WO2008134752A2 - Methods and compositions for the treatment of cancer - Google Patents
Methods and compositions for the treatment of cancer Download PDFInfo
- Publication number
- WO2008134752A2 WO2008134752A2 PCT/US2008/062092 US2008062092W WO2008134752A2 WO 2008134752 A2 WO2008134752 A2 WO 2008134752A2 US 2008062092 W US2008062092 W US 2008062092W WO 2008134752 A2 WO2008134752 A2 WO 2008134752A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- mesd
- oligopeptide
- seqidno
- lrp6
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
Definitions
- Sequence Listing which is a part of the present disclosure, includes a computer readable form and a written sequence listing comprising nucleotide and/or amino acid sequences of the present invention.
- the sequence listing information recorded in computer readable form is identical to the written sequence listing.
- the subject matter of the Sequence Listing is incorporated herein by reference in its entirety.
- Dysregulation of the Wnt signaling pathway can result in cancer.
- Several components of the Wnt signaling pathway have been identified as oncogenes or tumor suppressors (showing gain-of-function or Ioss-of-function mutations, respectively) in human cancers.
- Dysregulation of Wnt signaling can cause excess proliferation of mammary progenitor cells and predisposes these cells to cancer.
- activation of the Wnt signaling pathway in the mammary gland is sufficient to induce mammary tumorigenesis, and overexpression of Wnt-1 can result in mammary tumorigenesis (Woodward, W. A., et al., J. Cell Sci. 118: 3585-2598, 2005; Liu, S., et al., Breast Cancer Res. 86-95, 2005; Howe, L.R. and Brown, A.M., Cancer Biol. Ther. 3: 36-41, 2004).
- oligopeptides which can prevent, slow or reverse cancer progression.
- These oligopeptides include full-length polypeptides encoded by the mesd gene, a gene identified as contributing to mesodermal development, as well as fragments thereof.
- the inventors have developed oligopeptides, each of which comprises, consists essentially of, or consists of a contiguous subsequence of a polypeptide encoded by a mesd gene.
- An oligopeptide of these configurations can comprise a full-length mesd polypeptide or a fragment thereof.
- An oligopeptide of these configurations can comprise, consist essentially of, or consist of an amino acid sequence of from about 10 contiguous amino acids in length up to about 70 contiguous amino acids in length, or from about 30 contiguous amino acids in length up to about 67 contiguous amino acids in length.
- an oligopeptide can comprise, consist essentially of, or consist of an amino acid sequence selected from
- an oligopeptide can comprise a sequence selected from the group consisting of KGGGSKEKNKTKQDKGKKKKEGDLKSRSSKEENRAGNK (SEQ ID NO: 14), KGGGSKEKNKTKPEKAKKKEGDPKPRASKEDNRAGSR (SEQ ID NO: 20),
- an oligopeptide can consist essentially of a sequence selected from the group consisting of KGGGSKEKNKTKQDKGKKKKEGDLKSRSSKEENRAGNK (SEQ ID NO: 14) KGGGSKEKNKTKPEKAKKKEGDPKPRASKEDNRAGSR (SEQ ID NO: 20), KGGGSKEKNKTKPEKAKKKEGDRKPRASKEDNRAGSR (SEQ ID NO: 21) and QMYPGKGGGSKEKNKTKPEKAKKKEGDPKPRASKEDNRAGSRREDL (SEQ ID NO: 22).
- an oligopeptide can consist of a sequence selected from the group consisting of KGGGSKEKNKTKQDKGKKKKEGDLKSRSSKEENRAGNK (SEQ ID NO: 14) KGGGSKEKNKTKPEKAKKKEGDPKPRASKEDNRAGSR (SEQ ID NO: 20),
- an oligopeptide of the present teachings which is at least about 10 contiguous amino acids in length up to about 70 contiguous amino acids in length can include conservative amino acid substitutions at one or more positions, as compared to an oligopeptide of a sequence set forth as SEQ ID NO: 1 through SEQ ID NO: 38.
- an oligopeptide of the present teachings can exhibit a biochemical property of antagonizing binding of a Wnt ligand to an LRP5 receptor and/or LRP6 receptor.
- Further aspects of the present teachings include a full-length mesd polypeptide which differs in one or more amino acids from those of a polypeptide presented herein by one or more conservative amino acid substitutions, in which the polypeptide antagonizes binding of a Wnt ligand to an LRP5 receptor and/or LRP6 receptor.
- the present teachings also include oligopeptides having at least about 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79% sequence identity, at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89% sequence identity, or at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity with a polypeptide set forth as SEQ ID NO: 1 through SEQ ID NO: 32, and also inhibits Wnt binding an LRP5 receptor and/or LR.P6 receptor.
- an oligopeptide can be a substantially pure oligopeptide or an isolated oligopeptide, including a substantially pure or isolated full-length Mesd polypeptide or a portion thereof such as an oligopeptide having a sequence set forth in SEQ ID NO: 1 through SEQ ID NO: 32, or an oligopeptide having conservative substitutions with respect to a sequence of a full-length Mesd polypeptide set forth in Table I or an oligopeptide set forth as SEQ ID NO: 1 through SEQ ID NO: 32.
- the sequence of a Mesd polypeptide or a portion thereof can be that of a polypeptide or a portion thereof comprising at least about 10 contiguous amino acids and encoded by a mesd gene from any animal, including, in non-limiting example, a vertebrate such as a fish, a reptile, an amphibian such as Xenopus laevis, a bird such as Gallus gallus or a mammal such as a human or rodent such as Mus musculus, provided the sequence shares at least about 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79% sequence identity, at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89% sequence identity, or at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity with a Mesd polypeptide or at least one sequence set forth as SEQ ID NO:
- a Mesd polypeptide or oligopeptide can be at least about 20 contiguous amino acids, at least about 30 contiguous amino acids, or at least 37 contiguous amino acids in length, up to and including full length genes.
