose, glycerol or ethanol.
- the pharmaceutical compositions to be administered may also contain minor amounts of non-toxic auxiliary substances such as wetting or emulsifying agents, pH buffering agents, stabilizers, solubility enhancers, and other such agents, such as for example, sodium acetate, sorbitan monolaurate, triethanolamine oleate and cyclodextrins.
- pharmaceutically acceptable carriers used in parenteral preparations include aqueous vehicles, nonaqueous vehicles, antimicrobial agents, isotonic agents, buffers, antioxidants, local anesthetics, suspending and dispersing agents, emulsifying agents, sequestering or chelating agents and other pharmaceutically acceptable substances.
- aqueous vehicles examples include sodium chloride injection, Ringers Injection, isotonic dextrose Injection, sterile water injection, dextrose and lactated Ringers Injection.
- Nonaqueous parenteral vehicles include fixed oils of vegetable origin, cottonseed oil, corn oil, sesame oil and peanut oil.
- Antimicrobial agents in bacteriostatic or fungistatic concentrations may be added to parenteral preparations packaged in multiple-dose containers which include phenols or cresols, mercurials, benzyl alcohol, chlorobutanol, methyl and propyl p-hydroxybenzoic acid esters, thimerosal, benzalkonium chloride and benzethonium chloride.
- Isotonic agents include sodium chloride and dextrose. Buffers include phosphate and citrate. Antioxidants include sodium bisulfate. Local anesthetics include procaine hydrochloride. Suspending and dispersing agents include sodium carboxymethylcelluose, hydroxypropyl methylcellulose and polyvinylpyrrolidone. Emulsifying agents include Polysorbate 80 (TWEEN- 80). A sequestering or chelating agent of metal ions includes EDTA (ethylenediaminetetraacetic acid) or EGTA (ethylene glycol tetraacetic acid). Pharmaceutical carriers may also include ethyl alcohol, polyethylene glycol and propylene glycol for water miscible vehicles; and sodium hydroxide, hydrochloric acid, citric acid or lactic acid for pH adjustment.
- preparations for parenteral administration can include sterile solutions ready for injection, sterile dry soluble products, such as lyophilized powders, ready to be combined with a solvent just prior to use, including hypodermic tablets, sterile suspensions ready for injection, sterile dry insoluble products ready to be combined with a vehicle just prior to use and sterile emulsions.
- the solutions may be either aqueous or nonaqueous.
- concentration of the antibody or antigen-binding fragment thereof of the invention which is optionally in association with a further chemotherapeutic agent, can be adjusted so that an injection provides an effective amount to produce the desired pharmacological effect.
- unit-dose parenteral preparations are packaged in an ampoule, a vial or a syringe with a needle. All preparations for parenteral administration must be sterile, as is known and practiced in the art.
- a sterile, lyophilized powder is prepared by dissolving the antibody or antigen-binding fragment thereof, which is optionally in association with a further chemotherapeutic agent, or a pharmaceutically acceptable derivative thereof, in a suitable solvent.
- the solvent may contain an excipient which improves the stability or other pharmacological components of the powder or reconstituted solution, prepared from the powder. Excipients that may be used include, but are not limited to, dextrose, sorbital, fructose, corn syrup, xylitol, glycerin, glucose, sucrose or other suitable agent.
- the solvent may also contain a buffer, such as citrate, sodium or potassium phosphate or other such buffer known to those of skill in the art at, in one embodiment, about neutral pH.
- a buffer such as citrate, sodium or potassium phosphate or other such buffer known to those of skill in the art at, in one embodiment, about neutral pH.
- Subsequent sterile filtration of the solution followed by lyophilization under standard conditions known to those of skill in the art provides a desirable formulation.
- the resulting solution will be apportioned into vials for lyophilization.
- Each vial can contain a single dosage or multiple dosages of the anti-IGF1 R antibody or antigen-binding fragment thereof or composition thereof. Overfilling vials with a small amount above that needed for a dose or set of doses (e.g., about 10%) is acceptable so as to facilitate accurate sample withdrawal and accurate dosing.
- the lyophilized powder can be stored under appropriate conditions, such as at about 4°C to room temperature.
- Reconstitution of a lyophilized powder with water for injection provides a formulation for use in parenteral administration.
