WO2007051207A2 - Kinase and ubiquination assays - Google Patents

Kinase and ubiquination assays Download PDF

Info

Publication number
WO2007051207A2
WO2007051207A2 PCT/US2006/060373 US2006060373W WO2007051207A2 WO 2007051207 A2 WO2007051207 A2 WO 2007051207A2 US 2006060373 W US2006060373 W US 2006060373W WO 2007051207 A2 WO2007051207 A2 WO 2007051207A2
Authority
WO
WIPO (PCT)
Prior art keywords
test sample
ubiquitin
substrate
protein
ret
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2006/060373
Other languages
English (en)
French (fr)
Other versions
WO2007051207A3 (en
Inventor
Kurt William Vogel
Steven Michael Riddle
Robert Aron Horton
Matthew Brian Robers
Gregory Allen Michaud
Thomas Machleidt
Kevin Vedvik
Kristin G Huwiler
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Life Technologies Corp
Original Assignee
Invitrogen Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Invitrogen Corp filed Critical Invitrogen Corp
Priority to EP06839622A priority Critical patent/EP1955071A4/en
Priority to JP2008538212A priority patent/JP2009513681A/ja
Publication of WO2007051207A2 publication Critical patent/WO2007051207A2/en
Publication of WO2007051207A3 publication Critical patent/WO2007051207A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/536Immunoassay; Biospecific binding assay; Materials therefor with immune complex formed in liquid phase
    • G01N33/542Immunoassay; Biospecific binding assay; Materials therefor with immune complex formed in liquid phase with steric inhibition or signal modification, e.g. fluorescent quenching
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/34Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving hydrolase
    • C12Q1/37Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving hydrolase involving peptidase or proteinase

Definitions

  • This invention relates to assays employing a fluorescent molecule and a luminescent metal complex and to methods for monitoring and measuring molecular interactions, such as competitive binding or enzymatic activity (e.g., kinase, de-ubiquinating or ubiquination activity).
  • molecular interactions such as competitive binding or enzymatic activity (e.g., kinase, de-ubiquinating or ubiquination activity).
  • Ubiquitination primarily serves as a targeting signal, and proteins carrying the most common type of poly-Ubiquitm chain are targeted for destruction by the ubiquitin- proteasome pathway, responsible for the majority of cytosolic proteolysis (Ciechanovcr ct al., Proc. Nail. Acad. Sci. USA 5 95, 2727-30, 1998).
  • Ubiquiiin (Ub) is attached Io proteins through an isopeptidc linkage, involving the C-terminal carboxylatc of Ub and the C-KH2 of a lysine side chain, (Ciechanovcr ct al., MoI Biol Rep, 26, 59-64, 1999; Hodgins et al., J.
  • the enzyme cascade involved in Ub-conjugation and poly-Ub chain formation comprises at least three distinct sets of enzymatic activities including the Ub activating enzyme El , Ub-conjugating enzymes (El) and E3 ligases (reviewed in Hershko and Ciechanovcr, Annu Rev Bioch ⁇ m, 67, 425-79, 1998).
  • DUBs deubiquitinating enzymes
  • DCEs deconjugating enzymes
  • UBPs hydrolyze isopeptide bonds between Ub and folded protein domains, such as additional Ub moieties or target proteins.
  • UBPs exhibit broad substrate specificity (Wilkinson, FASEBJ, 11, 1245-56, 1997).
  • UCHs generally cleave bonds between Ub and an unfolded polypeptide or Ub and small substituents (Pickart et al., J.Biol. Chem., 260, 7903-10, 1985; Wilkinson, FASEB J, 11, 1245-56, 1997; Wilkinson et al., Biochemistry, 25, 6644-9, 1986).
  • Small Ubiquitin-related Modifier (SUMO) proteins are small proteins that are covalently attached to and detached from other proteins in cells to modify their function. SUMOylation is a post-translational modification involved in various cellular processes, such as miclear-cytosolic transport, transcriptional regulation, apoptosis, protein stability, response to stress, and progression through the cell cycle. SUMO proteins are similar to ubiquitin ( ⁇ lrich, Trends Cell Biol. 2005 Oct; 15(10):525-32). In contrast to ubiquitin, SUMO is typically not used to tag proteins for degradation. The protein is typically not active until the last four amino acids of the C-terminus have been cleaved off.
  • non-radioactive kinase assays depend on phosphorylation of a chemically synthesized peptide substrate of up to approximately 20 residues.
  • larger native substrates such as whole proteins or protein domains
  • they can be the "native" substrate of a kinase in a biologically relevant pathway.
  • the use of "native" substrates is a desirable feature for many practitioners of kinase assays. As an example, it Is known that some kinases require a "docking" site far removed from the site of phosphorylation, in order to be phosphorylated. In some cases, smaller peptide substrates do not function as substrates.
  • Drug discovery can involve the systematic and/or high-throughput screening of diverse chemical libraries containing thousands of members.
  • Luminescence-based techniques including fluorescence polarization (FP), resonance energy transfer (RET), and luminescence resonance energy transfer methods (LRET) methods, are typically highly sensitive, homogenous methods for probing molecular interactions.
  • Background luminescence e.g., fluorescence or luminescence from assay components
  • non-specific interactions of assay components can limit the sensitivity of luminescence-based assays, particularly when luminophores having short lifetimes are used, resulting in the detection of false positives or false negatives in a drug or compound screen.
  • follow-up screening of individually-picked compounds or the use of multiple screens may be required to validate screen results. It would be useful to have screening methodologies that could increase the information content of fluorescent or luminescent assays and reduce the number of spurious results encountered in drug screens.
  • the invention provides compositions, methods, apparatuses, and kits useful for monitoring molecular interactions, including competitive binding events and those resulting from enzymatic activities.
  • the invention provides compositions and methods for detection and/or identification of molecular modification (e.g., post-translation modification) events, as well as detection and/or identification of molecular modification activities.
  • the result of molecular modification events are detected by changes in optical properties (e.g., changes in optical properties of (1) the molecules which are modified or (2) a composition which contains these molecules).
  • the invention utilizes a donor moiety (e.g., a luminescent metal complex (e.g. Terbium)) and an acceptor moiety (e.g., a fluorescent protein or polypeptide (e.g. GFP)).
  • a luminescent metal complex e.g. Terbium or Europium
  • a fluorophore e.g. fluorescein
  • the invention provides a method of measuring enzymatic activity utilizing a fluorescent molecule and a luminescent metal complex.
  • the fluorescent molecule and luminescent metal complex are located on two binding partners, respectively.
  • the fluorescent molecule and luminescent metal complex are located on one molecule, e.g. the substrate for an enzyme.
  • the activity of an enzyme(s) e.g. ubiquitination enzymes
  • each of the two molecules comprises one part of a resonance energy transfer pair.
  • one molecule comprises a fluorescent molecule and the other molecule comprises a luminescent metal complex.
  • one molecule comprises both parts of a RET pair (e.g. creating a RET capable molecule).
  • this molecule comprises both a fluorescent molecule and a luminescent metal complex.
  • the present invention includes related compositions, for example, a composition comprising two molecules that each comprises one part of a resonance energy transfer pair.
  • the composition can optionally include an enzyme capable of "ligating" the two molecules.
  • the activity of the enzyme disrupts or inhibits a RET capable molecule or the formation of a RET capable complex.
  • the activity of an enzyme(s) e.g., deubiquinating enzyme or protease
  • cleaves a molecule comprised of a fluorescent molecule and a luminescent metal complex e.g. disrupting a FRET capable molecule.
  • the activity of an enzyme(s) phosphorylates or dephosphorylates (e.g., modulates phosphorylation) a molecule comprised of a fluorescent molecule or a luminescent metal complex.
  • the invention provides a method for measuring the effect of a test compound on binding between a first binding partner and a second binding partner.
  • the method includes contacting a first binding partner, a second binding partner, and a test compound (e.g., a kinase or small molecule drug candidate) to form a test sample.
  • a test compound e.g., a kinase or small molecule drug candidate
  • the first binding partner and the second binding partner includes a luminescent metal complex, while the other includes a fluorescent acceptor moiety.
  • a first binding partner and a second binding partner are capable of binding to one another to form a complex.
  • a test sample is exposed to light and the fluorescent emission from the test sample is measured.
  • the test sample is exposed to light having a wavelength in the range from 100 nm to 2000 nm and the fluorescence emission of the test sample is measured.
  • the test compound is identified as affecting binding between the first binding partner and the second binding partner when the fluorescence emission measurement of the test sample is different from the fluorescence emission measurement of a corresponding control sample, e.g., lacking the test compound.
  • the emission (e.g., fluorescence) measurements) involves a ratiometric calculation.
  • a ratiometric calculation comprises a ratio of the fluorescence emission of a test sample versus a control sample.
  • a ratiometric calculation comprises a ratio of the fluorescence emission of the acceptor molecule (e.g., fluorescein or GFP) versus the fluorescence emission of the donor molecule of a RET pair (e.g., lanthanide metal complex).
  • a ratiometric measurement comprises both a ratio of fluorescence emission of the test sample versus the control sample and a ratio of the fluorescence emission of the acceptor molecule (e.g., fluorescein or GFP) versus the fluorescence emission of the donor molecule of a RET pair (e.g., lanthanide metal complex).
  • a first binding partner and a second binding partner can be independently selected from the group consisting of a protein or polypeptide, a polynucleotide, a lipid, a polysaccharide, a hormone, and a small organic compound.
  • a polypeptide can be an antibody or antibody fragment.
  • Fluorescent acceptor moieties can be selected from, but not limited to, the group consisting of fluorescein, rhodamine, GFP, GFP derivatives, FITC, 5-FAM, 6-FAM, 7-hydroxycoumarin-3-carboxamide, 6-chloro-7- hydroxycoumarin-3-carboxamide, f ⁇ uorescein-5-isothiocyanate, dichlorotriazinylaminofluorescein, tetramethylrhodamine-5-isothiocyanate, tetramethylrhodamine-6-isothiocyanate, succinimidyl ester of 5-carboxyfiuorescein 5 succinimidyl ester of 6-carboxyfluorescein, 5-carboxytetramethylrhodamine, 6- carboxymethylrhodamine, and 7-amino-4-methylcoumarin-3-acetic acid.
  • donor moieties include a luminescent metal complex such as a lanthanide metal complex.
  • a lanthanide metal complex can include an organic antenna moiety, a metal liganding moiety and a lanthanide metal ion.
  • a lanthanide metal ion can be selected from the group consisting of: Sm(III), Ru(III), Eu (III), Gd(III), Tb(III), and Dy(III).
  • the lanthanide metal ion is terbium (Tb).
  • An organic antenna moiety can be selected from the group consisting of: rhodamine 560, fluorescein 575, fluorescein 590, 2- quinolone, 4-quinolone, 4-trifluoromethylcoumarin (TFC), 7-diethyl-amino-coumarin-3- carbohydrazide, 7-amino-4-methyl-2-coumarin (carbostyril 124), 7-arnino-4-methyl-2- coumarin (coumarin 120), 7-amino-4-trifluoromethyl-2-coumarin (coumarin 124), and aminomethyltrimethylpsoralen.
  • a metal liganding moiety can be a metal chelating moiety selected from the group consisting of: EDTA 5 DTPA, TTHA 5 DOTA 5 NTA 5 HDTA 5 DTPP, EDTP 5 HDTP 5 NTP 5 DOTP 5 DO3A, DOTAGA, and NOTA.
  • a lanthanide metal complex has a structure: -L n -A-S n -C]Vr, or
  • a method includes contacting an enzyme(s) (e.g., kinase, protease, de-ubiquitinating enzyme, ubiquination enzyme) with a substrate(s) for the enzyme and measuring the enzymatic product.
  • an enzyme(s) e.g., kinase, protease, de-ubiquitinating enzyme, ubiquination enzyme
  • the enzymatic reaction is performed in the presence of a modulator or potential modulator of the enzymatic activity.
  • the enzyme, substrate(s), and potential modulator are then contacted with a first binding partner and a tracer to form a test sample.
  • the first binding partner has binding specificity for either the enzymatic product or the substrate of the enzymatic activity.
  • a first binding partner is capable of binding the tracer.
  • the tracer can be unlabeled or it can include a luminescent metal complex or a fluorescent acceptor moiety, e.g., a "luminescent tracer.”
  • a luminescent metal complex e.g. Terbium
  • the other includes a fluorescent acceptor moiety.
  • a first binding partner and a substrate includes a luminescent metal complex, while the other includes a fluorescent acceptor moiety (e.g., fluorescein or GFP).
  • a test sample is then exposed to light and the fluorescent emission from the test sample is measured.
  • the test sample is exposed to one wavelength of light or a range of wavelengths (e.g., a lOnm, 15nm, 20 nm, 30nm, or 50nm band or range of wavelength).
  • the test sample can also be exposed to light having at least one wavelength in the range from 100 nm to 2000 nm (e.g., a wavelength of light in the range from 250 nm to 750 nm, 250 nm to 300 nm, 250 nm to 400 nm, 250 nm to 500 nm, 250 nm to 600 nm, 250 nm to 700 nm, 350 nm to 700 nm, 450 nm to 700 nm, 500 nm to 1000 nm, 1000 ran to 2000 nm, 100 nm to 400 ran, etc.) and the fluorescence emission from the test sample is measured.
  • a potential modulator is identified as a modulator of the enzymatic activity when the fluorescence emission measurement of the test sample is different from the fluorescence emission measurement of a corresponding control sample lacking or containing less of the potential modulator.
  • the fluorescence emission of a test sample or a control sample can be measured at two or more wavelengths. In one embodiment, a ratio of fluorescence emission measurements of a test sample or a control sample at two wavelengths is calculated.
  • An enzymatic activity can be selected from the group consisting of kinase activity, phosphatase activity, glucuronidase activity, prenylation, glycosylation, methylation, demethylation, acylation, acetylation, ubiquitination, deubiquitination, sulfation, proteolysis, nuclease activity, nucleic acid polymerase activity, nucleic acid reverse transcriptase activity, nucleotidyl transferase activity, and polynucleotide translation activity.
  • components of the assays can be from various sources, e.g., purified, partially purified and/or cell lysates. Each component may be from the same, different or various combinations of sources.
  • an enzyme ⁇ e.g., kinase, ubiquitinase (ubiquitinating enzyme), or DUB, and protease
  • a cell lysate e.g., kinase, ubiquitinase (ubiquitinating enzyme), or DUB, and protease
  • the substrate or potential substrate for the enzyme is from a cell lysate.
  • protease e.g., DUB
  • a genetically encoded acceptor fluorophore avoids difficult "orthogonal'" labeling strategies to site-specifically incorporate two distinct fluorophores into a single protein.
  • labeled proteins arc typically prepared through a random labeling of surface-accessible amine groups.
  • preparing enzyme substrates as fluorescent protein fusions leads to improved lot-to-lot consistency of the substrate, which is a consideration m developing reagents for high-throughput screening applications.
  • Some embodiments of the invention provide cellular based assays.
  • the cell expresses a fusion protein comprising a label ⁇ e.g., an acceptor label, a donor label or a fluorescent protein such as a GFP) and a substrate for a post-translational modification (e.g., a substrate for ubiquitination or a potential ubiquitination substrate), wherein the status of the post-translationa! modification and/or rate of post-translational modification of the substrate or a potential ubiquitination.
  • a binding partner e.g., an antibody
  • thai preferentially binds the modified or unmodified substrate fusion protein.
  • Some embodiments provide methods for determining if a compound is a modulator of a post-transiationai modification. Some embodiments provide an. assay for determining, monitoring or quantitating the post-translational modification comprising expressing the fusion protein in a cell, lysmg the cell and contacting the cell Iy sate (e.g., a crude, partially purified or purified cell lysatc) with a binding partner whose binding is regulated by the postradiational modification. For example, the binding partner may bave a greater affinity for the unmodified as compared to the post-translationally modified protein or vice versa.
  • the binding partner may bave a greater affinity for the unmodified as compared to the post-translationally modified protein or vice versa.
  • the binding partner binds a compound (e.g., a peptide or a polypeptide) that is added, attached to or associated with the substrate fusion protein as part of the post- translational modification. In some embodiments, the binding partner binds a compound ⁇ e.g., a peptide or a polypeptide " ) that is removed or disassociated from the substrate fusion protein as part of the post-transiationai modification.
  • a compound e.g., a peptide or a polypeptide
  • the binding partner is labeled. In some embodiments, the binding partner comprises a label that is capable of forming a RET pair with the label on the fusion protein. In some embodiments, the binding partner (e.g., an antibody) is not labeled. In some aspects of the invention, the binding partner i& utilized to preferentially immobilize the modified or un-modified substrate/label fusion protein. Then the binding can be detected, e.g., by exciting and detecting the label of the fusion protein.
  • ubiquitination assays are cither performed without intact/living cells or use lysed-cell starting points or semi-purified systems to assay protein ubiquicination.
  • the inventors describe herein assays that utilize a living cell (starting point). Additionally, these cellular based assays can be used, inter alia, to test the ability of a compound to diffuse into a living cell or act on the cell surface ⁇ e.g., bind and/or block a receptor) and inhibit, enhance/up-regulate or modulate an activity of a ubiquitination machinery or a pathway in the context of the living cell.
  • the cellular assays of the invention can be utilized for high-throughput and m some embodiments take advantage of the user friendly qualities of existing TR-FRET assays. Some embodiments of the invention involve a set of generic TR-FRET ubiquitin reagents for both ubiquitination and deubiquitination.
  • TR- FRET donor e.g., terbium
  • acceptors e.g., fluorescein or fluorescent proteins
  • the time resolved signal from the terbium donor reduces the amount of interference from color quenchers and autofluorescent compounds that are frequently encountered in compound libraries.
  • TR-FRET ubiquitin platforms are provided herein as a simple, flexible set of reagents to accelerate compound screening to identify specific inhibitors of ubiquitin conjugating and deubiquitinating enzymes.
  • An article of manufacture such as a kit, can include packaging material; and a first binding partner and/or a second binding partner, where the second binding partner is capable of binding the first binding partner.
  • a binding partner can comprise a luminescent metal complex or a fluorescent acceptor moi ⁇ ty.
  • the article of manufacture comprises a fusion protein comprised of a fluorescent peptide domain, ⁇ e.g. GFP) and a ubiquitin domain, wherein said ubiquitin domain is linked to a luminescent metal complex (e.g., Terbium).
  • a composition in another aspect, can be a first binding partner, a second binding partner, or a mixture thereof.
  • a binding partner can include a fluorescent acceptor moiety or a luminescent metal chelate.
  • a composition comprises a fusion protein comprised of a fluorescent peptide domain (e.g. GFP) and a ubiquitin domain, wherein said ubiquitin domain is linked to a luminescent metal complex (e.g., Terbium).
  • a fluorescent peptide domain e.g. GFP
  • a ubiquitin domain e.g., Terbium
  • Figure 1 is a schematic indicating one embodiment of a TR-RET assay.
  • Figure 2 demonstrates the structure of a lanthanide metal chelate comprising an organic antenna moiety and the transfer of energy from the organic antenna moiety to the lanthanide metal ion.
  • Figure 3 demonstrates the chemical structure of two luminescent metal chelates comprising organic antenna moieties.
  • Figure 4 demonstrates the normalized excitation/emission spectrum for a terbium chelate comprising an organic antenna moiety (CS 124).
  • Figure 5 is a terbium chelate emission spectrum, demonstrating the overlap of terbium emission bands with fluorescein and rhodamine excitation bands and the location of fluorescein and rhodamine emission bands in regions having minimal terbium emission.
  • Figure 6 demonstrates an overlap of the terbium chelate and fluorescein spectra.
  • Figure 7 demonstrates an overlap of the terbium chelate and rhodamine spectra.
  • Figure 8 demonstrates the absorbance profile of a chelate and a chelate-antibody conjugate.
  • Figure 9 depicts embodiments of the invention which relates to methods of measuring kinase activity.
  • Figure 10 depicts one embodiment of the invention which relates to methods of measuring de-ubiquinating activity.
  • FIG 11 depicts non-limiting examples of ubiquitin substrates that can be utilized in the present invention.
  • HE & HF utilize a terbium labeled antibody.
  • a fluorescent acceptor e.g., a GFP polypeptide or protein
  • GFP is depicted as an example of a label and as an example of an acceptor label.
  • Terbium (Tb) is depicted as an example of a label and as an example of a donor label.
  • the invention is not meant to be limited to GFP or Tb but contemplates the use of essentially any labels including any compatible donor or acceptor labels for RET.
  • any time the term ubiquitin is used in the figure it can refer to either mono-ubiquitin or poly-ubiquitin or any ubiquiton.
  • SA-Streptavidin B-Biotin
  • Figures 12A and 12B show the results of assays measuring deubiquinating activity.
  • Figures 13 - 19 shows the results of assays measuring kinase activity.
  • Figure 20 shows the results of an assay of JNKl and JNK2 using c-Jun-GFP fusion substrate.
  • Figure 21 shows an assay demonstrating selective inhibition of p38 iso forms using ATF2-GFP as a substrate.
  • Figure 22 shows a graphical representation of an Intrachain TR-FRET Ubiquitination
  • Figure 23 shows a representative bar graph of the TR-FRET signal witnessed with a LanthaScreenTM Intrachain Ubiquitination reaction and the corresponding controls.