- a polypeptide or oligopeptide antagonizes binding of a Wnt ligand to an LRP5 receptor and/or LRP6 receptor.
- the present teachings include methods of treatment of cancers in which
- the method comprises administering to a subject in need of therapy, such as a human patient diagnosed with cancer, a Mesd polypeptide, a therapeutically effective amount of a Mesd polypeptide as set forth in table I or an oligopeptide which is at least about 10 contiguous amino acids in length up to about 70 contiguous amino acids in length, and comprises a sequence set forth in SEQ ID NO: 1 through SEQ ID NO: 32, or a sequence comprising at least 10 contiguous amino acids in length up to about 70 contiguous amino acids in length and sharing at least about 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79% sequence identity, at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89% sequence identity, or at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity with a Mesd polypeptid
- a cancer can be treated by administering to a subject a full length Mesd polypeptide, such as a polypeptide set forth in Table I, including a mammalian Mesd polypeptide such as a human or murine Mesd polypeptide.
- a full length Mesd polypeptide such as a polypeptide set forth in Table I, including a mammalian Mesd polypeptide such as a human or murine Mesd polypeptide.
- a cancer can be treated by administering to a subject a polypeptide sharing at least about 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79% sequence identity, at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89% sequence identity, or at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity with full length Mesd polypeptide, such as a polypeptide set forth in Table I, including a mammalian Mesd polypeptide such as a human or murine Mesd polypeptide.
- a vector comprising a promoter operably linked to a nucleic acid sequence encoding a Mesd polypeptide, or an oligopeptide which comprises a sequence from a polypeptide encoded by the mesd gene as described herein.
- a vector can be a plasmid or a virus, and a promoter can be a eukaryotic promoter or a prokaryotic promoter.
- vectors can be used to produce an oligopeptide ex vivo, e.g., by expression in a host cell or host microorganism in vitro, or can be used therapeutically, such as by administering a vector described in the present teachings, or by administering, to a subject in need of treatment, cells comprising the vector and which produce a full-length Mesd polypeptide or a Mesd oligopeptide.
- a vector can comprise, in addition to a promoter and a nucleic acid encoding an Mesd polypeptide or oligopeptide, a sequence linked to those encoding the polypeptide or oligopeptide and encodes an amino acid sequence which promotes polypeptide or oligopeptide export or secretion from a cell, such as a leader peptide sequence known to those of skill in the art.
- FIG. 1 illustrates that Mesd binds to mature LRP6 at the cell surface with high affinity.
- FIG. 2 illustrates that Mesd binds to mature LRP5 and LRP6 but not significantly to other members of the LDLR family.
- FIG. 3 illustrates that the C-terminal region of Mesd is required for interaction with LRP6.
- FIG. 4 illustrates that the C-terminal region of Mesd is necessary and sufficient for LRP6 binding.
- FIG. 5 illustrates that the carboxy -terminal region of Mesd is required for LRP6 folding.
- FIG. 6 illustrates that LRP6 is not a constitutively active endocytosis receptor.
- FIG. 7 illustrates that LRP6 exhibits a limited level of Mesd degradation.
- FIG. 8 illustrates that the 39 kDa specialized molecular chaperone receptor-associated protein RAP binds to LRP6 and partially competes for Mesd binding.
- FIG. 9 illustrates that Mesd inhibits DKKl binding to LRP6.
- FIG. 10 illustrates that Mesd polypeptide or a Mesd oligopeptide can both bind LRP5 and inhibit binding of DKKl to cither LRP5 or LRP6.
- FIG. 1 1 shows results from HEK293 cells stably transfected with TCF/LEF-luc reporter construct was treated without Wnt-3A or with Wnt-3A plus the indicated inhibitors (Mesd and/or Dkkl) for 16 hours at 37 0 C. Wnt signaling was measured by quantifying the luciferase activity using a live cell imaging system.
- FIG. 12 shows MMTV-LRP6 transgenic mouse showing mammary gland hyperplasia MMTV-LRP6 transgenic mice were generated by overexpressing LRP6 cDNA in the mammary epithelial cells driven by the MMTV promoter.
- Mammary glands from littermates of either WT (panels A, C) or MMTV-LRP6 virgin mice (panels B, D) at 14 weeks of age were analyzed by whole mount staining. Note mammary hyperplasia in MMTV-LRP6 mice (panel B at low power field and D at high power field).
- Wnt receptors are candidate oncoproteins, and mutated forms of two members of the mammalian low-density lipoprotein receptor (LDLR)-related protein (LRP) family, LRP5 and LRP6. have recently been shown to be capable of constitutively activating Wnt/ ⁇ -catenin signaling in cell culture.
- LRP5 AND LRP6-specific inhibitors such as Mesd to inhibit Wnt signaling at the cell surface.
- dosage forms and administration regimes can be determined using standard methods known to skilled artisans, for example as set forth in standard references such as Remington: the Science and Practice of Pharmacy (Alfonso R. Gennaro ed. 19th ed. 1995); Hardman, J. G., et al., Goodman & Gilman's The Pharmacological Basis of Therapeutics, Ninth Edition, McGraw-Hill, 1996; and Rovve, R.C., et al., Handbook of Pharmaceutical Excipients, Fourth Edition, Pharmaceutical Press, 2003.
- the present inventor discloses substantially pure oligopeptides which can be used to treat cancers, including a cancer in which cancerous cells exhibit modified Wnt signaling, such as, without limitation, breast cancer, multiple myeloma (MM), prostate cancer and skin cancer.
- a cancer in which cancerous cells exhibit modified Wnt signaling such as, without limitation, breast cancer, multiple myeloma (MM), prostate cancer and skin cancer.
- the present inventor has found that an Mesd polypeptide can inhibit Wnt ligand binding to (LDLR)-related protein-5 (LRP5) and (LDLR)-related protein-6 (LRP6). Accordingly, Mesd polypeptide or a functional fragment thereof can be used for treating cancer and for increasing bone health, as described in US Patent application 11/557,292, filed November 7, 2006.