- the lyophilized powder is added to sterile water or other liquid suitable carrier. The precise amount depends upon the selected therapy being given. Such amount can be empirically determined.
- Administration by inhalation can be provided by using, e.g., an aerosol containing sorbitan trioleate or oleic acid, for example, together with trichlorofluoromethane, dichlorofluoromethane, dichlorotetrafluoroethane or any other biologically compatible propellant gas; it is also possible to use a system containing an IGF1 R inhibitor, which is optionally in association with a further chemotherapeutic agent, by itself or associated with an excipient, in powder form.
- an active agent e.g., anti-IGF1 R, which is optionally in association with a further chemotherapeutic agent
- a solid inner matrix e.g., polymethylmethacrylate, polybutylmethacrylate, plasticized or unplasticized polyvinylchloride, plasticized nylon, plasticized polyethyleneterephthalate, natural rubber, polyisoprene, polyisobutylene, polybutadiene, polyethylene, ethylene-vinylacetate copolymers, silicone rubbers, polydimethylsiloxanes, silicone carbonate copolymers, hydrophilic polymers such as hydrogels of esters of acrylic and methacrylic acid, collagen, cross-linked polyvinylalcohol and cross-linked partially hydrolyzed polyvinyl acetate, that is surrounded by an outer polymeric membrane, e.g., polymethylmethacrylate, polybutylmethacrylate, plasticized or unplasticized polyvinylchloride, plasticized nylon, plasticized polyethylene
- the antibody or fragment diffuses through the outer polymeric membrane in a release rate controlling step.
- the percentage of active agent contained in such parenteral compositions is highly dependent on the specific nature thereof, as well as the activity of the antibody or antigen-binding fragment, which is optionally in association with a further chemotherapeutic agent, and the needs of the subject.
- Agents set forth herein can be formulated into a sustained release formulation including liposomal formulations such as unilamellar vesicular (ULV) and multilamellar vesicular (MLV) liposomes and DepoFoamTM particles (Kim et al., Biochim. Biophys. Acta (1983) 728(3):339-348; Kim, Methods Neurosci. (1994) 21 : 118-131 ; Kim et al., Anesthesiology (1996) 85(2): 331-338; Katre et al., J. Pharm. Sci. (1998) 87(11) : 1341- 1346).
- liposomal formulations such as unilamellar vesicular (ULV) and multilamellar vesicular (MLV) liposomes and DepoFoamTM particles
- a feature of the DepoFoam system is that, inside each DepoFoam particle, discontinuous internal aqueous chambers, bounded by a continuous, non-concentric network of lipid membranes render a higher aqueous volume-to-lipid ratio and much larger particle diameters compared with MLV.
- sunitinib is sunitinib malate, and, in an embodiment of the invention, is supplied in capsules containing sunitinib malate equivalent to 12.5 mg, 25 mg or 50 mg of sunitinib together with mannitol, croscarmellose sodium, povidone (K-25) and magnesium stearate as inactive ingredients.
- leucovorin is leucovorin calcium
- leucovorin calcium in an embodiment of the invention, is in a tablet containing 5 mg of leucovorin (equivalent to 5.40 mg of anhydrous leucovorin calcium) and the following inactive ingredients: corn starch, dibasic calcium phosphate, magnesium stearate, and pregelatinized starch; or 15 mg of leucovorin (equivalent to 16.20 mg of anhydrous leucovorin calcium) and the following inactive ingredients: lactose, magnesium stearate, microcrystalline cellulose, pregelatinized starch, and sodium starch glycolate.
- 5-fluorouracil is a colorless to faint yellow aqueous, sterile, nonpyrogenic injectable solution for intravenous administration wherein each 10 ml_ contains 500 mg of fluorouracil; and wherein pH is adjusted to 8.6 to 9.4 with sodium hydroxide and hydrochloric acid if necessary.
- the present invention is intended to exemplify the present invention and not to be a limitation thereof. Methods and compositions disclosed below fall within the scope of the present invention.
- Example 1 Inhibition of colorectal tumor growth in xenograft models.
- mice treated with anti-IGF1 R and 5-fluorouracil and leucovorin is set forth in Table 1.