  • Figure 24 shows representative Z' data for an Intrachain Ubiquitination reaction.
  • the negative control (-) is the reaction mixture without the ATP solution.
  • the dashed lines represent two standard deviations.
  • Figure 25 shows an inhibition curve of an Intrachain TR-FRET Ubiquitination assay with methylated-ubiquitin.
  • Methylated-ubiquitin is unable or has the decreased ability to form poly-ubiquitin chains due to the methylation of the lysine residues within the protein, therefore preventing or inhibiting the formation of intrachain TR-FRET pairs.
  • Figure 26A shows an example of a ubiquitination assay with a GFP/P53 fusion protein and terbium-ubiquitin (terbium labeled ubiquitin). If the DNA sequence of the target protein (in this case p53) is known, a fusion product with a fluorescent protein or polypeptide (e.g., GFP) can be formed. For example a p53-GFP fusion protein can be used in a ubiquitination assay with terbium-ubiquitin to monitor the ubiquitination of p53.
  • Figure 26B shows a Tb-Streptavidin/Biotin-Ubiquitin format.
  • GFP acts as the TR-FRET acceptor and can be read with standard filter sets, e.g., LanthaScreenTM standard filter sets (Invitrogen, Carlsbad, CA).
  • Figure 27 shows examples of various ubiquination assay formats utilizing fluorescein labeled antibodies. A similar format may be utilized wherein the antibody is labeled with
  • terbium and the ubiquitin is labeled with fluorescein.
  • a similar format may be utilized wherein the antibody is labeled with an acceptor moiety of a RET pair and the ubiquitin is labeled a donor moiety of the RET pair.
  • Another similar format can be utilized wherein a labeled antibody binds directly to the protein to be ubiquitinated, e.g., instead of binding to a "tag" or indirectly binding through a primary antibody.
  • Figure 28 shows a general principle for a fluorescent protein-based TR-FRET kinase assay.
  • Figure 29 depicts detection of ubiquitination of a fusion protein comprising a ubiquitination substrate (e.g., I ⁇ B ⁇ ) and an acceptor label (e.g., GFP).
  • the fusion protein is expressed in a cell.
  • the cell is exposed to conditions and/or compounds to determine if they modulate (e.g., the rate of) ubiquitination of the substrate.
  • the cell is then lysed and exposed to a binding partner which binds ubiquitin (e.g., poly-ubiquitin) and wherein the binding partner is labeled with a donor label that forms a FRET pair with the acceptor label of the fusion protein.
  • Ubiquitination is detected via FRET, e.g., a change in emission of the acceptor and/or donor.
  • Figure 30 shows data from a cellular ubiquitination assay as described herein, e.g., see Example 23 below.
  • Panels A shows data using an anti-ubiquitin labeled antibody.
  • Panel B shows data using an anti-polyubiquitin labeled antibody.
  • Figure 31 depicts protein ubiquitination on protein arrays.
  • (A) Protein arrays containing p53 and c-Jun proteins were incubated with enzymes for protein ubiquitination in the presence of fluorescein ubiquitin or biotin-ubiquitin. To detect ubiquitination for arrays treated with biotin-ubiquitin, arrays were also treated with streptavidin-AF647 (SA647). A negative control was also performed in which an array was treated with only SA647.
  • FIG. 32A depicts a map of pcDNA6.2-N-EmGFP-DEST.
  • Figure 32B shows a coding sequence for an EmGFP-IkBa (SEQ ID NO:27).
  • Figure 33 depicts a biotm/streptavidin format for ubiquitination (e.g., polyubiquitination).
  • the streptavidin is attached to a Ub and a labeled biotin (e.g., Tb labeled) binds to the streptavidin-Ub.
  • a streptavidin/biotin complex can be on the target protein with the other member of the FRET pair on a Ub.
  • a streptavidin/biotin complex can be on a Ub with the other member of a FRET pair on a target protein.
  • the streptavidin complex contains a donor member of a FRET pair.
  • the streptavidin complex contains an acceptor member of a FRET pair.
  • Figure 34 shows representative data from an anti-epitope ubiquitination assay with GST-UbcHl.
  • the anti-epitope ubiquitination assay has a good signal-to-background compared to controls (A), and methylated ubiquitin will compete with fluorescein-ubiquitin for attachment to the GST-UbcHl (B).
  • the results of 23 positive control wells (standard ubiquitination reaction conditions) and 23 negative controls wells (standard ubiquitination reaction without ATP) give a Z' value of 0.88 for the anti-epitope ubiquitination assay.
  • Figure 35 shows representative data from an endpoint intrachain ubiquitination assay with UbcHl.
  • the dashed lines represent ⁇ 3 standard deviations.
  • FIG 36 shows representative data from a Biotin/Streptavidin ubiquitination assay with UbcHl .
  • the Biotin/Streptavidin ubiquitination assay has a good signal-to-background compared to controls (A) and methylated ubiquitin will compete with the ability of biotin and fluorescein-ubiquitin to form polyubiquitin chains (B).
  • the results of 21 positive control wells (standard ubiquitination reaction conditions) and 21 negative controls wells (standard ubiquitination reaction without ATP) give a Z' value of 0.8 for the Biotin/Streptavidin ubiquitination assay (C).
  • the dashed lines represent + 3 standard deviations.
  • Figure 37A shows results from an assay for LPS induced phosphorylation of GFP- ATF2 in THPl cell lysates.
  • Figure 37B shows results for inhibition of JNK activation by SP600125 measured in THPl cell lysates.
  • Figure 38A shows TNF- ⁇ induced phosphorylation of GFP-I ⁇ - ⁇ in HEK293 GFP- I ⁇ -a cells.
  • Figure 38B shows inhibition of TNF- ⁇ induced phosphorylation of GFP-I ⁇ B ⁇ .
  • Figure 39A shows cleavage of a SUMOl deconjugating substrate (Topaz-SUMOl- Tb) and a Nedd ⁇ deconjugating substrate (Topaz-Nedd8-Tb) by SENPl and NEDPl, respectively.
  • Figure 39B shows cleavage of a SUMO2 (Topaz-SUMO2-Tb) and a SUMO3 (Topaz-SUMO3-Tb) deconjugating substrate by SENP2.
  • Figure 40 shows representative data of an anti-epitope TR-FRET SUMOylation assay of GST-SPlOO with a fluorescein-SUMO 1/2/3 and a Tb-anti-GST antibody.
  • Figure 41 A shows the results when GFP-Ub-Tb was tested as a substrate (at 10 nM) against UCH-L3 ( ⁇ ), USP-2 (•), USP-15 (A), UCH-Ll (T), USP-5 ( ⁇ ) and USP-14 (o). USP- 14 is not expected to show activity in the absence of association with components of the 26S proteasome. USP-2 and USP-15 are indistinguishable.
  • Figure 41B shows the results when tight-binding DUB inhibitor, ubiquitin aldehyde, was titrated against 0.1 nM UCH-L3 and 10 nM GFP-Ub-Tb and shown to inhibit the reaction with an IC50 of 0.2 nM.
  • Figure 41C shows a sigmodial dose response (variable slope) to obtain the EC 5 O value for a titration of a YFP-ubiquitin— Tb substrate as described in Example 12.
  • Figure 42A shows cleavage of cAMP by phosphodiesterase to form AMP.
  • FIG. 42B shows a generic strategy for phosphodiester synthesis.
  • Figure 42C depicts cAMP and shows analogs that are available with linkers attached at various positions.
  • Figure 42D depicts detection of fluorescein labeled AMP using a Tb-anti AMP antibody.
  • Figure 42E shows an exemplary method for detection of PDE activity using phosphotyrosine as the recognition element.
  • Figure 42F shows an exemplary method for detection of PDE activity using bis-(fluorescem-tyrosine) phosphate as the substrate
  • t-Boc tert-butyloxycarbonyl
  • BzI benzyl
  • PTK protein tyrosine kinase
  • Fmoc fluorenyhnethyloxycarbonyl
  • ELISA enzyme-linked irnmuno absorbant assay
  • FP fluorescence polarization
  • FITC fluorescein isothiocyanate
  • RET resonance energy transfer
  • FRET fluorescence resonance energy transfer or Forster resonance energy transfer
  • TR time resolved
  • FAM carboxyfluorescein.
  • antibody and antibodies include polyclonal antibodies, monoclonal antibodies, humanized or chimeric antibodies, single chain Fv antibody fragments, Fab fragments, and F(ab) 2 fragments.
  • Polyclonal antibodies are heterogeneous populations of antibody molecules that are specific for a particular antigen, while monoclonal antibodies are homogeneous populations of antibodies to a particular epitope contained within an antigen.
  • a chimeric antibody is a molecule in which different portions are derived from different animal species, such as those having a variable region derived from a mouse monoclonal antibody and a human immunoglobulin constant region.
  • epitope refers to an antigenic determinant on an antigen to which an antibody binds.
  • Epitopes usually consist of chemically active surface groupings of molecules such as amino acids, sugar side chains, or chemical moieties (e.g., from organic compounds) and typically have specific three- dimensional structural characteristics as well as specific charge characteristics.
  • Epitopes can consist of a series of contiguous amino acids, e.g., 5 contiguous amino acids.
  • an epitope can be a discontinuous epitope, e.g., the epitope is a particular arrangement of amino acids in space that results from the secondary, tertiary, and/or quaternary folding of a protein or polypeptide.
  • an epitope can consist of a modified amino acid side chain, e.g., a phosphorylated tyrosine, serine, or threonine.
  • Monoclonal antibodies are particularly useful in the present invention.
  • RET means resonance energy transfer, and refers to the radiationless transmission of an energy quantum from its site of absorption (the donor) to the site of its utilization (the acceptor) in a molecule, or system of molecules, by resonance interaction between donor and acceptor species, over distances considerably greater than interatomic, without substantial conversion to thermal energy, and without the donor and acceptor coming into kinetic collision.
  • a donor is a moiety that initially absorbs energy (e.g. , optical energy or electronic energy).
  • a luminescent metal complex as described herein can comprise two donors: 1) an organic antenna moiety, which absorbs optical energy (e.g., from a photon); and 2) a lanthanide metal ion, which absorbs electronic energy (e.g., transferred from an organic antenna moiety).
  • RET is sometimes referred to as fluorescent resonance energy transfer or Forster resonance energy transfer (both abbreviated FRET).
  • FRET can be used to detect proximity between fluorescent molecules. If the emission spectrum of the donor overlaps with the excitation spectrum of the acceptor (for example, in the case of a terbium chelate and a fluorescent protein or polypeptide), energy transfer takes place when the molecules are proximal. Because of the long fluorescent lifetime of terbium chelates, energy transfer can be detected after interferences from other fluorescent molecules or from scattered light has dissipated.
  • acceptor refers to a chemical or biological moiety that accepts energy via resonance energy transfer.
  • acceptors may re-emit energy transferred from a donor fluorescent or luminescent moiety as fluorescence (e.g. , RET or TR-RET) and are "fluorescent acceptor moieties.”
  • a donor fluorescent or luminescent moiety and an acceptor fluorescent moiety are referred to as a "RET pair.”
  • acceptors include coumarins and related fluorophores; xanthenes such as fluoresceins and fluorescein derivatives; fluorescent proteins such as GFP and GFP derivatives; rhodols, rhodamines, and derivatives thereof; resorufins; cyanines; difluoroboradiazaindacenes; and phthalocyanines.
  • label refers to the inclusion of a luminescent metal complex or a fluorescent acceptor moiety on a first binding partner, second binding partner, tracer, test compound, potential modulator, substrate, or product, as described herein.
  • Methods for incorporation of labels include expression as fusion proteins, covalent attachment through chemical ligation, and non covalent attachment such as those mediated by ligand-protein domain interactions such as biotin-avidin or FKBP ligands and FKBP, or through antibody mediated interactions with antibody targets.
  • modulates refers to partial or complete enhancement or inhibition of an activity or process (e.g., by attenuation of rate or efficiency).
  • modulator refers to a chemical compound (naturally occurring or non- naturally occurring), such as a biological macromolecule (e.g., polynucleotide, protein or polypeptide, hormone, polysaccharide, lipid), an organic molecule (e.g., a small organic molecule), or an extract made from biological materials such as bacteria, plants, fungi, or animal (particularly mammalian, including human) cells or tissues.
  • a biological macromolecule e.g., polynucleotide, protein or polypeptide, hormone, polysaccharide, lipid
  • an organic molecule e.g., a small organic molecule
  • an extract made from biological materials such as bacteria, plants, fungi, or animal (particularly mammalian, including human) cells or tissues.
  • Modulators may be evaluated for potential activity as inhibitors or enhancers (directly or indirectly) of a biological process or processes (e.g., agonist, partial antagonist, partial agonist, inverse agonist, antagonist, antineoplastic agents, cytotoxic agents, inhibitors of neoplastic transformation or cell proliferation, cell proliferation-promoting agents, and the like) by inclusion in screening assays described herein.
  • a biological process or processes e.g., agonist, partial antagonist, partial agonist, inverse agonist, antagonist, antineoplastic agents, cytotoxic agents, inhibitors of neoplastic transformation or cell proliferation, cell proliferation-promoting agents, and the like.
  • the activity of a modulator may be known, unknown, or partially known.
  • non-naturally occurring refers to the fact that an object, compound, or chemical cannot be found in nature.
  • a polypeptide, protein or polynucleotide that is present in an organism (including viruses) that can be isolated from a source in nature and which has not been intentionally modified by man in the laboratory is naturally- occurring, while such a polypeptide or polynucleotide that has been intentionally modified by man is non-naturally occurring.
  • organic molecule refers to compounds having a molecular skeleton containing a covalent arrangement of one or more of the elements C, N, H, O, S, and P, and typically having a molecular weight less than 10000 Daltons.
  • Organic molecules having a molecular weight less than 5000 Daltons may be referred to as "small organic molecules.”
  • polypeptide refers to a polymer of two or more amino acids joined together through amide bonds.
  • a polypeptide can be an entire protein (e.g., isolated from a natural source or an expression system), a fragment of a protein, an enzymatically or chemically synthesized and/or modified version of a protein or protein fragment, or an amino acid sequence designed de novo (e.g., not based on a known protein sequence).
  • Polypeptides can be 2-1000 amino acids in length (e.g., 2-900, 2-800, 2-700, 2-600, 2-500, 2-480, 2-450, 2-300, 2-200, 2-100, 2-50, 2-25, 5-900, 5-800, 5-700, 5-600, 5-500, 5-450, 5-300, 5-200, 5- 100, 5-50, 5-25, 10-900, 10-800, 10-700, 10-600, 10-500, 10-450, 10-300, 10-200, 10-100, 10-50, 20-900, 20-800, 20-700, 20-600, 20-500, 20-450, 20-300, 20-200, 20-100, or 20-50 amino acids in length).
  • 2-1000 amino acids in length e.g., 2-900, 2-800, 2-700, 2-600, 2-500, 2-480, 2-450, 2-300, 2-200, 2-100, 2-50, 2-25, 5-900, 5-800, 5-700, 5-600, 5-500, 5-450, 5-300, 5-200, 5- 100, 5-50, 5-25, 10-900, 10-800, 10-700, 10-
  • Amino acids may be natural or unnatural amino acids, including, for example, beta-alanine, phenylglycine, and homoarginine.
  • All of the amino acids used in the present invention may be either the D- or L-isomer.
  • Particularly useful chemically modified or substituted amino acids including phosphorylated (e.g., phospho-serine (phosphorylated at the hydroxyl of the side chain), phospho-tyrosine (phosphorylated at the OH of the side- chain phenyl ring), and phospho-threonine (phosphorylated at the hydroxyl of the size chain)), sulfated, methylated, or prenylated amino acids.
  • phosphorylated e.g., phospho-serine (phosphorylated at the hydroxyl of the side chain), phospho-tyrosine (phosphorylated at the OH of the side- chain phenyl ring), and phospho-threonine (phosphorylated at the hydroxyl of the size chain)
  • post-translational modification and “post-translational type modification” are used interchangeably and refer to enzymatic or non-enzymatic modification of one or more amino acid residues in a protein or polypeptide.
  • Typical modifications include phosphorylation, dephosphorylation, glycosylation, methylation, sulfation, ubiquitination, acylation, acetylation, prenylation, and ADP-ribosylation.
  • Preferred post-translational type modifications include phosphorylation and dephosphorylation.
  • the term post-translational modification includes non-covalent modifications that may affect protein or polypeptide activity, structure, or function, such as polypeptide-polypeptide interactions or the binding of ligands, allosteric modulators, other modulators, or second messengers such as calcium, cAMP, or inositol phosphates.
  • test compound refers to a compound to be tested by one or more screening method(s) of the invention, e.g., to determine if it is a putative modulator of an enzymatic activity such as a kinase activity.
  • a test compound can be any chemical, such as an inorganic chemical, an organic molecule, a protein or polypeptide, a carbohydrate, a polynucleotide, a polysaccharide, a lipid, a phospholipid, or a combination thereof.
  • various predetermined concentrations e.g., various dilutions
  • test compounds are used for screening, such as 0.01 micromolar, 1 micromolar, or 10 micromolar.
  • Experimental controls for a test compound can include measuring a signal for an assay performed in the absence of the test compound or comparing a signal obtained using a compound known to modulate a target activity with a signal obtained with the test compound.
  • the test compound can be substantially or partially purified or a cell lysate.
  • the terms "ubiquination” and “ubiquitination” are used interchangeably.
  • TR-FRET kinase assays are often performed using fluorophore-labeled peptide substrates. Although some tyrosine kinases will phosphorylate such substrates, many (e.g., serine/threonine kinases) show poor activity against such substrates, and show higher activity against native protein substrates.
  • native protein kinase substrates as fluorescent protein (e.g., GFP) fusions
  • the inventors have developed robust kinase assays for which peptf de-based substrates, e.g., those that are unacceptable or work with low efficiency.
  • Such assays allow for routine analysis of "difficult" kinases, and are useful in identifying compounds that act on the substrate (e.g., potentially by binding to a "docking" site rather than the kinase itself).
  • One embodiment of the invention provides a method to assay kinase activity using a fluorescent polypeptide fusion of a substrate.
  • the invention provides a method to assay kinase activity using a GFP fusion substrate.
  • the substrate moiety can be a polypeptide sequence, a protein or a protein domain, ⁇ n one embodiment, the protein or protein domain comprises a site for phosphorylation.
  • a GFP fusion protein of > 20 residues is used as the substrate.
  • Such substrates can be produced recombinantly in bacteria, or in insect cells. These larger substrates (such as whole proteins or protein domains) can be "physiologically relevant” (e.g., they can be the "native" substrate of a kinase in a biologically relevant pathway).
  • this invention increases the number of kinases that can be assayed and increases the potential biological relevance of studies of kinase activity, since the present invention is not limited to small peptide substrates.
  • Figure 28 represents a fluorescent protein-based TR-FRET kinase assay of the invention.
  • the kinase's protein substrate (or a fragment thereof containing the phosphorylation site) is produced as a fusion to a fluorescent protein (e.g., GFP). If the substrate is phosphorylated, it can bind to an antibody specific for the phosphorylated substrate.
  • this antibody is labeled with a fluorescent and/or luminescent label that can act as a RET partner with the fluorescent protein/peptide, which is part of the substrate fusion protein.
  • the antibody is labeled with a lanthanide metal.
  • the lanthanide metal is Terbium or Europium.
  • the antibody specifically binds the unphosphorylated substrate. In this case, RET signal will be reduced as more substrate is phosphorylated. If the antibody is specific for the phosphorylated substrate, then FRET signal increases as more substrate is phosphorylated. In some aspects of the invention, a TR-FRET signal is measured.
  • the fluorescent label can be a compatible fluorescent protein or polypeptide, for example Green Fluorescent Protein (GFP) or a GFP variant.
  • the substrate protein or polypeptide may be expressed recombinantly and isolated as a fusion with the GFP protein or polypeptide.
  • the substrate protein or polypeptide may be expressed within a cell and then used in a non-purified form from a cell lysate or may be used in a substantially pure form.
  • the kinase phosphorylated substrate is recognized by a labeled phosphospecific antibody labeled with a lanthanide metal complex (e.g., comprising Tb). This association is detected by an increase in RET between terbium and the fluorescent label.
  • the invention can be used to assess enzymatic activity, such as that of a kinase.
  • the kinase and/or the kinase's protein substrate can be either purified or present in a complex matrix such as that of a cell lysate.
  • the invention can be used to assess the ability of a compound to affect enzymatic activity, such as after treating a purified kinase or cell containing a kinase with a test compound.
  • the assay is cell based with the kinase's substrate fusion protein being expressed by the cell.
  • non-radioactive kinase assays depend on phosphorylation of a chemically synthesized peptide substrate of up to approximately 20 residues.
  • This assay format uses, as an example, a GFP fusion protein of > 20 residues as the substrate.
  • substrates are produced recombinantly in bacteria or in insect cells.
  • These larger substrates can be "physiologically relevant” (e.g., they can be the "native" substrate of a kinase in a biologically relevant pathway).
  • the use of "native" substrates is a desirable feature for many practitioners of kinase assays. As an example, it is known that some kinases require a "docking" site far removed from the site of phosphorylation in order to be phosphorylated. In many such cases, smaller peptide substrates may not function as substrates.
  • the "native" substrate or fragment thereof is expressed as a fusion comprising a fluorescent polypeptide.