- LDLR low-density lipoprotein receptor
- LRP5 low-density lipoprotein receptor
- LRP6 low-density lipoprotein-6
- Oligopeptides of the present teachings comprise from about 10 contiguous amino acids up to about 70 contiguous amino acids, wherein the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 and SEQ ID NO: 12.
- the sequences represent subsequences from Mesd polypeptide encoded by a mesd gene comprised by the genome of a variety of species such as, without limitation, human, mouse, dog. cow, chimpanzee, orangutan and rat.
- oligopeptide refers to a molecule comprising at least two amino acids joined by peptide bonds
- polypeptide refers to a molecule comprising a full-length amino acid sequence as encoded by a gene, an mRNA or a cDNA.
- a substantially pure oligopeptide of the present teachings can comprise at least 20 or at least 30 contiguous amino acids, up to about 67 amino acids. Sequences of the present teachings are set forth herein in Table II, which present oligopeptide sequences of from 54 to 67 contiguous amino acids, and Table III, which presents oligopeptide sequences of from 10 to 46 amino acids.
- An oligopeptide of the present teachings can be synthesized using standard techniques well known to skilled artisans, such as, in non-limiting example Merrifield solid phase synthesis, or molecular cloning methods, including, in non-limiting example, synthesizing an oligonucleotide encoding an oligopeptide and inserting the oligonucleotide into a vector, or subcloning a portion of a cDNA into a vector using restriction enzyme digestion, ligation with a ligase, and/or polymerase chain reaction techniques.
- a vector comprising an oligonucleotide encoding an oligopeptide can in inserted into a cell by transfection or transformation, and expressed in the cell using methods well known to skilled artisans. Oligopeptides can be isolated and/or purified by standard techniques well known to skilled artisans. Table II
- substitutions can be from families of amino acid residues having similar side chains as have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- Families include amino acids with basic side chains (e.g., lysine, arginine, histidine
- a further aspect of the invention comprises polypeptides and oligopeptides which differ in one or more amino acids from those of a polypeptide or oligopeptide sequence described herein by deletion or insertion of one or more amino acids.
- an oligopeptide can be from about 10 amino acids in length up to 67 amino acids in length.
- the sequence can comprise any sequence set forth in Table II or Table III, and/or can include any sequence selected from SEQ ID NO: 1 through SEQ ID NO: 38.
- a sequence of an oligopeptide can be a sequence sharing at least 70% sequence identity, at least 80% sequence identity, or at least 90% sequence identity with at least one sequence of SEQ ID NO: 1 through SEQ ID NO: 38 and has the biochemical property of antagonizing, inhibiting or blocking binding of a mature cell surface proteins LRP5 and/or LRP6 with an extracellular ligand such as a Wnt ligand, when the oligopeptide is contacted with an LRP5 and/or LRP6, such as an LRP5 and/or LRP6 comprised by a cell membrane.
- a sequence of an oligopeptide can be a sequence sharing at least 70% sequence identity, at least 80% sequence identity, or at least 90% sequence identity with at least one sequence of SEQ ID NO: 1 through SEQ ID NO: 38 and furthermore can have the biochemical property of antagonizing Wnt signaling.
- conservative substitutions can be made in oligopeptide sequences, for example substitution of a hydrophobic amino acid such as valine with a different hydrophobic amino acid such as isoleucine. Methods for identifying and selecting conservative substitutions for amino acids are well known to skilled artisans (see, e.g., Pearson, W.R., Methods Enzymol. 266: 227-258, 1996).
- nucleic acid vectors comprising a promoter operably linked to a nucleic acid sequence encoding an oligopeptide comprise a sequence selected from SEQ ID NO: 1 through SEQ ID NO: 38.
- the oligopeptide or polypeptide sequence can be a sequence sharing at least about 70%, 71%, 72%, 73%, 74%, 75% : 76%, 77%, 78%, 79% sequence identity, at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89% sequence identity, or at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity with at least one of SEQ ID NO: 1 through SEQ ID NO: 38.
- a promoter of these configurations can be a eukaryotic promoter (i.e., a promoter which can support transcription in the environment of a eukaryotic cell such as a mammalian cell or a microbial eukaryotic cell such as a yeast cell) or a prokaryotic promoter (i.e., a promoter which can support transcription in the environment of a prokaryotic cell such as a bacterium).
- a eukaryotic promoter i.e., a promoter which can support transcription in the environment of a eukaryotic cell such as a mammalian cell or a microbial eukaryotic cell such as a yeast cell
- a prokaryotic promoter i.e., a promoter which can support transcription in the environment of a prokaryotic cell such as a bacterium.
- Non-limiting examples of a promoter which can be used in a vector of the present teachings include an actin promoter, a CUP 1 promoter from a yeast metallothionein gene, and promoter-enhancer elements from the simian virus 40 (SV40) early -region or a mouse alpha 2(I)-collagen gene, and an E. coli lac operon operator/promoter.
- a vector can be, for example, a plasmid or a virus, such as, for example., a baculovirus or a bacteriophage.
- the present teachings encompass a cell comprising a vector as described herein.
- a cell comprising a vector can be a cell in which the promoter of the vector is operable, for example an E. coli cell harboring a plasmid comprising a lac operon/promoter, or an insect cell harboring a baculovirus vector.
- the present teachings include methods of treating cancer in a subject in need of treatment. Methods of these configurations include administering to a subject a therapeutically effective amount of a Mesd polypeptide, a polypeptide sharing at least 70% sequence identity, at least 80% sequence identity, or at least 90% sequence identity with an Mesd polypeptide, or an oligopeptide comprising between 10 contiguous amino acids and about 70 contiguous amino acids, wherein the oligopeptide comprises an amino acid sequence selected from SEQ ID NO: 1 through SEQ ID NO: 38 and a sequence sharing at least 70% sequence identity, at least 80% sequence identity, or at least 90% sequence identity with at least one sequence set forth as SEQ ID NO: 1 through SEQ ID NO: 38, wherein an polypeptide or oligopeptide antagonizes binding of a Wnt ligand to an LRP5 receptor and/or LRP6 receptor, when in contact with LRP5.
