WO2008154351A1 - Rtef-1 variants and the use thereof for inhibition of angiogenesis - Google Patents

Rtef-1 variants and the use thereof for inhibition of angiogenesis Download PDF

Info

Publication number
WO2008154351A1
WO2008154351A1 PCT/US2008/066058 US2008066058W WO2008154351A1 WO 2008154351 A1 WO2008154351 A1 WO 2008154351A1 US 2008066058 W US2008066058 W US 2008066058W WO 2008154351 A1 WO2008154351 A1 WO 2008154351A1
Authority
WO
WIPO (PCT)
Prior art keywords
rtef
dominant negative
isolated
nucleic acid
acid sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2008/066058
Other languages
English (en)
French (fr)
Other versions
WO2008154351A9 (en
Inventor
J. Timothy Stout
Trevor Mcfarland
Binoy Appukuttan
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Research Development Foundation
Original Assignee
Research Development Foundation
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to JP2010511354A priority Critical patent/JP5410416B2/ja
Priority to AT08770291T priority patent/ATE553771T1/de
Priority to EP08770291A priority patent/EP2170938B1/en
Priority to AU2008261969A priority patent/AU2008261969B2/en
Priority to CN2008801004835A priority patent/CN101970472B/zh
Priority to CA2689913A priority patent/CA2689913C/en
Application filed by Research Development Foundation filed Critical Research Development Foundation
Priority to DK08770291.6T priority patent/DK2170938T3/da
Publication of WO2008154351A1 publication Critical patent/WO2008154351A1/en
Priority to IL202338A priority patent/IL202338A/en
Anticipated expiration legal-status Critical
Publication of WO2008154351A9 publication Critical patent/WO2008154351A9/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/04Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • A61K38/10Peptides having 12 to 20 amino acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0048Eye, e.g. artificial tears
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/12Drugs for disorders of the urinary system of the kidneys
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/02Ophthalmic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/04Antineoplastic agents specific for metastasis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702Regulators; Modulating activity
    • C07K14/4703Inhibitors; Suppressors
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K7/00Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04Linear peptides containing only normal peptide links
    • C07K7/06Linear peptides containing only normal peptide links having 5 to 11 amino acids
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K7/00Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04Linear peptides containing only normal peptide links
    • C07K7/08Linear peptides containing only normal peptide links having 12 to 20 amino acids
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61NELECTROTHERAPY; MAGNETOTHERAPY; RADIATION THERAPY; ULTRASOUND THERAPY
    • A61N5/00Radiation therapy
    • A61N5/10X-ray therapy; Gamma-ray therapy; Particle-irradiation therapy
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/10Fusion polypeptide containing a localisation/targetting motif containing a tag for extracellular membrane crossing, e.g. TAT or VP22