  • One embodiment of the invention provides a method for measuring kinase activity of a compound comprising: a) contacting the compound and a fusion protein to form a test sample, wherein the fusion protein comprises a fluorescent protein or polypeptide and a kinase substrate polypeptide; b) contacting said fusion protein with a binding molecule labeled with a luminescent metal complex, wherein said binding molecule specifically binds either the unphosphorylated or phosphorylated substrate; exposing said test sample to light (e.g., having a wavelength in the range from 250 nm to 750 nm) and measuring the fluorescence emission from said test sample.
  • light e.g., having a wavelength in the range from 250 nm to 750 nm
  • Another embodiment of the invention provides a method for identifying a modulator of kinase activity comprising: a) contacting a kinase and a fusion protein to form a test sample, wherein the fusion protein comprises a fluorescent protein or polypeptide and a kinase substrate polypeptide and said contacting is carried out in the presence of a potential modulator of said kinase activity; b) contacting said fusion protein with a binding molecule labeled with a luminescent metal complex, wherein said binding molecule specifically binds either the unphosphorylated or phosphorylated substrate; c) exposing said test sample to light (e.g., having a wavelength in the range from 250 nm to 750 nm) and measuring the fluorescence emission from said test sample.
  • light e.g., having a wavelength in the range from 250 nm to 750 nm
  • Another embodiment of the invention provides a method for measuring kinase activity of at least one compound comprising: a) contacting the compound and at least one fusion protein to form a test sample, wherein the fusion protein comprises a fluorescent protein or polypeptide and a kinase substrate polypeptide; b) contacting the fusion protein with a binding molecule labeled with a luminescent metal complex, wherein the binding molecule specifically binds either the unphosphorylated or phosphorylated substrate; c) exposing the test sample to at least one wavelength of light; and d) measuring the fluorescence emission from the test sample.
  • the kinase is measured from a cell lysate.
  • the cell lysate can be a crude cell lysate, partially purified or substantially purified. Substantially purified refers to about 95% purity.
  • the kinase (or other enzyme depending on the particular embodiment of the invention e.g. de-ubiquitinase or ubiquitinase) is about 90, 91, 92, 93, 94, 95, 96, 99, 99.9 or 100% pure, such as 90% to 99.9%, 93% to 99.9%, 95% to 99.9%, or 90% to 96% pure.
  • the enzyme is from a cell lysate that has been centrifuged to remove cellular debris.
  • the enzyme is in the presence of at least one protease inhibitor, e.g., to reduce degradation in a cell lysate or during purification.
  • Another embodiment of the invention provides a method for identifying a modulator of kinase activity comprising: a) contacting a kinase and a fusion protein to form a test sample, wherein the fusion protein comprises a fluorescent protein or polypeptide and a kinase substrate polypeptide and the contacting is carried out in the presence of at least one potential modulator of the kinase activity; b) contacting the fusion protein with a binding molecule labeled with a luminescent metal complex, wherein the binding molecule specifically binds either the unphosphorylated or phosphorylated substrate; c) exposing the test sample to at least one wavelength of light; and d) measuring the fluorescence emission from the test sample.
  • Another embodiment of the invention provides a method for measuring a kinase activity of at least one compound, the method comprising: a) contacting the at least one compound and at least one fusion protein to form a test sample, wherein the fusion protein comprises a fluorescent polypeptide and a kinase substrate polypeptide; b) incubating the test sample under conditions suitable for the kinase activity; c) contacting the test sample, before, during or after (b), with a binding molecule comprising a label, wherein the binding molecule binds with specificity to the at least one fusion protein containing either an unphosphorylated or phosphorylated substrate and wherein the fluorescent polypeptide and the label are a RET pair; d) exposing the test sample to at least one wavelength of light; and e) measuring fluorescence emission from the test sample.
  • Another embodiment of the invention provides a method for determining if at least one compound modulates a kinase activity, the method comprising: a) contacting the at least one compound, at least one kinase and at least one fusion protein to form a test sample, wherein the fusion protein comprises a fluorescent polypeptide and a kinase substrate polypeptide; b) incubating the test sample under conditions suitable for the kinase activity; c) contacting the test sample, before, during or after (b), with a binding molecule comprising a label, wherein the binding molecule binds with specificity to the at least one fusion protein containing either an unphosphorylated or phosphorylated substrate and wherein the fluorescent polypeptide and the label are a RET pair; d) exposing the test sample to at least one wavelength of light; and e) measuring fluorescence emission from the test sample.
  • Another embodiment of the invention provides an article of manufacture comprising: a) packaging material; b) at least one fusion protein comprising a fluorescent protein or polypeptide and a kinase substrate polypeptide; and c) at least one binding molecule labeled with a luminescent metal complex.
  • Another embodiment of the invention provides a fusion protein comprising: i) a fluorescent protein or polypeptide; and ii) a kinase substrate polypeptide.
  • Another embodiment of the invention provides an article of manufacture comprising: a) packaging material; b) at least one fusion protein comprising a fluorescent polypeptide and a kinase substrate polypeptide; and c) at least one binding molecule comprising a label, wherein the fluorescent polypeptide and the label are a RET pair.
  • the fluorescent protein or polypeptide is GFP. In some embodiments, the fluorescent protein or polypeptide is a fluorescent polypeptide the amino acid sequence of any of the fluorescent polypeptide sequences as described herein. In some embodiments, the fluorescent protein or polypeptide is a fluorescent polypeptide with an amino acid sequence that is at least 70%, 80%, 90%, 95% or 98% homology to any of the fluorescent polypeptide sequences as described herein. In one embodiment, the luminescent metal complex comprises terbium. In one embodiment, the binding molecule is an antibody or antibody fragment. In one embodiment, the binding molecule binds an unphosphorylated form of the fusion protein. In one embodiment, the binding molecule binds a phosphorylated form of the fusion protein.
  • the luminescent metal complex comprises an organic antenna moiety, a metal liganding moiety and a terbium metal ion. In one embodiment, the luminescent metal complex comprises Tb(III). In one embodiment, the luminescent metal complex comprises an organic antenna moiety, a metal liganding moiety and a terbium metal ion. In one embodiment, the luminescent metal complex comprises a metal chelating moiety selected from the group consisting of: EDTA, DTPA, TTHA, DOTA, NTA, HDTA, DTPP, EDTP, HDTP, NTP, DOTP, DO3A, DOTAGA, and NOTA. In one embodiment, the compound is in a cell lysate.
  • the compound is substantially purified.
  • the potential modulator is in a cell lysate. In one embodiment, the potential modulator is substantially purified. In one embodiment, the compound is a kinase enzyme. In one embodiment, the kinase enzyme is in a cell lysate. In one embodiment, the kinase is purified. In one embodiment, the fusion protein is substantially purified. In one embodiment, the fusion protein is in a cell lysate. In one embodiment, measuring the fluorescence emission from the test sample comprises measuring time resolved fluorescence.
  • the method further comprises contacting the kinase and the fusion protein to form a control sample, wherein the concentration of the potential modulator of the kinase activity is less than the concentration in the test sample.
  • the potential modulator of the kinase activity is absent from the control sample.
  • measuring the fluorescent emission comprises a ratiometric measurement.
  • De-ubiquination Assays Another embodiment of the invention provides the use of TR-RET with protein- based substrates that, can enable sensitive detection of deubiquitinating enzyme (DUB) activity.
  • Methods of the invention allow the use of both standard RET (resonance energy transfer) or time-resolved resonance energy transfer (TR-RET).
  • TR-RET time-resolved resonance energy transfer
  • Use of TR-RET or RET enables sensitive detection of this type of enzyme activity, for example for use in screening for modulators, activators or inhibitors.
  • Use of TR-RET is of particular utility in high throughput screening due to the robustness of the assay signal and the resistance to interference from test compounds.
  • the present invention also includes the use of protein fragments or peptides comprised of a de-ubiquination domain (e.g., de-ubiquination protein or polypeptide substrate) e.g. , an amino acid sequence cleaved by a de-ubiquinating enzyme(s).
  • a de-ubiquination domain e.g., de-ubiquination protein or polypeptide substrate
  • a genetically encoded fluorophore such as green fluorescent protein, enables facile production of labeled substrates.
  • Compositions suitable for use in the presently described methods are also described, including mixtures of compositions.
  • Some embodiments of the invention are based on the fact that many proteases cleave at specific amino acid sequences, but also recognize substrate structure distant in amino acid sequence, and therefore preferentially cleave folded protein substrates rather than typical short peptide substrates.
  • the protease recognition site could be ubiquitin, a ubiquitin-like protein such as SUMO, Nedd8, ISG15, or others.
  • methods of measuring and detecting DUB activity can be employed using a protein substrate with both donor and acceptor fluorophores covalently attached.
  • a method can be employed using a protein substrate with either one donor or acceptor fluorophore covalently attached, and the other provided by its association to a binding partner.
  • both donor and acceptor fluorophores can be present on binding partners, e.g., see figures 10 and 11.
  • the donor and acceptor fluorophores can be standard organic fluorophores, luminescent molecules, lanthanide chelates, or genetically encoded fluorescent protein or polypeptides.
  • the binding partners could be, but are not limited to, antibodies, streptavidin, small molecules attached to a fluorophore (tracers), or other molecules.
  • the fluorophores would be chosen such that RET would occur in the intact substrate. However, after cleavage with a ubiquitin-specific protein (e.g., a DUB or a DCE), RET would be disrupted.
  • a ubiquitin-specific protein e.g., a DUB or a DCE
  • RET would be disrupted.
  • Some embodiments of the invention use a Terbium chelate and a suitable accepter fluorophore (e.g., GFP).
  • Some embodiments of the invention utilize a terbium labeled ubiquitin. In one embodiment, the terbium is labeled via attachment to a cysteine residue or residues.
  • the cysteine residue may be a cysteine residue naturally found in ubiquitin or a cysteine residue engineered into a ubiquitin protein.
  • Some embodiments of the invention utilize an N- terminal fusion of ubiquitin with a short C-terminal extension containing an engineered cysteine residue that has been labeled with a terbium chelate.
  • the intact substrate shows a high degree of FRET, whereas DUB-dependant or DCE-dependent cleavage leads to a decrease in FRET.
  • various substrates and methods of the invention see figure 11.
  • the invention provides a method for measuring de-ubiquinating activity of a compound comprising: a) contacting the compound and a fusion protein to form a test sample, wherein the fusion protein comprises i) a fluorescent protein or polypeptide; ii) a de-ubiquinating enzyme polypeptide substrate; and iii) a luminescent metal complex, wherein ii) is positioned between i) and ii); b) exposing said test sample to light having a wavelength (e.g., in the range from 250 nm to 750 nm) and measuring the fluorescence emission from said test sample.
  • a wavelength e.g., in the range from 250 nm to 750 nm
  • Another embodiment of the invention provides a method for identifying a modulator of de-ubiquinating activity comprising: a) contacting a de-ubiquinating compound and a fusion protein to form a test sample and said contacting is carried out in the presence of a potential modulator of said kinase activity, wherein the fusion protein comprises: i) a fluorescent protein or polypeptide; ii) a ubiquitin or ubiquitin like protein or polypeptide; and iii) a luminescent metal complex, wherein ii) is positioned between i) and Hi); c) exposing said test sample to light having a wavelength (e.g., in the range from 250 nm to 750 nm) and measuring the fluorescence emission from said test sample.
  • a wavelength e.g., in the range from 250 nm to 750 nm
  • Another embodiment of the invention provides a method for measuring de- ubiquinating activity of at least one compound comprising: a) contacting the compound and a fusion protein to form a test sample, wherein the fusion protein comprises: i) a fluorescent protein or polypeptide; ii) a de-ubiquinating enzyme polypeptide substrate; and iii) a luminescent metal complex, wherein upon cleavage of the de-ubiquinating enzyme polypeptide substrate, resonance energy transfer between (i) and (iii) is decreased; c) exposing the test sample to at least one wavelength of light; and d) measuring the fluorescence emission from the test sample.
  • the at least one compound is a de-ubiquinating enzyme.
  • Another embodiment of the invention provides a method for measuring de- ubiquinating activity of at least one compound, the method comprising: a) contacting the compound and at least one fusion protein to form a test sample, wherein the at least one fusion protein comprises: i) a fluorescent polypeptide; ii) a de-ubiquinating enzyme polypeptide substrate; and iii) a label, wherein the fluorescent polypeptide and the label are a RET pair and wherein upon cleavage of the de-ubiquinating enzyme polypeptide substrate, resonance energy transfer between (i) and (iii) is decreased; b) exposing the test sample to at least one wavelength of light; andc) measuring fluorescence emission from the test sample.
  • Another embodiment of the invention provides a method for determining if at least one compound modulates a de-ubiquinating activity, the method comprising: a) contacting the at least one compound, at least one de-ubiquinating enzyme and at least one fusion protein to form a test sample, wherein the fusion protein comprises: i) a fluorescent polypeptide; ii) a de-ubiquinating enzyme polypeptide substrate; and iii) a label, wherein the fluorescent polypeptide and the label are a RET pair and wherein upon cleavage of the de- ubiquinating enzyme polypeptide substrate, resonance energy transfer between (i) and (iii) is decreased; b) exposing the test sample to at least one wavelength of light; and c) measuring fluorescence emission from the test sample.
  • Another embodiment of the invention provides a method for identifying a modulator of de-ubiquinating activity, the method comprising: a) contacting at least one de-ubiquinating enzyme and a fusion protein to form a test sample in the presence of at least one potential modulator of the de-ubiquinating activity, wherein the fusion protein comprises: i) a fluorescent protein or polypeptide ii) a de-ubiquinating enzyme polypeptide substrate; and iii) a luminescent metal complex, wherein upon cleavage with the at least one de-ubiquinating enzyme, resonance energy transfer between (i) and (iii) is decreased; c) exposing the test sample to at least one wavelength of light; and d) measuring the fluorescence emission from the test sample.
  • Another embodiment of the invention provides a article of manufacture comprising: a) packaging material; b) at least one fusion protein comprising: i) a fluorescent protein or polypeptide; ii) a de-ubiquinating enzyme polypeptide substrate; and iii) a luminescent metal complex, wherein upon cleavage with the at least one de-ubiquinating enzyme, resonance energy transfer between (i) and (iii) is decreased.
  • Another embodiment of the invention provides an article of manufacture comprising: a) packaging material; and b) at least one fusion protein comprising: i) a fluorescent polypeptide; ii)a de-ubiquinating enzyme polypeptide substrate; and iii) a label, wherein the fluorescent polypeptide and the label are a RET pair and wherein upon cleavage of the de-ubiquinating enzyme polypeptide substrate, resonance energy transfer between (i) and (iii) is decreased.
  • the article of manufacture further comprises at least one de- ubiquinating enzyme.
  • the de-ubiquinating enzyme is selected from the group consisting of POHl (also known as Rpnll); UCHL3; ubiquitin carboxyl-terminal esterase Ll (UCHLl); SUMOl/sentrin specific protease 1 (SENPl); ubiquitin carboxyl- terminal esterase Ll (UCHLl); ubiquitin specific protease 1 (USPl); ubiquitin specific protease 10 (USPlO); ubiquitin specific protease 12 (USP12); ubiquitin specific protease 14 (USP 14); ubiquitin specific protease 15 (USP 15); ubiquitin specific protease 16 (USP 16); ubiquitin specific protease 18 (USPl 8); ubiquitin specific protease 2 (USP2); ubiquitin specific protease 28 (USP28); ubiquitin specific protease 3 (USP3); ubiquitin specific protease 30
  • the DUB is measured from a cell lysate.
  • the cell lysate can be a crude cell lysate, partially purified or substantially purified. Substantially purified refers to about 95% purity.
  • the DUB is about 90, 91, 92, 93, 94, 95, 96, 99, 99.9 or 100% pure, such as 90% to 99.9%, 93% to 99.9%, 95% to 99.9%, or 90% to 96% pure.
  • the enzyme is from a cell lysate that has been centrifuged to remove cellular debris.
  • the enzyme is in the presence of at least one protease inhibitor, e.g., to reduce degradation in a cell lysate or during purification.
  • Another embodiment of the invention provides a fusion protein comprising: i) a fluorescent protein or polypeptide; ii) a de-ubiquinating enzyme polypeptide substrate; and iii) a luminescent metal complex, wherein upon cleavage with the at least one de-ubiquinating enzyme, resonance energy transfer between (i) and (iii) is decreased.
  • Some embodiments of the invention comprise an N-terminal fluorescent protein (e.g., GFP) fusion of ubiquitin with a short C-terminal extension containing an engineered cysteine residue that has been labeled with a terbium chelate.
  • GFP N-terminal fluorescent protein
  • an intact substrate demonstrates FRET, whereas DUB-dependant cleavage leads to a decrease in FRET.
  • Another embodiment of the invention provides a fusion protein comprising: i) a fluorescent polypeptide; ii) a de-ubiquinating enzyme polypeptide substrate; and iii) a label, wherein the fluorescent polypeptide and the label are a RET pair and wherein upon cleavage of the de- ubiquinating enzyme polypeptide substrate, resonance energy transfer between (i) and (iii) is decreased.
  • the compound is a de-ubiquinating enzyme.
  • the de-ubiquinating enzyme polypeptide substrate is a ubiquitin protein or polypeptide, a ubiquitin like polypeptide, protein or fragments thereof.
  • measuring the fluorescence emission from the test sample comprises determining a ratiometric measurement.
  • the method further comprises contacting the de-ubiquitinating and the fusion protein to form a control sample, wherein the concentration of the potential modulator of the de-ubiquitinating activity is less than the concentration in the test sample.
  • the potential modulator of the de-ubiquitinating activity is absent from the control sample.
  • measuring the fluorescent emission comprises a ratiometric measurement.
  • a fusion protein is expressed in a cell, wherein the fusion protein comprises a label (e.g., a GFP) and a ubiquitination substrate.
  • a label e.g., a GFP
  • a ubiquitination substrate e.g., a GFP
  • the fusion protein can be expressed in a cell under conditions that cause ubiquitination, the cells can then be lysed and the ubiquitinated fusion protein can be utilized in deubiquitination assays and methods as described herein.
  • the fusion protein can be expressed in a cell under conditions that cause ubiquitination. Then the cells are exposed to compounds and/or conditions of interest. In some embodiments, the cells are then lysed and ubiquitination/deubiquitination is measured as described herein, e.g., as described for some of the cellular based ubiquitination assay. For example, the cell lysate can then be contacted with a labeled binding partner that preferentially binds the ubiquitinated substrate or the un-ubiquitinated substrate.
  • the labeled binding partner is labeled with a RET partner (e.g., comprising terbium) compatible with the label (e.g., a GFP) of the fusion protein.
  • the labeled binding partner binds a ubiquitin or ubiquitin like protein (e.g., anti-ubiquitin or anti-polyubiquitin).
  • the labeled binding partner binds polyubiquitin (e.g., anti-polyubiquitin).
  • the labeled binding partner binds preferentially binds a non-ubiquitinated substrate, e.g., ubiquitination decrease RET measurements.
  • the deubiquitination assays and methods of the present invention a fluorescent protein as a label, e.g., a fluorescent protein and ubiquitin fusion protein.
  • the fluorescent protein is a GFP.
  • the fluorescent protein is a YFP.
  • a fusion protein comprises the following amino acid sequence:
  • a fusion protein comprises the previous amino acid sequence with the amino acid sequence "AC" added to the C-terminus.
  • a fusion protein comprises an amino acid sequence that has at least 70%, 80%, 90%, 95%, or 98% homology to the fluorescent polypeptides described herein.
  • the fusion protein does not comprise a tag, e.g., a histidine tag.
  • This section generally refers to de-ubiquitination as an exemplary embodiment of the invention.
  • the invention also contemplates and provides similar assays and methods utilizing any protease, e.g., a protease that uses a SUMO protein as a substrate.
  • the methods and assays described herein can also be performed using another protein in place of a de-ubiquitination assay and another substrate protein in place of ubiquitin, such as a SUMO specific protease and a SUMO protein.
  • the SUMO specific protease is a UIp (e.g., catalog# 12588-018, Invitrogen, Carlsbad, CA).
  • a fusion protein containing a SUMO protein can be produced recombinantly for assays and methods of the invention.
  • a protein of interest as a fusion to the SUMO protein
  • the SUMO fusion protein comprises a poly-histidine tag.
  • Ubiquinating enzymes include, but are not limited to, El, E2 and E3 enzymes.
  • El and E2 are structurally related and well characterized enzymes. There are several species of E2, some of which act in preferred pairs with specific E3 enzymes to confer specificity for different target proteins.
  • E3 enzymes contain two separate activities: a ubiquitin ligase activity to conjugate ubiquitin to substrates and form polyubiquitin chains via isopeptide bonds, and a targeting activity to physically bring the ligase and substrate together. Substrate specificity of different E3 enzymes is the major determinant in the selectivity of the ubiquitin-dependent protein degradation process.
  • E3 ligases that have been characterized include the HECT (homologous to E6-AP carboxy terminus) domain proteins, represented by the mammalian E6AP-E6 complex which functions as a ubiquitin ligase for the tumor suppressor p53 and which is activated by papillomavirus in cervical cancer (Huang et al., Science 286:1321-26 (1999)).