- the cancer can be breast cancer and multiple myeloma (MM), prostate cancer and skin cancer, or any cancer with these characteristics. These methods can also be applied to cells or tissues in vitro or ex vivo.
- the present methods also include administering to a subject in need of treatment a vector such as described above, or cells comprising a vector, such as human cells comprising a vector comprising a eukaryotic promoter operably linked to a nucleic acid encoding an oligopeptide as described herein.
- the human cells can be cells from a subject which are transformed with a vector, grown in vitro using standard cell culture techniques, and returned to the donor.
- a therapeutically effective amount of a polypeptide, oligopeptide or vector of the present teachings can be determined using methods well known in the art, such as found in standard pharmaceutical texts such as Herfindal, Gourley and Hart, Williams and Wilkins, ed. Clinical Pharmacy and Therapeutics, Williams & Wilkins, 1988; Goodman, L. S. and Gilman, A., ed. The Pharmacological Basis of Therapeutics, McGraw-Hall; 2005; Kalant, H., and Roschlau, W.H.E., ed., Principles of Medical Pharmacology, Mosby, Incorporated. 1989; J. T. DiPiro, R.L. et al., ed.
- 125 I-Mesd (5 nM) reached maximal binding after 2 hours incubation at 4°C with LRP6-expressing HT1080 cells (FIG. I A). Inclusion of excess unlabeled Mesd (500 nM) completely eliminated this binding. No significant 125 I-Mesd binding was seen with the control cells (pLNCX2). Saturation of Mesd specific binding was seen at concentrations of >6.4 nM (FIG. IB). Scatchard analysis of the binding data revealed that Mesd binds LRP6 with a Kd of -3.3 nM (FIG. 1C). This affinity of Mesd to LRP6 is comparable to that of RAP to LRP (ladonato, S.P., Biochem. J. 296: 867-875, 1993).
- Human recombinant DKKl protein and mouse recombinant Wnt3a protein were from R&D Systems. Human recombinant RAP protein was expressed in a glutathione S-transferase (GST) expression vector and isolated as described previously (Bu et al., 1993). Monoclonal anti-Myc antibody 9E10 was from Roche. Monoclonal antibody 8Gl against human LRP was from Research Diagnostics. Monoclonal ami- HA antibody has been described before (Li, Y., J. Biol. Chem. 275: 17187-17194, 2000). Polyclonal rabbit anti-LDLRwas produced by immunizing rabbits with recombinant human LDLR 1-294 fragment.
- Peroxidase-labeled antimouse antibody and ECL system were from Amersham Life Science. Plasmid pcDNA3. lC-Myc-hLRP5 containing the full-length human LRP5 cDNA and plasmid pCS-Myc-hLRP6 containing the full-length human LRP6 cDNA were from Cindy Bartels and Christof Niehrs, respectively. Carrier-free Na 125 I was purchased from NEN Life Science Products. IODO-GEN was from Pierce. Proteins were iodinated by using the IODO-GEN method as described previously (Li, Y., J. Biol. Chem. 275: 17187-17194, 2000).
- LRP6- transduced HT1080 cells and the control cells have been described before (Li et al., 2004), and were cultured in DMEM medium containing 10% fetal bovine serum and 350 _£/ml G418.
- the LRP-null CHO cells stably transfected with human LDLR-related protein (LRP) minireceptor mLRP4, mLRP4 tail mutant mLRP4tailess (mLRP4 without the cytoplasmic tail), human LDLR-related protein IB (LRPlB) minireceptor mLRPlB4, human VLDLR, or human apoER2 have been described before (Li, Y., J. Biol. Chem.
- MEF-I WT
- MEF-2 LRP-deficient
- MEF-3 LDLR-deficient
- MEF- 4 LRP and LDLR-double-deficient
- LDLR family members To examine the expression of the LDLR family members, cells cultured in six-well plates were lysed with 0.5 ml lysis buffer (phosphate-buffered saline containing 1% Triton X-100 and 1 mM PMSF) at 4 0 C for 30 minutes. Equal quantities of protein were subjected to SDS-PAGE under non-reducing conditions. Following transfer to Immobilon-P membrane, successive incubations with primary antibody and horseradish peroxidase-conjugated secondary antibody were carried out for 60 minutes at room temperature. The immunoreactive proteins were then detected using the lysis buffer (phosphate-buffered saline containing 1% Triton X-100 and 1 mM PMSF) at 4 0 C for 30 minutes. Equal quantities of protein were subjected to SDS-PAGE under non-reducing conditions. Following transfer to Immobilon-P membrane, successive incubations with primary antibody and horseradish peroxidase-conjugated secondary antibody were carried out for 60 minutes at room temperature
- ECL system To examine the cytosolic ⁇ -catenin level, cells in six-well plates were treated with Mesd at various concentrations for 90 minutes at 37°C. After washing in ice-cold PBS, cells were collected and homogenized in a glass Dounce homogenizer in buffer consisting of 100 mM Tris-HCl pH 7.4, 140 mM NaCl, 2 mM DTT, 2 mM PMSF, and IX CompleteTM protease inhibitors (500 ⁇ l/well). The homogenate was centrifuged for 10 minutes at 500 g, and the supernatant was further centrifuged at 100,000 g at 4°C for 90 minutes. The resulting supernatant was designated the cytosolic fraction.
- the ⁇ -catenin levels were then examined by western blotting using ⁇ -catenin-specific antibody from Cell Signaling Technology.
- the immunoreactive proteins were detected using the ECL system. Films showing immunoreactive bands were scanned with a Kodak Digital Science DC 120 Zoom Digital Camera and band intensities were analyzed with Kodak Digital SciencelD Image Analysis Software.