Definitions

  • the invention concerns the fields of molecular biology and specifically concerns processes involving blood vessel formation (angiogenesis).
  • Transcriptional enhancer factor 1 -related (RTEF-I) gene is a member of the TEA DNA binding domain gene family.
  • the TEA DNA binding domain gene family is highly conserved from Aspergillus nidulans, yeast, Drosophila, mice to human.
  • the TEA DNA binding family of proteins can be involved in both activation and repression of different genes and their particular function can be modified by association with other proteins (Kaneko & DePamphilis, 1998). Expression of specific members of these genes has been identified in various mammalian tissues, including heart, skeletal muscle, pancreas, placenta, brain and lung (Stewart et al, 1996; Yasunami et al., 1996; Farrance et al, 1996).
  • TEF-I transcriptional enhancer factor- 1
  • Transcripts of the RTEF-I gene were first identified in chicken tissue and demonstrated to be enriched in cardiac and skeletal muscle (Farrance et al, 1996).
  • the chicken RTEF-I binds to the myocyte-specific CAT (M-CAT) cis DNA elements and regulates expression of muscle specific genes, and requires muscle specific cofactors for full transcriptional activation.
  • M-CAT myocyte-specific CAT
  • Random screening of 2166 human colorectal cancer cDNA library identified a partial cDNA RTEF-I sequence which lead to the isolation of a full length human homo log of the avian RTEF-I from a heart cDNA library (Stewart et al, 1996; Frigerio et al, 1995).
  • Northern blot analysis of human tissue indicated highest levels of expression in skeletal muscle and pancreas, with lower levels in heart, kidney and placenta, whereas message was not detected in liver, lung or brain (Stewart et al, 1996).
  • Northern blot analysis of the mouse homolog of RTEF-I indicates a different tissue expression pattern when compared to human.
  • Adult mouse lung tissue expressed the highest level, with very low levels in kidney, heart and skeletal muscle and undetectable amounts in liver, thymus, spleen and brain, whereas RTEF-I message was abundant in mouse embryonic skeletal muscle (Yockey et al, 1996).
  • An alternatively spliced mouse isoform of RTEF-I that lacks exon 5 when compare to the full length gene has been identified in mouse skeletal muscle cells (Yockey et al., 1996).
  • VEGF Vascular endothelial growth factor
  • BAEC bovine aortic endothelial cells
  • RTEF-I mediated VEGF gene activation via interaction with SpI elements within the VEGF promoter and not M- CAT motifs.
  • RTEF mediated expression of VEGF is achieved independently of the hypoxia-inducible factor (HIF-I) and hypoxia responsive element (HRE) pathway of activation (Shie et al, 2004).
  • VEGF over-expression has been implicated in a variety of angiogenic disorders such as tumor angiogenesis and aberrant neovascularization.
  • VEGF plays an important role in the development and severity of retinopathy of prematurity (ROP) and other ocular neovascular diseases(Lashkari et al, 2000; Miller, 1997; Vannay et al, 2005; Young et al, 1997).
  • ROP retinopathy of prematurity
  • VEGF blockade therapies typically involve inhibiting the interaction of extra cellular VEGF with cognate cell surface receptors.
  • alternative strategies for VEGF blockade such as method for inhibiting VEGF production.
  • the invention provides an isolated dominant negative (DN) RTEF-I polypeptide comprising an RTEF-I amino acid sequence with one or more internal deletions.
  • DN dominant negative
  • the term dominant negative means that the RTEF-I variant suppresses or reduces the activity of an intact RTEF-I polypeptide as exemplified by SEQ ID NO:1.
  • a DN RTEF-I variant may be defined as a polypeptide that when expressed in a cell inhibits or reduces VEGF promoter activity.
  • a DN RTEF-I may be defined as a polypeptide that reduces or inhibits hypoxia induced or RTEF-I (e.g., SEQ ID NO:1, SEQ ID NO:2 or SEQ ID NO:4) induced VEGF promoter activity.
  • a RTEF-I amino acid sequence may be a mammalian RTEF-I amino acid sequence, preferably a human RTEF-I amino acid sequence.
  • a DN RTEF-I polypeptide comprising one or more internal amino acid deletions.
  • a DN RTEF-I may comprise a deletion of amino acids encoded by exons 3, 4, 5, 6, 7, 8, 9 or 10.
  • a DN RTEF-I may comprise a deletion of all of the amino acids sequence encoded by exons 4, 5, 6, 7, 8 and/or 9.
  • a DN RTEF-I may comprise a partial deletion of amino acids from exon 3 and/or exon 10, such as a deletion of about the last 5 amino acids encoded by exon 3 or deletion of about the first 11 amino acids encoded by exon 10.
  • a DN RTEF- 1 may comprise amino acid substitutions relative to a wild type RTEF-I sequence, such as human RTEF-I sequence.
  • a DN RTEF-I may be defined as a RTEF-I polypeptide comprising one or more internal amino acid deletions wherein the DN RTEF-I is about or at least about 70, 75, 80, 85, 90, 95, 98 or 99 percent identical to a wild type RTEF-I sequence (e.g., SEQ ID NO:1, SEQ ID NO:2 or SEQ ID NO:4) over the undeleted amino acid region.
  • a RTEF-I dominant negative polypeptide may comprise a RTEF-I amino acid sequence is about or at least about 70, 75, 80, 85, 90, 95, 98 or 99 percent identical to SEQ E) NO:3 (the amino acid sequence encoded by the 651 bp cDNA).
  • the DN RTEF-I polypeptide may comprise the sequence given by SEQ ID N0:3. Further embodiments of DN RTEF-I polypeptides contemplated by the invention are provided in the detailed description of the embodiments.
  • a DN RTEF-I polypeptide may comprise a cell internalization moiety.
  • a cell internalization moiety may be associated with or conjugated to a DN RTEF-I polypeptide.
  • a DN RTEF-I may be provided in complex with a liposomal vesicles thereby enabling the polypeptide to traverse the cell membrane.
  • a cell internalization moiety may be a peptide, a polypeptide, an aptamer or an avimer (see for example U.S. Applns. 20060234299 and 20060223114) sequence.
  • a cell internalization moiety may comprise amino acids from the HIV tat, HSV-I tegument protein VP22, or Drosophila antennopedia.
  • a cell internalization moiety may be a engineered internalization moiety such as the poly- Arginine, Methionine and Glycine peptides described by Wright et al. (2003) and Rothbard et al. (2000).
  • a cell internalization moiety may be the RMRRMRRMRR (SEQ ID NO: 23) exemplified herein.
  • a polypeptide cell internalization moiety and a DN RTEF-I polypeptide may comprise a fusion protein.
  • DN RTEF-I fusion proteins comprising a cell internalization moiety and a DN RTEF-I sequence.
  • fusion proteins may additionally comprises a one or more amino acid sequences seperating the cell internalizing moiety and the DN RTEF-I polypeptide sequence.
  • a linker sequence may separate these two domains.
  • a linker sequences may comprise a "flexible" amino acids with a large number or degrees of conformational freedom such as a poly glycine linker.
  • a linker sequence may comprising a proteinase cleavage site.
  • a linker sequence may comprising a cleavage site that is recognized and cleaved by an intracellular proteinase thereby releasing a DN RTEF-I sequence from the cell internalization sequence once the fusion protein has been internalized.
  • a cell internalization moiety may be further defined as a cell targeting moiety, that is a moiety that binds to or is internalized by only a selected population of cells such as cells expressing a particular cellular receptor.
  • a cell targeting may, for example, comprise an antibody, a growth factor, a hormone, a cytokine, an aptamer or an avimer that binds to a cell surface protein.
  • a cell targeting moiety of the invention may target a particular type of cells such as a retinal, endothelial, iris or neuronal cell.
  • a cell targeting moiety of the invention may be defined as cancer cell binding moiety.
  • a cell targeting moiety of the invention may target a cancer cell associated antigen such a gp240 or Her-2/neu.
  • a DN RTEF-I polypeptide may comprise additional amino acid sequences such as a cell trafficking signals (e.g., cell secretion signal, a nuclear localization signal or a nuclear export signal) or a reporter polypeptides such as an enzyme or a fluorescence protein.
  • a DN RTEF-I polypeptide comprises a cellular secretion signal.
  • a DN RTEF-I polypeptide may comprise a secretion sequence from a human gene such as the IL-2 secretion signal sequence (MYRMQLLSCIALSLALVTNS, SEQ ID NO:22).
  • a DN RTEF-I polypeptide may comprise a cell internalization moiety and cell secretion signal, thereby allowing the polypeptide to be secreted by one cells and internalized into a surrounding a cell.
  • nucleic acid sequence comprising sequence encoding a DN RTEF-I polypeptide as described supra.
  • a nucleic acid sequence encoding any of the DN RTEF-I polypeptides or polypeptide fusion proteins described herein are also included as part of the instant invention.
  • the skilled artisan will understand that a variety of nucleic acid sequence may be used to encode identical polypeptides in view of the degeneracy of genetic code. In certain cases for example the codon encoding any particular amino acid may be altered to improve cellular expression or to reduce the chance that a nucleic acid may recombine at a genomic RTEF-I locus.
  • a nucleic acid sequence encoding a DN RTEF-I polypeptide is comprised in an expression cassette.
  • expression cassette means that additional nucleic acids sequences are included that enable expression of DN RTEF-I in a cell, or more particularly in a eukaryotic cell. Such additional sequences may, for examples, comprise a promoter, an enhancer, intron sequences (e.g., before after or with in the DN RTEF-I coding region) or a polyadenylation signal sequence.
  • sequences included in an expression cassette may be used to alter the expression characteristics of a DN RTEF-I.
  • cell type specific, conditional or inducible promoter sequences may be used to restrict DN RTEF-I to selected cell types or growth conditions.
  • a hypoxia inducible promoter may be used in RTEF-I expression cassettes of the invention.
  • promoters with enhanced activity in cancer cells or cells of the eye may be employed.
  • certain alterations may be made to the RTEF-I polypeptide sequence in order to enhance expression from an expression cassette for example, as exemplified herein, the initiation codon of a DN RTEF-I may be changes to ATG to facilitate efficient translation.
  • a DN RTEF-I coding sequence may be comprised in an expression vector such as a viral expression vector.
  • Viral expression vectors for use according to the invention include but are not limited to adenovirus, adeno-associated virus, herpes virus, SV-40, retrovirus and vaccinia virus vector systems.
  • a retroviral vector may be further defined as a lentiviral vector.
  • such lentiviral vectors may be self-inactivating (SIN) lentiviral vector such as those described in U.S. Applns. 20030008374 and 20030082789 incorperated herein by reference.
  • the present invention concerns methods for reducing or inhibiting RTEF-I dependent transcriptional activity.
  • RTEF-I dependent transcriptional activity refers to transcription that is mediated or enhanced by expression of an full length or fully active RTEF-I polypeptide, as exemplified by SEQ ID NO:1, SEQ ID NO: 2 or SEQ ID NO:4.
  • the invention provides methods for inhibiting or reducing VEGF promoter activity (and thereby VEGF expression) comprising expressing a DN RTEF- 1 polypeptide in a cell.
  • a method for treating a patient with an angiogenic disorder comprising administering to the patient an effective amount of a therapeutic composition comprising a RTEF-I dominant negative polypeptide or a nucleic acid expression vector encoding a RTEF- 1 dominant negative polypeptide as described supra.
  • a therapeutic composition comprising a RTEF-I dominant negative polypeptide or a nucleic acid expression vector encoding a RTEF- 1 dominant negative polypeptide as described supra.
  • methods described herein may used to treat a human patient.
  • angiogenic disorder refers to disorders involving a undesirable vascularization such as ocular neovascularization, arteriovenous malformations, coronary restenosis, peripheral vessel restenosis, glomerulonephritis, rheumatoid arthritis or cancer ⁇ e.g., tumor vascularization).
  • methods of the invention may be used to treat ocular disorders such as macular degeneration ⁇ e.g., age-related macular degeneration (AMD)), corneal graft rejection, corneal neovascularization, retinopathy of prematurity (ROP) and diabetic retinopathy.
  • AMD age-related macular degeneration
  • ROP retinopathy of prematurity
  • methods of the invention may be used in the treatment of wet or dry AMD.
  • methods of the invention may be used to treat a number AMD associated ocular lesions such as predominantly classic, minimally classic, and occult with no classic lesions (Gragoudas et al, 2004).
  • additional antiangiogenic therapies may be used in combination or in conjunction with methods of the invention. Such additional therapies may be administered before, after or essentially simultaneously with the methods descried herein.
  • additional antiangiogenic therapies may antagonize the VEGF and/or FGF signaling pathway.
  • additional therapy may comprise administration an antibody that binds to VEGF, a VEGF receptor, FGF or an FGF receptor.
  • methods and compositions of the invention may be used in conjunction with AVASTIN ® (bevacizumab), LUCENTIS ® (ranibizumab), MACUGEN ® (pegaptanib sodium) or an anti-inflammatory drug.
  • a therapeutic composition comprising a DN-RTEF-I composition and bevacizumab or pegaptanib sodium in a pharmaceutically acceptable carrier.
  • a gene that regulates angiogenesis may be delivered in conjunction with the methods of the invention.
  • a gene that regulates angiogenesis may be a tissue inhibitor of metalloproteinase, endostatin, angiostatin, endostatin XVIII, endostatin XV, kringle 1-5, PEX, the C-terminal hemopexin domain of matrix metalloproteinase-2, the kringle 5 domain of human plasminogen, a fusion protein of endostatin and angiostatin, a fusion protein of endostatin and the kringle 5 domain of human plasminogen, the monokine-induced by interferon- gamma (Mi g), the interferon- alpha inducible protein 10 (IPlO), a fusion protein of Mi g and IPlO, soluble FLT-I (fins-like tyrosine kinase 1 receptor), and kinase insert domain receptor (KDR) gene.
  • an angiogenic regulator gene may be delivered in a
  • the invention provides methods for treating cancer.
  • described methods may be used to limit or reduce blood flow to a tumor thereby reducing tumor growth or metastasis, hi certain cases, the methods herein may be used to inhibit or treat metastatic cancers.
  • a variety of cancer types may be treated with methods of the invention, for example a cancer for treatment may be a bladder, blood, bone, bone marrow, brain, breast, colon, esophagus, eye, gastrointestinal, gum, head, kidney, liver, lung, nasopharynx, neck, ovary, prostate, skin, stomach, testis, tongue, or uterus cancer.
  • additional anticancer therapies may be used in combination or in conjunction with methods of the invention. Such additional therapies may be administered before, after or concomitantly with methods of the invention.
  • an additional anticancer therapy may be a chemotherapy, surgical therapy, an immunotherapy or a radiation therapy.
  • DN RTEF-I compositions of the invention may be administered to a patient locally or systemically.