- Table 1 Combination efficacy study design in WiDr
- a indicates the treated group is significantly better than the control group (p ⁇ 0 05)
- b indicates the combination treated group is significantly better than either single agent used alone (p ⁇
- a indicates the treated group is significantly better than the control group (p ⁇ 0.05).
- b indicates the combination treated group is significantly better than either single agent used alone (p ⁇
- anti-IGF1 R LCF/HCA ( ⁇ 1 , ⁇ )
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Epidemiology (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Biomedical Technology (AREA)
- Oncology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US12/934,458 US20110104256A1 (en) | 2008-03-25 | 2009-03-23 | Methods for treating or preventing colorectal cancer |
| MX2010010480A MX2010010480A (es) | 2008-03-25 | 2009-03-23 | Metodos de tratamiento o prevencion del cancer colorrectal. |
| CA2718918A CA2718918A1 (en) | 2008-03-25 | 2009-03-23 | Methods for treating or preventing colorectal cancer |
| EP09751040A EP2259797A2 (en) | 2008-03-25 | 2009-03-23 | Methods for treating or preventing colorectal cancer |
| JP2011501946A JP2011515478A (ja) | 2008-03-25 | 2009-03-23 | 結腸直腸がんを処置または予防するための方法 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US3919708P | 2008-03-25 | 2008-03-25 | |
| US61/039,197 | 2008-03-25 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2009142810A2 true WO2009142810A2 (en) | 2009-11-26 |
| WO2009142810A3 WO2009142810A3 (en) | 2010-07-15 |
Family
ID=41340744
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2009/037953 Ceased WO2009142810A2 (en) | 2008-03-25 | 2009-03-23 | Methods for treating or preventing colorectal cancer |
Country Status (8)
| Country | Link |
|---|---|
| US (1) | US20110104256A1 (https=) |
| EP (1) | EP2259797A2 (https=) |
| JP (1) | JP2011515478A (https=) |
| CA (1) | CA2718918A1 (https=) |
| CL (1) | CL2009000721A1 (https=) |
| MX (1) | MX2010010480A (https=) |
| TW (1) | TW200944233A (https=) |
| WO (1) | WO2009142810A2 (https=) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP4378478A4 (en) * | 2021-07-27 | 2025-11-12 | Toray Industries | MEDICINE FOR THE TREATMENT AND/OR PREVENTION OF CANCER |
Families Citing this family (30)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR101313702B1 (ko) | 2005-02-03 | 2013-10-04 | 와이어쓰 | 제피티니브 및/또는 에를로티니브 내성암 치료용 약제학적 조성물 |
| EP1942937A1 (en) | 2005-11-04 | 2008-07-16 | Wyeth | Antineoplastic combinations with mtor inhibitor, herceptin, and/or hki-272 |
| US8022216B2 (en) | 2007-10-17 | 2011-09-20 | Wyeth Llc | Maleate salts of (E)-N-{4-[3-chloro-4-(2-pyridinylmethoxy)anilino]-3-cyano-7-ethoxy-6-quinolinyl}-4-(dimethylamino)-2-butenamide and crystalline forms thereof |
| BRPI0914790A2 (pt) | 2008-06-17 | 2015-10-20 | Wyeth Llc | uso de um composto de vinorelbina e um composto de hki-272, composição farmacêutica e produto e kit para o tratamento de neoplasma |
| US8669273B2 (en) | 2008-08-04 | 2014-03-11 | Wyeth Llc | Antineoplastic combinations of 4-anilino-3-cyanoquinolines and capecitabine |
| ES2645692T3 (es) | 2008-11-11 | 2017-12-07 | The Board Of Regents,The University Of Texas System | Microcápsulas de rapamicina y su uso para el tratamiento del cáncer |
| TWI460178B (zh) | 2009-02-12 | 2014-11-11 | Arqule Inc | 組合性組成物及治療癌症之方法 |