  • E3 ligase is the APC (anaphase promoting complex), which is a multi-subunit complex that is involved in both entry into anaphase as well as exit from mitosis (see King et al., Science 274:1652-59 (1996) for review).
  • proteins known to be degraded by the APC contain a conserved nine amino acid motif known as the "destruction box" that targets them for ubiquitination and subsequent degradation.
  • proteins that are degraded during Gl including Gl cyclins, CDK inhibitors, transcription factors and signaling intermediates, do not contain this conserved amino acid motif. Instead, substrate phosphorylation appears to play an important role in targeting their interaction with an E3 ligase for ubiquitination (see Hershko et al., Ann. Rev. Biochem. 67:429-75 (1998)).
  • modulators of E3 ligase activity may be used to upregulate or downregulate specific molecules involved in cellular signal transduction.
  • Disease processes can be treated by such up- or down regulation of signal transducers to enhance or dampen specific cellular responses.
  • This principle has been used in the design of a number of therapeutics, including phosphodiesterase inhibitors for airway disease and vascular insufficiency, kinase inhibitors for malignant transformation and proteasome inhibitors for inflammatory conditions such as arthritis.
  • Ubiquitin and Ubiquitination enzyme are described herein in exemplary embodiments of the invention.
  • the invention also contemplates the use of Ubiquitin-like proteins and Ubiquitin-like enzymes, many of which are described herein e.g., those related to ubiquitination, SUMOylation, NEDDylation and ISGylation.
  • Ubiquitin-like proteins and Ubiquitin-like enzymes many of which are described herein e.g., those related to ubiquitination, SUMOylation, NEDDylation and ISGylation.
  • one skilled in the art will readily recognize comparable assays and methods related to ubiquitin- like proteins, enzymes and pathways.
  • Ubiquitin and Ubiquitin like Proteins and Polypeptides Ubiquitin and ubiquitin-like proteins are collectively known as "ubiquitons". Some ubiquitons comprise a central structural element of these post-translational modifications which is a ubiquitin superfold and, as well as being small conjugatable protein modifiers, ubiquitin superfolds can be domains that are genetically built into much, larger proteins. An encompassing term for each of these structural folds is 'ubiquiton'. Ubiquitons have various functions, some of which are unrelated to protein degradation, and some ubiquitons have little homology to ubiquitin.
  • ubiquitin like proteins including but not limited to: NEDD8; SUMO- 1; UCHL3; SUMO-2; SUMO-3; SUM04; ISG15a; ISG15b; FATlOa; FATlOb; FUBl; UBL5; URMl; ATG8; Rubl; Smt3; Hubl; U ⁇ nl; and ATG12.
  • Embodiments of the invention contemplate fluorescent protein-fusions (e.g., GFP) of any of these proteins or active fragments thereof.
  • AU of these ubiquitin like polypeptides, proteins or fragments thereof are contemplated in the present invention.
  • the ubiquitin like polypeptide/protein is UCHL3.
  • proteins that proteolytically remove ubiquitin and/or ubiquitin-like polypeptides from protein substrates including but not limited to: POHl (also known as Rpnl 1); UCHL3; ubiquitin carboxyl-terminal esterase Ll (UCHLl); SUMOl/sentrin specific protease 1 (SENPl); ubiquitin carboxyl-terminal esterase Ll (UCHLl); ubiquitin specific protease 1 (USPl); ubiquitin specific protease 10 (USPlO); ubiquitin specific protease 12 (USP12); ubiquitin specific protease 14 (USP14); ubiquitin specific protease 15 (USP15); ubiquitin specific protease 16 (USP16); ubiquitin specific protease 18 (USP18); ubiquitin specific protease 2 (USP2); ubiquitin specific protease 28 (USP28); ubiquitin specific prote
  • UCHs ubiquitin-c terminal hydrolases
  • USPs ubiquitin specific proteases
  • All of these proteins that proteolytically remove ubiquitin and/or ubiquitin-like proteins from polypeptide substrates are contemplated in the present invention. They may be used individually or in any combination.
  • NEDD8/Rubl is a ubiquitin (Ub)-like post-translational modifier. NEDD8/Rubl is thought to be covalently linked to cullin (Cul)-family proteins in a manner analogous to ubiquitination.
  • NEDD 8 is thought to enhance the ubiquitinating activity of the SCF complex (composed of Skpl, CuI-I, ROCl and F-box protein). It is also thought that NEDD8 modification of CuI-I enhances recruitment of Ub-conjugating enzyme Ubc4 (E2) to the SCF complex (E3) and that the NEDD8-modifying system accelerates the formation of the E2-E3 complex, which stimulates protein polyubiquitination. It is believed that the NEDD8 system positively regulates SCF activity, possibly through a conformational change of CuI-I that promotes the E2-E3 complex formation.
  • NEDDylation or de-NEDDylation see, e.g., Kawakami et al. EMBO J. 2001 Aug l;20(15):4003-12; Osaka et al. Genes Dev. 12 (15), 2263-2268 (1998); Whitby et al. J. Biol. Chem. 273 (52), 34983-34991 (1998); and Kite et al. J. Biol. Chem. 276 (23), 20603-20609 (2001).
  • the C-terminal glycine of ubiquitin can be utilized for activation by El, and glycine residues are typically found at the C-termini of ubiquitin-like proteins, such as SUMO, NEDD8 and ISG15. This C-terminal residue can eventually become conjugated to the lysyl e-amino group of target proteins to form isopeptide linkages and subsequent conjugates.
  • SUMO modification serves to stabilize protein substrates.
  • Attachment of ubiquitin-like proteins might alter substrate conformation, affect the affinity for ligands or other interacting molecules, alter substrate localization and influence protein stability.
  • the invention provides various methods for the detection of ubiquination and various methods to identifying a modulator of a ubiquination reaction, e.g., see figures 22, 26 and 27.
  • the methods and assays of the invention can be in a high throughput format, cellular based, in vitro based or a combination thereof.
  • Ubiquinating enzymes include, but are not limited to
  • ubiquitination There are several different classes of ubiquitination.
  • poly-ubiquitination typically results in a chain of ubiquitin or ubiquitin like molecules being attached to a protein.
  • Mono-ubiquitination results in only one ubiquitin or ubiquitin like molecule being attached to a protein.
  • Multi-ubiquitination results in ubiquitin or ubiquitin like molecules being attached to a protein at different sites on the protein.
  • N-terminal ubiquitination results in a ubiquitin or ubiquitin like molecule being attached to the N-terminus of a protein.
  • One embodiment of the invention provides a sensitive screening assay to monitor a change in the rate or amount of poly-ubiquitination of a protein.
  • the assay is a HTS assay.
  • the assay is used to identify and develop pharmaceuticals for the treatment of disorders where ubiquitin-mediated protein degradation participates in the disease process (e.g. in diseases related to protein misfolding).
  • ubiquitination assays and related methods are disclosed as examples of post-translation modification assays.
  • the invention also contemplates related assays and methods, e.g., those related to SUMOylation.
  • SUMOylation involves SUMO isoforms being conjugated to lysine residues that are found within a sequence (e.g., a consensus sequence) in a target protein.
  • the consensus sequence may comprise ⁇ KXE, in which ⁇ represents a large hydrophobic amino acid and X represents any amino acid.
  • a SUMOylation motif is found surrounding Kl 1 of SUMO-2 and - 3 but not SUMO-I. Therefore, like ubiquitin, SUMO-2 and -3 are capable of forming poly SUMO chains.
  • SUMO-I can be conjugated to SUMO-2 and -3 but it functions as a chain terminator.
  • NEDDylation The Nedd8 conjugation process, called NEDDylation, is similar to ubiquitination. NEDDylation can utilize the El activating-enzyme complex composed of two subunits, APP-
  • BPl and UBA3 BPl and UBA3, and the E2 conjugating-enzyme, UBC12 (e.g., Yeh et al. 2000).
  • Known substrates of NEDDylation include, but are not limited to, Cullin family proteins,Cull, Cul2,
  • NEDD8 and related proteins are also known as Rubl, ISG15 (UCRP), APG8, APG12, FATlO, URMl, Hubl, MGC104393, MGC125896 and MGC125897.
  • a Nedd-8 gene can be found at Chromosome:
  • the assays and methods of the invention attach one protein to another as a post-translational modification, e.g. ubiquitination, SUMOylation and NEDDylation.
  • a labeled antibody which binds an epitope from a SUMO protein is utilized.
  • the assay is an intrachain TR-FRET ubiquitin assay.
  • a portion of the ubiquitin (Ub) in the reaction is labeled with a
  • RET donor and another portion is labeled with a RET acceptor, wherein the donor and acceptor are compatible for RET.
  • a portion of the ubiquitin (Ub) in the reaction is labeled with fluorescein, and another portion is labeled with a terbium chelate.
  • a portion of the ubiquitin (Ub) in the reaction is labeled with a fluorescent protein, and another portion is labeled with a terbium chelate.
  • the fluorescein and terbium ubiquitin portions are mixed with the ubiquitination enzymes (El, E2, and E3), the target protein to be ubiquitinated, and an ATP solution to fuel the reaction.
  • the target protein is a ubiquitin protein or polypeptide. In another embodiment, the target protein is not ubiquitin.
  • ubiquitination enzymes incorporate a fluorescein labeled ubiquitin and a terbium labeled ubiquitin into poly-ubiquitin chains on the target protein. See Figure 22. Following the ubiquitination of the protein of interest, both the RET donor and acceptor are present on the ubiquitin chain itself, allowing for the detection of the ubiquitination event without requiring the addition of a secondary reagent to complete the RET pairing.
  • the percent incorporation of the fluorescein and terbium ubiquitin on the target protein may be controlled, in part, by the initial concentrations of each ubiquitin analogue at the start of the reaction.
  • the percent of target protein ubiquitinated is determined by measuring the RET ratio upon exciting the reaction mixture at 340 Dm, and measuring the intensity of light emitted at 520 nm as compared to the light emitted at 495 nm. A significant increase in the RET ratio signifies ubiquitination of the target protein, whereas no significant increase in the RET ratio indicates that the target protein was not poly-ubiquitinated.
  • the substrate is polyubiquitinated, but not by forming polyubiquitin chains.
  • multiple ubiquitin molecules are added to at least two sites on the substrate, e.g., multi-ubiquitinated.
  • a compound(s) e.g., a drug or drug candidate
  • a compound(s) is introduced to measure the effectiveness of the compound(s) to inhibit or promote the ubiquitination of the target protein.
  • a decrease in the RET ratio e.g., compared to control wells
  • an increase in the TR-FRET ratio is observed if the compound(s) promotes the ubiquitination of the target protein.
  • the intrachain ubiquitination assay can be used with target proteins of which the encoding DNA sequence is unknown (therefore unable to encode epitope tags) or that do not have an antibody to selectively label the target protein.
  • the assay can also be used to monitor the kinetics of the ubiquitination of a target protein in real time.
  • an intrachain TR-FRET ubiquitination assay incorporates both TR-FRET partners (e.g., Fluorescein-ubiquitin and Terbium-ubiquitin) in the ubiquitin chain, eliminating the requirement for the addition of a secondary reagent for analysis.
  • a ubiquitin addition mutant is synthesized, e.g., with the addition of four amino acids (e.g., methionine-cysteine-glycine-glycine) to the N-terminus of the wildrype protein.
  • a cysteine is introduced to allow for the site specific labeling of the ubiquitin mutant with thiol reactive forms of fluorescein or the terbium chelate.
  • the ubiquitin addition mutant is labeled with either the fluorescein or terbium chelate thiol reactive dyes to produce the corresponding fluorescein-ubiquitin or terbium-ubiquitin.
  • a binding partner e.g. an antibody
  • a ubiquitination assay that utilizes 1) an acceptor labeled (e.g. fluorescent label) binding partner (e.g. an antibody) with a donor labeled (e.g., terbium) ubiquitin or 2) a donor labeled (e.g., terbium) binding partner (e.g. an antibody) and an acceptor labeled (e.g. fluorescent label) ubiquitin can be established.
  • an acceptor labeled binding partner e.g. an antibody
  • a donor labeled binding partner e.g. an antibody
  • an acceptor labeled (e.g. fluorescent label) binding partner e.g. an antibody
  • a donor labeled binding partner e.g. an antibody
  • an acceptor labeled (e.g. fluorescent label) binding partner e.g. an antibody
  • a donor labeled binding partner e.g. an antibody
  • an appropriate binding molecule e.g., an antibody
  • binds ubiquitin and/or ubiquitin chains In some methods, not all antibodies that bind ubiquitin will be useful or optimal.
  • some antibodies may, as an example, 1) have a higher affinity for a free ubiquiton as compared to a ubiquiton that is pan of a ubiquitoned protein, 2) have a lower affinity for a free ubiquiton as compared to a ubiquiton that is part of a ubiquitoned protein, or 3) have relatively the same affinity for a free ubiquiton as compared to a ubiquiton that is part of a ubiquitoned protein.
  • Some antibodies that bind a free ubiquiton may bind to an epitope that is not available or is altered when the ubiquiton is part of a ubiquitonated protein/substrate.
  • a binding molecule e.g., an antibody
  • the binding molecule is an antibody.
  • an antibody preferentially binds a ubiquitin or ubiquiton that is associated with a ubiquitonated protein/substrate.
  • an antibody preferentially binds a free ubiquitin or ubiquiton, e.g., that is not associated with a ubiquitonated protein/substrate.
  • an antibody is a FKl or FK2 antibody or binds the same epitopes (Fujimuro et ⁇ l., Methods Enzymol. 399:75-86 (2005).
  • the antibody is FK-I (e.g., recognizing poly- ubiquitin chains), for example, from BioMol (Plymouth Meeting, PA) represented by Catalog# PW8805 or an antibody comprising the CDRs of this antibody.
  • the antibody is FK-2 (e.g., recognizing ubiquitin), for example, from BioMol represented by Catalog# PW881O or an antibody comprising the CDRs of this antibody.
  • Some embodiments of the invention provide an anti-epitope ubiquitination assay which utilizes an acceptor (e.g., fluorescein) labeled ubiquitin and a donor (e.g., a terbium) labeled anti-epitope antibody to complete the TR-FRET pairing.
  • Some embodiments of the invention provide an anti-epitope ubiquitination assay which utilizes a donor (e.g., a terbium) labeled ubiquitin and an acceptor (e.g. , fluorescein) labeled anti-epitope antibody to complete the TR-FRET pairing.
  • the anti-epitope format can detect both mono- and polyubiquitination of a target protein.
  • the anti-epitope ubiquitination assay has an acceptable signal-to- background compared to controls, and methylated ubiquitin will compete with fluorescein- ubiquitin for attachment to a GST-UbcHl
  • a ubiquination assay utilizes a protein which is a fusion between a fluorescent protein or polypeptide (e.g. , GFP) and the target protein or polypeptide to be ubiquitinated (see Figure 26).
  • a fluorescent protein or polypeptide e.g., a GFP
  • GFP fluorescent protein or polypeptide
  • An example of a ubiquitination assay with a GFP fusion protein or polypeptide with p53 and terbium-ubiquitin is outlined in Figure 26.
  • both monoubiquitinated and polyubiquitinated proteins can be detected and/or measured.
  • This assay can be used in a high throughput screening format to identify compounds that can modulate (e.g., inhibit, maintain or enhance) the function of a ubiquitination enzyme(s) (e.g., Mdm2, the ubiquitin ligase enzymes (E3)) or compounds that can modulate the interaction between a ubiquitinating enzyme and a target protein (e.g., Mdm2 and p53).
  • a ubiquitination enzyme(s) e.g., Mdm2, the ubiquitin ligase enzymes (E3)
  • E3 the ubiquitin ligase enzymes
  • the ubiquitinating enzyme is measured from a cell lysate.
  • the cell lysate can be a crude cell lysate, partially purified or substantially purified. Substantially purified refers to about 95% purity.
  • the ubiquitinating enzyme is about 90, 91, 92, 93, 94, 95, 96, 99, 99.9 or 100% pure, such as 90% to 99.9%, 93% to 99.9%, 95% to 99.9%, or 90% to 96% pure.
  • the enzyme is from a cell lysate that has been centrifuged to remove cellular debris.
  • the enzyme is in the presence of at least one protease inhibitor, e.g., to reduce degradation in a cell lysate or during purification.
  • One embodiment of the invention provides a cell expressing a fusion protein wherein the fusion protein comprises a substrate for an enzymatic activity (e.g., ubiquitination) and the fusion protein comprises a label (e.g., a fluorescent protein, such as GFP).
  • the label can act as a donor ⁇ or acceptor label for RET.
  • the enzymatic activity is ubiquitination.
  • the ubiquitination is poly-ubiquitination.
  • the ubiquitination is mono-ubiquitination.
  • the fusion protein can be expressed in any cell, e.g., an eukaryotic or mammalian cell.
  • GFP/ubiquitination substrate fusion proteins within a cell allows the cell's own ubiquitin machinery to modify a target protein. This can be especially useful with ubiquitin-protein ligases (e.g., E3) that consist of multiple subunits, such as APC, that might otherwise be difficult to express and purify for an assay (e.g., an in vifro assay).
  • ubiquitin-protein ligases e.g., E3
  • APC ubiquitin-protein ligases
  • Some embodiments of the invention related to cellular ubiquitination assays utilize a cell endogenously expressing a GFP fusion of I ⁇ B ⁇ , e.g., in 293 cells.
  • a TNFR receptor can be stimulated with TNF ⁇ to induce the ubiquitination of the GFP-I ⁇ B ⁇ .
  • a labeled (e.g., terbium) anti-ubiquitin antibody is introduced to detect the ubiquitinated fusion protein, e.g., by completing FRET pairing and in some cases stimulating emission from the acceptor (e.g., GFP) and/or decreasing emission from the donor.
  • Some embodiments of the invention e.g., the cellular based assays described herein, can be used to monitor the ubiquitination status of a target protein(s) in a cellular environment.
  • the invention provides means to screen compounds, e.g., for cell permeability as well as for effective inhibition of ubiquitination in the cellular milieu.
  • the cellular based assays of the invention provide one with the ability examine or determine various aspects of a pathway with regards to an enzymatic activity, such as ubiquitination.
  • a pathway with regards to an enzymatic activity, such as ubiquitination.
  • compounds and/or conditions e.g., radiation, temperature change, change in oxygen concentrations, etc.
  • the compound may exert its effect directly on a ubiquitinating enzyme(s) or it may exert its effect indirectly by affecting another protein in a pathway related to ubiquitination.
  • the effect(s) exerted by the compound or condition is modulation of the rate of ubiquitination of at least one protein substrate.
  • the rate of ubiquitination of a substrate is decreased. In some embodiments, the rate of ubiquitination of a substrate is increased. Any cellular pathway related to ubiquitination may be utilized and examined in the assays of the invention.
  • a fusion protein (e.g., comprising a ubiquitination substrate and a label (e.g., GFP) is expressed by the cell.
  • these cells are utilized in an assay of the invention.
  • the cells after the cells have been exposed to a condition and/or compound the cells are lysed.
  • the cell lysate may optionally be purified or partially purified with regards to the labeled ubiquitination substrate fusion protein, e.g., as described herein.
  • the cell lysate can then be contacted with a labeled binding partner that binds the ubiquitinated substrate.
  • the labeled binding partner is labeled with a FRET partner (e.g., comprising terbium) compatible with the label (e.g., a GFP) of the fusion protein.
  • the labeled binding partner binds a ubiquitin or ubiquitin like protein (e.g., anti-ubiquitin or anti-polyubiquitin).
  • the labeled binding partner binds polyubiquitin (e.g., anti- polyubiquitin).
  • the labeled binding partner binds preferentially binds a non-ubiquitinated substrate, e.g., ubiquitination decrease RET measurements.
  • the amount of ubiquitinated GFP-I ⁇ B ⁇ is measured as a dose response with TNF ⁇ (a known activator of TNFR).
  • TNF ⁇ a known activator of TNFR
  • either Tb-anti- polyubiquitin and/or Tb-anti-ubiquitin are used to bind the ubiquitinated fusion protein (e.g., GFP-I ⁇ B ⁇ ) from the cellular lysate, e.g., to complete the FRET pairing.
  • the pathway related to ubiquitination is the NF- ⁇ B pathway.
  • stimulation of the TNF receptor (TNFR) activates TNFR-associated factor (TRAF) and subsequently TGFb-activated kinase 1 (TAKl).
  • TNF TNF receptor
  • TAKl TGFb-activated kinase 1
  • the active TAKl regulates the phosphorylation of IKK ⁇ that is responsible for phosphorylating I ⁇ B ⁇ .
  • the ubiquitin-ligase complex, SCF-bTrCP poly-ubiquitinates the phosphorylated I ⁇ B ⁇ , signaling the protein for degradation.
  • Some embodiments of the invention provide methods for determining if a compound is a modulator of a post-translational modification, the method comprising: (a) contacting the compound and a cell expressing at least one fusion protein, wherein the fusion protein comprises a first label and a substrate for the post-translational modification to form a test sample; (b) contacting the test sample with a binding partner that exhibits discriminate binding based on the presence or absence of the post-translational modification, wherein the binding partner comprises a second label and wherein the first and second label are a RET pair; and (c) measuring the fluorescence emission from the test sample.
  • the method additionally comprises a control sample, e.g., lacking the compound or the fusion protein.
  • a fluorescence property of the test sample is compared to a fluorescence property of a control sample.