  • methods of the invention may involve administering a DN RTEF-I composition topically, intravenously, intradermally, intraarterially, intraperitoneally, intralesionally, intracranially, intraarticularly, intraprostaticaly, intrapleurally, intratracheally, intraocularly, intranasally, intravitreally, intravaginally, intrarectally, intramuscularly, intraperitoneally, subcutaneously, subconjunctival, intravesicularlly, mucosally, intrapericardially, intraumbilically, intraocularally, orally, by inhalation, by injection, by infusion, by continuous infusion, by localized perfusion bathing target cells directly, via a catheter, or via a lavage.
  • a DN RTEF-I composition is delivered to the eye, administration may be, for example, via topical, subconjunctival, periocular, retrobulbar, subtenon, intracameral, intravitreal, intraocular, subretinal, posterior juxtascleral or suprachoroidal administration.
  • a DN RTEF-I composition may be administered locally to the eye by intraocular injection, topical administration (e.g., in an eye drop formulation).
  • a pharmaceutical composition of the invention comprised in a bottle said bottle comprising an exit portal that enables drop-wise administration of the composition.
  • a pharmaceutical composition comprised in a bottle comprises multiple doses however in certain aspects a bottle comprises a single dose unit for administration to one or two eyes, preferable a single dose unit is comprised in 1-2 drops of the formulation.
  • the term "bottle” refers to any fluid container such as an ampoule, dropper or syringe.
  • Embodiments discussed in the context of a methods and/or composition of the invention may be employed with respect to any other method or composition described herein. Thus, an embodiment pertaining to one method or composition may be applied to other methods and compositions of the invention as well.
  • FIG. IA-B RTEF-I mRNA splicing is altered during hypoxia. Retinal and iris endothelial cells were placed under hypoxic conditions and RTEF-I splicing was analyzed by RT-PCR.
  • FIG. IA A schematic representation of the RTEF-I splice variants identified by RT-PCR. Exon sequence for the untranslated region (diagonal hatching) and amino acid coding region (open boxes) of each splice variant is shown.
  • FIG. IB A reproduction of agarose gel electrophoresis showing RTEF-I specific RT-PCR products prepared from primary cultures of human retinal vascular endothelial cells (RVEC).
  • Lanes 1 & 4 DNA ladder; Lane 2: cDNA prepared from RVEC under normoxic conditions gave 2 products (1305 & 936bp in size); Lane 3: cDNA prepared from RVEC under hypoxic conditions gave 3 products (1305, 936 & 447bp in size).
  • FIG. 2 RTEF-I variants activate or repress the VEGF promoter.
  • 293T cells were transfected with VEGF promoter reporter construct (VEGF promoter driving secreted alkaline phosphotase) along with an expression vector comprising the indicated RTEF-I variant.
  • Results show AP activity in the media was 6 hours post transfection with pSEAP-VEGF promoter plus pcDNA expression constructs comprising the 1305 bp (lane 1), 936 bp (lane 2), 651 bp (lane 3), ss-651-RMR bp (lane 6) or 447 bp (lane 4) RTEF-I variants.
  • Lane five shows control VEGF promoter activity when cotransfected with an insert-less pcDNA control plasmid.
  • FIG. 3 RTEF-I modulation of VEGF promoter activity is dependent on a portion of the VEGF promoter comprising 4 SPl binding sites.
  • Cells were transfected as described above with pcDNA expression constructs comprising the 1305 bp (lane 1), 936 bp (lane 2), 651 bp (lane 3), ss-651 bp (lane 6) or 447 bp (lane 4) RTEF-I variants and a reporter vector comprising the intact VEGF promoter (solid boxes) or a VEGF promoter with a deletion from nucleotide -113 to -57 (open boxes). Lane five shows control VEGF promoter activity when cotransfected with an insert- less pcDNA control plasmid.
  • FIG. 4 The 651bp RTEF-I acts as a dominant negative.
  • Cells were transfected as described above with pSEAP-VEGF and the 1305 bp (lanes 1, 2), the 936 bp (lanes 3, 4) or the 447 bp (lane 5, 6) RTEF-I variant either alone (lanes 1, 3 and 5) or in addition to the ss-651 -RMR bp RTEF-I variant (lanes 2, 4 and 6).
  • FIG. 5A-C Detection of RTEF-I polypeptides. Antibodies were raised against an amino acid sequence unique to RTEF-I but shared by each of the naturally occurring variants.
  • FIG. 5A is a amino acid alignment between a region of RTEF-I and related transcription factors. The amino acid sequence used for antibody production is underlined.
  • FIG. 5B a reproduction of an immunoblot using anti- RTEF-I antibodies.
  • Cells lysates used for analysis were from cell transfected with a pcDNA empty vector (lanes 2 and 8) or a pcDNA expression vector for the 1305 bp (lanes 3, 9), 936 bp (lanes 4, 10), 651 bp (lanes 5, 11) or 447 bp (lanes 6, 11) RTEF-I variant. Detection of the each RTEF-I variant is indicated by the ellipses. Lanes 1 and 7 are molecular mass markers. Lanes 1-6 represent an overexposure of the image from lanes 7-12. FIG.
  • FIG. 6A-B Expression of RTEF-I variants in the eye.
  • FIG. 6A a reproduction of an immunoblot showing RTEF-I expression in normal primate eye tissue. Immunoblot analysis was performed on protein from retina (lane 1), choroid (lane 2) and iris (lane 3) tissue lysates. M indicates a molecular mass markers.
  • FIG. 6B a reproduction of an ethidium bromide stained agarose gel used to visualize semiquantitative RT-PCR productions generated using RTEF-I specific primers. Lane 1 shows results from CRAO retina RNA while lane 2 shows results from control retinal RNA.
  • FIG. 7A-D Immunohistochemistry analysis of RTEF-I expression in primate eye tissue.
  • FIG. 7A-B Strong staining for RTEF-I appears localized to iris (I), ciliary body (CB), optic nerve (ON) and retina (R). The cornea (C) and lens (L) were negative for RTEF-I antibody hybridization.
  • FIG. 7C-D The strongest RTEF-I staining is in the ganglion cell layer (GCL) and the inner nuclear layer (INL). Staining appears to be localized to both the cytoplasm and nucleus. Staining is scarce in the outer layers.
  • VEGF vascular endothelial growth factor
  • the instant invention provides a dominant negative transcription factor that is integral in VEGF activation.
  • the instant invention concerns the targeting of an intracellular processes, therapeutics of the invention may be targeted to specific cell types thereby reducing undesirable systemic side effects.
  • the instant inventions offers new methods to treat angiogenic disorders and/or ways to enhance the effectiveness of current VEGF blockade strategies.
  • RTEF-I a member of a family of multifunctional transcription factors and has been shown to be an activator of VEGF transcription, including hypoxia induced VEGF transcription.
  • multiple splice variants of RTEF-I are produced in cells and RTEF-I polypeptides produced from alternative RNA splice variants comprise altered transcriptional function (FIG. IA, B).
  • RTEF-I transcript of approximately 651 base pairs produces a polypeptide that inhibits VEGF promoter activity (FIG. 2, compare lanes 3 and 5).
  • this RTEF-I variant was shown to be an even more effective inhibitor of the VEGF promoter when provided as a fusion protein with a secretion signal and cell internalization polypeptide FIG. 2 lane 6).
  • the polypeptide from the 651 bp RTEF-I transcript acts in a dominant negative. That is the polypeptide not only reduces VEGF promoter activity but also blocks VEGF promoter enhancement by a other RTEF-I protein isoforms.
  • RTEF is expressed in the tissues of the eye thereby implicating its importance in the development of ocular neovascular disorders. Studies here indicate that RTEF-I activation of VEGF production may for one factor that contributes to the development of neovascular disorders.
  • methods and compositions of the invention may provide a means for preventing the early stages of neovascularization.
  • the instant invention provides the basis for new DN RTEF-I polypeptides and the use thereof to prevent or inhibit angiogenic disorders.
  • DN RTEF-I polypeptides may delivered directly to the intra cellular milieu or expressed in targeted cells to blockade VEGF production.
  • Such dominate negative polypeptides down regulate not only nascent VEGF production but also production of VEGF that is normally stimulated by RTEF-I such bas during hypoxia.
  • compositions of the invention may be used to reduce the ability of targeted cells and tissues to recruit new blood vessel formation. This is of great interest in, for example, ocular neovascular disorders such as AMD where the invasion of blood vessels is directly related to the pathogenesis of the disease.
  • DN RTEF-I may be used to treat tumors or tumor metastases by reducing their ability to gain nutrients through new blood vessel formation.
  • methods to slow tumor growth and/or induce tumor regression are also provided.
  • compositions of the invention target intracellular transcription apprentice compositions of the invention may be used to target effected tissues by used of specific cell targeting/internalization moieties thereby reducing the side effects in other non-targeted tissues.
  • RTEF-I variants are described and functionally characterized herein.
  • the four sequence specifically studied here comprise the following amino acid sequences.
  • SEQ ID NO: 1 encoded by a 1305bp RTEF-I human cDNA is a 434 amino acid protein having the sequence:
  • SEQ ID NO: 2 encoded a 936bp human cDNA is a 311 amino acid protein having the sequence:
  • SEQ ID NO: 3 encoded by a 651bp human cDNA is a 216 amino acid protein having the sequence:
  • SEQ ID NO: 4 encoded by a 447bp human cDNA is a 148 amino acid protein having the sequence:
  • a dominant negative (DN) RTEF-I polypeptide may comprise one or more internal amino acid deletions.
  • DN RTEF-I may comprise a deletion of amino acids encoded by exons 3, 4, 5, 6, 7, 8, 9 or 10.
  • a DN- RTEFl comprises the amino acid sequence of SEQ ID NO: 3 or a derivative thereof.
  • DQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSG (SEQ ID NO: 8)
  • VKPFSQQTYAVQPPLPLPG* (SEQ ID NO: 10)
  • DN RTEF-I polypeptides may be further modified by one or more amino substitutions while maintaining their transcriptional functions.
  • amino acid substitutions can be made at one or more positions wherein the substitution is for an amino acid having a similar hydrophilicity.
  • the importance of the hydropathic amino acid index in conferring interactive biologic function on a protein is generally understood in the art (Kyte & Doolittle, 1982).
  • Patent 4,554,101 the following hydrophilicity values have been assigned to amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.0 ⁇ 1); glutamate (+3.0 ⁇ 1); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); threonine (- 0.4); proline (-0.5 ⁇ 1); alanine ( 0.5); histidine -0.5); cysteine (-1.0); methionine (- 1.3); valine (-1.5); leucine (-1.8); isoleucine (-1.8); tyrosine ( 2.3); phenylalanine (- 2.5); tryptophan (-3.4).
  • any of the DN RTEF-I polypeptides described herein may be modified by the substitution of an amino acid, for different, but homologous amino acid with a similar hydrophilicity value. Amino acids with hydrophilicities within +/- 1.0, or +/- 0.5 points are considered homologous.
  • Cell internalization moieties for use herein may be any molecule in complex (covalently or non-covalently) with a DN RTEF-I that mediate transport of the DN RTEF-I across a cell membrane.
  • Such internalization moieties may be peptides, polypeptides, hormones, growth factors, cytokines, aptamers or avimers.
  • cell internalization moiety may mediate non-specific cell internalization or be a cell targeting moiety that is internalized in a subpopulation of targeted cells.
  • cell targeting moieties for use in the current invention are antibodies.
  • the term antibody includes, but is not limited to, polyclonal antibodies, monoclonal antibodies, single chain antibodies, humanized antibodies, minibodies, dibodies, tribodies as well as antibody fragments, such as Fab', Fab, F(ab')2, single domain antibodies and any mixture thereof, hi some cases it is preferred that the cell targeting moiety is a single chain antibody (scFv).
  • the cell targeting domain may be an avimer polypeptide. Therefore, in certain cases the cell targeting constructs of the invention are fusion proteins comprising a DN RTEF-I and a scFv or an avimer. In some very specific embodiments the cell targeting construct is a fusion protein comprising DN RTEF-I polypeptide fused to a single chain antibody.
  • a cell targeting moieties may be a growth factor.
  • transforming growth factor epidermal growth factor, insulin-like growth factor, fibroblast growth factor, B lymphocyte stimulator (BLyS), heregulin, platelet-derived growth factor, vascular endothelial growth factor (VEGF), or hypoxia inducible factor
  • B lymphocyte stimulator B lymphocyte stimulator
  • VEGF vascular endothelial growth factor
  • hypoxia inducible factor may be used as a cell targeting moiety according to the invention.
  • These growth factors enable the targeting of constructs to cells that express the cognate growth factor receptors.
  • VEGF can be used to target cells that express FLK-I and/or FIt-I.
  • the cell targeting moiety may be a polypeptide BLyS (see U.S. Appln. 20060171919).
  • a cell targeting moiety may be a hormone.
  • hormones for use in the invention include, but are not limited to, human chorionic gonadotropin, gonadotropin releasing hormone, an androgen, an estrogen, thyroid-stimulating hormone, follicle-stimulating hormone, luteinizing hormone, prolactin, growth hormone, adrenocorticotropic hormone, antidiuretic hormone, oxytocin, thyrotropin-releasing hormone, growth hormone releasing hormone, corticotropin-releasing hormone, somatostatin, dopamine, melatonin, thyroxine, calcitonin, parathyroid hormone, glucocorticoids, mineralocorticoids, adrenaline, noradrenaline, progesterone, insulin, glucagon, amylin, erythropoitin, calcitriol, calciferol, atrial-natriuretic peptide, gastrin, secretin
  • cell targeting moieties may be cytokines.
  • cytokines ILl, IL2, IL3, IL4, IL5, IL6, IL7, IL8, IL9, ILlO, ILI l, IL12, IL13, IL14, IL15, IL-16, IL-17, IL-18, granulocyte-colony stimulating factor, macrophage-colony stimulating factor, granulocyte-macrophage colony stimulating factor, leukemia inhibitory factor, erythropoietin, granulocyte macrophage colony stimulating factor, oncostatin M, leukemia inhibitory factor, IFN- ⁇ , IFN- ⁇ , IFN- ⁇ , LT- ⁇ , CD40 ligand, Fas ligand, CD27 ligand, CD30 ligand, 4-1BBL, TGF- ⁇ , IL l ⁇ , IL-I ⁇ , IL-I RA, MIF and IGIF may be granulocyte-colony
  • a cell targeting moiety of the invention may be a cancer cell targeting moiety. It is well known that certain types of cancer cells aberrantly express surface molecules that are unique as compared to surrounding tissue. Thus, cell targeting moieties that bind to these surface molecules enable the targeted delivery of DN RTEF-I specifically to the cancers cells.
  • a cell targeting moiety may bind to and be internalized by a lung, breast, brain, prostate, spleen, pancreatic, cervical, ovarian, head and neck, esophageal, liver, skin, kidney, leukemia, bone, testicular, colon or bladder cancer cell.
  • cancer cell targeted DN RTEF-I may, in some cases, be contingent upon the expression or expression level of a particular cancer marker on the cancer cell.
  • a method for treating a cancer with targeted DN RTEF-I comprising determining whether (or to what extent) the cancer cell expresses a particular cell surface marker and administering DN RTEF-I targeted therapy (or another anticancer therapy) to the cancer cells depending on the expression level of a marker gene or polypeptide.
  • cell targeting moieties according to the invention may be, for example, an antibody.
  • a cell targeting moiety according the invention may bind to a skin cancer cell such as a melanoma cell. It has been demonstrated that the gp240 antigen is expressed in variety of melanomas but not in normal tissues.