- HEK293 cells were plated into six-well plates. For each well, 0.1 ⁇ g of the TOP-FLASHTCF luciferase construct (Upstate Biotechnology) was cotransfected with 0.8 ⁇ g Mesd-expressing vector, 0.8 ⁇ g Mesd mutant-expressing vector, or empty vector. A ⁇ -galactosidase-expressing vector (Promega, Madison, WI) was included as an internal control for transfection efficiency. After 48 hours, cells were lysed and both luciferase and ⁇ -galactosidase activities were determined with enzyme assay kits (Promega). The luciferase activity was determined with a luminometer using the Dual Luciferase Assay system (Promega). Luciferase activity was normalized to the activity of the ⁇ -galactosidase.
- Ligand-binding buffer minimal Eagle's medium containing 0.6% BSA with a different concentration of radioligand, 0.6 ml/well
- 500 nM unlabeled RAP or 500 nM unlabeled Mesd was added to cell monolayers, in the absence or the presence of 500 nM unlabeled RAP or 500 nM unlabeled Mesd, followed with incubation for 0-4 hours at 4°C. Thereafter, overlying buffer containing unbound ligand was removed, and cell monolayers were washed and lysed in low-SDS lysis buffer (62.5 mM Tris-HCl pH 6.8, 0.2% SDS, 10% v/ glycerol) and counted.
- low-SDS lysis buffer 62.5 mM Tris-HCl pH 6.8, 0.2% SDS, 10% v/ glycerol
- the protein concentration of each cell lysate was measured in parallel dishes that did not contain the ligands. Ligand degradation was performed using the methods as described (Li, Y., J. Biol. Chem. 275: 17187-17194, 2000). Briefly, 2 x 10 5 cells were seeded into 12-well dishes 1 day prior to assay. Pre-warmed assay buffer (minimal Eagle's medium containing 0.6% BSA with radioligand, 0.6 ml/well) was added to cell monolayers in the absence or the presence of unlabeled 500 nM RAP or 500 nM Mesd, followed by incubation for 4 hours at 37 0 C.
- Pre-warmed assay buffer minimal Eagle's medium containing 0.6% BSA with radioligand, 0.6 ml/well
- I25 Ianti- HA IgG The binding of I25 Ianti- HA IgG was carried out at 4°C for 90 minutes with gentle rocking. Unbound 125 I-anti-HA IgG was removed by washing cell monolayers three times with cold assay buffer. Ice-cold stop/strip solution (0.2 M acetic acid, pH 2.6, 0.1 M NaCl) was added to one set of plates without warming up and kept on ice. The remaining plates were then placed in a 37°C water bath and 0.5 ml assay buffer prewarmed to 37 0 C was quickly added to cell monolayers to initiate internalization. After each time point, the plates were quickly placed on ice and the assay buffer was replaced with cold stop/strip solution.
- Ice-cold stop/strip solution 0.2 M acetic acid, pH 2.6, 0.1 M NaCl
- 125 I-anti-HA IgG that remained on the cell surface was stripped by incubation of cell monolayers with cold stop/strip solution for a total of 20 minutes (0.75 ml for 10 minutes, twice) and counted. Cell monolayers were then solubilized with low-SDS lysis buffer and counted. The sum of 125 I-anti-HA IgG that was internalized plus that remaining on the cell surface after each assay was used as the maximum potential internalization. The fraction of internalized 125 I-anti-HA IgG after each time point was calculated and plotted.
- Human DKKl cDNA (clone MGC:868, IMAGE:3508222) was obtained from Invitrogen and subcloned into pcDNA3 (EcoRI/Xbal). To facilitate immunodetection, a c-Myc epitope was included at the C-terminus. The integrity of the subcloned DNA sequence was confirmed by DNA sequencing. Human DKKl -conditioned media were produced by transient transfection of HEK293 cells with pcDN ADKKl -Myc in serum-free medium, and allowed to bind to
- LRP6-transduced HT1080 cells and control cells at room temperature for 60 minutes in the absence or presence of 1 ⁇ M Mesd.
- Cells were then fixed in 4% paraformaldehyde, labeled with anti-Myc monoclonal antibody and detected with Alexa-488 goat anti-mouse IgG.
- the immunofluorescence was detected by a laser-scanning confocal microscope (Olympus Fluoview 500).
- I25 I-Mesd binding analysis was performed with four groups of cells expressing different members of the LDLR family (FIG. 2).
- HEK293 cells were transiently transfected with cDN As for the LDLR, LRP5, LRP6 or empty pcDNA3 vector.
- LRP-null Chinese hamster ovary (CHO) cells were stably transfected with LRP minireceptor mLRP4, LRPlB minireceptor mLRPlB4, apoER2, VLDLR, or empty pcDNA3 vector (Li, Y., J. Biol. Chem.
- mLRP4 is composed of residues 3274-4525 of the full-length LRP, which includes the fourth cluster of ligand-binding repeats and the entire C-terminus of the receptor.
- mLRPlB4 is composed of residues 3276-4599 of the full length LRPlB, which includes the fourth cluster of ligand binding repeats and the entire C-terminus of the receptor.
- mLRP4 and mLRPlB4 mimic the function and trafficking of LRP and LRPlB, respectively.
- Example 4 This example illustrates that 45 amino acids of Mesd are necessary and sufficient for binding to mature LRP6.
- a truncated Mesd mutant containing the last 45 amino acids of C-terminal region was generated (FJG. 3A) and its binding affinity for LRP6 was then analyzed. As shown in FIG. 4, The C-terminal region of Mesd is necessary and sufficient for LRP6 binding.
- A Binding analyses of 125 I-Mesd and its mutant Mesd (150-195) (5 nM) to LRP6-transduced HT1080 cells and control cells.