  • One embodiment of the invention provides a method for measuring ubiquination activity of at least one compound comprising: a) contacting the compound with at least one protein and labeled ubiquiton to form a test sample, wherein the labeled ubiquiton comprises at least two populations, wherein the first population is labeled with an acceptor molecule of a compatible RET pair and the second population is labeled with a donor molecule of a compatible RET pair; b) exposing the test sample to at least one wavelength of light; and c) measuring the fluorescence emission from the test sample.
  • Another embodiment of the invention provides a method for identifying at least one modulator of ubiquination activity, the method comprising: a) contacting at least one potential modulator of the ubiquination activity, at least one protein and labeled ubiquiton to form a test sample, wherein the labeled ubiquiton comprises at least two populations, wherein the first population is labeled with an acceptor molecule of a compatible RET pair and the second population is labeled with a donor molecule of a compatible RET pair; b) exposing the test sample to at least one wavelength of light; and c) measuring the fluorescence emission from the test sample.
  • the method further comprises contacting the at least one protein and the labeled ubiquitin to form a control sample, wherein the concentration of the potential modulator of the ubiquination activity is less than the concentration in the test sample. In one embodiment, the potential modulator of the ubiquination activity is absent from the control sample.
  • Another embodiment of the invention provides an article of manufacture comprising: a) packaging material; and b) at least two populations of labeled ubiquiton, wherein the first population is labeled with an acceptor molecule of a compatible RET pair and the second population is labeled with a donor molecule of a compatible RET pair.
  • the article of manufacture further comprises at least one ubiquinating enzyme. In one embodiment, the article of manufacture further comprises at least one ubiquinating enzyme is selected from an El, E2, and E3. In one embodiment, the article of manufacture further comprises ubiquinating enzymes El, E2, and E3.
  • Another embodiment of the invention provides a method for measuring a ubiquitination activity of at least one compound comprising: a) contacting i) the at least one compound with ii) a ubiquitin and iii) a protein to form a test sample, wherein the protein comprises a ubiquitination substrate and a first moiety of a RET pair; b) incubating the test sample under conditions suitable for ubiquitination; c) contacting the test sample either before, during or after (b) with a binding molecule that binds the ubiquitin, wherein the binding molecule is labeled with a second moiety of a FRET pair; d) exposing the test sample to at least one wavelength of light; and e) measuring the fluorescence emission from the test sample.
  • Another embodiment of the invention provides a method for determining if at least one compound is a modulator of ubiquination activity, the method comprising: a) contacting i) the at least one compound with ii) a ubiquitin, iii) a protein, and iv) a ubiquitinating enzyme to form a test sample, wherein the protein comprises a ubiquitination substrate and a first moiety of a RET pair; b) incubating the test sample under conditions suitable for ubiquitination; c) contacting the test sample, either before, during or after (b), with a binding molecule that binds the ubiquitin, wherein the binding molecule is labeled with a second moiety of a FRET pair; d) exposing the test sample to at least one wavelength of light; e) measuring the fluorescence emission from the test sample; and f) comparing the fluorescence emission to a control sample.
  • Another embodiment of the invention provides ubiquitin or ubiquitin like protein or polypeptide labeled with a terbium metal ion.
  • the terbium ion labeled ubiquitin or ubiquitin like protein or polypeptide is as described in example 17 below.
  • the second labeled ubiquitin population is labeled with a lanthanide metal complex.
  • the lanthanide metal complex comprises terbium.
  • the lanthanide metal complex comprises an organic antenna moiety, a metal liganding moiety and a lanthanide metal ion.
  • the lanthanide metal complex comprises Tb(III).
  • the lanthanide metal complex comprises a metal chelating moiety selected from the group consisting of: EDTA, DTPA, TTHA, DOTA, NTA, HDTA, DTPP, EDTP, HDTP, NTP 5 DOTP, D03A, DOTAGA, and NOTA.
  • the at least one wavelength of light is in the range from 250 nm to 750 nm.
  • the first labeled ubiquitin population is labeled with fluorescein or a fluorescent protein or polypeptide.
  • the fluorescent protein or polypeptide is a GFP.
  • the at least one protein is ubiquitin.
  • the at least one protein is not ubiquitin.
  • at least one member from the group selected of the compound, the at least one protein and the labeled ubiquitin is in a cell lysate.
  • at least one member from the group selected of the compound, the at least one protein and the labeled ubiquitin is substantially purified.
  • At least one member from the group selected of the potential modulator, the at least one protein and the labeled ubiquitin is in a cell lysate. In one embodiment, at least one member from the group selected of the potential modulator, the at least one protein and the labeled ubiquitin is substantially purified. In one embodiment, measuring the fluorescence emission from the test sample comprises determining a ratiometric measurement.
  • the assays described herein can be run in various volumes.
  • the volumes of the reactions can be reduced significantly.
  • the reaction volumes are between about 1 nanoliter (nl) to about 200ul; about 10 nl to about 200 ul; about 100 nl to about 200 ul; about 1 ul to about 200 ul; about 10 ul to about 200 ul; about 10 nl to about 100 ul; about 10 nl to about 20 ul; about 100 nl to about 20 ul; about 1 ul to about 20 ul; about 1 ul to about 10 ul; about 1 ul to about 5 ul; about 5 ul to about 10 ul; or about 10 ul to about 20 ul.
  • the reaction volume is about 4 or 20 ul.
  • the assays of the invention can be run in relatively small reaction volumes. This lends the advantage of being able to reduce the amount and cost of assay reagents, some of which may be in limited supply.
  • the miniaturization, of the assay can also increase the number of samples screened at a time, e.g., increasing high throughput efficiency.
  • FRET kinase assays are often run at or near the EC80 concentration of the kinase (under a given set of substrate and ATP concentrations), so that small changes in the amount of active kinase present will result in appreciable changes in the TR-FRET value, while maintaining a suitable separation between the readouts of active and inactive kinase.
  • Binding Partners One embodiment of the invention is based on monitoring and/or measuring a molecular interaction (e.g., complex formation or disruption) between two binding partners.
  • a "binding partner” is a compound (e.g., a first binding partner) that has affinity for another compound (e.g. , a second binding partner) (or vice versa) such that the two binding partners are capable of forming ⁇ complex when bound.
  • Two binding partners can be members of a specific binding pair.
  • a first binding partner can be a monoclonal antibody and a second binding partner can be a composition having the epitope recognized by that monoclonal antibody.
  • One embodiment related to kinase or phosphatase activity utilizes anti-phospho- specif ⁇ c antibodies labeled with a lanthanide metal complex (e.g., comprising a Tb chelate) following standard protocols (e.g., supplied with a commercial chelate reagent).
  • a lanthanide metal complex e.g., comprising a Tb chelate
  • phospho-specif ⁇ c antibodies are labeled "in situ" through association with species-specific antibodies (e.g., Tb-labeled anti-IgG) that bind to the anti-phosphospecific antibodies.
  • these reagents are added to a kinase reaction in which the GFP- or fluorescein-labeled protein or polypeptide substrate has been used.
  • the GFP fusion may be produced in E coli using standard molecular biology, recombinant protein expression, and protein purification techniques. After a brief incubation the assay may be read using standard "LanthaScreenTM” settings, e.g., as described in the "LanthaScreenTM User's Guide” (Invitrogen, California).
  • the invention provides compositions that include a binding partner.
  • the binding partner can be labeled with a luminescent metal complex (e.g., Tb or Europium).
  • the binding partner can be labeled with a fluorescent acceptor moiety.
  • Examples of binding partners labeled with luminescent metal complexes or fluorescent acceptor moieties are set forth in the Examples, below.
  • the present invention also provides mixtures of binding partners.
  • a composition can include a first binding partner and a second binding partner.
  • the first binding partner can comprise a luminescent metal complex while the second binding partner can comprise a fluorescent acceptor moiety.
  • the first binding partner can comprise a fluorescent acceptor moiety
  • the second binding partner can comprise a luminescent metal complex.
  • the affinity (apparent Ka) of a first binding partner for a second binding partner is about 1 mM or less, e.g., about 10 ⁇ M or less, or about 1 ⁇ M or less, or about 0.1 ⁇ M or less, or 10 nM or less, or 1 nM or less, or 0.1 nM or less.
  • experimental parameters e.g., concentrations of assay components, reaction times, temperatures, and buffers, depending on the Kd of the first binding partner for the second binding partner, to obtain a desired combination of conditions and cost-effectiveness.
  • a second binding partner need not be an optimal binding partner for a first binding partner.
  • a binding partner encompasses all binding partners whose binding interactions can be probed using the methods of the present invention.
  • a second binding partner is sometimes referred to herein as a "tracer,” and if it includes a luminescent metal complex or a fluorescent acceptor moiety, a "luminescent tracer.”
  • a binding partner can be a protein, polypeptide, a polynucleotide, a lipid, a phospholipid, a polysaccharide, or an organic molecule.
  • protein or polypeptide binding partners examples include an antibody, a protein, or an enzyrnatically or chemically-synthesized or modified polypeptide sequence (e.g., a polypeptide sequence derived from a protein, modified from a protein, or designed and synthesized de novo.)
  • a protein or polypeptide binding partner may be linear or cyclic.
  • An organic molecule binding partner can be a small organic molecule.
  • first and second binding partners that form complexes include an antibody and a composition having an epitope or epitope mimetic recognized by that antibody; a polypeptide and a ligand (e.g., receptor-ligand interactions); a polypeptide and another polypeptide (e.g., protein-protein interactions); a polypeptide and a polynucleotide (e.g., protein-DNA or protein-RNA interactions); a polynucleotide and another polynucleotide (e.g., DNA-DNA, DNA-RNA, or RNA-RNA interactions); a polypeptide and an organic molecule (e.g., protein-drug interactions); a polypeptide and a lipid (e.g., protein- phospholipid interactions); a polynucleotide and an organic molecule; and an organic molecule and another organic molecule.
  • a ligand e.g., receptor-ligand interactions
  • a polypeptide and another polypeptide e.g.,
  • a binding partner can comprise either a luminescent metal complex or a fluorescent acceptor moiety.
  • one binding partner can comprise a luminescent metal complex and the other can comprise a fluorescent acceptor moiety, e.g., a first binding partner comprises a luminescent metal complex and a second binding partner comprises a fluorescent acceptor moiety.
  • a first binding partner comprises a luminescent metal complex
  • a second binding partner comprises a fluorescent acceptor moiety.
  • Inclusion of a luminescent metal complex and fluorescent acceptor moiety on a binding partner pair allows an interaction of first and second binding partners to be monitored by one or more fluorescent techniques (e.g., TR-RET, or multiplex modes). For example, when a first binding partner and second binding partner are bound to one another, the complex will typically exhibit a characteristic ' TR-RET signal.
  • Disruption of the molecular interaction between the first binding partner and the second binding partner alters the TR-RET signal, allowing the monitoring of the molecular interaction in either TR-RET modes.
  • an antibody can be labeled with a luminescent metal chelate and a protein or polypeptide binding partner for the antibody can be labeled with a fluorescent acceptor moiety.
  • the sample typically exhibits a fluorescence emission measurement characteristic of RET between the luminescent metal chelate and the acceptor moiety.
  • Addition of a competitor at a suitable concentration and with a suitable K d for the antibody results in displacement of the second binding partner, with a change in the fluorescence emission measurement as a result of a loss of RET between the luminescent metal chelate on the antibody and the fluorescent acceptor moiety on the protein or polypeptide.
  • Binding partners can be prepared and purified by a number of methods known to those of ordinary skill in the art.
  • antibodies including monoclonal antibodies and antibody fragments, can be prepared by a number of methods known to those of skill in the art, or can be purchased from a variety of commercial vendors, including Serotec (Raleigh, NC), Abeam (Cambridge, MA), R&D Systems, Cambridge Antibody Technologies, and Covance Research Products (Denver, CO).
  • an antigen for which an antibody is desired is prepared, e.g., recombinantly, by chemical synthesis, or by purification of a native protein, and then used to immunize animals.
  • polypeptides or proteins containing a particular amino acid sequence and/or post-translational modification e.g., phosphorylation
  • Various host animals including, for example, rabbits, chickens, mice, guinea pigs, goats, and rats, can be immunized by injection of the antigen of interest.
  • adjuvants can be used to increase the immunological response and include Freund's adjuvant (complete and/or incomplete), mineral gels such as aluminum hydroxide, surface-active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanin, and dinitrophenol.
  • Polyclonal antibodies are contained in the sera of the immunized animals.
  • Monoclonal antibodies can be prepared using standard hybridoma technology. In particular, monoclonal antibodies can be obtained by any technique that provides for the production of antibody molecules by continuous cell lines in culture as described, for example, by Kohler et al.
  • Such antibodies can be of any immunoglobulin class including IgM, IgG, IgE, IgA, IgD, and any subclass thereof.
  • the hybridoma producing the monoclonal antibodies of the invention can be cultivated in vitro or in vivo. Chimeric antibodies can be produced through standard techniques.
  • Antibody fragments that have specific binding affinity for an antigen can be generated by known techniques. Such antibody fragments include, but are not limited to, F(ab') 2 fragments that can be produced by pepsin digestion of an antibody molecule, and Fab fragments that can be generated by reducing the disulfide bridges of F(ab') 2 fragments. Alternatively, Fab expression libraries can be constructed. See, for example, Huse et al. (1989) Science 246:1275-1281. Single chain Fv antibody fragments are formed by linking the heavy and light chain fragments of the Fv region via an amino acid bridge (e.g., 15 to 18 amino acids), resulting in a single chain polypeptide. Single chain Fv antibody fragments can be produced through standard techniques, such as those disclosed in U.S. Patent No. 4,946,778.
  • antibodies or fragments thereof can be tested for recognition of (and affinity for) a second binding partner by standard immunoassay methods including, for example, enzyme- linked immunosorbent assay (ELISA) or radioimmuno assay (RIA).
  • ELISA enzyme- linked immunosorbent assay
  • RIA radioimmuno assay
  • Suitable antibodies typically will have a Kd for a second binding partner of about 1 rnM or less, e.g., about 10 ⁇ M or less, or about 1 ⁇ M or less, or about 0.1 ⁇ M or less, or about 10 nM or less, or about 1 nM or less, or about 0.1 nM or less.
  • the second binding partner can be a protein or polypeptide containing the same post-translational modification.
  • a second binding partner will have the same chemical structure as an antigen used to immunize.
  • Other polypeptides in addition to antibodies are useful as first or second binding partners and can also be prepared and analyzed using standard methods.
  • polypeptides or proteins can be obtained by extraction from a natural source (e.g., from isolated cells, tissues or bodily fluids), by expression of a recombinant nucleic acid encoding the protein or polypeptide, or by chemical synthesis.
  • Polypeptides or proteins can be produced by, for example, standard recombinant technology, using expression vectors encoding the proteins or polypeptides. The resulting polypeptides then can be purified.
  • Expression systems that can be used for small or large scale production of polypeptides include, without limitation, microorganisms such as bacteria (e.g., E. coli and B. subtilis) transformed with recombinant bacteriophage DNA, plasmid DNA, or cosmid DNA expression vectors; yeast (e.g., S.
  • yeast expression vectors transformed with recombinant yeast expression vectors; insect cell systems infected with recombinant virus expression vectors (e.g., baculovirus); plant cell systems infected with recombinant virus expression vectors (e.g., tobacco mosaic virus) or transformed with recombinant phsmi ⁇ expression vectors (e.g., Ti plasmid); or mammalian cell systems (e.g., primary cells or immortalized cell lines such as COS cells, Chinese hamster ovary cells, HeLa cells, human embryonic kidney 293 cells, and 3T3 Ll cells) harboring recombinant expression constructs containing promoters derived from the genome of mammalian cells (e.g., the metallothionein promoter) or from mammalian viruses (e.g., the adenovirus late promoter and the cytomegalovirus promoter).
  • mammalian cell systems e.g., primary cells or immortalized cell lines such as CO
  • Suitable methods for purifying the polypeptides or proteins of the invention can include, for example, affinity chromatography, immunoprecipitation, size exclusion chromatography, and ion exchange chromatography. See, for example, Flohe et al. (1970) Biochim. Biopkys. Acta. 220:469-476, or Tilgmann et al. (1990) FEBS 264:95-99.
  • the extent of purification can be measured by any appropriate method, including but not limited to: column chromatography, polyacrylamide gel electrophoresis, or high-performance liquid chromatography.
  • Polypeptides and proteins as first or second binding partners can also be prepared using solid phase synthesis methods, see, e.g., WO 03/01115 and 6,410,255.
  • polypeptides synthesized chemically have between 3 to 50 amino acids (e.g., 3 to 30, 3 to 20, 3 to 15, 5 to 30, 5 to 20, 5 to 15, 8 to 20, 8 to 15, 10 to 10, 10 to 15 or 10 to 12 amino acids in length).
  • Suitable amino acids include natural, non-natural, and modified (e.g., phosphorylated) amino acids.
  • Amino acids with many different protecting groups appropriate for immediate use in the solid phase synthesis of peptides are commercially available.
  • Polynucleotides useful as binding partners can be produced by standard techniques, including, without limitation, common molecular cloning and chemical nucleic acid synthesis techniques. For example, polymerase chain reaction (PCR) techniques can be used. PCR refers to a procedure or technique in which target nucleic acids are enzymatically amplified. Sequence information from the ends of the region of interest or beyond typically is employed to design polynucleotide primers that are identical in sequence to opposite strands of the template to be amplified. PCR can be used to amplify specific sequences from DNA as well as RNA, including sequences from total genomic DNA or total cellular RNA.
  • PCR polymerase chain reaction
  • Primers are typically 14 to 40 nucleotides in length, but can range from 10 nucleotides to hundreds of nucleotides in length.
  • General PCR techniques are described, for example in PCR Primer: A Laboratory Manual, ed. by Dieffenbach and Dveksler, Cold Spring Harbor Laboratory Press, 1995.
  • reverse transcriptase can be used to synthesize complementary DNA (cDNA) strands.
  • Ligase chain reaction, strand displacement amplification, self-sustained sequence replication, or nucleic acid sequence-based amplification also can be used to obtain isolated nucleic acids. See, for example, Lewis Genetic Engineering News, 12(9): 1 (1992); Guatelli et al, Proc. Natl. Acad.
  • Polynucleotides of the invention also can be chemically synthesized, either as a single nucleic acid molecule (e.g., using automated DNA synthesis in the 3' to 5' direction using phosphoramidite technology) or as a series of smaller polynucleotides.
  • one or more pairs of long polynucleotides can be synthesized that contain the desired sequence, with each pair containing a short segment of complementarity (e.g., about 15 nucleotides) such that a duplex is formed when the polynucleotide pair is annealed.
  • DNA polymerase is used to extend the polynucleotides, resulting in a single, double-stranded polynucleotide.
  • Polynucleotides of the invention also can be obtained by mutagenesis.
  • polynucleotides can be mutated using standard techniques including polynucleotide-directed mutagenesis and site-directed mutagenesis through PCR. See Short Protocols in Molecular Biology, Chapter 8, Green Publishing Associates and John Wiley & Sons, edited by Ausubel et al, 1992.
  • binding partners are utilized to label substrates with the enzymatic reaction of interest.
  • binding partners are utilized to label substrates with the enzymatic reaction of interest. For examples see figures 9, llb-f and 27.
  • a binding partner can comprise a luminescent metal complex.
  • a luminescent metal complex can act as a donor fluorophore in a RET or TR-RET assay.
  • a luminescent metal complex is useful in the present methods because its excited state lifetime is typically on the order of milliseconds or hundreds of microseconds rather than nanoseconds; a long excited state lifetime allows detection of a molecular interaction between binding partners to be monitored after the decay of background fluorescence and/or interference from light- scattering.
  • a luminescent metal complex includes a metal liganding moiety, one or more lanthanide metal ions, and optionally linkers, spacers, and organic antenna moieties.
  • a metal liganding moiety coordinates one or more lanthanide metal ions to form a metal complex.
  • a metal liganding moiety includes one or more metal coordinating moieties X, where X is a heteroatom electron-donating group capable of coordinating a metal cation, such as O " , OH, NH 2 , OPO 3 2" , NHR, or OR where R is an aliphatic group.
  • a metal liganding moiety can be a chelating moiety or a cryptand moiety.
  • a lanthanide metal ion is coordinated to a chelating moiety, the complex is referred to as a "metal chelate.” If a lanthanide metal ion is coordinated to a cryptand moiety, the complex is referred to as a "metal cryptand.”
  • a metal chelate should be stable to exchange of the lanthanide ion.
  • Metal chelates preferably have a formation constant (Kf) of greater than 10 10 M "1 .
  • Kf formation constant
  • a variety of useful chelating moieties are known to those of skill in the art. Typical examples of chelating moieties include: EDTA, DTPA, TTHA, DOTA, NTA, HDTA, DTPP, EDTP, HDTP, NTP,
  • DOTP DOTP, DO3A, DOTAGA, and NOTA.
  • a luminescent metal chelate can have the following structures:
  • A represents an organic antenna moiety
  • L represents a linker
  • S represents a spacer
  • n can be 0 or 1;
  • C represents a metal chelating moiety
  • M represents a lanthanide metal ion coordinated to C.
  • Figure 3 also demonstrates luminescent metal chelates useful for conjugating to amine moieties (top structure) or thiol moieties (bottom structure) on binding partners.