  • a cell targeting construct comprising an DN RTEF-I and a cell targeting moiety that binds to gp240.
  • the g ⁇ 240 binding molecule may be an antibody, such as the ZME-Ol 8 (225.28S) antibody or the 9.2.27 antibody.
  • the g ⁇ 240 binding molecule may be a single chain antibody such as the scFvMEL antibody.
  • cell targeting constructs may be directed to breast cancer cells.
  • cell targeting moieties that bind to Her-2/neu such as anti-Her-2/neu antibodies may conjugated to a DN RTEF-I.
  • cell targeting constructs are fusion proteins comprising the single chain anti-Her-2/neu antibody scFv23 and DN RTEF-I.
  • Other scFv antibodies such as scFv(FRP5) that bind to Her-2/neu may also be used in the compositions and methods of the current invention (von Minckwitz et al, 2005).
  • cancer cell targeting moieties according to invention may have the ability to bind to multiple types of cancer cells.
  • the 8H9 monoclonal antibody and the single chain antibodies derived therefrom bind to a glycoprotein that is expressed on breast cancers, sarcomas and neuroblastomas (Onda et al, 2004).
  • Another example are the cell targeting agents described in U.S. Appln. 2004005647 and in Winthrop et al, 2003 that bind to MUC-I an antigen that is expressed on a variety cancer types.
  • cell targeting constructs according the invention may be targeted against a plurality of cancer or tumor types.
  • Polyclonal antibodies generally are raised in animals by multiple subcutaneous (sc) or intraperitoneal (ip) injections of the antigen.
  • antigen refers to any polypeptide that will be used in the production of a antibodies.
  • Antigens for use according to the instant invention include in certain instances, cancer cell surface marker polypeptides and eye specific cell surface markers.
  • a protein that is immunogenic in the species to be immunized e.g. keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin, or soybean trypsin inhibitor
  • a bifunctional or derivatizing agent for example maleimidobenzoyl
  • Monoclonal antibodies are obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally-occurring mutations that may be present in minor amounts. Thus, the modifier "monoclonal" indicates the character of the antibody as not being a mixture of discrete antibodies.
  • monoclonal antibodies of the invention may be made using the hybridoma method first described by Kohler & Milstein (1975), or may be made by recombinant DNA methods (U.S. Patent 4,816,567).
  • lymphocytes that produce or are capable of producing antibodies that will specifically bind to the protein used for immunization.
  • lymphocytes may be immunized in vitro. Lymphocytes then are fused with myeloma cells using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell (Goding 1986).
  • the hybridoma cells thus prepared are seeded and grown in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells.
  • a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells.
  • the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (HAT medium), which substances prevent the growth of HGPRT-deficient cells.
  • Preferred myeloma cells are those that fuse efficiently, support stable high level expression of antibody by the selected antibody-producing cells, and are sensitive to a medium such as HAT medium.
  • preferred myeloma cell lines are murine myeloma lines, such as those derived from MOPC-21 and MPC-I l mouse tumors available from the SaIk Institute Cell Distribution Center, San Diego, Calif. USA, and SP-2 cells available from the American Type Culture Collection, Rockville, Md. USA.
  • Culture medium in which hybridoma cells are growing is assayed for production of monoclonal antibodies directed against the target antigen.
  • the binding specificity of monoclonal antibodies produced by hybridoma cells is determined by immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA) or enzyme-linked immunoabsorbent assay (ELISA).
  • RIA radioimmunoassay
  • ELISA enzyme-linked immunoabsorbent assay
  • the binding affinity of the monoclonal antibody can, for example, be determined by the Scatchard analysis of Munson & Pollard (1980).
  • the clones may be subcloned by limiting dilution procedures and grown by standard methods, Goding (1986). Suitable culture media for this purpose include, for example, Dulbecco's Modified Eagle's Medium or RPMI- 1640 medium.
  • the hybridoma cells may be grown in vivo as ascites tumors in an animal.
  • the monoclonal antibodies secreted by the subclones are suitably separated from the culture medium, ascites fluid, or serum by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
  • DNA encoding the monoclonal antibodies of the invention is readily isolated and sequenced using conventional procedures ⁇ e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies).
  • the hybridoma cells of the invention serve as a preferred source of such DNA.
  • the DNA may be placed into expression vectors, which are then transfected into host cells such as simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells.
  • the DNA also may be modified, for example, by substituting the coding sequence for human heavy and light chain constant domains in place of the homologous murine sequences, Morrison et al. (1984), or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non- immunoglobulin polypeptide.
  • “chimeric” or “hybrid” antibodies are prepared that have the binding specificity for any particular antigen described herein.
  • non-immunoglobulin polypeptides are substituted for the constant domains of an antibody of the invention, or they are substituted for the variable domains of one antigen-combining site of an antibody of the invention to create a chimeric bivalent antibody comprising one antigen-combining site having specificity for the target antigen and another antigen-combining site having specificity for a different antigen.
  • Chimeric or hybrid antibodies also may be prepared in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents.
  • immunotoxins may be constructed using a disulfide exchange reaction or by forming a thioether bond. Examples of suitable reagents for this purpose include iminothiolate and methyl-4-mercaptobutyrimidate.
  • the antibodies of the invention typically will be labeled with a detectable moiety.
  • the detectable moiety can be any one which is capable of producing, either directly or indirectly, a detectable signal.
  • the detectable moiety may be a radioisotope, such as 3 H, 14 C, 32 P, 35 S, or 125 I, a fluorescent or chemiluminescent compound, such as fluorescein isothiocyanate, rhodamine, or luciferin; biotin; radioactive isotopic labels, such as, e.g., 3 H, 14 C, 32 P, 35 S, or 125 I, or an enzyme, such as alkaline phosphatase, beta-galactosidase or horseradish peroxidase.
  • any method known in the art for separately conjugating the antibody to the detectable moiety may be employed, including those methods described by Hunter et al. (1962); David et al. ⁇ 191 A); Pain et al. (1981); and Nygren (1982).
  • the antibodies of the present invention may be employed in any known assay method, such as competitive binding assays, direct and indirect sandwich assays, and immunoprecipitation assays (Zola, 1987).
  • Sandwich assays involve the use of two antibodies, each capable of binding to a different immunogenic portion, or epitope, of the protein to be detected.
  • the test sample analyte is bound by a first antibody which is immobilized on a solid support, and thereafter a second antibody binds to the analyte, thus forming an insoluble three part complex.
  • the second antibody may itself be labeled with a detectable moiety (direct sandwich assays) or may be measured using an antiimmunoglobulin antibody that is labeled with a detectable moiety (indirect sandwich assay).
  • sandwich assay is an ELISA assay, in which case the detectable moiety is an enzyme.
  • antibodies for use in the methods of the invention may be polyclonal or monoclonal antibodies or fragments thereof. However, in some aspects it is prefered that the antibodies are humanized such that they do not illict an immune respose in subject being treated. Methods for humanizing non-human antibodies are well known in the art. Generally, a humanized antibody has one or more amino acid residues introduced into it from a source which is non-human. These non-human amino acid residues are often referred to as "import" residues, which are typically taken from an "import” variable domain.
  • Humanization can be essentially performed following the method of Winter and co-workers (Jones et al, 1986); Riechmann et al, 1988; Verhoeyen et al, 1988), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody. Accordingly, such "humanized" antibodies are chimeric antibodies (Cabilly, supra), wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species. In practice, humanized antibodies are typically human antibodies in which some CDR residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies.
  • humanized antibodies are prepared by a process of analysis of the parental sequences and various conceptual humanized products using three dimensional models of the parental and humanized sequences. Three dimensional immunoglobulin models are commonly available and are familiar to those skilled in the art. Computer programs are available which illustrate and display probable three- dimensional conformational structures of selected candidate immunoglobulin sequences. Inspection of these displays permits analysis of the likely role of the residues in the functioning of the candidate immunoglobulin sequence, i.e.
  • Human monoclonal antibodies can be made by the hybridoma method. Human myeloma and mouse-human heteromyeloma cell lines for the production of human monoclonal antibodies have been described, for example, by Kozbor (1984) and Brodeur et al. (1987).
  • transgenic animals e.g. mice
  • transgenic animals e.g. mice
  • J H antibody heavy chain joining region
  • the phage display technology (McCafferty et al., 1990) can be used to produce human antibodies and antibody fragments in vitro, from immunoglobulin variable (V) domain gene repertoires from unimmunized donors.
  • V domain genes are cloned in-frame into either a major or minor coat protein gene of a filamentous bacteriophage, such as Ml 3 or fd, and displayed as functional antibody fragments on the surface of the phage particle.
  • a filamentous bacteriophage such as Ml 3 or fd
  • the phage mimicks some of the properties of the B-cell.
  • Phage display can be performed in a variety of formats; for their review see, e.g. Johnson et al. (1993).
  • V-gene segments can be used for phage display. Clackson et al. (1991) isolated a diverse array of anti-oxazolone antibodies from a small random combinatorial library of V genes derived from the spleens of immunized mice.
  • a repertoire of V genes from unimmunized human donors can be constructed and antibodies to a diverse array of antigens (including self-antigens) can be isolated essentially following the techniques described by Marks et al. (1991), or Griffith et al. (1993).
  • the instant invention concerns nucleic acid molecules encoding a DN RTEF-I polypeptide.
  • a DN RTEF-I nucleic acid sequence is comprised in a nucleic acid vector.
  • vector is used to refer to a carrier nucleic acid molecule into which a nucleic acid sequence can be inserted for introduction into a cell where it can be replicated.
  • a nucleic acid sequence can be "exogenous,” which means that it is foreign to the cell into which the vector is being introduced or that the sequence is homologous to a sequence in the cell but in a position within the host cell nucleic acid in which the sequence is ordinarily not found.
  • Vectors include plasmids, cosmids, viruses (bacteriophage, animal viruses, and plant viruses), and artificial chromosomes ⁇ e.g., YACs).
  • viruses bacteria, animal viruses, and plant viruses
  • artificial chromosomes ⁇ e.g., YACs.
  • One of skill in the art would be well equipped to construct a vector through standard recombinant techniques (see, for example, Maniatis et al, 1988 and Ausubel et al, 1994, both incorporated herein by reference).
  • expression vector refers to any type of genetic construct comprising a nucleic acid coding for a RNA capable of being transcribed. In some cases, RNA molecules are then translated into a protein, polypeptide, or peptide. In other cases, these sequences are not translated, for example, in the production of antisense molecules or ribozymes.
  • Expression vectors can contain a variety of "control sequences,” which refer to nucleic acid sequences necessary for the transcription and possibly translation of an operably linked coding sequence in a particular host cell. In addition to control sequences that govern transcription and translation, vectors and expression vectors may contain nucleic acid sequences that serve other functions as well and are described infra.
  • a “promoter” is a control sequence that is a region of a nucleic acid sequence at which initiation and rate of transcription are controlled. It may contain genetic elements at which regulatory proteins and molecules may bind, such as RNA polymerase and other transcription factors, to initiate the specific transcription a nucleic acid sequence.
  • the phrases "operatively positioned,” “operatively linked,” “under control,” and “under transcriptional control” mean that a promoter is in a correct functional location and/or orientation in relation to a nucleic acid sequence to control transcriptional initiation and/or expression of that sequence.
  • a promoter generally comprises a sequence that functions to position the start site for RNA synthesis.
  • the best known example of this is the TATA box, but in some promoters lacking a TATA box, such as, for example, the promoter for the mammalian terminal deoxynucleotidyl transferase gene and the promoter for the SV40 late genes, a discrete element overlying the start site itself helps to fix the place of initiation. Additional promoter elements regulate the frequency of transcriptional initiation. Typically, these are located in the region 30 110 bp upstream of the start site, although a number of promoters have been shown to contain functional elements downstream of the start site as well.
  • a coding sequence "under the control of a promoter, one positions the 5' end of the transcription initiation site of the transcriptional reading frame "downstream" of (i.e., 3' of) the chosen promoter.
  • the "upstream” promoter stimulates transcription of the DNA and promotes expression of the encoded RNA.
  • the spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another.
  • the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline.
  • individual elements can function either cooperatively or independently to activate transcription.
  • a promoter may or may not be used in conjunction with an "enhancer,” which refers to a cis-acting regulatory sequence involved in the transcriptional activation of a nucleic acid sequence.
  • a promoter may be one naturally associated with a nucleic acid sequence, as may be obtained by isolating the 5' non-coding sequences located upstream of the coding segment and/or exon. Such a promoter can be referred to as "endogenous.”
  • an enhancer may be one naturally associated with a nucleic acid sequence, located either downstream or upstream of that sequence.
  • certain advantages will be gained by positioning the coding nucleic acid segment under the control of a recombinant or heterologous promoter, which refers to a promoter that is not normally associated with a nucleic acid sequence in its natural environment.
  • a recombinant or heterologous enhancer refers also to an enhancer not normally associated with a nucleic acid sequence in its natural environment.