- B Binding analyses of 123 I-MeSd and its mutant Mesd (150-195) (5 nM) to LRP6-transduced HTl 080 cells. Assays were carried out for 3 hours at 4 0 C in the absence or presence of 500 nM Mesd or its mutant. Values are the means of triple determinations with the s.d. indi cated by error bars.
- Mesd mutant (Mesd_C), which lacks the C-terminal region (amino acids 156-191) but retains the endoplasmic reticulum retention signal (REDL) (FIG. 3A).
- HEK293 cells were transiently transfected with cDNA for the LRP6 with cotransfection of control vector, or cDNAs for Mesd or Mesd ⁇ C.
- the steady-state levels of LRP6 were analyzed by western blotting with the anti-MYC antibody (FIG. 5A). As seen in the figure, two forms of the receptor, i.e. the ER form and mature form (containing complex sugar modifications), were seen for LRP6.
- FIG. 5A In the presence of Mesd coexpression, but not of Mesd_C coexpression, the amount of the mature form of LRP6 was significantly increased (FIG. 5A).
- FlG. 5 A.. HEK293 cells were transiently transfected with the indicated cDNAs. Cell lysates were analyzed by SDS-PAGE under reducing conditions and western blotted with anti-FLAG or anti-HA antibodias as indicated.
- LEF lymphoid-enhancing factor
- TCF T-cell factors
- the TOP-FLASH luciferase reporter contains TCF-binding sites and can be directly activated by the ⁇ -catenin/TCF complex (Korinek et al., 1997).
- LRP6 is cell surface receptor, and only the mature receptor can reach the cell surface and modulate Wnt signaling (Cong et al., 2004).
- Mesd_C on Wnt signaling using the TOP-FLASH luciferase reporter assay in HEK293 cells.
- FIG. 5B HEK293 cells were cotransfected with LRP6, MESD, Mesd ⁇ C or empty pcDNA3 vector and a TCF/LEF transcriptional activity reporter plasmid (TOP-FLASH). The luciferase activity was measured 48 hours after transfection. Values are the means of triple determinations with the s.d. indicated by error bars. Together, these results suggest that the C-terminal region of Mesd is required for LRP6 folding and its signaling function at the cell surface.
- Example 6 This example illustrates that LRP6 is not a constitutively active endocytosis receptor and mediates a limited level of Mesd degradation.
- LRP6 is a constitutively active endocytosis receptor
- kinetic analyses of receptor endocytosis with HT1080 cells transduced with HA-tagged LRP6 were performed.
- LRP6 ligands on its internalization we utilized l25 I-anti-HA IgG for LRP6 endocytosis assays.
- Binding of 125 I-anti-HA IgG to HA-tagged LRP6 was specific, i.e. the binding of l25 I-anti-HA IgG to the HT1080 control cells was minimal when compared to HT1080-LRP6 cells (FIG. 6A).
- HA-tagged LRP minireceptor mLRP4 as a positive control
- mLRP4tailess mLRP4 lacking the cytoplasmic tail
- FIG. 6 illustrates that LRP6 is not a constitutively active endocytosis receptor.
- A Anti-HA IgG binding to cell surface HA-tagged LRP6. Binding of 125 I-anti-HA IgG (1 nM) to LRP6-t ⁇ ansduced HTl 080 cells and the control cells was carried out for 90 minutes at 4°C.
- B LRP6 endocytosis. LRP6-transduced HT1080 cells, mLRP4-transfected CHO cells and mLRP4tailess-transfected CHO cells were incubated with 1 nM l23 l-anti-HA IgG at 4°C for 90 minutes, and then incubated at 37°C for the indicated times.
- Example 7 This example illustrates that LRP6 mediates little Mesd uptake and degradation.
- LRP6-mediated Mesd uptake and degradation was investigated in the experiments illustrated in FIG. 7.
- HTl 080 cells transduced with LRP6 exhibited 125 I-MeSd degradation at a level of 320 fmoles/mg cell protein after 4 hours of incubation at 37 0 C, whereas 125 I-MeSd binding following 4 hours of incubation at 4°C was detected at a level as high as 1320 fmoles/mg cell protein.
- ⁇ -catenin is a key molecule in the Wnt/ ⁇ -calenin signaling pathway.
- a cytosolic pool of ⁇ -catenin interacts with DNA-binding proteins and participates in Wnt signal transduction (Hinck, L. : J. Cell Biol. 125, 1327-13401994; Gottardi, C. J., J. Cell Biol. 153: 1049-1060, 2001; Klingelhofer, J., Oncogene 22, 1 181-1188, 2003).
- Example 9 This example illustrates that RAP binds to LRP6 and partially competes for Mesd binding.
- Receptor-associated protein (RAP) binds with high affinity to LRP, megalin, VLDLR and apoER2, and with a lower affinity to the LDLR (Bu, G., Int. Rev. Cytol. 209, 79-116. 2001).
- RAP and Mesd bind to identical, overlapping, or different sites on the receptors.
- FIG. 8 to determine whether RAP also binds LRP6, we performed RAP-binding analysis with HT1080 cells stably expressing LRP6 at 4 0 C.
- Control cells expressing vector alone, exhibited a moderate level of cell surface 125 I-RAP binding, probably mediated by cell surface heparan sulfate proteoglycan and endogenous receptors of the LDLR family.
- LRP6 expressing HTl 080 cells displayed -20% increase of RAP binding, and this increase was abolished by excess unlabeled Mesd (FIG. 8A).
- FIG. 8A binding of 125 I-RAP (5 nM) to LRP6-transduced HTl 080 cells and the control cells was carried out for 4 hours at 4°C in the absence (total) or presence of 500 nM RAP, or 500 nM Mesd.
- FIG. 8B binding of 125 I-MeSd (5 nM) to LRP6-transduced HT1080 cells was carried out for 2 hours at 4°C in the absence (total) or presence of various concentrations of RAP or 500 nM Mesd.
- RAP is a receptor antagonist for members of the LDLR family, and is able to inhibit the binding of most known ligands of the LDLR family members.