  • Cryptates are formed by the inclusion of a lanthanide cation into a tridimensional organic cavity, leading to highly stable complexes.
  • a variety of useful cryptand moieties are known to those of skill in the art. Examples of cryptand moieties useful in the present methods include: trisbypyridine (TBP, e.g., TBP pentacarboxylate), and pyridine bipyridine
  • Chelating and cryptand moieties can be synthesized by a variety of methods known to those of skill in the art or may be purchased commercially. See U.S. Pat. Nos. 5,639,615; 5,656,433; 5,622,821; 5,571,897; 5,534,622; 5,220,012; 5,162,508; and 4,927,923; and WO 96/23526 and WO 03/011115.
  • Lanthanide Metal Ions Metal liganding moieties coordinate one or more lanthanide metal ions to form a metal complex. Lanthanide metal ions are useful because their special electronic configuration shields the optically active electrons, resulting in characteristic line type emissions. As the electronic transitions of the metal ions are forbidden by quantum mechanics rules, the emission lifetimes of these ions are typically long (from ⁇ s to msec). Useful lanthanide metal ions include Sm(III), Ru(III), Eu (III), Gd(III), Tb(III), and
  • Dy(III) Methods for complexing a metal ion to a chelating or cryptand moiety are known to those of skill in the art, see, e.g., WO 96/23526 and WO 03/011115.
  • a luminescent metal complex can optionally include an organic antenna moiety.
  • An organic antenna moiety typically has a conjugated electronic structure so that it can absorb light. The absorbed light is transferred by intramolecular non-radiative processes from the singlet to the triplet excited state of the antenna moiety, then from the triplet state to the emissive level of the lanthanide ion, which then emits characteristically long-lived luminescence. See Figures 2 and 4. It should be noted that some metal liganding moieties can absorb light without the inclusion of an organic antenna moiety. For example, certain cryptand moieties that contain conjugated organic moieties, such as tribipyridine pentacarboxylate, do not require the inclusion of a discrete organic antenna moiety.
  • an organic antenna moiety can be a polynuclear heterocyclic aromatic compound.
  • the polynuclear heterocylic aromatic compound can. have two or more fused ring structures.
  • useful organic antenna moieties include rhodamine 560, fluorescein 575, fluorescein 590, 2-quinolone, 4-quinolone, 4-trifluoromethylcoumarin (TFC), 7-diethyl-amino-cournarin-3-carbohydrazide, 7-amino-4-methyl-2-coumarin (carbostyril 124, CS124), 7-amino-4-methyl-2-coumarin (coumarin 120), 7-amino-4- trifluoromethyl-2-coumarin (coumarin 124), and aminomethyltrimethylpsoralen. See Figures 2 and 3.
  • Linkers and Spacers can optionally be included in a luminescent metal complex.
  • a Linker (L) functions to link a luminescent metal complex to a first or second binding partner.
  • a L can link an acetate, amine, amide, carboxylate, or methylene functionality on a metal liganding moiety to a first or second binding partner.
  • One of skill in the art can design Ls to react with a number of functionalities on binding partners, including, without limitation, amines, acetates, thiols, alcohols, ethers, esters, ketones, and carboxylates.
  • a L can cap the N-terminus, the C-terminus, or both N- and C- termini, as an amide moiety.
  • Other exemplary L capping moieties include sulfonamides, ureas, thioureas and carbamates.
  • Ls can also include linear, branched, or cyclic alkanes, alkenes, or alkynes, and phosphodiester moieties.
  • the L may be substituted with one or more functional groups, including ketone, ester, amide, ether, carbonate, sulfonamide, or carbamate functionalities.
  • Additional examples of Ls and synthetic methodologies for incorporating them into metal complexes, particularly metal complexes linked to polypeptides or proteins, are set forth in WO 01/09188, WO 01/08712, and WO 03/011115.
  • a Spacer can connect an organic antenna moiety to a metal liganding moiety.
  • a S can link an acetate, amine, or methylene functionality on a metal liganding moiety to an organic antenna moiety.
  • One of skill in the art can design Ss to react with a number of functionalities on organic antenna moieties and on metal liganding moieties, including, without limitation, amines, acetates, thiols, alcohols, ethers, esters, ketones, and carboxylates.
  • Ss can include linear, branched, or cyclic alkanes, alkenes, or alkynes, and phosphodiester moieties.
  • the S may be substituted with one or more functional groups, including ketone, ester, amide, ether, carbonate, sulfonamide, or carbamate functionalities.
  • a binding partner can include a fluorescent acceptor moiety.
  • a fluorescent acceptor moiety can act as an acceptor in RET or TR-RET-based assays.
  • an optimal fluorescent acceptor moiety should exhibit a good quantum yield and a large extinction, coefficient; should be resistant to coliisional quenching and bleaching: and should be easily co ⁇ jugaied to a variety of first a ⁇ d second binding partners by methods known to those having ordinary skill in the art.
  • Suitable fluorophores include, without limitation, fluorescein, rhodamr ⁇ e, FITCs (e.g., fluorescein-S-isothiocyarmie), 5- FAM, 6-FAM, 5,6-FAM, 7-hydroxycouaiarin-3-carboxaraide, 6-chloro-7-hydroxycoumarm- 3-carboxamidc, dichlorotriazinylatninofluoresccin, tetramethylrhodaminc-S-isothiocyanate, tetramet ⁇ ylrhoda ⁇ nine-6-iR ⁇ th.iocyanate, succininiidyl ester of 5-carboxyfluorescein, siiccimmidyl ester of 6-carboxyfluore&cein, 5-carboxytetrainethyIrhodaminc, 6- carboxyniethylrhodamine 5 and 7-amino-4-methylcoumarin-3-acetic acid
  • fl ⁇ or ⁇ pbores include the Cy family of iluoropbores (Cy 3, Cy3B, Cy3.5, Cy5; available from Amersharo Biosciexices, Piseataway, NJ); the Alexa Fluor family (available from Molecular Probes, Eugene, OR); the BODIPY family (available from Molecular Probes, Eugene, OR); carbopyronins; squarines; cyanine/indocyani ⁇ es; benzopyryliura hefcerocyjes; and amide- bridged benzopyryliums.
  • Fluorescent polypeptides, proteins and mutants can also be used as fluorescent acceptor moieties.
  • Examples include firefly, bacterial, or click beetle luciferases, aequorins, and other pholoproteins (for example as described in U.S. Patents 5,221 ,623, issued Ju ⁇ e 22, 19S9 to Thompson et al., 5,683,888 issued November 4, 1997 to Campbell; 5,674,713 issued September 7, 1997 to DeLuca et al.; 5.650.289 issued My 22, 1997 to Wood; and 5,843,746 issued December 1 , 1998 to Tatsumi et al.).
  • GFP and GFP mutants are particularly useful in applications using TbfIII) ⁇ containing metal complexes.
  • Fluorescent proteins and their color variants are excellent tools for cell biology and are important tools for biochemical HTS (high throughput screening) assay development.
  • a fluorescent protein is utilized as a FRET partner, e.g., with a lanthanide metal complex.
  • FRET partner e.g., with a lanthanide metal complex.
  • These embodiments of the invention can utilize any fluorescent protein that when utilized with the corresponding lanthanide metal complex can act together as a FRET pair. For example, if the emission spectrum of the donor overlaps with the excitation spectrum of the acceptor (e.g., in the case of a terbium chelate and a fluorescent protein), energy transfer takes place when the molecules are proximal.
  • avGFP fusion proteins or polypeptides in combination with terbium chelates is utilized to create a general strategy for time-resolved fluorescence resonance energy transfer (TR-FRET) assays for kinase and ubiquitin-related pathways.
  • TR-FRET time-resolved fluorescence resonance energy transfer
  • terbium can be paired with GFP, enabling TR- FRET assays using a genetically encoded acceptor fluorophore.
  • the general strategy consists of making a fusion between GFP and a protein or polypeptide of interest. After purification of the fusion protein, either a terbium labeled antibody or terbium labeled fusion protein provides the TR-FRET signal. Finally the assay functions by disruption or association of the terbium donor with the GFP acceptor.
  • GFP enables biochemical assay development by providing for example 1) a soluble fluorescent label for easy protein purification, 2) a fully labeled substrate, and 3) a well matched acceptor fluorophore for TR-FRET.
  • a topaz GFP is utilized. Labeling kinase substrate as a GFP fusion has some advantages such as improving batch-to- batch consistency as compared to when a substrate protein is randomly labeled through accessible amino groups and lower cost when compared to using an acceptor-labeled antibody.
  • a fluorescent acceptor moiety for use in multiplex assays should exhibit characteristics useful for RET/TR-RET applications.
  • a region of the fluorophore 's absorbance spectra should overlap with a region of a luminescent metal chelate's emission spectra, while a region of the fiuorophore's emission spectra preferably overlaps substantially with a region of the luminescent metal chelate's emission spectra.
  • acceptor fluorophores in TR-RET assays using Tb(HI)- containing luminescent metal complexes include, but are not limited to, fluorescein (and its derivatives); rhodamine (and its derivatives); Alexa Fluors 488, 500, 514, 532, 546, 555, 568 (available from Molecular Probes); BODIPYs FL, R6Q and TMR (available from Molecular Probes); Cy3 and Cy3B (available from Amersham Biosciences), and IC3 (available from Dojindo Molecular Technologies, Gaithersburg, MD).
  • acceptor fluorophores in TR-RET assays using Eu(IH)-containing luminescent metal complexes include: Alexa Fluors 594, 610, 633, 647, and 660 (available from Molecular Probes); BODIPYs TR, 630/650, and 650/665 (available from Molecular Probes); Cy5 (available from Amersham Biosciences) and IC5 (available from Dojindo Molecular Technologies).
  • Suitable fluorophores for use in the present invention are commercially available, e.g., from Molecular Probes (Eugene. OR), Attotec (Germany). Amersham, and Biosearcli Technologies (Novato, CA). Methods for incorporating fluorophores into a variety of binding partners are known to those of skill in the art; see, e.g., 6.410.255.
  • Methods of the present invention also take advantage of resonance energy transfer (RET) between a donor moiety ⁇ e.g., a luminescent metal chelate) and an acceptor moiety ⁇ e.g., a fluorescent acceptor moiety).
  • a donor luminescent metal chelate is excited by light of appropriate wavelength and intensity ⁇ e.g., within the donor antenna moiety's excitation spectrum) and under preferable conditions in which direct excitation of the acceptor fluorophore is minimized.
  • the donor luminescent chelate then transfers the absorbed energy by non-radiative means to the acceptor fluorescent moiety, which subsequently re-emits some of the absorbed energy as fluorescence emission at one or more characteristic wavelengths.
  • the re-emitted radiation is not measured until after a suitable delay time, e.g., 25, 50, 75, 100, 150, 200, or 300 microseconds to allow decay of background fluorescence, light scattering, or other luminescence, such as that caused by the plastics used in microtiter plates.
  • a suitable delay time e.g. 25, 50, 75, 100, 150, 200, or 300 microseconds to allow decay of background fluorescence, light scattering, or other luminescence, such as that caused by the plastics used in microtiter plates.
  • a first binding partner can comprise either a luminescent metal complex or a fluorescent acceptor moiety, while the second binding partner comprises the other.
  • an antibody first binding partner can be labeled with a Tb(III)- chelate-organic antenna moiety (luminescent metal chelate), while a protein or polypeptide for which the antibody is specific can be labeled with a fluorescein (fluorescent acceptor moiety).
  • disruption of the complex formed by the antibody and protein or polypeptide ⁇ e.g., by a compound that affects binding between the two) results in an alteration in energy transfer between the luminescent metal chelate on the antibody and the fluorescent acceptor moiety on the polypeptide that may be used to monitor and measure the binding between the first and second binding partners.
  • a compound that affects binding of a second binding partner (or tracer) to a first binding partner can be, for example, a test compound, an enzyme product (e.g., for which the first binding partner has specificity), or an enzyme substrate (e.g., for which the first binding partner has specificity).
  • a compound that affects binding of a second binding partner (or tracer) to a first binding partner can comprise either a luminescent metal chelate or fluorescent acceptor moiety while the first binding partner comprises the other.
  • disruption of the complex formed between the first binding partner and the second binding partner by the labeled compound that affects binding can result in an increase in RET.
  • RET can be manifested as a reduction in the intensity of the luminescent signal from the donor luminescent metal complex and/or an increase in emission of fluorescence from the acceptor fluorescent moiety.
  • a complex between an antibody having a donor luminescent metal complex and a protein or polypeptide having an acceptor fluorescent moiety is disrupted, e.g., by a competitor for the protein or polypeptide, such as an unlabeled protein or polypeptide
  • the donor luminescent metal complex and the acceptor fluorescent moiety physically separate, and RET is diminished or eliminated.
  • luminescence emission from the donor luminescent metal complex increases and fluorescence emission from the acceptor fluorescent moiety decreases.
  • a ratio of emission amplitudes at wavelengths characteristic (e.g., the emission maximum) of the donor luminescent metal complex relative to the acceptor fluorescent moiety should increase as compared to the same ratio under RET conditions (e.g., when emission of the donor luminescent metal complex is quenched by the acceptor).
  • E the efficiency of RET
  • F and F° are the fluorescence intensities of the donor in the presence and absence of the acceptor, respectively
  • R is the distance between the donor and the acceptor.
  • Ro the distance at which the energy transfer efficiency is 50% of maximum is given (in A) by:
  • K 2 is an orientation factor having an average value close to 0.67 for freely mobile donors and acceptors
  • Q is the quantum yield of the unquenched fluorescent donor
  • n is the refractive index of the intervening medium
  • J is the overlap integral, which expresses in quantitative terms the degree of spectral overlap.
  • the characteristic distance Ro at which RET is 50% efficient depends on the quantum yield of the donor, the extinction coefficient of the acceptor, the overlap between the donor's emission spectrum and the acceptor's excitation spectrum, and the orientation factor between the two fluorophores.
  • Changes in the degree of RET can be determined as a function of a change in a ratio of the amount of luminescence from the donor and acceptor moieties, a process referred to as "ratioing.”
  • ratioing By calculating a ratio, the assay is less sensitive to, for example, well-to-well fluctuations in substrate concentration, photobleaching and excitation intensity, thus making the assay more robust. This is of particular importance in automated screening applications where the quality of the data produced is important for its subsequent analysis and interpretation. See, e.g., U.S. 6, 410, 255; 4,822,733; 5,527,684; and 6,352,672.
  • the emission from the donor moiety is measured.
  • the emission from the acceptor moiety is measured.
  • an increase in RET is measured by a decrease in emission from the donor moiety.
  • a ratiometric analysis is performed, wherein a ratio of luminescence emission at two different wavelengths is compared between a test sample and a control sample.
  • the two wavelengths can correspond to an emission maximum for a luminescent metal complex and a fluorescent acceptor moiety.
  • an emissions ratio of the control sample will be about 1.5, 2, 3, 4, 5, 7, 10, 15, 20, 25, 30, 40, 50, or 100 times larger or smaller than the emissions ratio of a test sample.
  • Methods of the present invention can be used to measure the effect of a test compound or compounds on binding between a first binding partner and a second binding partner.
  • the present methods may be used to identify competitive binders to first or second binding partners, or to identify compounds that physically (e.g., allosterically) or chemically affect a first or second binding partner so as to consequently affect binding of its partner.
  • assays to identify effects of test compounds on such binding partner interactions as protein-protein interactions, protein-ligand interactions, protein-DNA interactions, and polynucleotide hybridizations may be designed using the present methods.
  • a first binding partner, a second binding partner, and a test compound are contacted to form a test sample.
  • one of the binding partners comprises a luminescent metal complex, while the other comprises a fluorescent acceptor moiety. See Figure 1.
  • the first and second binding partner is capable of binding to one another to form a complex.
  • the test sample is exposed to light (e.g., at a wavelength in an absorbance band of the luminescent metal complex or of the antenna moiety), typically in the wavelength range of 250 run to 750 nm, and the fluorescence emission from the test sample is measured.
  • fluorescence emission may be measured after a suitable time delay, as indicated above, to result in a time-resolved fluorescence emission measurement.
  • a test compound can comprise either a luminescent metal complex or a fluorescent acceptor moiety and a first binding partner can comprise the other.
  • a first binding partner receptor can be labeled with a luminescent metal chelate while a test ligand for the first binding partner receptor can be labeled with a fluorescent acceptor moiety.
  • Disruption of a complex formed between the first binding partner receptor and an unlabeled second binding partner (e.g., a ligand for the receptor) by the labeled test ligand can lead to an increase in RET.
  • a test compound is identified as affecting binding between first and second binding partners when the fluorescence emission measurement of the test sample is different from the fluorescence emission measurement of a control sample lacking the test compound.
  • a difference is considered statistically significant at p ⁇ 0.05 with an appropriate parametric or non-parametric statistic, e.g., Chi-square test, Student's t-test, Mann- Whitney test, or F-test.
  • a difference is statistically significant at p ⁇ 0.01, p ⁇ 0.005, or p ⁇ 0.001.
  • Methods for Identifying Modulators of Enzymatic Activity can also be used to identify a modulator of enzymatic activity.
  • a first binding partner is selected based on specificity for either a substrate or a product of an enzymatic activity.
  • an antibody with specificity for a phosphorylated tyrosine as compared to an unmodified tyrosine can be a first binding partner with specificity for a product of tyrosine kinase activity.
  • a tracer is then selected based partially on the specificity of the first binding partner for the substrate or product of the enzymatic activity.
  • a tracer can include the purported epitope recognized by an antibody first binding partner, or a recognition site or chemical structure recognized by a protein or polypeptide first binding partner.
  • a tracer can have the same chemical structure as an antigen used to immunize an animal to generate a first binding partner antibody.
  • the first binding partner will bind to a tracer with a similar Kd as to the enzymatic product or substrate for which it has specificity, e.g., about 0.001 to 1000 times, or 0.01 to 100 times, or 0.1 to 10 times the K d of the first binding partner for the product or substrate.
  • a tracer may be labeled (e.g., include a luminescent metal complex or a fluorescent acceptor moiety; referred to herein as a "luminescent tracer”) or the tracer may be unlabeled.
  • the first binding partner is an antibody with specificity for a phosphorylated tyrosine, a product of tyrosine kinase activity
  • a luminescent tracer can be selected that includes the epitope (or an epitope mimetic) recognized by the antibody (in this case, a phosphorylated tyrosine) so that the antibody binds the luminescent tracer.
  • the inclusion of a fluorescent acceptor moiety or luminescent metal complex on the tracer should not substantially affect the K d of the first binding partner for the tracer.
  • enzymatic activities may be probed, including, without limitation, kinase activity, phosphatase activity, glucuronidase activity, prenylation, glycosylation, methylation, demethylation, acylation, acetylation, ubiquitination, deubiquination, sulfation, proteolysis, nuclease activity, nucleic acid polymerase activity, nucleic acid reverse transcriptase activity, nucleotidyl transferase activity, polynucleotide transcription activity, and polynucleotide translation activity.
  • an enzyme is contacted with a substrate for the enzyme under conditions effective for an enzymatic activity of the enzyme to form a product from the substrate.
  • conditions effective for enzymatic activity will vary with the enzyme, enzymatic activity, and substrate chosen.
  • ATP is generally included.
  • Incubation conditions for a contacting step can vary, e.g., in enzyme concentration, substrate concentration, temperature, and length of time.
  • an incubation temperature conditions typically are from about 15 to about 40 °C; in some embodiments, the temperature may be about room temperature, e.g., about 20-25 0 C.
  • a contacting step is carried out in the presence of a potential modulator of the enzymatic activity.
  • the enzyme, substrate, and potential modulator mixture is then contacted with a first binding partner and luminescent tracer, as described above, to form a test sample.
  • a first binding partner or the luminescent tracer includes a luminescent metal complex, while the other includes a fluorescent acceptor moiety.
  • the enzyme, substrate, and potential modulator mixture is contacted with a first binding partner and optionally a tracer to form a test sample.
  • either the first binding partner or the substrate includes a luminescent metal complex, while the other includes a fluorescent acceptor moiety.
  • enzymatic activity can result in the conversion of the labeled substrate to a labeled product.
  • the inclusion of a fluorescent acceptor moiety or luminescent metal complex on the substrate should not substantially affect the ability of the enzyme to form a product from the labeled substrate.
  • the inclusion of a fluorescent acceptor moiety or luminescent metal complex on the substrate (or product) should not substantially affect the Ka of the first binding partner for the substrate (or product) for which it has specificity.
  • the test sample is also exposed to at least one wavelength of light (e.g., at a wavelength in an absorbance band of the luminescent metal complex), typically in the wavelength range of 250 nm to 750 nm, and the fluorescence emission from the test sample is measured. Fluorescence emission may be measured after a suitable time delay, as indicated above, to result in a time-resolved fluorescence emission measurement.
  • at least one wavelength of light e.g., at a wavelength in an absorbance band of the luminescent metal complex
  • Fluorescence emission may be measured after a suitable time delay, as indicated above, to result in a time-resolved fluorescence emission measurement.
  • a tracer may be unlabeled, e.g., in embodiments where a first binding partner is labeled with a luminescent metal complex and a substrate is labeled with a fluorescent acceptor moiety. Disruption of a complex formed between an unlabeled tracer and a labeled first binding partner by an appropriately labeled compound (e.g., labeled substrate, labeled product, labeled test compound) that affects binding between the unlabeled tracer and first binding partner can lead to an increase or decrease in RET.