  • Such promoters or enhancers may include promoters or enhancers of other genes, and promoters or enhancers isolated from any other virus, or prokaryotic or eukaryotic cell, and promoters or enhancers not "naturally occurring," i.e., containing different elements of different transcriptional regulatory regions, and/or mutations that alter expression.
  • promoters that are most commonly used in recombinant DNA construction include the ⁇ lactamase (penicillinase), lactose and tryptophan (trp) promoter systems, hi addition to producing nucleic acid sequences of promoters and enhancers synthetically, sequences may be produced using recombinant cloning and/or nucleic acid amplification technology, including PCRTM, in connection with the compositions disclosed herein (see U.S. Patent Nos. 4,683,202 and 5,928,906, each incorporated herein by reference). Furthermore, it is contemplated the control sequences that direct transcription and/or expression of sequences within non-nuclear organelles such as mitochondria, chloroplasts, and the like, can be employed as well.
  • promoter and/or enhancer that effectively directs the expression of the DNA segment in the organelle, cell type, tissue, organ, or organism chosen for expression.
  • Those of skill in the art of molecular biology generally know the use of promoters, enhancers, and cell type combinations for protein expression, (see, for example Sambrook et al. 1989, incorporated herein by reference).
  • the promoters employed may be constitutive, tissue-specific, inducible, and/or useful under the appropriate conditions to direct high level expression of the introduced DNA segment, such as is advantageous in the large-scale production of recombinant proteins and/or peptides.
  • the promoter may be heterologous or endogenous.
  • any promoter/enhancer combination could also be used to drive expression.
  • Use of a T3, T7 or SP6 cytoplasmic expression system is another possible embodiment.
  • Eukaryotic cells can support cytoplasmic transcription from certain bacterial promoters if the appropriate bacterial polymerase is provided, either as part of the delivery complex or as an additional genetic expression construct.
  • tissue-specific promoters or elements as well as assays to characterize their activity, is well known to those of skill in the art.
  • Nonlimiting examples of such regions include the human LIMK2 gene (Nomoto et al. 1999), the somatostatin receptor 2 gene (Kraus et. al, 1998), murine epididymal retinoic acid- binding gene (Lareyre et. al, 1999), human CD4 (Zhao-Emonet et. al, 1998), mouse alpha2 (XI) collagen (Tsumaki, et. al, 1998), DlA dopamine receptor gene (Lee, et. al, 1997), insulin-like growth factor II (Wu et. al, 1997), and human platelet endothelial cell adhesion molecule-1 (Almendro et. al, 1996).
  • a specific initiation signal also may be required for efficient translation of coding sequences. These signals include the ATG initiation codon or adjacent sequences. Exogenous translational control signals, including the ATG initiation codon, may need to be provided. One of ordinary skill in the art would readily be capable of determining this and providing the necessary signals. It is well known that the initiation codon must be "in-frame" with the reading frame of the desired coding sequence to ensure translation of the entire insert. The exogenous translational control signals and initiation codons can be either natural or synthetic. The efficiency of expression may be enhanced by the inclusion of appropriate transcription enhancer elements.
  • IRES elements are used to create multigene, or polycistronic, messages.
  • IRES elements are able to bypass the ribosome scanning model of 5' methylated Cap dependent translation and begin translation at internal sites (Pelletier and Sonenberg, 1988).
  • IRES elements from two members of the picornavirus family polio and encephalomyocarditis have been described (Pelletier and Sonenberg, 1988), as well an IRES from a mammalian message (Macejak and Sarnow, 1991).
  • IRES elements can be linked to heterologous open reading frames. Multiple open reading frames can be transcribed together, each separated by an IRES, creating polycistronic messages.
  • each open reading frame is accessible to ribosomes for efficient translation.
  • Multiple genes can be efficiently expressed using a single promoter/enhancer to transcribe a single message (see U.S. Patent Nos. 5,925,565 and 5,935,819, each herein incorporated by reference).
  • Vectors can include a multiple cloning site (MCS), which is a nucleic acid region that contains multiple restriction enzyme sites, any of which can be used in conjunction with standard recombinant technology to digest the vector (see, for example, Carbonelli et. al, 1999, Levenson et. al, 1998, and Cocea, 1997, incorporated herein by reference.)
  • MCS multiple cloning site
  • Restriction enzyme digestion refers to catalytic cleavage of a nucleic acid molecule with an enzyme that functions only at specific locations in a nucleic acid molecule. Many of these restriction enzymes are commercially available. Use of such enzymes is widely understood by those of skill in the art.
  • a vector is linearized or fragmented using a restriction enzyme that cuts within the MCS to enable exogenous sequences to be ligated to the vector.
  • "Ligation” refers to the process of forming phosphodiester bonds between two nucleic acid fragments, which may or may not be contiguous with each other. Techniques involving restriction enzymes and ligation reactions are well known to those of skill in the art of recombinant technology.
  • RNA molecules will undergo RNA splicing to remove introns from the primary transcripts.
  • Vectors containing genomic eukaryotic sequences may require donor and/or acceptor splicing sites to ensure proper processing of the transcript for protein expression (see, for example, Chandler et. al, 1997, herein incorporated by reference.)
  • the vectors or constructs of the present invention will generally comprise at least one termination signal.
  • a “termination signal” or “terminator” is comprised of the DNA sequences involved in specific termination of an RNA transcript by an RNA polymerase.
  • a termination signal that ends the production of an RNA transcript is contemplated.
  • a terminator may be necessary in vivo to achieve desirable message levels.
  • the terminator region may also comprise specific DNA sequences that permit site-specific cleavage of the new transcript so as to expose a polyadenylation site. This signals a specialized endogenous polymerase to add a stretch of about 200 A residues (polyA) to the 3' end of the transcript. RNA molecules modified with this polyA tail appear to more stable and are translated more efficiently.
  • terminator comprises a signal for the cleavage of the RNA, and it is more preferred that the terminator signal promotes polyadenylation of the message.
  • the terminator and/or polyadenylation site elements can serve to enhance message levels and to minimize read through from the cassette into other sequences.
  • a polyadenylation signal may be the signal from neuropilin-1 as described in U.S. Appln. 20050175591.
  • Terminators contemplated for use in the invention include any known terminator of transcription described herein or known to one of ordinary skill in the art, including but not limited to, for example, the termination sequences of genes, such as for example the bovine growth hormone terminator or viral termination sequences, such as for example the SV40 terminator.
  • the termination signal may be a lack of transcribable or translatable sequence, such as due to a sequence truncation.
  • a vector in a host cell may contain one or more origins of replication sites (often termed "ori"), which is a specific nucleic acid sequence at which replication is initiated.
  • ori origins of replication sites
  • ARS autonomously replicating sequence
  • cells containing a nucleic acid construct of the present invention may be identified in vitro or in vivo by including a marker in the expression vector.
  • markers would confer an identifiable change to the cell permitting easy identification of cells containing the expression vector.
  • a selectable marker is one that confers a property that allows for selection.
  • a positive selectable marker is one in which the presence of the marker allows for its selection, while a negative selectable marker is one in which its presence prevents its selection.
  • An example of a positive selectable marker is a drug resistance marker.
  • a drug selection marker aids in the cloning and identification of transformants
  • genes that confer resistance to neomycin, puromycin, hygromycin, DHFR, GPT, zeocin and histidinol are useful selectable markers, hi addition to markers conferring a phenotype that allows for the discrimination of transformants based on the implementation of conditions, other types of markers including screenable markers such as GFP, whose basis is colorimetric analysis, are also contemplated.
  • screenable enzymes such as herpes simplex virus thymidine kinase (tk) or chloramphenicol acetyltransferase (CAT) may be utilized.
  • a plasmid vector is contemplated for use to transform a host cell.
  • plasmid vectors containing replicon and control sequences which are derived from species compatible with the host cell are used in connection with these hosts.
  • the vector ordinarily carries a replication site, as well as marking sequences which are capable of providing phenotypic selection in transformed cells, hi a non-limiting example, E. coli is often transformed using derivatives of pBR322, a plasmid derived from an E. coli species.
  • pBR322 contains genes for ampicillin and tetracycline resistance and thus provides easy means for identifying transformed cells.
  • the pBR plasmid, or other microbial plasmid or phage must also contain, or be modified to contain, for example, promoters which can be used by the microbial organism for expression of its own proteins.
  • phage vectors containing replicon and control sequences that are compatible with the host microorganism can be used as transforming vectors in connection with these hosts.
  • the phage lambda GEMTM 11 may be utilized in making a recombinant phage vector which can be used to transform host cells, such as, for example, E. coli LE392.
  • Further useful plasmid vectors include pIN vectors (Inouye et. al, 1985); and pGEX vectors, for use in generating glutathione S transferase (GST) soluble fusion proteins for later purification and separation or cleavage.
  • GST glutathione S transferase
  • Other suitable fusion proteins are those with ⁇ galactosidase, ubiquitin, and the like.
  • Bacterial host cells for example, E. coli, comprising the expression vector, are grown in any of a number of suitable media, for example, LB.
  • suitable media for example, LB.
  • the expression of the recombinant protein in certain vectors may be induced, as would be understood by those of skill in the art, by contacting a host cell with an agent specific for certain promoters, e.g., by adding EPTG to the media or by switching incubation to a higher temperature. After culturing the bacteria for a further period, generally of between 2 and 24 h, the cells are collected by centrifugation and washed to remove residual media.
  • DN RTEF-I components of the present invention may be a viral vector that encodes a DN RTEF-I pollypeptide.
  • virus vectors that may be used to deliver a nucleic acid of the present invention are described below.
  • a particular method for delivery of the nucleic acid involves the use of an adenovirus expression vector.
  • adenovirus vectors are known to have a low capacity for integration into genomic DNA, this feature is counterbalanced by the high efficiency of gene transfer afforded by these vectors.
  • "Adenovirus expression vector” is meant to include those constructs containing adenovirus sequences sufficient to (a) support packaging of the construct and (b) to ultimately express a tissue or cell specific construct that has been cloned therein.
  • Knowledge of the genetic organization or adenovirus, a 36 kb, linear, double stranded DNA virus allows substitution of large pieces of adenoviral DNA with foreign sequences up to 7 kb (Grunhaus and Horwitz, 1992).
  • the nucleic acid may be introduced into the cell using adenovirus assisted transfection. Increased transfection efficiencies have been reported in cell systems using adenovirus coupled systems (Kelleher and Vos, 1994; Cotten et. al, 1992; Curiel, 1994).
  • Adeno associated virus (AAV) is an attractive vector system for use in the delivery of DN RTEF-I expression cassettes of the present invention as it has a high frequency of integration and it can infect nondividing cells, thus making it useful for delivery of genes into mammalian cells, for example, in tissue culture (Muzyczka, 1992) or in vivo.
  • AAV has a broad host range for infectivity (Tratschin et. al, 1984; Laughlin et.
  • Retroviruses have promise as DN RTEF-I delivery vectors in therapeutics due to their ability to integrate their genes into the host genome, transferring a large amount of foreign genetic material, infecting a broad spectrum of species and cell types and of being packaged in special cell lines (Miller, 1992).
  • a nucleic acid ⁇ e.g., one encoding a DN RTEF-I
  • a packaging cell line containing the gag, pol, and env genes but without the LTR and packaging components is constructed (Mann et. al, 1983).
  • Retroviral vectors are able to infect a broad variety of cell types. However, integration and stable expression require the division of host cells (Paskind et. al., 1975).
  • Lentiviruses are complex retroviruses, which, in addition to the common retroviral genes gag, pol, and env, contain other genes with regulatory or structural function. Methods for delivery of antiangiogenic molecules with lentiviral vectors have been previously described, see for example U.S. Patent 7,122,181 incorporated herein by reference. Lentiviral vectors are well known in the art (see, for example, Naldini et. al, 1996; Zufferey et. al, 1997; Blomer et. al, 1997; U.S. Pat. Nos. 6,013,516 and 5,994,136).
  • lentivirus examples include the Human Immunodeficiency Viruses: HIV-I, HIV-2 and the Simian Immunodeficiency Virus: SrV.
  • Lentiviral vectors have been generated by multiply attenuating the HIV virulence genes, for example, the genes env, vif, vpr, vpu and nef are deleted making the vector biologically safe.
  • Recombinant lentiviral vectors are capable of infecting non-dividing cells and can be used for both in vivo and ex vivo gene transfer and expression of nucleic acid sequences.
  • recombinant lentivirus capable of infecting a non-dividing cell wherein a suitable host cell is transfected with two or more vectors carrying the packaging functions, namely gag, pol and env, as well as rev and tat is described in U.S. Pat. No. 5,994,136, incorporated herein by reference.
  • One may target the recombinant virus by linkage of the envelope protein with an antibody or a particular ligand for targeting to a receptor of a particular cell-type.
  • a sequence (including a regulatory region) of interest into the viral vector, along with another gene which encodes the ligand for a receptor on a specific target cell, for example, the vector is now target-specific.
  • viral vectors may be employed as vaccine constructs in the present invention.
  • Vectors derived from viruses such as vaccinia virus (Ridgeway, 1988; Baichwal and Sugden, 1986; Coupar et. al, 1988), Sindbis virus, cytomegalovirus and herpes simplex virus may be employed. They offer several attractive features for various mammalian cells (Friedmann, 1989; Ridgeway, 1988; Baichwal and Sugden, 1986; Coupar et. al, 1988; Horwich et. al, 1990).