- DKKl is an LRP6-specific ligand and antagonist.
- FIG. 9 Myc-tagged DKKl binds to LRP6 cells (FIG. 9B) but not to the control cells (FIG. 9A). The presence of Mesd completely blocked the binding of Myc-DKKl to LRP6 at the cell surface (FIG. 9C).
- Serum-free conditioned medium was harvested from HEK293 cells transiently transfected with cDNA for human Myc-DKKl and allowed to bind to LRP6-transduced HTl 080 cells (B,C) and control cells (A) in the absence (A,B) or presence (C) of 1 ⁇ M Mesd.
- Cell-surface-bound Myc-tagged DKK proteins were fixed and detected by immunofluorescence staining with anti-Myc antibody.
- D DKKl binding to cell surface LRP6 is inhibited by Mesd.
- Binding of 125I-DKK1 (5 nM) to LRP6- transduced HT1080 cells or the control cells was carried out for 3 hours at 4°C in the absence (total) or presence of 500 nM RAP or 500 nM Mesd.
- E LRP6-mediated DKKl degradation is inhibited by Mesd.
- LRP6-mediated 125 I-Mesd (5 nM) degradation was carried out for 4 hours at 37°C in the absence or presence of 500 nM RAP or 500 nM Mesd. Values are the means of triple determinations with the s.d. indicated by error bars. Bar, 10 ⁇ m.
- Myc-tagged DKKl binds to LRP6 cells (FIG. 9B) but not to the control cells (FIG. 9A). Importantly, the presence of Mesd completely blocked the binding of Myc-DKKl to LRP6 at the cell surface (FIG. 9C).
- This example illustrates binding of Mesd polypeptide or an Mesd oligopeptide to LRP5 and LRP6.
- FIG. 1OA shows that both wild type Mesd and Mesd oligopeptide
- KGGGSKEKNKTKPEKAKKKEGDPKPRASKEDNRAGSR can reduce binding of l25 I-Mesd to LRP5 up to about 10-fold, while FIG. 1OC shows that both Mesd and the oligopeptide show even greater reduction of binding of 125 I-Mesd to LRP6.
- FIG. 10B shows that a small but significant reduction in binding of 125 I-DKKl to LRP5 was observed when the LRP5 was contacted with either Mesd or the oligopeptide
- FIG. 10D binding of 125 I-DKKl greater than 2-fold was observed when LRP6 was the target
- This example illustrates inhibition of WNT signalling in HEK293 cells.
- Wnt signaling was measured in HEK293 cells comprising TCF/LEF-Luc assays in cells were prepared as described above, and subjected to the treatments as shown in Table IV, with the results (i.e., luciferase activity) presented in FIG. 11.
- human LRP6 cDNA was cloned into the MMTV-SV40-Bssk vector, between the murine mammary tumor virus long terminal repeat (MMTV-LTR) and an SV40 large T antigen intron and polyadenylation signal. Prior to injection, the construct was linearized and purified. Transgenic mice were generated in the FVB/N inbred background and transgenic founders were identified by PCR testing for the presence of the transgene. Four founders were obtained and their offsprings were characterized for the expression of LRP6, extent of Wnt signaling, and mammary gland morphology by whole mount staining. FIG. 12.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Epidemiology (AREA)
- Immunology (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Organic Chemistry (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2008245425A AU2008245425A1 (en) | 2007-04-30 | 2008-04-30 | Methods and compositions for the treatment of cancer |
| BRPI0810207-4A2A BRPI0810207A2 (pt) | 2007-04-30 | 2008-04-30 | Métodos e composições para o tratamento de câncer |
| EP08747240A EP2150270A4 (en) | 2007-04-30 | 2008-04-30 | METHODS AND COMPOSITIONS FOR TREATING CANCER |
| CA002685737A CA2685737A1 (en) | 2007-04-30 | 2008-04-30 | Methods and compositions for the treatment of cancer |
| JP2010506618A JP2010526090A (ja) | 2007-04-30 | 2008-04-30 | 癌の治療のための方法および組成物 |
| US12/598,240 US8198236B2 (en) | 2007-04-30 | 2008-04-30 | Methods and compositions for the treatment of cancer |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US91490207P | 2007-04-30 | 2007-04-30 | |
| US60/914,902 | 2007-04-30 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2008134752A2 true WO2008134752A2 (en) | 2008-11-06 |
| WO2008134752A3 WO2008134752A3 (en) | 2008-12-24 |
Family
ID=39926323
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2008/062092 Ceased WO2008134752A2 (en) | 2007-04-30 | 2008-04-30 | Methods and compositions for the treatment of cancer |
Country Status (7)
| Country | Link |
|---|---|
| US (1) | US8198236B2 (OSRAM) |
| EP (1) | EP2150270A4 (OSRAM) |
| JP (1) | JP2010526090A (OSRAM) |
| AU (1) | AU2008245425A1 (OSRAM) |
| BR (1) | BRPI0810207A2 (OSRAM) |
| CA (1) | CA2685737A1 (OSRAM) |
| WO (1) | WO2008134752A2 (OSRAM) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2012526139A (ja) * | 2009-05-07 | 2012-10-25 | ノバルティス アーゲー | Dickkopf−1もしくはDickkopf−4または両方に対する結合分子の組成物および使用方法 |
| EP3265112A4 (en) * | 2015-01-19 | 2018-10-03 | Rappaport Family Institute For Research In The Medical Sciences | Ubiquitin ligase kpc1 promotes processing of p105 nf-kappab1 to p50, eliciting strong tumor suppression |
| USRE47860E1 (en) | 2011-11-04 | 2020-02-18 | Novartis Ag | Methods of treating cancer with low density lipoprotein-related protein 6 (LRP6)—half life extender constructs |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20080227698A1 (en) * | 2005-11-08 | 2008-09-18 | Washington University | Oligopeptides for treatment of osteoporosis and other bone diseases and methods thereof |