| DK3000467T3 (da) | 2009-04-06 | 2023-03-27 | Wyeth Llc | Behandling med neratinib mod brystkræft |
| US9283211B1 (en) | 2009-11-11 | 2016-03-15 | Rapamycin Holdings, Llc | Oral rapamycin preparation and use for stomatitis |
| US8580764B2 (en) * | 2010-07-01 | 2013-11-12 | Arqule, Inc. | Combinational compositions and methods for treatment of cancer |
| US9141756B1 (en) | 2010-07-20 | 2015-09-22 | University Of Southern California | Multi-scale complex systems transdisciplinary analysis of response to therapy |
| EP2611443A2 (en) | 2010-09-01 | 2013-07-10 | ArQule, Inc. | Methods for treatment of non-small cell lung cancer |
| WO2013162368A1 (en) * | 2012-04-26 | 2013-10-31 | Stichting Vu-Vumc | Biomarkers |
| NL2010276C2 (en) * | 2013-02-08 | 2014-08-11 | Stichting Vu Vumc | Biomarkers. |
| AU2013202947B2 (en) | 2012-06-13 | 2016-06-02 | Ipsen Biopharm Ltd. | Methods for treating pancreatic cancer using combination therapies comprising liposomal irinotecan |
| US9717724B2 (en) | 2012-06-13 | 2017-08-01 | Ipsen Biopharm Ltd. | Methods for treating pancreatic cancer using combination therapies |
| WO2014160328A1 (en) | 2013-03-13 | 2014-10-02 | The Board Of Regents Of The University Of Texas System | Mtor inhibitors for prevention of intestinal polyp growth |
| US9700544B2 (en) | 2013-12-31 | 2017-07-11 | Neal K Vail | Oral rapamycin nanoparticle preparations |
| EP3089737B1 (en) | 2013-12-31 | 2021-11-03 | Rapamycin Holdings, LLC | Oral rapamycin nanoparticle preparations and use |
| JP6210640B2 (ja) * | 2014-06-19 | 2017-10-11 | 大原薬品工業株式会社 | ホリナートカルシウム含有錠 |
| CN106999734B (zh) * | 2014-09-29 | 2020-06-16 | 得克萨斯大学体系董事会 | 针对parp抑制剂的应答的预测和靶向c-met和parp1的组合疗法 |
| WO2016164815A1 (en) | 2015-04-10 | 2016-10-13 | Applied Proteomics, Inc. | Protein biomarker panels for detecting colorectal cancer and advanced adenoma |
| US11318131B2 (en) | 2015-05-18 | 2022-05-03 | Ipsen Biopharm Ltd. | Nanoliposomal irinotecan for use in treating small cell lung cancer |
| JP7042739B2 (ja) | 2015-08-20 | 2022-03-28 | イプセン バイオファーム リミティド | 癌処置のためのリポソーム型イリノテカン及びparp阻害薬を使用する併用療法 |
| TW202400181A (zh) | 2015-08-21 | 2024-01-01 | 英商益普生生物製藥有限公司 | 使用包含微脂伊立替康(irinotecan)及奧沙利鉑(oxaliplatin)之組合療法治療轉移性胰臟癌的方法 |
| WO2017136671A1 (en) * | 2016-02-04 | 2017-08-10 | Chattterjee Bandana | Combination therapy for castration-resistant prostate cancer |
| CN110402163A (zh) | 2016-11-02 | 2019-11-01 | 易普森生物制药有限公司 | 使用包括脂质体伊立替康、奥沙利铂、5-氟尿嘧啶(和甲酰四氢叶酸)的组合疗法治疗胃癌 |
| JP2017210493A (ja) * | 2017-09-08 | 2017-11-30 | 大原薬品工業株式会社 | ホリナートカルシウム含有錠 |
| JP7493237B2 (ja) * | 2018-11-14 | 2024-05-31 | 学校法人金沢医科大学 | びまん性胃がんを治療するための医薬組成物 |
| JP2021036003A (ja) * | 2020-12-05 | 2021-03-04 | 大原薬品工業株式会社 | ホリナートカルシウム含有錠 |
Family Cites Families (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| ME00502B (me) * | 2001-01-05 | 2011-10-10 | Amgen Fremont Inc | Antitjela za insulinu sličan receptor faktora i rasta |
| EP1506286B1 (en) * | 2002-05-24 | 2014-03-19 | Merck Sharp & Dohme Corp. | Neutralizing human anti-igfr antibody |
| AU2003244817B2 (en) * | 2002-06-28 | 2010-08-26 | Domantis Limited | Antigen-binding immunoglobulin single variable domains and dual-specific constructs |
| DE602004029581D1 (de) * | 2003-08-13 | 2010-11-25 | Pfizer Prod Inc | Modifizierte humane igf-1r antikörper |
| TW200526684A (en) * | 2003-11-21 | 2005-08-16 | Schering Corp | Anti-IGFR1 antibody therapeutic combinations |