  • a nucleic acid to be delivered may be housed within an infective virus that has been engineered to express a specific binding ligand.
  • the virus particle will thus bind specifically to the cognate receptors of the target cell and deliver the contents to the cell.
  • a novel approach designed to allow specific targeting of retrovirus vectors was developed based on the chemical modification of a retrovirus by the chemical addition of lactose residues to the viral envelope. This modification can permit the specific infection of hepatocytes via sialoglycoprotein receptors.
  • Suitable methods for nucleic acid delivery for transformation of an organelle, a cell, a tissue or an organism for use with the current invention are believed to include virtually any method by which a nucleic acid (e.g., DNA) can be introduced into an organelle, a cell, a tissue or an organism, as described herein or as would be known to one of ordinary skill in the art.
  • a nucleic acid e.g., DNA
  • Such methods include, but are not limited to, direct delivery of DNA such as by ex vivo transfection (Wilson et. al, 1989, Nabel et al, 1989), by injection (U.S. Patent Nos.
  • organelle(s), cell(s), tissue(s) or organism(s) may be stably or transiently transformed.
  • compositions for use in methods of the invention may be formulated into a pharmacologically acceptable format.
  • pharmaceutical or pharmacologically acceptable refers to molecular entities and compositions that do not produce an adverse, allergic or other untoward reaction when administered to an animal, such as, for example, a human, as appropriate.
  • the preparation of an pharmaceutical composition that contains at least one DN RTEF-I polypeptide or nucleic acid active ingredient will be known to those of skill in the art in light of the present disclosure, as exemplified by Remington's Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1990, incorporated herein by reference.
  • preparations should meet sterility, pyrogenicity, general safety and purity standards as required by FDA Office of Biological Standards.
  • pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, surfactants, antioxidants, preservatives (e.g., antibacterial agents, antifungal agents), isotonic agents, absorption delaying agents, salts, preservatives, drugs, drug stabilizers, gels, binders, excipients, disintegration agents, lubricants, sweetening agents, flavoring agents, dyes, such like materials and combinations thereof, as would be known to one of ordinary skill in the art (see, for example, Remington's Pharmaceutical Sciences, 18th Ed., 1990, incorporated herein by reference).
  • a pharmaceutically acceptable carrier is preferably formulated for administration to a human, although in certain embodiments it may be desirable to use a pharmaceutically acceptable carrier that is formulated for administration to a non- human animal, such as a canine, but which would not be acceptable (e.g., due to governmental regulations) for administration to a human. Except insofar as any conventional carrier is incompatible with the active ingredient, its use in the therapeutic or pharmaceutical compositions is contemplated.
  • the actual dosage amount of a composition of the present invention administered to a subject can be determined by physical and physiological factors such as body weight, severity of condition, the type of disease being treated, previous or concurrent therapeutic interventions, idiopathy of the patient and on the route of administration.
  • the practitioner responsible for administration will, in any event, determine the concentration of active ingredient(s) in a composition and appropriate dose(s) for the individual subject.
  • compositions may comprise, for example, at least about 0.1% of an active compound.
  • the an active compound may comprise between about 2% to about 75% of the weight of the unit, or between about 25% to about 60%, for example, and any range derivable therein.
  • a dose may also comprise from about 1 microgram/kg/body weight, about 5 microgram/kg/body weight, about 10 microgram/kg/body weight, about 50 microgram/kg/body weight, about 100 microgram/kg/body weight, about 200 microgram/kg/body weight, about 350 microgram/kg/body weight, about 500 microgram/kg/body weight, about 1 milligram/kg/body weight, about 5 milligram/kg/body weight, about 10 milligram/kg/body weight, about 50 milligram/kg/body weight, about 100 milligram/kg/body weight, about 200 milligram/kg/body weight, about 350 milligram/kg/body weight, about 500 milligram/kg/body weight, to about 1000 mg/kg/body weight or more per administration, and any range derivable therein.
  • a range of about 5 mg/kg/body weight to about 100 mg/kg/body weight, about 5 microgram/kg/body weight to about 500 milligram/kg/body weight, etc. can be administered, based on the numbers described above.
  • the compositions of the present invention are suitable for application to mammalian eyes.
  • the formulation may be a solution, a suspension, or a gel.
  • the composition is administered via a bioerodible implant, such as an intravitreal implant or an ocular insert, such as an ocular insert designed for placement against a conjunctival surface.
  • the therapeutic agent coats a medical device or implantable device.
  • the formulation of the invention will be applied to the eye in aqueous solution in the form of drops.
  • drops may be delivered from a single dose ampoule which may preferably be sterile and thus rendering bacteriostatic components of the formulation unnecessary.
  • the drops may be delivered from a multi-dose bottle which may preferably comprise a device which extracts preservative from the formulation as it is delivered, such devices being known in the art.
  • components of the invention may be delivered to the eye as a concentrated gel or similar vehicle which forms dissolvable inserts that are placed beneath the eyelids.
  • compositions of the present invention may be administered in the form of injectable compositions either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid prior to injection may also be prepared. These preparations also may be emulsified.
  • a typical composition for such purpose comprises a pharmaceutically acceptable carrier.
  • the composition may contain 10 mg, 25 mg, 50 mg or up to about 100 mg of human serum albumin per milliliter of phosphate buffered saline.
  • Other pharmaceutically acceptable carriers include aqueous solutions, non-toxic excipients, including salts, preservatives, buffers and the like.
  • non-aqueous solvents examples include propylene glycol, polyethylene glycol, vegetable oil and injectable organic esters such as ethyloleate.
  • Aqueous carriers include water, alcoholic/aqueous solutions, saline solutions, parenteral vehicles such as sodium chloride, Ringer's dextrose, etc.
  • Intravenous vehicles include fluid and nutrient replenishers.
  • Preservatives include antimicrobial agents, antioxidants, chelating agents and inert gases. The pH and exact concentration of the various components the pharmaceutical composition are adjusted according to well known parameters.
  • compositions are suitable for oral administration.
  • Oral formulations include such typical excipients as, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate and the like.
  • the compositions take the form of solutions, suspensions, tablets, pills, capsules, sustained release formulations or powders.
  • the route is topical, the form may be a cream, ointment, salve or spray.
  • an effective amount of the therapeutic composition is determined based on the intended goal.
  • unit dose or “dosage” refers to physically discrete units suitable for use in a subject, each unit containing a predetermined- quantity of the therapeutic composition calculated to produce the desired responses, discussed above, in association with its administration, i.e., the appropriate route and treatment regimen.
  • the quantity to be administered both according to number of treatments and unit dose, depends on the protection desired. Thus, in some case dosages can be determined by measuring for example changes in serum insulin or glucose levels of a subject.
  • Precise amounts of the therapeutic composition may also depend on the judgment of the practitioner and are peculiar to each individual. Factors affecting the dose include the physical and clinical state of the patient, the route of administration, the intended goal of treatment ⁇ e.g., alleviation of symptoms versus attaining a particular serum insulin or glucose concentration) and the potency, stability and toxicity of the particular therapeutic substance.
  • the compositions of the present invention are suitable for application to mammalian eyes.
  • the formulation may be a solution, a suspension, or a gel.
  • the composition is administered via a bioerodible implant, such as an intravitreal implant or an ocular insert, such as an ocular insert designed for placement against a conjunctival surface.
  • the therapeutic agent coats a medical device or implantable device.
  • the formulation of the invention will be applied to the eye in aqueous solution in the form of drops.
  • drops may be delivered from a single dose ampoule which may preferably be sterile and thus rendering bacteriostatic components of the formulation unnecessary.
  • the drops may be delivered from a multi-dose bottle which may preferably comprise a device which extracts preservative from the formulation as it is delivered, such devices being known in the art.
  • components of the invention may be delivered to the eye as a concentrated gel or similar vehicle which forms dissolvable inserts that are placed beneath the eyelids.
  • therapeutic methods of the invention may be used in combination or in conjunction with additional antiangiogenic or anticancer therapies.
  • DN RTEF-I is administered in conjunction with a chemo therapeutic agent.
  • a chemo therapeutic agent for example, cisplatin (CDDP), carboplatin, procarbazine, mechlorethamine, cyclophosphamide, camptothecin, ifosfamide, melphalan, chlorambucil, busulfan, nitrosurea, dactinomycin, daunorubicin, doxorubicin, bleomycin, plicomycin, mitomycin, etoposide (VP 16), tamoxifen, raloxifene, estrogen receptor binding agents, taxol, paclitaxel, gemcitabien, navelbine, farnesyl-protein tansferase inhibitors, transplatinum, 5- fluorouracil, vincristin, Velcade, vinblastin and methotrexate, or any analog or derivative variant of the foregoing may used in methods according to the invention.
  • CDDP
  • DN RTEF-I compositions may be used to sensitize cell to radiation therapy.
  • Radio therapy may include, for example, ⁇ -rays, X-rays, and/or the directed delivery of radioisotopes to tumor cells.
  • microwaves and/or UV-irradiation may also used according to methods of the invention.
  • Dosage ranges for X-rays range from daily doses of 50 to 200 roentgens for prolonged periods of time (3 to 4 wk), to single doses of 2000 to 6510 roentgens.
  • Dosage ranges for radioisotopes vary widely, and depend on the half-life of the isotope, the strength and type of radiation emitted, and the uptake by the neoplastic cells.
  • contacted and “exposed,” when applied to a cell are used herein to describe the process by which a therapeutic construct and a chemotherapeutic or radio therapeutic agent are delivered to a target cell or are placed in direct juxtaposition with the target cell.
  • both agents are delivered to a cell in a combined amount effective to kill the cell or prevent it from dividing.
  • Immunotherapeutics generally, rely on the use of immune effector cells and molecules to target and destroy cancer cells.
  • the immune effector may be, for example, an antibody specific for some marker on the surface of a tumor cell.
  • the antibody alone may serve as an effector of therapy or it may recruit other cells to actually effect cell killing.
  • the antibody also may be conjugated to a drug or toxin (chemotherapeutic, radionuclide, ricin A chain, cholera toxin, pertussis toxin, etc.) and serve merely as a targeting agent.
  • the effector may be a lymphocyte carrying a surface molecule that interacts, either directly or indirectly, with a tumor cell target.
  • Various effector cells include cytotoxic T cells and NK cells.
  • Immunotherapy thus, could be used as part of a combined therapy, in conjunction with gene therapy.
  • the general approach for combined therapy is discussed below.
  • the tumor cell must bear some marker that is amenable to targeting, i.e., is not present on the majority of other cells. Many tumor markers exist and any of these may be suitable for targeting in the context of the present invention.
  • Common tumor markers include carcinoembryonic antigen, prostate specific antigen, urinary tumor associated antigen, fetal antigen, tyrosinase (p97), gp68, TAG-72, HMFG, Sialyl Lewis Antigen, MucA, MucB, PLAP, estrogen receptor, laminin receptor, erb B, Her-2/neu, gp240 and pl55.
  • gene therapy in which a therapeutic polynucleotide is administered before, after, or at the same time as a cell targeting construct of the present invention.
  • Delivery of DN RTEF-I in conjunction with a vector encoding one or more additional gene products may have a combined anti- hyperproliferative effect on target tissues.
  • a variety of genes are encompassed within the invention, for example a gene encoding p53 may be delivered in conjunction with DN RTEF-I compositions.
  • Curative surgery is a cancer treatment that may be used in conjunction with other therapies, such as the treatment of the present invention, chemotherapy, radiotherapy, hormonal therapy, gene therapy, immunotherapy and/or alternative therapies.
  • a DN RTEF-I therapy of the invention may be employed alone or in combination with a cytotoxic therapy as neoadjuvant surgical therapy, such as to reduce tumor size prior to resection, or it may be employed as postadjuvant surgical therapy, such as to sterilize a surgical bed following removal of part or all of a tumor.
  • Curative surgery includes resection in which all or part of cancerous tissue is physically removed, excised, and/or destroyed.
  • Tumor resection refers to physical removal of at least part of a tumor, hi addition to tumor resection, treatment by surgery includes laser surgery, cryosurgery, electro surgery, and miscopically controlled surgery (Mohs' surgery). It is further contemplated that the present invention may be used in conjunction with removal of superficial cancers, precancers, or incidental amounts of normal tissue.
  • a cavity may be formed in the body.
  • Treatment may be accomplished by perfusion, direct injection or local application of the area with an additional anti-cancer therapy.
  • Such treatment may be repeated, for example, every 1, 2, 3, 4, 5, 6, or 7 days, or every 1, 2, 3, 4, and 5 weeks or every 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months.
  • These treatments may be of varying dosages as well.
  • Hormonal therapy may also be used in conjunction with the present invention or in combination with any other cancer therapy previously described.
  • the use of hormones may be employed in the treatment of certain cancers such as breast, prostate, ovarian, or cervical cancer to lower the level or block the effects of certain hormones such as testosterone or estrogen. This treatment is often used in combination with at least one other cancer therapy as a treatment option or to reduce the risk of metastases.
  • retinal and iris tissues were aseptically dissected and separated away from donor eyes, and digested in 0.2% collagenase (Sigma Chemical Co,, St Louis, MO) and endothelial cells (EC) were isolated from other cell types by using mouse monoclonal anti-human CD31 antibody-coated magnetic beads (Dynal Biotech, Inc., Lake Success, NY).