  • an appropriately labeled compound e.g., labeled substrate, labeled product, labeled test compound
  • a potential modulator is identified as a modulator of enzymatic activity when the fluorescence emission measurement of the test sample is different from the fluorescence emission measurement of a control sample lacking the potential modulator.
  • a difference is considered statistically significant at p ⁇ 0.05 with an appropriate parametric or non-parametric statistic, e.g., Chi-square test, Student's t-test, Mann- Whitney test, or F-test.
  • a difference is statistically significant at p ⁇ 0.01, p ⁇ 0.005, or p ⁇ 0.001.
  • any of the methods of the present invention can be modified to be performed in a high-throughput or ultra-high-throughput manner.
  • a method to identify a modulator of activity of an enzyme may be modified to contact a plurality of substrates, independently, with a particular enzyme(s) and potential modulator(s), to form a plurality of enzyme mixtures.
  • Each enzyme mixture is then contacted with an appropriate first binding partner and luminescent tracer to form a test sample, with the excitation and measurement steps as described previously.
  • high-throughput methods are particularly amenable to multi-well plate or 2-D array panel formats. Devices for incubating and monitoring multi-well plates are known in the art.
  • the Z'-Factor is a statistic designed to reflect both assay signal dynamic range and the variation associated with signal measurements.
  • Signal-to-noise (S/N) or signal-to-background (S/B) ratios alone are unsatisfactory in this regard because they do not take into account the variability in sample and background measurements and signal dynamic range.
  • the Z'-Factor takes into account these factors, and because it is dimensionless, it can be used to compare similar assays.
  • assays of the present invention yield Z'-factors of greater than or equal to 0.5. Methods for determining Z'-factor are known to those of skill in the art.
  • a Z'-factor may be determined by evaluating the dynamic range of a method.
  • kits and apparatuses useful for performing the described inventions.
  • a kit includes packaging material, such as a container, and one or more compositions useful as first and/or second binding partners.
  • a kit can include one or more of the following: a multi-well plate, one or more enzymes, buffers, and directions for use of the kit.
  • Kits of the invention may be designed to perform one or more methods of the invention. Further these kits may contain one or more composition described herein. Appendix A contains protocols which may be included in, for example, kits of the invention.
  • An apparatus will generally include a sample chamber and means for illuminating the sample chamber with at least one wavelength of light (e.g., in the range of 250 nm to 750 nm). In addition, an apparatus will include means for detecting light (e.g., fluorescence) emitted from the sample chamber.
  • the invention further provides methods for providing various aspects of the invention to others ⁇ e.g., customers). These methods will typically involve at least one of the following steps: (a) advertising a product or service, (b) receiving one or more orders for the product or service, (c) supplying the product or performing the service with, optionally, delivering tangible material or data resulting from the service, (d) providing a bill to the party which placed the order, (e) ensuring that payment of the bill occurs, and (f) processing the payment (e.g., cashing a payment check, debiting a bank account, etc.).
  • steps will typically involve at least one of the following steps: (a) advertising a product or service, (b) receiving one or more orders for the product or service, (c) supplying the product or performing the service with, optionally, delivering tangible material or data resulting from the service, (d) providing a bill to the party which placed the order, (e) ensuring that payment of the bill occurs, and (f) processing the payment (e.g., cashing
  • the method is a method for generating revenue by providing a purchasing function to a customer to purchase a product or service provided herein.
  • the purchasing function can include providing a telephonic ordering system, a direct sales representative, or by utilizing a computer system that displays a visual representation on a monitor, of a link to purchase a product or service disclosed herein.
  • the method can further include providing a computer-based ordering function that is activated when the visual representation is selected.
  • the invention is directed, in part to performing a service for a party, providing data derived from that service to the party and collecting payment for the service.
  • These services will often be directed to assays related to the detection and/or identification of molecular modifications, e.g., utilizing the methods and assays as described herein.
  • detecting substrates for ubiquitinating enzymes or other enzymes that conjugate a ubiquiton to a polypeptide by contacting a ubiquitinating enzyme(s) with polypeptides immobilized on a substrate. Also provided herein are methods for detecting substrates for a ubiquitination-like enzyme(s) (or other enzymes that conjugate a ubiquitin-like protein to a polypeptide) by contacting a ubiquitination-like enzyme(s) with polypeptides immobilized on a substrate.
  • the methods can include contacting a positionally addressable array comprising a plurality of polypeptides immobilized on a substrate, with ubiquitin that is associated with a detectable moiety (or a ubiquitin-like protein(s) associated with a detectable moiety) and a ubiquitinating enzyme(s) and detecting the detectable moiety.
  • the detecting includes identifying polypeptides of the plurality of polypeptides that are associated with a ubiquiton sucli as ubiquitin, SUMO or NEDD8, for example, by identifying positions on the array at which the detectable moiety is detected.
  • the reaction conditions for the ubiquitination reaction are provided herein including those for other methods for the addition of a ubiquiton to a substrate.
  • the ubiquitinating enzymes include El, E2, and E3.
  • the method can further include incubating a positionally addressable array with a deubiquitinating enzyme, detecting the detectable moiety and identifying substrates for the deubiquitinating enzyme by comparing polypeptides that were labeled with the detectable moiety before and after contact with the deubiquitinating enzyme.
  • the contacting typically includes incubating for an effective period of time to allow the enzyme to remove ubiquitin from substrates.
  • these methods can also be performed utilizing ubiquitin-like proteins and measuring/detecting the removal of the ubiquitin-like protein.
  • the methods of the invention can be used to measure, for example, de-ubiquitination, de-SUMOylation, de-NEDDylation and de-ISGylation
  • a method for identifying and/or measuring ubiquitinating activity of a sample by contacting a positionally addressable array comprising a plurality of polypeptides immobilized on a substrate, with a ubiquiton associated with a detectable moiety and a sample (e.g., a cell lysate); and detecting the detectable moiety.
  • the method is for identifying and/or measuring, for example, ubiquitination, SUMOylation, NEDDylation and ISGylation activity.
  • a method for identifying deubiquitinating activity of a sample by contacting a positionally addressable array comprising a plurality of polypeptides immobilized on a substrate with a ubiquiton associated with a detectable moiety and a ubiquitinating enzyme, (optionally detecting polypeptides that are associated with the detectable moiety), contacting the array with a sample (e.g., a cell lysate); detecting the detectable moiety, and identifying deubiquitination substrates, e.g., by comparing the polypeptides associated with the detectable moiety before and after contact with the cell lysate and/or comparing to a control array.
  • a method for identifying deubiquitinating activity of a sample by contacting a positionally addressable array comprising a plurality of polypeptides immobilized on a substrate wherein the polypeptides comprise a ubiquiton (e.g., associated with a detectable moiety) with a sample (e.g., a cell lysate), (optionally detecting the detectable moiety), and identifying deubiquitination substrates, e.g., by comparing the polypeptides associated with the detectable moiety before and after contact with the cell lysate.
  • the polypeptides of the plurality of polypeptides comprise a ubiquitin associated with (e.g., fused as part of a fusion protein) a detectable moiety (e.g., a fluorescent protein).
  • the invention provides methods for identifying ubiquitinating or non- deubiquitinating activity of a sample (e.g., a cell lysate) that can be used to compare different samples (e.g., cell lysates from different populations of cells to further characterize the molecular differences of cells), for example, to identify biomarkers.
  • the different samples are derived from (e.g., are cell lysates of) different populations of cells.
  • the different populations of cells can include cells of a different organism, different developmental state, different disease state, such as cancerous vs. benign vs. normal, exposed to different conditions, exposed to different compounds, cells from different organs and/or combinations thereof.
  • the detectable moiety can include, as a nonlimiting example, biotin, avidin, an epitope, or a fluorescent moiety.
  • the detectable moiety can be covalently or non-covalently associated with the ubiquitin.
  • the detectable label is provided by an antibody labeled with a detectable moiety, e.g., a labeled antibody that binds ubiquitin or a ubiquitin-like protein.
  • Any of the methods that include polypeptide arrays provided herein can include during contact with the ubiquitinating or deubiquitinating enzyme, contacting the enzyme and/or the polypeptides with a test compound.
  • the polypeptides for the protein array aspects of the invention can be immobilized on a substrate to form a positionally addressable array comprising a plurality of polypeptides, with each protein being at a different position on a solid support.
  • the polypeptides can be immobilized in an array at a density, for example, of at least 100, 200, 250, 300, 400, 500, 1000, 2500, 5000, or 10,000 polypeptides per square centimeter.
  • the polypeptides can include at least 100, 200, 250, 500, 1000, 2500, 5000, 7500, 10000, or all expressed polypeptides of a single species of organisms.
  • the polypeptides can be structurally related and/or can be members of the same protein family.
  • the polypeptides can include secondary modifications.
  • the polypeptides can be in certain embodiments, at least 20, 25, 50, 100, 250, 500, or 1000 amino acids in length.
  • the array can be formed by methods known in the art.
  • the protoarrays of the invention can also utilize RET as a means of detection.
  • two moieties can be utilized that are capable of RET (e.g., FRET or TR-FRET).
  • the plurality of polypeptides are associated with a member of a RET pair, e.g., a donor or acceptor moiety.
  • the plurality of polypeptides is associated with a fluorescent protein (e.g., a GFP) such as by being expressed as a fusion protein.
  • a fluorescent protein e.g., a GFP
  • a ubiquitin or ubiquitin-like protein are associated with a member of a RET pair, e.g., a donor or acceptor moiety.
  • a ubiquitin or ubiquitin-like protein are labeled with a lanthanide metal complex.
  • a ubiquitin or ubiquitin-like protein is indirectly labeled utilizing an antibody labeled with a member of a RET pair.
  • the method or assay involves two populations of a ubiquitin, two populations of a ubiquitin-like protein, or a population of a ubiquitin and a population of a ubiquitin-like protein, wherein one population is associated with a donor moiety and a second population is associated with an acceptor moiety.
  • the polypeptides of the array are of a sufficient density that attachment of the two populations of ubiquitin or ubiquitin-like proteins results in RET. Therefore, various methods and assays described herein can utilize this format.
  • Assays and methods utilizing RET may involve detecting an increase, decrease or no change of RET, an increase, decrease or no change of emission from the donor moiety, an increase, decrease or no change of emission from the acceptor moiety, or combinations and/or ratios thereof.
  • Some embodiments of the invention provide a method for detecting at least one substrate for at least one ubiquitination or ubiquitination-like enzyme comprising: a) contacting i) the at least one ubiquitination or ubiquitination-like enzyme with ii) polypeptides immobilized on a substrate and iii) at least one ubiquitin or ubiquitin-like protein comprising a detectable moiety, b) incubating (a) under conditions to allow for ubiquitin or ubiquitination-like activity, c) detecting the detectable moiety associated with any of the polypeptides on the substrate.
  • Some embodiments of the invention provide a method for identifying or measuring deubiquitmating activity of a sample comprising: a) contacting i) the sample with ii) at least one or a plurality of polypeptides immobilized on a substrate, wherein the at least one or plurality of polypeptides comprise a ubiquitin or ubiquitin-like protein associated with a detectable moiety, wherein the deubiquitmating activity causes the dissociation of the detectable moiety from the substrate, b) incubating (a) under conditions to suitable for de-ubiquitination activity, c) detecting the detectable moiety associated with any of the polypeptides on the substrate.
  • Phosphodiesterases are an important class of enzymes that are of interest as pharmaceutical targets. Phosphodiesterases cleave a phosphodiester bond to form a phosphate and a hydroxyl group. In the case of cyclic nucleotide monophosphate substrates such as cAMP, the hydroxyl and the phosphate reside within the same molecule, and the cleavage of the phosphodiester forms the nucleotide monophosphate (e.g., AMP) as shown in Figure 42A.
  • cyclic nucleotide monophosphate substrates such as cAMP
  • the hydroxyl and the phosphate reside within the same molecule, and the cleavage of the phosphodiester forms the nucleotide monophosphate (e.g., AMP) as shown in Figure 42A.
  • Phosphodiester synthesis is described in the scientific literature (e.g. Friedman et al, J. Am. Chem. Soc. 72(1): 624-625 (1950).)
  • phosphoryl chloride can be reacted with a hydroxyl containing compound in a pyridine/benzene mixture to form a dichloro phosphoryl ester, which can be reacted with a second equivalent of the same or different hydroxyl containing compound to form a mono-chloro phosphodiester, which can then be hydrolyzed with water to give the corresponding phosphodiester.
  • An example of this is shown schematically in Figure 42B.
  • Colorimetric assays for phosphodiesterases include the use of bis-(4-nitrophenyl) phosphate as substrate that forms para-nitrophenol and para-nitrophenol phosphate upon enzymatic cleavage. (Kelly et al. Biochemistry, 14(22):49$3-$ (1975).) Para-nitrophenol is then detected by its absorbance at 410 nm. Berkessel and Riedl (Angew. Chem., Int. Ed. Eng., 36: 1481-1483 (1997)) have described the use of a quenched fluorescent substrate in which a naphthalene residue acts as the fluorophore, and an azobenzene moiety acts as the quencher.
  • naphthalene and the azobenzene are linked via a phosphodiester linkage that is cleaved by the phosphodiesterase, separating the quencher from the fluorophore.
  • Takakusa and colleagues have described a FRET-based assay for phosphodiesterases that uses a substrate containing a FRET pair that is linked by a phosphodiester moiety. (Takakusa et at, J Am Chem Soc.
  • CPF4 coumarin - phosphate - fluorescein
  • the present invention provides methods for the detection of phosphodiesterase activity. In some embodiments, these methods are based upon the specific recognition of the phosphate moiety (the phosphate monoester) by an antibody. In some embodiments, methods are based upon the specific recognition of the cyclic monoester/phosphate. In some embodiments, the antibody exhibits low binding affinity towards the uncleaved phosphodiester relative to its affinity for the phosphorylated product.
  • Neoepitope refers to an epitope that is uncovered, unmasked, or otherwise revealed in order to be recognized by an antibody. In some embodiments, prior to the event that allows the epitope to be bound by the antibody, there is decreased or no detectable binding.
  • the antibody demonstrates an affinity for a product of the reaction and less or no affinity for the starting compound(s).
  • the product comprises one member of a RET pair and the antibody comprises a second member of a RET pair and the antibody has binding specificity for the product.
  • Some embodiments of the invention utilize a strategy in which the phosphate generated upon phosphodiesterase mediated cleavage serves as an epitope for an antibody.
  • Some embodiments of the invention provide a method of measuring/detecting phosphodiesterase by coupling the liberated phosphate to a first member of a RET pair (e.g. a fluorophore), and by labeling the antibody with a second member of the RET pair (e.g., terbium chelate), e.g., see Figures 42D and 42E
  • a fluorescently modified cAMP is used as a substrate.
  • a fluorescently labeled phosphodiester that does not resemble or is not a cAMP is used as a substrate.
  • Cyclic AMP (cAMP) analogs containing amino-alkyl linkers attached to the 2, 6, 8, or T positions are commercially available from e.g., Biolog (Bremen,
  • Some embodiments of the invention utilize a fluorescein-labeled version of cAMP as a phosphodiesterase substrate.
  • a number of analogs may be prepared, in order to compare their ability to be utilized as a substrate for a phosphodiesterase, or their performance in a RET assay using, e.g., an anti-AMP antibody. Examples are also shown in Figure 42D.
  • a labeled (e.g., fluorescein) phosphodiesterase substrate is incubated with a phosphodiesterase, in the presence of a labeled (e.g., Terbium) anti-AMP antibody.
  • the AMP when the phosphodiester is cleaved, the AMP is recognized by the antibody, bringing the anitbody's label (Tb) and the fluorescein into proximity so that FRET or TR-FRET may occur.
  • the antibody can be added before, during or after the reaction. If the antibody is present during the reaction, then the reaction can be read in real time or in a kinetics mode. That way the progression and/or rate of the reaction can be measured.
  • Some embodiments of the invention are based upon using phosphotyrosine as the epitope that is generated upon phosphodiesterase activity utilizing known, readily available antibodies.
  • a substrate consists of a phosphotyrosine labeled with a first member of a RET pair (e.g., fluorescein) that is coupled to another group through a phosphodiester linkage.
  • a RET pair e.g., fluorescein
  • Figure 42E depicts an example of this type of assay. Depending on enzyme specificity, up to four products can be formed depending on the site of ester hydrolysis.
  • This assay detects the product formed when the cleavage occurs at the phospho-ester site that is not attached to the tyrosine moiety, thereby leaving fluorescein labeled phosphotyrosine intact after enzyme activity.
  • This molecule is then detected with an anti-phosphotyrosine antibody (e.g., such as PY20) labeled with a second member of a RET pair (e.g., terbium).
  • RET is possible when the labeled antibody binds the fluorescein labeled phosphotyrosine.
  • Fluorescein labeled phosphotyrosine is recognized with high affinity by terbium- labeled PY20, and a high TR-FRET signal is generated upon this interaction (data not shown).
  • RET e.g., TR- FRET
  • a substrate can be used to detect phosphodiesterase (PDE) activity by unmasking of phosphotyrosine as shown in Figure 42F.
  • PDE phosphodiesterase
  • This substrate bis-(fluorescein-tyrosine) phosphate, will form two products, one of which will be recognized by the antibody.
  • both products are fluorescent, and therefore fluorescence background may be increased due to the presence of extra fluorescein.
  • two antibodies could be used: one directed towards phosphotyrosine, the other directed towards tyrosine.
  • Fluorescently labeled cAMP analogs modified at the 2, 6, 8, or 2' position of cAMP are readily synthesizable from commercially available starting materials, or are commercially available products (e.g., Alexa Fluor® 488 8-(6-aminohexyl)aminoadenosine 3',5'- cyclicmonophosphate, bis(triethylammonium) salt (Alexa Fluor® 488 cAMP), available as part # A35775 from Molecular Probes).
  • Antibodies labeled with terbium chelates are readily prepared using standard antibody labeling techniques and commercially available amine-reactive terbium chelates (such as Invitrogen's LanthaScreenTM Amine Reactive Tb Chelate, part # PV3581).
  • the related embodiments of the invention will provide assays that are more sensitive in terms of the amount of enzyme required to yield a suitable signal change.
  • a or D are fluorescent, and which, when cleaved by a hydrolytic enzyme, yields a product that is recognized by an antibody to which is attached a luminescent probe that can act as a partner in a RET assay with fluorescent moiety A or D.
  • Activity can also be used to identify compounds/samples that modulate these reactions.
  • the compound is added to the reaction and e.g., the reaction is compared to a control to determine if the compound modulates the reaction. Modulation includes inhibiting or activating the reaction.
  • the present invention provides phosphodiesterase assays wherein a phosphodiesterase substrate is labeled with a first member of a RET pair, wherein upon cleavage by a phosphodiesterase, an epitope for an antibody to bind is exposed/created.
  • An antibody labeled with a second member of the RET pair is contacted with the product(s) of the reaction wherein the antibody binds to the epitope an the product comprising the first member of the RET pair.
  • Some embodiments of the invention provide a method of detecting phosphodiesterase activity comprising: a) contacting i) a sample with ii) a substrate for a phosphodiesterase wherein the substrate comprises a first member of a RET pair to form a test sample; b) incubating (a) under conditions to suitable for the phosphodiesterase activity; c) contacting the test sample, either before, during or after (b), with a binding molecule with specificity of a cleavage product of the phosphodiesterase, wherein the binding molecule comprises a second member of the RET pair, wherein the cleavage product comprises the first member of a the RET pair; d) exposing the test sample to at least one wavelength of light; and e) measuring the fluorescence emission from the test sample.
  • PY72 anti-phosphotyrosine IgG antibody
  • an antibody that preferentially binds amino acid sequences containing phosphorylated tyrosines e.g., sequences phosphorylated by protein tyrosine kinases (PTKLs)
  • PY72 hybridoma cells were obtained from the SaIk Institute; the immunogen was phosphotyrosine conjugated to KLH.
  • Ascites were produced by Harlan Bioproducts for Science, Indianapolis IN. Ascites were purified with a protein G column (Pierce).
  • Purified antibody is also available from Covance, Berkeley CA (Part # MMS414P).) The antibody was then removed from the dialysis membrane and concentrated to 48.8 uM (7.3 mg/mL) using a Centricon YM50 (Millipore) concentrator.
  • a monoclonal antibody with specificity for phosphorylated serines was also prepared and labeled with a luminescent metal chelate, as described above.
  • a direct binding curve (showing luminescent metal chelate -labeled PY72 antibody binding to fluorescent acceptor labeled tracer) was generated by incubating serial dilutions of the labeled antibody (10 nM to 9.8 pM in two fold dilutions) with 1 nM fluorescent acceptor- labeled tracer (PTK labeled tracer; sequence F-ADE(p Y)LIPQQS, where F is fluorescein and pY is a phosphorylated tyrosine, SEQ ID NO:1; note that the tracer is a phosphorylated tyrosine derivative of a protein tyrosine kinase (PTK) substrate) in FP dilution buffer (part #P2839, Invitrogen, Carlsbad, CA).