| MX2007003314A (es) * | 2004-09-22 | 2007-08-06 | Pfizer | Combinaciones terapeuticas que comprenden inhibidor de poli(adp-ribosa)polimerasas. |
| JP4875064B2 (ja) * | 2005-04-15 | 2012-02-15 | シェーリング コーポレイション | 癌を処置または予防するための方法および組成物 |
| NZ564098A (en) * | 2005-06-15 | 2010-04-30 | Schering Corp | Anti-IGF1R antibody formulations |
| JP2009520028A (ja) * | 2005-12-19 | 2009-05-21 | オーエスアイ・ファーマスーティカルズ・インコーポレーテッド | Igfr抑制剤および抗癌剤の併用 |
| WO2007113648A2 (en) * | 2006-04-05 | 2007-10-11 | Pfizer Products Inc. | Ctla4 antibody combination therapy |
| WO2008005469A2 (en) * | 2006-06-30 | 2008-01-10 | Schering Corporation | Igfbp2 biomarker |
| EP2121018A2 (en) * | 2006-12-13 | 2009-11-25 | Schering Corporation | Treating cancer with anti-igf1r antibody 19d12=sch 717454 |
| US20110129456A1 (en) * | 2008-05-05 | 2011-06-02 | Yaolin Wang | Sequential Administration of Chemotherapeutic Agents for Treatment of Cancer |
-
2009
- 2009-03-23 US US12/934,458 patent/US20110104256A1/en not_active Abandoned
- 2009-03-23 EP EP09751040A patent/EP2259797A2/en not_active Withdrawn
- 2009-03-23 WO PCT/US2009/037953 patent/WO2009142810A2/en not_active Ceased
- 2009-03-23 JP JP2011501946A patent/JP2011515478A/ja active Pending
- 2009-03-23 CA CA2718918A patent/CA2718918A1/en not_active Abandoned
- 2009-03-23 MX MX2010010480A patent/MX2010010480A/es not_active Application Discontinuation
- 2009-03-24 CL CL2009000721A patent/CL2009000721A1/es unknown
- 2009-03-24 TW TW098109578A patent/TW200944233A/zh unknown
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP4378478A4 (en) * | 2021-07-27 | 2025-11-12 | Toray Industries | MEDICINE FOR THE TREATMENT AND/OR PREVENTION OF CANCER |
Also Published As
| Publication number | Publication date |
|---|---|
| EP2259797A2 (en) | 2010-12-15 |
| TW200944233A (en) | 2009-11-01 |
| CL2009000721A1 (es) | 2010-05-14 |
| CA2718918A1 (en) | 2009-11-26 |
| MX2010010480A (es) | 2010-10-15 |
| WO2009142810A3 (en) | 2010-07-15 |
| US20110104256A1 (en) | 2011-05-05 |
| JP2011515478A (ja) | 2011-05-19 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20110104256A1 (en) | Methods for treating or preventing colorectal cancer | |
| US20110129456A1 (en) | Sequential Administration of Chemotherapeutic Agents for Treatment of Cancer | |
| US20110014117A1 (en) | Anti-igf1r | |
| EP2104501B1 (en) | Methods of cancer treatment with igf1r inhibitors | |
| US8216571B2 (en) | Fully human anti-VEGF antibodies and methods of using | |
| WO2010124009A2 (en) | Fully human anti-vegf antibodies and methods of using | |
| US20150093398A1 (en) | Methods and Compositions for Treating or Preventing Cancer | |
| CN114729035B (zh) | 抗cea抗体-依喜替康类似物偶联物及其医药用途 | |
| WO2011057064A1 (en) | Igf1r inhibitor based treatment of prostate cancer | |
| EP4130006A1 (en) | Anti-psma antibody-exatecan analogue conjugate and medical use thereof | |
| CN116059391B (zh) | 抗cldn-18.2抗体药物偶联物及其用途 | |
| BRPI0720924A2 (pt) | Métodos de tratamento |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 09751040 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2009751040 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2718918 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2011501946 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2010/010480 Country of ref document: MX |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 12934458 Country of ref document: US |