  • ECs were cultured in complete MCDB-131 medium (Clonetics/BioWhittaker, Walkersville, MD) supplemented with 10% fetal bovine serum and antibiotics. Cells were used at passages 2 to 5.
  • Retinal and iris endothelial cells were cultured to 80% confluence in 60mm diameter culture dishes and then placed in an air tight Modulator Incubator Chamber (Billups-Rothenberg, Del Mar, CA). A 1% O 2 , 5% CO 2 and remainder N 2 gas mix was flushed through the chamber for exactly 5 minutes whereupon the chamber was sealed and placed into a humidified 37 0 C incubator. After 8 hours the chamber was flushed again for 5 minutes with the hypoxic gas mix and sealed and incubated for a further 8 hours and then flushed again and incubated for another 8 hours at which point total RNA was isolated. Total RNA extraction and RT-PCR
  • Amplified products were subjected to electrophoresis and visualized in a 1.5% agarose gel and subsequently purified from the gel (Qiaquick Gel Extraction, Qiagen, Valencia, CA) for standard dideoxynucleotide sequencing on an Abi 310 automated sequencer.
  • RTEF-I isoforms were directionally cloned into the pcDNA 3.1 expression plasmid (Invitrogen, Carlsbad, CA). The predicted TTG start was converted to ATG within the forward primer sequence.
  • Human VEGF 5' proximal promoter fragment of l,136bp containing 54bp of 5'UTR and l,082bp upstream of the transcription start site was directionally cloned 5' to the secretable alkaline phosphatase (SEAP) gene within the pSEAP reporter plasmid (Clontech, Mountain View, CA).
  • SEAP secretable alkaline phosphatase
  • Promoter fragments with deletions were constructed by first amplifying the 5' end of the promoter and 3' end of the promoter and subsequent ligation of the amplified products. The ligated products lacking the region of interest were then amplified and directionally cloned into the promoterless pSEAP vector. All constructs were sequenced on both strands for verification prior to transfection studies.
  • Transfection was performed using the Amaxa Nucleofection Device (Amaxa Inc, Gaithersburg, MD), Amaxa reagents and standard manufacturer's protocol. Briefly, 293T cells were cultured in 10% DMEM media till 80% confluent, trypsinized and collected. One million cells was used per nucleofection. One million cells were resuspended in lOOul of Nucleofect solution and 5 ⁇ l (containing 2 ⁇ g) of total plasmid DNA, electroporated (program #A023 on Nucleofection Device) and then immediately resuspended in 1 ml of prewarmed media and seeded into a single well of a 6 well plate.
  • exon 5 lacking in the 447bp isoform, but an unusual in frame splice event occurs in the middle of exon 7 which splices out from Gln-83 in exon 7 to codon Gln-425 within exon 12 (FIG. IA).
  • exon 3 is spliced directly into an internal splice acceptor site in exon 10 thereby completely removing exons 4, 5, 6, 7, 8 and 9 from the transcript.
  • the 1305bp product shows identity to the transcriptional enhancer factor- 1 related (RTEF-I) gene originally identified in human cardiac, skeletal muscle, pancreas and lung tissue (Stewart et al, 1996).
  • RTEF-I transcriptional enhancer factor- 1 related
  • Two other RTEF isoforms, variant 2 (accession #NM_201441) which lack exon 5 from Asp-119 to GIy-161 and variant 3 (accession #NM_201443) which employs a downstream protein initiation site at Met-130, have previously been reported.
  • the 936bp, 651bp and 447bp isoforms identified within human ocular vascular cells have not been identified in any other human tissue to date.
  • the full length 1305 bp transcript encodes a polypeptide having 434 amino acids with a predicted molecule weight of -48.6 KDa.
  • This polypeptide comprises 50 strongly basic (K,R), 47 strongly acidic (D,E), 133 hydrophobic (A, I, L, F, W, V) and 124 polar (N, C, Q, S, T, Y) amino acids.
  • the predicted isoelectric point is 8.248 and the predicted charge is 4.799 at pH 7.0.
  • Each of the identified RTEF-I isoforms appear to utilize a non-canonical TTG (UUG) start codon resulting in an amino terminal lysine residue.
  • the 936 bp transcript encodes a polypeptide having 311 amino acids with a predicted molecule weight of -35.6 KDa.
  • This polypeptide comprises 40 strongly basic (K,R), 38 strongly acidic (D,E), 93 hydrophobic (A, I, L, F, W, V) and 92 polar (N, C, Q, S, T, Y) amino acids.
  • the predicted isoelectric point is 8.037 and the predicted charge is 3.458 at pH 7.0.
  • the 651 bp transcript encodes a polypeptide having 216 amino acids with a predicted molecule weight of -24.4 KDa.
  • This polypeptide comprises 22 strongly basic (K,R), 27 strongly acidic (D,E), 60 hydrophobic (A, I, L, F, W, V) and 71 polar (N, C, Q, S, T, Y) amino acids.
  • the predicted isoelectric point is 6.039 and the predicted charge is -4.046 at pH 7.0.
  • the 651bp isoform is spliced in frame from within ex on 3 after Thr-92 into the middle of exon 10 at Ser-311 (all numbering based in the largest RTEF-I isoform (SEQID NO: I)).
  • the 651bp isoform contains all of exon 2, most of exon 3 (lacks 5 of the 22 amino acids in exon 3), most of exon 10 (lacks the first 11 amino acids of exon 10) and complete exons 11 and 12. This results in retention of most of the TEA binding domain but with loss of one of the 3 predicted ⁇ -helices and the putative nuclear localization signal (Leu- 105 to Lys-109) normally contained within the 72 amino acid TEA domain.
  • the Proline Rich Domain (PRD), activation domain and the first STY domain (Ser-253 to Ser-271) is also lacking in the 651bp isoform.
  • the splice event into exon 10 starts at Ser- 11 within this exon (i.e., the 11 th amino acid in exon 10) which is the very start of the second STY domain (Ser-253 to Ser-336).
  • This splice event results in fusion of a partial TEA domain, lacking a putative nuclear localization signal, directly with a STY domain.
  • the 447 bp transcript encodes a polypeptide having 148 amino acids with a predicted molecule weight of -16.5 KDa.
  • This polypeptide comprises 22 strongly basic (K,R), 17 strongly acidic (D 5 E), 43 hydrophobic (A, I, L, F, W, V) and 40 polar (N, C, Q, S, T, Y) amino acids.
  • the predicted isoelectric point is 9.444 and the predicted charge is 5.561 at pH 7.0.
  • the predicted protein sequence for both the 936bp and 447bp isoforms contain the 72 amino acid TEA domain (Asp-38 to Lys-109) which contains 3 predicted ⁇ -helices and a putative nuclear localization signal (Leu- 105 to Lys-109). However within the C-terminal domain a proline rich-domain (Pro- 189 to Pro-213) spanning the last 6 amino acids of exon 7 and the first 19 residues of exon 8 is missing from the 447bp isoform (FIG. IA).
  • the polypeptide resulting from the 1305bp isoform acts as a transcriptional stimulator of VEGF, in bovine aortic endothelial cells, via binding to a SpI site (Shie et al, 2004).
  • the 5' proximal promoter of the human VEGF gene consisting of 54bp of 5'UTR and l,082bp upstream of the transcription initiation site was cloned into a pSEAP reporter plasmid and the RTEF-I isoforms were cloned into a pcDNA expression vector.
  • the 651bp isoform (lane 3, FIG. 2) inhibited expression approximately 3 -fold lower than expression observed in the control, whereas the SS-651bp-RMR version (lane 6, FIG.
  • the ss-651-RMR bp RTEF-I comprises the coding region for the 651bp isoform of RTEF-I fused at the N-terminus to the human IL-2 secretion signal sequence (SEQ ID NO:22) and fused at the C-terminus to the internalization moiety (SEQ ID NO:23). This created the "ss-651-RMR" product, which is secretable from expressing cells and importable into surrounding cells.
  • the 651bp isoform remains able to inhibit expression relative to the control in the absence of the SpI sites within the VEGF promoter.
  • regulation of VEGF promoter is the same for each isoform is the same regardless of whether SpI elements are present or not.
  • the 651bp fragment is capable of inhibiting the enhancer effect of the 1305bp, 936bp and 447bp isoforms from the VEGF promoter in a competitive manner. That is, introducing increased amounts of 651bp in conjunction with any of the other enhancing isoforms that normally upregulate the expression from the VEGF promoter resulted in competitive inhibition of the enhancer activity.
  • RTEF-I polypeptides were transfected with the a control (empty vector) pcDNA expression vector or an expression vector for the 1305bp, 936bp, 651bp or 447bp cDNA sequences. Following transfection cell lysates were analyzed by Western blot using an anti -RTEF-I antisera. Anti -RTEF-I antisera was raised against an RTEF-I peptide corresponding to amino acids 2-14 of the full length sequence.
  • Antibodies for Western blot were directed to an RTEF-I epitope that was unique relative to related human TEA proteins but shared by each of the RTEF-I isoforms that were transfected (FIG. 5A).
  • Results of the studies demonstrate that each of the expected RTEF-I polypeptides was expressed in transfected cells though in the case of the polypeptide from the 651bp cDNA expression levels were quite low.
  • RTEF-I RTEF-I isoforms
  • Western blot analysis with an anti-RTEF-1 antibody that binds to each protein isoform demonstrated RTEF-I expression in certain tissues of the eye.
  • Expression of RTEF-I appeared highest in choroid and lowest in retina (FIG. 6A).
  • Detected protein products that migrated slower than the 75kD mass marker seem to be the full length RTEF-I (1305 bp) isoform (FIG. 6 A, upper panel). Products migrating between the 23 and 25kD mass markers are believed to arise from the 651 bp isoform (FIG. 6 A, lower panel).
  • the RTEF-I isoforms (1305bp, 651bp, and 447bp) were cloned into a pMAX-FP-N vector (Amaxa hie, Gaithersburg, MD) with a different fluorescent protein fused to the carboxyl end of each of the isoforms respectively.
  • the 1305bp isoform was fused with a green fluorescent protein (GFP), while 651bp isoform was fused with a red fluorescent protein (RFP) and the 447bp isoform was fused with a yellow fluorescent protein (YFP).
  • GFP green fluorescent protein
  • RFP red fluorescent protein
  • YFP yellow fluorescent protein
  • the 651bp isoform was also cloned into a pHR- CMV-eGFP vector with a hIL-2 secretion signal and a RMR transport motif to produce a ss-651-RMR RTEF-I-GFP fusion protein.
  • Each construct was verified by sequencing analysis.
  • Human 293T cells were plated into 6 well plates at a density of 3xlO 5 cells per well. Cells were grown to 80% confluency in DMEM media supplemented with 10% FBS and IX concentration of penicillin-streptomycin- amphotericin. Each construct was transfected into the treated 293 T cells via electroporation using the Amaxa Nucleofecter II apparatus (Amaxa Inc, Gaithersburg, MD). Cells were incubated for 24 hours at 37 0 C, with 5% of CO 2 . All transfection reactions were observed using fluorescent microscopy for fluorescent activity, and were photo-documented to record localization patterns of the RTEF-I protein isoforms
  • the fluorescent microscopy analysis demonstrates that the two VEGF- enhancer RTEF-I isoforms (1305bp and 447bp) containing a nuclear localization signal were found localized to the nucleus of the cell. Furthermore, the inhibitory isoform 651 was found concentrated in the cytoplasm, outside and surrounding the nucleus. However, with a hiL-2 secretion signal sequence and a RMR transport motif, the ss-651-RMR RTEF-I isoform was found localizing in the cell nucleus.
  • the nuclear fractions, cytoplasmic fractions and media were analyzed with the samples from cells transfected with a pcDNA empty vector, or a pcDNA expression vector for the 1305bp, 936 bp, 651bp, ss-651-RMR, or 447bp RTEF-I variant.
  • 651bp RTEF-I negative dominant isoform localizes in the cytoplasm even though it can competitively inhibit the action of the enhancer RTEF-I isoforms which localize in the nucleus.
  • VEGF is a key protein responsible for the development of various ocular neovascular diseases and establishment of ocular tumors. Identification of proteins that regulate the expression of the VEGF gene will help to understand the etiology and progression of ocular tumors.
  • the most common intraocular cancer in adults is ocular melanoma (OM) and can lead to local tissue damage, loss of vision and has a tendency to metastasize which has significant consequences on patient morbidity and mortality.
  • OM ocular melanoma
  • RTEF-I The various human RTEF-I isoforms are able to differentially potentiate expression from the VEGF 5' proximal promoter region. Since upregulation of VEGF mediates angiogenesis, inflammation and tumor progression, the inventors believe that RTEF-I may play a role in the development and advancement of vascularized human ocular tumors such as melanoma, and possibly other non-ocular tumors.
  • RTEF-I protein (observed as red staining) is present within human ocular melanoma cell.
  • the melanoma cells look brown, due to the presence of melanin pigment.
  • the cells stained red and brown are tumor cells with RTEF-I protein.
  • the high level of RTEF-I in those tumor cells suggests that the RTEF-I may upregulate the VEGF gene within these cells, and promote cell proliferation and tumor expansion.
  • using the 651bp RTEF-I isoform may be used to repress VEGF expression in these melanoma cells and to inhibit the growth of this type of ocular tumor.
  • the application of the 651bp RTEF-I isoform may be beneficial in the therapy of other cancers, which rely on VEGF stimulated tumor expansion.
  • compositions and methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this invention have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the compositions and methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the invention. More specifically, it will be apparent that certain agents which are both chemically and physiologically related may be substituted for the agents described herein while the same or similar results would be achieved. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the invention as defined by the appended claims.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Molecular Biology (AREA)
  • Zoology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Epidemiology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Wood Science & Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Immunology (AREA)
  • Microbiology (AREA)
  • Plant Pathology (AREA)
  • Toxicology (AREA)
  • Physics & Mathematics (AREA)
  • Marine Sciences & Fisheries (AREA)
  • Ophthalmology & Optometry (AREA)
  • Virology (AREA)
  • Cardiology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Oncology (AREA)
  • Pain & Pain Management (AREA)
  • Urology & Nephrology (AREA)
PCT/US2008/066058 2007-06-06 2008-06-06 Rtef-1 variants and the use thereof for inhibition of angiogenesis Ceased WO2008154351A1 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
AT08770291T ATE553771T1 (de) 2007-06-06 2008-06-06 Rtef-1-varianten und deren verwendung zur inhibierung von angiogenese
EP08770291A EP2170938B1 (en) 2007-06-06 2008-06-06 Rtef-1 variants and the use thereof for inhibition of angiogenesis
AU2008261969A AU2008261969B2 (en) 2007-06-06 2008-06-06 RTEF-1 variants and the use thereof for inhibition of angiogenesis
CN2008801004835A CN101970472B (zh) 2007-06-06 2008-06-06 Rtef-1变体及其用于抑制血管发生的用途
CA2689913A CA2689913C (en) 2007-06-06 2008-06-06 Rtef-1 variants and the use thereof for inhibition of angiogenesis
JP2010511354A JP5410416B2 (ja) 2007-06-06 2008-06-06 血管形成の阻害のためのrtef−1変異体およびその使用
DK08770291.6T DK2170938T3 (da) 2007-06-06 2008-06-06 RTEF-1-varianter samt deres anvendelse til inhibering af angiogenese
IL202338A IL202338A (en) 2007-06-06 2009-11-25 Variants of 1 – rtef and their use to suppress the formation of new blood vessels