| EP2566892B1 (en) * | 2010-05-06 | 2017-12-20 | Novartis AG | Compositions and methods of use for therapeutic low density lipoprotein-related protein 6 (lrp6) antibodies |
| WO2014109519A1 (ko) * | 2013-01-10 | 2014-07-17 | 강원대학교산학협력단 | 작은안구증-연관 전사인자 유래의 펩타이드 및 이를 포함하는 조성물 |
| KR102073144B1 (ko) * | 2018-12-13 | 2020-02-04 | 주식회사 엘베이스 | 올리고펩티드를 유효성분으로 포함하는 암의 예방 또는 치료용 약학적 조성물 |
| CN114853847B (zh) | 2022-06-29 | 2022-09-27 | 中国农业大学 | 辣椒籽分离的寡肽ftle及其在预防或治疗癌症中的应用 |
Family Cites Families (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20030022293A1 (en) * | 1997-09-18 | 2003-01-30 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
| CA2388922A1 (en) * | 1999-11-19 | 2001-05-25 | Human Genome Sciences, Inc. | 23 human secreted proteins |
| US8637506B2 (en) * | 2003-09-22 | 2014-01-28 | Enzo Biochem, Inc. | Compositions and methods for bone formation and remodeling |
| EP1945240B1 (en) * | 2005-09-16 | 2016-12-28 | Raptor Pharmaceutical Inc | Compositions comprising receptor-associated protein (rap) variants specific for cr-containing proteins and uses thereof |
| US20080227698A1 (en) * | 2005-11-08 | 2008-09-18 | Washington University | Oligopeptides for treatment of osteoporosis and other bone diseases and methods thereof |
-
2008
- 2008-04-30 AU AU2008245425A patent/AU2008245425A1/en not_active Abandoned
- 2008-04-30 CA CA002685737A patent/CA2685737A1/en not_active Abandoned
- 2008-04-30 US US12/598,240 patent/US8198236B2/en not_active Expired - Fee Related
- 2008-04-30 BR BRPI0810207-4A2A patent/BRPI0810207A2/pt not_active IP Right Cessation
- 2008-04-30 EP EP08747240A patent/EP2150270A4/en not_active Withdrawn
- 2008-04-30 WO PCT/US2008/062092 patent/WO2008134752A2/en not_active Ceased
- 2008-04-30 JP JP2010506618A patent/JP2010526090A/ja active Pending
Non-Patent Citations (1)
| Title |
|---|
| See references of EP2150270A4 * |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2012526139A (ja) * | 2009-05-07 | 2012-10-25 | ノバルティス アーゲー | Dickkopf−1もしくはDickkopf−4または両方に対する結合分子の組成物および使用方法 |
| USRE47860E1 (en) | 2011-11-04 | 2020-02-18 | Novartis Ag | Methods of treating cancer with low density lipoprotein-related protein 6 (LRP6)—half life extender constructs |
| EP3265112A4 (en) * | 2015-01-19 | 2018-10-03 | Rappaport Family Institute For Research In The Medical Sciences | Ubiquitin ligase kpc1 promotes processing of p105 nf-kappab1 to p50, eliciting strong tumor suppression |
| US11452759B2 (en) | 2015-01-19 | 2022-09-27 | Technion Research & Development Foundation Limited | Ubiquitin ligase KPC1 promotes processing of P105 NF-κB1 to p50, eliciting strong tumor suppression |
Also Published As
| Publication number | Publication date |
|---|---|
| BRPI0810207A2 (pt) | 2014-10-14 |
| AU2008245425A2 (en) | 2010-01-07 |
| US8198236B2 (en) | 2012-06-12 |
| CA2685737A1 (en) | 2008-11-06 |
| WO2008134752A3 (en) | 2008-12-24 |
| AU2008245425A1 (en) | 2008-11-06 |
| US20100120685A1 (en) | 2010-05-13 |
| EP2150270A2 (en) | 2010-02-10 |
| JP2010526090A (ja) | 2010-07-29 |
| EP2150270A4 (en) | 2011-09-28 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP2150270A2 (en) | Methods and compositions for the treatment of cancer | |
| AU2017200612B2 (en) | Methods for treating fatty liver disease | |
| CN102482339B (zh) | 用于增加产热脂肪细胞的方法 | |
| Yanagisawa et al. | A novel interaction between kinesin and p120 modulates p120 localization and function | |
| EP3058986B1 (en) | Bmp-alk3 antagonists and uses for promoting bone growth | |
| US8603455B2 (en) | Removal promoters and inhibitor for apoptosis cells in vivo | |
| CA2331332A1 (en) | Anti-angiogenic proteins and methods of use thereof | |
| US20050147602A1 (en) | Compositions, methods and kits relating to CTHRC1, a novel modulator of collagen matrix | |
| Xu et al. | Analysis of molecular domains of epitope-tagged merlin isoforms in Cos-7 cells and primary rat Schwann cells | |
| EP1409507A2 (en) | Compositions, methods and kits relating to remodelin | |
| US6759047B1 (en) | Anti-angiogenic proteins and methods of use thereof | |
| JP2008013436A (ja) | 血管形成促進剤 | |
| AU766098B2 (en) | Thrombospondin-2 and uses thereof | |
| US20080227698A1 (en) | Oligopeptides for treatment of osteoporosis and other bone diseases and methods thereof | |
| JP4843595B2 (ja) | 生体内のアポトーシス細胞の除去促進剤及び除去阻害剤 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 08747240 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2685737 Country of ref document: CA Ref document number: 6399/CHENP/2009 Country of ref document: IN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2010506618 Country of ref document: JP Ref document number: 12598240 Country of ref document: US Ref document number: 2008747240 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2008245425 Country of ref document: AU |
|
| ENP | Entry into the national phase |
Ref document number: 2008245425 Country of ref document: AU Date of ref document: 20080430 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: PI0810207 Country of ref document: BR Kind code of ref document: A2 Effective date: 20091030 |