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US94224907P 2007-06-06 2007-06-06
US60/942,249 2007-06-06

Publications (2)

Publication Number Publication Date
WO2008154351A1 true WO2008154351A1 (en) 2008-12-18
WO2008154351A9 WO2008154351A9 (en) 2010-01-14

Family

ID=39657274

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2008/066058 Ceased WO2008154351A1 (en) 2007-06-06 2008-06-06 Rtef-1 variants and the use thereof for inhibition of angiogenesis

Country Status (10)

Country Link
US (3) US8748379B2 (cg-RX-API-DMAC7.html)
EP (1) EP2170938B1 (cg-RX-API-DMAC7.html)
JP (2) JP5410416B2 (cg-RX-API-DMAC7.html)
CN (1) CN101970472B (cg-RX-API-DMAC7.html)
AT (1) ATE553771T1 (cg-RX-API-DMAC7.html)
AU (1) AU2008261969B2 (cg-RX-API-DMAC7.html)
CA (1) CA2689913C (cg-RX-API-DMAC7.html)
DK (1) DK2170938T3 (cg-RX-API-DMAC7.html)
IL (1) IL202338A (cg-RX-API-DMAC7.html)
WO (1) WO2008154351A1 (cg-RX-API-DMAC7.html)

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2011133512A1 (en) * 2010-04-19 2011-10-27 Research Development Foundation Rtef-1 variants and uses thereof
JP2013502422A (ja) * 2009-08-17 2013-01-24 トラコン ファーマシューティカルズ、インコーポレイテッド 抗エンドグリン抗体及び抗vegf剤を用いる癌の併用療法
US20130281356A1 (en) * 2012-03-16 2013-10-24 University Health Network Methods and compositions for modulating toso activity
WO2015130783A1 (en) * 2014-02-25 2015-09-03 Research Development Foundation Sty peptides for inhibition of angiogenesis
US9150652B2 (en) 2009-09-30 2015-10-06 Tracon Pharmaceuticals, Inc. Endoglin antibodies
US9493561B2 (en) 2013-07-03 2016-11-15 University Health Network Antibodies to Toso
US9926375B2 (en) 2014-11-12 2018-03-27 Tracon Pharmaceuticals, Inc. Anti-endoglin antibodies and uses thereof
US10155820B2 (en) 2014-11-12 2018-12-18 Tracon Pharmaceuticals, Inc. Anti-endoglin antibodies and uses thereof
US10195281B2 (en) 2012-09-05 2019-02-05 Tracon Pharmaceuticals, Inc. Antibody formulations and uses thereof

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
IT1405683B1 (it) * 2010-10-18 2014-01-24 Istituto Giannina Gaslini Vettori lipidici veicolanti silenziatori genici
JP2024511277A (ja) 2021-02-19 2024-03-13 メビオン・メディカル・システムズ・インコーポレーテッド 粒子線治療システムのためのガントリー

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005034881A2 (en) * 2003-10-10 2005-04-21 Beth Israel Deaconess Medical Center Methods and compositions for treating conditions involving abnormal angiogenesis

Family Cites Families (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1995020975A1 (en) * 1994-02-04 1995-08-10 The Regents Of The University Of California Tef-1 isoforms and uses thereof
US6013516A (en) * 1995-10-06 2000-01-11 The Salk Institute For Biological Studies Vector and method of use for nucleic acid delivery to non-dividing cells
US5994136A (en) * 1997-12-12 1999-11-30 Cell Genesys, Inc. Method and means for producing high titer, safe, recombinant lentivirus vectors
US7575924B2 (en) * 2000-11-13 2009-08-18 Research Development Foundation Methods and compositions relating to improved lentiviral vectors and their applications
US7122181B2 (en) * 2000-12-19 2006-10-17 Research Development Foundation Lentiviral vector-mediated gene transfer and uses thereof
US7183388B2 (en) * 2001-03-30 2007-02-27 The Regents Of The University Of California Anti-MUC-1 single chain antibodies for tumor targeting
US20060223114A1 (en) * 2001-04-26 2006-10-05 Avidia Research Institute Protein scaffolds and uses thereof
ATE527347T1 (de) * 2001-08-02 2011-10-15 Inst Clayton De La Rech Verfahren und zusammensetzungen im zusammenhang mit verbesserten lentivirusvektor- produktionssystemen
CA2553676A1 (en) * 2004-01-28 2005-08-11 Research Development Foundation Human soluble neuropilin-1 primary polyadenylation signal and uses thereof
US20060234299A1 (en) * 2004-11-16 2006-10-19 Avidia Research Institute Protein scaffolds and uses thereof

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005034881A2 (en) * 2003-10-10 2005-04-21 Beth Israel Deaconess Medical Center Methods and compositions for treating conditions involving abnormal angiogenesis

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
APPUKUTTAN BINOY ET AL: "Identification of novel alternatively spliced isoforms of RTEF-1 within human ocular vascular endothelial cells and murine retina.", INVESTIGATIVE OPHTHALMOLOGY & VISUAL SCIENCE AUG 2007, vol. 48, no. 8, August 2007 (2007-08-01), pages 3775 - 3782, XP002491287, ISSN: 0146-0404 *
SHIE J-L ET AL: "RTEF1, a novel transcriptional stimulator of endothelial growth factor in hypoxic endothelial cells", JOURNAL OF BIOLOGICAL CHEMISTRY, AMERICAN SOCIETY OF BIOLOCHEMICAL BIOLOGISTS, BIRMINGHAM,; US, vol. 279, no. 24, 11 June 2004 (2004-06-11), pages 25010 - 25016, XP003009264, ISSN: 0021-9258 *
YOCKEY CE ET AL: "cDNA cloning and characterization of murine transcriptional enhancer factor-1-related protein 1, a transcription factor that binds to the M-CAT motif", JOURNAL OF BIOLOGICAL CHEMISTRY, AMERICAN SOCIETY OF BIOLOCHEMICAL BIOLOGISTS, BIRMINGHAM,; US, vol. 271, no. 7, 16 February 1996 (1996-02-16), pages 3727 - 3736, XP002142992, ISSN: 0021-9258 *

Cited By (22)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2016065059A (ja) * 2009-08-17 2016-04-28 トラコン ファーマシューティカルズ、インコーポレイテッド 抗エンドグリン抗体及び抗vegf剤を用いる癌の併用療法
JP2013502422A (ja) * 2009-08-17 2013-01-24 トラコン ファーマシューティカルズ、インコーポレイテッド 抗エンドグリン抗体及び抗vegf剤を用いる癌の併用療法
US9518122B2 (en) 2009-09-30 2016-12-13 Tracon Pharmaceuticals, Inc. Endoglin antibodies
US9944714B2 (en) 2009-09-30 2018-04-17 Tracon Pharmaceuticals, Inc. Endoglin antibodies
US9150652B2 (en) 2009-09-30 2015-10-06 Tracon Pharmaceuticals, Inc. Endoglin antibodies
WO2011133512A1 (en) * 2010-04-19 2011-10-27 Research Development Foundation Rtef-1 variants and uses thereof
US8785385B2 (en) 2010-04-19 2014-07-22 Research Development Foundation RTEF-1 variants and uses thereof
US9650426B2 (en) 2010-04-19 2017-05-16 Research Development Foundation RTEF-1 variants and uses thereof
US20180016320A1 (en) * 2012-03-16 2018-01-18 University Health Network Methods and compositions for modulating toso activity
US9228006B2 (en) * 2012-03-16 2016-01-05 University Health Network Methods and compositions for modulating Toso activity
US20130281356A1 (en) * 2012-03-16 2013-10-24 University Health Network Methods and compositions for modulating toso activity
US10822388B2 (en) 2012-03-16 2020-11-03 University Health Network Methods and compositions for modulating toso activity
US9624289B2 (en) 2012-03-16 2017-04-18 University Health Network Methods and compositions for modulating Toso activity
US9321824B2 (en) 2012-03-16 2016-04-26 Universal Health Network Methods and compositions for modulating Toso activity
US9670265B2 (en) 2012-03-16 2017-06-06 University Health Network Methods and compositions for modulating toso activity
US10195281B2 (en) 2012-09-05 2019-02-05 Tracon Pharmaceuticals, Inc. Antibody formulations and uses thereof
US9493561B2 (en) 2013-07-03 2016-11-15 University Health Network Antibodies to Toso
WO2015130783A1 (en) * 2014-02-25 2015-09-03 Research Development Foundation Sty peptides for inhibition of angiogenesis
US20170037091A1 (en) * 2014-02-25 2017-02-09 Research Development Foundation Sty peptides for inhibition of angiogenesis
US9926375B2 (en) 2014-11-12 2018-03-27 Tracon Pharmaceuticals, Inc. Anti-endoglin antibodies and uses thereof
US10155820B2 (en) 2014-11-12 2018-12-18 Tracon Pharmaceuticals, Inc. Anti-endoglin antibodies and uses thereof
US10336831B2 (en) 2014-11-12 2019-07-02 Tracon Pharmaceuticals, Inc. Use of anti-endoglin antibodies for treating ocular fibrosis

Also Published As

Publication number Publication date
CN101970472B (zh) 2013-10-30
CA2689913C (en) 2014-10-07
AU2008261969A1 (en) 2008-12-18
IL202338A (en) 2014-03-31
US20170081377A1 (en) 2017-03-23
CN101970472A (zh) 2011-02-09
US9512423B2 (en) 2016-12-06
DK2170938T3 (da) 2012-07-16
US8748379B2 (en) 2014-06-10
WO2008154351A9 (en) 2010-01-14
EP2170938B1 (en) 2012-04-18
JP5410416B2 (ja) 2014-02-05
US20140322205A1 (en) 2014-10-30
EP2170938A1 (en) 2010-04-07
US20090117119A1 (en) 2009-05-07
JP2010528663A (ja) 2010-08-26
CA2689913A1 (en) 2008-12-18
AU2008261969B2 (en) 2013-06-06
US9937269B2 (en) 2018-04-10
IL202338A0 (en) 2011-08-01
ATE553771T1 (de) 2012-05-15
JP2013215210A (ja) 2013-10-24

Similar Documents

Publication Publication Date Title
US9937269B2 (en) RTEF-1 variants and the use thereof for inhibition of angiogenesis
US9650426B2 (en) RTEF-1 variants and uses thereof
EA030259B1 (ru) Человеческие нейтрализующие антитела к фактору роста нервов (ngf) в качестве селективных ингибиторов метаболического пути ngf
UA46772C2 (uk) Кон'югат між суперантигеном дикого типу, який був модифікований, та частиною молекули, що відшукує мішень
AU2021261945A1 (en) Compositions and methods for generating an immune response to a tumor associated antigen
JP2023514148A (ja) Cd28変異を有するキメラ抗原受容体およびその使用
CN106810610A (zh) 抗EpCAM和CD3特异性双靶向抗体及其制备方法和应用、含该双靶向抗体表达盒的微环DNA及应用
WO2016138625A1 (zh) TRAIL穿膜肽样突变体MuR6、制备方法及应用
CN110386987A (zh) 一种抑制性的合成Notch和双靶点系统及其制备方法和应用
JP2009519006A (ja) 改善された色素上皮由来因子変異体及びその使用
WO2016138618A1 (zh) TRAIL穿膜肽样突变体MuR5、制备方法及应用
WO2019108920A1 (en) Trpv6 inhibitors and combination therapies for treating cancers
JP2024532486A (ja) Dll3を標的とする抗原認識受容体及びその使用
US20170037091A1 (en) Sty peptides for inhibition of angiogenesis
WO2023164266A2 (en) Dual checkpoint inhibitors and methods of using the same
CN118139892A (zh) 一种三靶点抗肿瘤药物、其制备方法及其应用

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 200880100483.5

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 08770291

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2008261969

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2689913

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2010511354

Country of ref document: JP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2008261969

Country of ref document: AU

Date of ref document: 20080606

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2008770291

Country of ref document: EP