  • PTK labeled tracer sequence F-ADE(p Y)LIPQQS, where F is fluorescein and pY is a phosphorylated tyrosine, S
  • a similar binding curve was performed with a luminescent metal chelated-labeled anti-pSer antibody and a fluorescent acceptor-labeled tracer (STK labeled tracer, sequence F- GRPRTS(pS)FAEG, where F is a fluorescein and pS is a phosphorylated serine, SEQ ID NO:2; note that the tracer is a phosphorylated serine derivative of a S/T kinase (STK) substrate).
  • STK labeled tracer sequence F- GRPRTS(pS)FAEG, where F is a fluorescein and pS is a phosphorylated serine, SEQ ID NO:2; note that the tracer is a phosphorylated serine derivative of a S/T kinase (STK) substrate).
  • a competition curve to show that the disruption of the antibody-tracer interaction could be monitored by both fluorescence polarization and time-resolved RET from the same sample was performed by incubating serial dilutions (10 ⁇ M to 19.5 nM in two-fold dilutions) of an unlabeled phosphotyrosine-containing peptide competitor (ADE(P Y)LIPQQS, where pY is a phosphorylated tyrosine, SEQ ID NO:3) in the presence of 10 nM Tb-chelate labeled PY72 antibody and 1 nM labeled PTK labeled tracer, as described above. After a 30 minute incubation, the plate was read on a Tecan Ultra plate reader.
  • Fluorescence polarization was measured using a 485 nm excitation filter (20 nr ⁇ bandpass) and 535 nm emission filters (25 nm bandpass).
  • Time-resolved RET was measured using a 340 nm excitation filter (35 nm bandpass) and 495 nm (10 nm bandpass) and 520 nm (25 nm bandpass) filters using a 200 ⁇ s integration window after a 100 ⁇ s post-flash delay with 10 flashes per well.
  • the time-resolved RET value (ratio) was calculated by dividing the 520 nm signal by the 495 nm signal.
  • Lyn B Kinase a member of the SRC family of protein tyrosine kinase (PTK) enzymes.
  • the kinase reaction was performed in the presence of 10 ⁇ M of a Prestwick library compound (test compound; Prestwick Library available from Prestwick Chemical, Inc., Washington DC) in 20 mM HEPES pH 7.5, 5 mM MgCl 2 , 150 nM poly(Gly:Tyr, 4:1) protein tyrosine kinase substrate, and 10 ⁇ M ATP using 1 ng of Lyn B kinase per reaction.
  • Prestwick library compound test compound; Prestwick Library available from Prestwick Chemical, Inc., Washington DC
  • the kinase reaction was allowed to proceed for 1 hour at room temperature and then stopped by adding 100 mM EDTA to a final concentration of 5 mM in a total volume of 40 ⁇ l.
  • 10 ⁇ l of a solution containing 20 nM Tb-chelate labeled PY72 antibody and 10 nM PTK labeled tracer was added to each well and incubated for an additional 30 min.
  • the plate was then read on a Tecan Ultra plate reader in both fluorescence polarization and time- resolved RET measurement modes. Fluorescence polarization was measured using a 485 nm excitation filter (20 nm bandpass) and 535 nm emission filters (25 nm bandpass).
  • Time- resolved RET was measured using a 340 nm excitation filter (35 nm bandpass) and 495 nm (10 nm bandpass) and 520 nm (25 nm bandpass) filters using a 200 ⁇ s integration window after a 100 ⁇ s post-flash delay with 10 flashes per well.
  • the time-resolved RET value (ratio) was calculated by dividing the 520 nm signal by the 495 nm signal.
  • Kinase inhibitors were identified by wells that showed high polarization or 520:495 TR-RET ratios. The results of the screen of approximately 750 compounds are shown in Example 5 - Conversion of FP Assay to Multiplex FP/TR-RET Assay
  • terbium-chelates are able to serve as donors to fluorophores such as fluorescein or rhodamine (and derivatives thereof) in TR-RET assays, and because fluorescein and rhodamine have excellent properties for use in FP assays, it is a simple matter to modify an FP assay such that it can be read in a dual-mode FP/TR-RET manner by labeling, for example, a binding partner such as a receptor protein or an antibody with a fluorescent terbium chelate.
  • the use of multiplex modes e.g., both FP and TR-RET
  • assays that are problematic in either the FP mode or TR-RET mode may be converted to robust assays using the other mode.
  • CREB cyclic- AM P response element binding protein
  • CREB kinase a serine kinase
  • the assay required the identification of a fiuorescein-labeled kinase product tracer containing a phosphorylated serine, ⁇ n addition, the assay required an anti-CREB pSerl33 antibody (available from. Cell Signaling Technologies, Beverly, MA) capable of binding the tracer.
  • Four candidate tracer peptides were prepared, as shown below, and tested for binding to the anti-pSerl33 antibody.
  • the tracers differed in their length and in. the position of the fluorophore on the peptide.
  • Tracer 1 Fluorescein-LRREILSRRP(pS)YRK (SEQ ID NO:4); Tracer 2: Fluorescein-REILSRRP(pS)YRK (SEQ ID NO:5) Tracer 3 : Fluorescein-ILSRRP(p S)YRK (SEQ ID NO:6); and Tracer 4: LRREILSRRP( ⁇ S)YRK-Fluorescein (SEQ ID NO:7).
  • Example 1 to yield an antibody with an average of 6.2 chelate molecules per antibody.
  • SEQ ID NO: 7 was seen to bind with sub-nM affinity and a 32-fold change in TR-RET value between free and bound forms.
  • PBCA a serine kinase
  • 1 ⁇ M peptide PKA substrate (LRREILSRRPSYRK, SEQ ID NO:8) in 50 mM Tris (pH 7.5) containing 10 mM MgCl 2 , 50 ⁇ M NaVO 4 , and 5 ⁇ M ATP.
  • the final reaction volume was 10 ⁇ L per well.
  • the reactions were allowed to proceed for 90 minutes at room temperature, after which a 10 ⁇ L quench/detection solution (containing labeled tracer identified in Example 5 above), Tb-chelate-labeled anti-pSerl33 antibody, and EDTA) was added.
  • the plate was covered and incubated at room temperature for 2 hours. The plate was then read on a TECAN Ultra 384 fluorescence plate reader using a 340/35 nm excitation filter and 520/25 and 495/10 nm emission filters (Chroma Technology Corp.). Data was collected using 10 flashes per well with a 100 ⁇ s delay and 200 ⁇ s integration window.
  • a Z' value was determined from 48 20 ⁇ L wells containing Tb-chelate labeled anti-pSerl33 antibody and labeled tracer (see above) in the presence (24 wells; "low signal” controls) or absence (24 wells, "high signal” controls) of 2.5 ⁇ M unlabeled tracer.
  • the plate was covered and incubated for 2 hours at room temperature. The plate was then read on a TECAN Ultra 384 fluorescence plate reader using the parameters described above. The Z'-value was 0.92.
  • an Estrogen Receptor ⁇ (ER- ⁇ ) FP competition assay was converted by directly labeling the ER receptor with an aminc-rcactivc terbium chelate; sec Example 1 above.
  • ER- ⁇ Estrogen Receptor ⁇
  • displacement of a fluorescein-labeled tracer by a competitor causes a change in the observed polarization, from high to low.
  • TR-RET assay the amount of labeled tracer bound to receptor is measured by RET between the terbium chelate on the receptor and the fluorescein, on the tracer.
  • RET signal In the absence of a competitor the RET signal is high, and as the competitor displaces the tracer this signal decreases.
  • 12.5 iiM unlabeled or Tb-chelate labeled ER- ⁇ protein were incubated with 1 nM labeled tracer (Phiormone ES2 (part#P2613, Invitrogen, Carlsbad, CA)) and titrated with serial dilutions of unlabeled estradiol, a known ER- ⁇ ligand. Both. FP and TR-RET assays showed similar EC50 values for the competition curve.
  • the TR-RET assay offers the advantage that it could be re-formatted, with similar results expected, using limiting concentrations ofreceptor and excess concentrations of tracer.
  • Example 7 The general method identified in Example 7 was used to screen for inhibitors of Epidermal Growth Factor Receptor (EGFR) Kinase (a protein tyrosine kinase) using the LOPAC (Sigma #LO1280) compound library. Hits identified in both readout modes were all seen to be true hits, whereas hits that showed discrepancy between readout modes were seen to be false. These results indicate that by multiplexing readout modes within an assay, one can significantly improve the integrity of the determined results.
  • EGFR Epidermal Growth Factor Receptor
  • LOPAC Sigma #LO1280
  • Anti p-Tyr antibody (anti-pY20 available from Zymed) was concentrated to 5 mg/mL in 100 mM sodium carbonate buffer, pH 9.5.
  • CS124-DTPA-Phe-NCS*Tb (Tb-chelate) was added at a 5 to 40-fold molar excess relative to antibody, and the reaction incubated at room temperature for 4 hours with light vortexing every 30 minutes. After 4 hours, the antibody was dialyzed twice against PBS to remove unreacted and/or hydrolyzed chelate.
  • the reaction was allowed to proceed for 90 minutes at 3O 0 C, after which a 10 ⁇ l solution of a 20 mM EDTA, 8 nM Tb-labeled anti-pTyr (anti pY72 antibody; see Examples 1 and 2) and 4 nM PTK labeled-tracer (see Example 2 above) in TR- RET dilution buffer (part#PV3152, Invitrogen, Carlsbad, CA) were added. The quenched reactions were then allowed to incubate for 1 hour at room temperature, after which they were read on a Tecan Ultra plate reader. Fluorescence Polarization was measured using a 485 nm excitation filter (20 nm. bandpass) and 535 nm emission filters (25 nm bandpass).
  • Time Resolved RET was measured using a 340 nm excitation filter (35 nm bandpass) and two emission filters; a 495nm with a 10 nm band pass for a reference peak and 520 nm with a 25nm band pass for signal change measurement, using a 200 ⁇ s integration window following a 100 ⁇ s post-flash delay.
  • TR-RET filters were from Chroma Technology Corp.
  • TR-RET values (ratios) were determined by dividing the intensity of the sample at 520 nm by the intensity of the sample at 495 nm.
  • the two identified inhibitors (Tyrphostin AG1478 and GW2974, which are known inhibitors of EGFR kinase) were assayed in a series of 3-fold dilutions, and the four poorly- correlating compounds in a series of two-fold dilutions, against EGFR kinase under conditions as described in the library screen.
  • GW2974 as the more potent inhibitor, with an EC50 of about 10-fold less than that seen for AG1478.
  • the assay was performed against a dilution series of the inhibitor Tyrphostin AG 1478 in the presence of 10 nM fluorescein.
  • the TR-RET data was seen to be impervious to the presence of the background fluorescence signal, whereas the FP data was severely compromised.
  • Example 9 Multiplex FP/TR-RET Assay using an EuflliyChelate-labeled Binding Partner Binding partners labeled with Eu-chelates can also be used in the methods of the present invention.
  • Europium(III)-chelate labeled PY72 (anti-phosphotyrosine) antibody was prepared as follows. To 50 ⁇ L of a 28.4 ⁇ M solution of PY72 antibody in phosphate- buffered saline (PBS) was added 1 ⁇ L of 21.25 mM SPDP (N-Succinimidyl 3-(2- pyridyldithio) propionate, Pierce Chemical Company) in DMSO.
  • PBS phosphate- buffered saline
  • a competition curve to show that the disruption of an Eu-chelate labeled antibody- labeled tracer interaction by an unlabeled phosphopeptide (e.g., a product of a protein kinase enzymatic reaction) could be measured by fluorescence polarization and/or time-resolved RET from the same sample was performed by incubating serial dilutions of an unlabeled phosphotyrosine-containing peptide competitor (2 ⁇ M to 1 nM in two-fold dilutions; in the presence of 5 nM Eu-chelate labeled PY72 antibody and 1 nM luminescent tracer in FP dilution buffer (Part #P2839, Invitrogen, Carlsbad, CA).
  • the luminescent labeled tracer was Alexa Fluor 633-CADE(pY)LIPQQS (SEQ ID NO: 10), a peptide in which the C5 maleimide derivative of Alexa Fluor 633 (Molecular Probes, Eugene OR, Part #A20342) had been coupled to the terminal cysteine of the peptide using standard procedures (following the protocol included with the Alexa Fluor dye) and purified via HPLC using standard procedures.
  • the peptide (CADE( ⁇ Y)LTPQQS; SEQ ID NO:9) had been ordered by AnaSpec, San Jose CA.
  • Alexa Fluor 633 has a maximum excitation wavelength of approximately 622 nm and a maximum emission wavelength of approximately 640 nm in aqueous solution.
  • RET Fluorescence polarization was measured using a 590 nm excitation filter (20 nm bandpass) and 650 nm emission filters (40 nm bandpass).
  • Time- resolved RET was measured using a 340 nm excitation filter (35 nm bandpass) and 615 nm (10 nm bandpass) and 665 nm (10 nm bandpass) emission filters using a 200 ⁇ s integration window after a 100 ⁇ s post-flash delay with 10 flashes per well.
  • the time-resolved RET value (ratio) was calculated by dividing the 665 nm signal by the 615 nm signal.
  • a multiplex system for the detection of His-tagged proteins or peptides was developed.
  • the basis of the assay was a competition between a Histidine-tagged analyte protein and a tracer consisting of fluorescein linked to a hexahistidine peptide for a terbium- chelate labeled anti-His-tag antibody.
  • the fiuorescein-labeled hexahistidine peptide associates with the anti-His-tag antibody, and this interaction can be detected by TR-RET or FP.
  • Fluorescein-His6 peptide fluorescein-HHHHHH, the "luminescent tracer;" SEQ ID NO: 11
  • ResGen Huntsv ⁇ lle AL
  • a commercial monoclonal antibody specific for the hexahistidine tag Part MCAl 396, Serotec, Raleigh, NC was purchased and used as supplied with no additional purification.
  • 0.25 mg antibody was concentrated in 100 mM sodium carbonate buffer, pH 9.5, to a final volume of 50 uL (5 mg / mL final concentration of antibody).
  • 30 ug of CS124-DTPA-Phe-NCS-Tb (a 20-fold molar excess relative to antibody) was added and the reaction allowed to proceed at room temperature for 4 hours with light vortexing every 30 minutes. After 4 hours, the antibody was dialyzed twice versus PBS to remove unreacted and/or hydrolyzed chelate.
  • a competitive binding assay was performed with 20 nM antibody and 2 nM tracer, with titration of increasing amounts of His-tagged peptide (sequence: Biotin- KGGHHHHHH, source: ResGen; SEQ ID NO: 12) ranging from 3 uM to 1.5 nM in two-fold dilutions.
  • the assay components were mixed in FP Dilution buffer (see above) and read after a 30 minute incubation on a Tecan Ultra plate reader using a 340 nm excitation filter (35 nm bandpass) and a 520 nm emission filter (25 nm bandpass). Data were collected using a 200 ⁇ s integration window after a 100 ⁇ s post-flash delay, with 10 flashes per well.
  • E. coli expression plasmids for two de-ubiquinating (DUB) substrates are constructed using the pRSET(B) vector (Invitrogen, Cat# V351-20) such that the fusion proteins encoded are comprised of (N-terminal to C-terminal), a His-tag, Emerald green fluorescent protein (EmGFP) 5 ubiquitin, a linker of variable sequence, and a C-terminal cysteine residue.
  • pRSET(B) vector Invitrogen, Cat# V351-20
  • EmGFP Emerald green fluorescent protein
  • amino acid sequences of two such substrates constructed are MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSEFATMVSKGEELFTGW PILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQ CFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIEL KGIDFKEDGNILGHKLEYNYNSHKVYITADKQKNGIKVNFKTR ⁇ NIEDGSVQLADH YQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELY KLETDQTSLYKKAGTMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAC (SEQ ID NO : 13) AND
  • BL21 StarTM (DE3)pLysS cells (Invitrogen, Cat# C6020-03) are transformed with the expression plasmids for the DUB substrates and plated on LB agar with ampicillin and chloramphenicol. Single colonies are selected and grown overnight in 50 mL of LB (Luria Broth) medium with ampicillin (100 mg/L) and chloramphenicol (34 mg/L) at 37 0 C and 225 rpm.
  • LB Lia Broth
  • 500 mL of Turbo PrimeTM Broth (Athena Enzyme Systems, 0110) is inoculated with 5 mL of each overnight culture and grown at 37 0 C at 225 rpm until the OD59 5 reached approximately 0.3. The cultures are then shifted to 25 °C and grown for one hour followed by induction with 0.5 mM IPTG. The cells are harvested after 4 hours of additional growth by centrifugation and stored at -80 0 C. Cell pellets from 500 mL of culture are suspended in 200 mL of Lysis Buffer (25 mM Tris pH 7.5, 100 mM NaCl).
  • the cells are disrupted by passing the suspension twice through a chilled high pressure homogenizer (Avestin EmulsifFlex C-50) at 10-15,000 pounds per square inch (PSI) and collected on ice.
  • the lysates are then clarified by centrifugation at 28,000xg for 30 minutes at 4 0 C.
  • the supernatants are batch bound to 2 mL of NiNTA agarose (Invitrogen) for 1 hour at 4 0 C.
  • the resin is then collected by centrifugation at 153xg for 5 min. The supernatants are discarded and the resin is suspended in approximately 5 mL of Lysis Buffer and transferred to a disposable column.
  • the columns are allowed to drain, and then are then washed with 20 mL of Lysis Buffer, followed by 10 mL of Lysis Buffer with 50 mM imidazole by gravity.
  • the column is then eluted with 4 mL of 12.5 mM Tris, 50 mM NaCl, and 500 mM Imidazole pH 7.0 and a single fraction is collected, e.g., which is bright green.
  • Dithiothreitol (DTT) is added to the eluted protein to a final concentration of 10 mM, which is then incubated at room temperature for 2 hours.
  • HBS 137 mM NaCl, 2.7 mM KCl, and 10 mM Hepes pH 7.5
  • NAP-5 column GE Healthcare 17-0853-01
  • Thiol reactive terbium chelate is then dissolved in water to 1 mg/mL and added in 2- fold molar excess to the desalted protein, which is at 60 to 80 uM.
  • the labeling reactions are allowed to proceed at room temperature for 3 hours, and the products are desalted over a NAP-5 column into HBS.
  • Protease reactions are performed using the DUB substrates EmGFP-Ub-AC-Tb or EmGFP-Ub-FFG-X-Tb in 50 mM Tris pH 7.5, 5 mM DTT, 0.1 mg/mL bovine serum albumin. (BSA), 0.5 mM ethylenediaminetetraacetic (EDTA) in 384-well low volume plates (Corning 3676). Reactions are started by addition of 10 ⁇ L of 200 nM DUB substrate to 10 ⁇ L of various concentrations of UCH-L3 (Boston Biochem E-325). Fluorescence measurements are captured after a one hour incubation at room temperature on a Tecan Ultra plate reader.
  • BSA bovine serum albumin.
  • EDTA ethylenediaminetetraacetic
  • the YFP-Ub-AC expression plasmid encodes an Alanine-Cysteine (AC) addition mutant to the C-terminus of YFP(Topaz)-ubiquitin.
  • the expression plasmid was transferred into chemically competent BL21 Star (DE3) pLysS cells using the method supplied by the vendor; followed by plating onto LB agar plates containing 0.1 mg/mL ampicillin and 0.05 mg/mL chloramphenicol. A colony was selected to inoculate 50 mL of LB broth containing 0.1 mg/mL ampicillin and 0.05 mg/mL chloramphenicol that was grown overnight at 37 0 C.
  • the YFP-Ub-AC cell paste was resuspended in 25mM Tris-HCl pH 7.5 with 10O mM NaCl and 30 mM Imidazole with a handheld polytron biohomogenizer.
  • the resuspended cells were lysed by passing through an Avestin Emulsiflex C50 homogenizer at 10,000 - 15,000 psi at 4°C.
  • the homogenized cells were centrifuged at 13,500 rpm ( ⁇ 28,000 x g) for 30 min in a JA- 14 rotor at 4°C. The supernatant was collected, and was batch bound to Ni-NTA agarose for 1 hr at 4 0 C with gentle agitation.
  • the Ni-NTA agarose was transferred to a disposable column and washed with 5 column volumes of lysis buffer to remove contaminating proteins.
  • the YFP-Ub-AC was eluted from the Ni-NTA column with 25mM Tris-HCl pH 7.5 with 100 mM NaCl and 400 mM Imidazole.
  • the intermediate was stored at -8O 0 C until required for labeling.
  • YFP-Ub-AC YFP-Ub-AC intermediate
  • a NapTM 10 desalting column a NapTM 10 desalting column
  • the eluted protein was immediately combined with 200 ⁇ g of thiol reactive Tb-chelate (Invitrogen Corp., Carlsbad, CA), and allowed to react at room temperature for two hours.
  • the reaction mixture was. loaded into a Slide-A-Lyzer (10,000 MWCO) and dialyzed against Hepes Buffered Saline (HBS) to remove unreacted Tb chelate.
  • the dialyzed YFP-Ub-AC is diluted with HBS to a final concentration of 20 ⁇ M (based upon absorbance at 280 nm) and stored at -8O 0 C.
  • Proteases (UCH-Ll, UCH-L3, USP-5, and USP-14) and ubiquitin aldehyde were purchased from Boston Biochem (Cambridge, MA).
  • serial dilutions of enzymes were prepared in 10 ⁇ L of assay buffer (20 mM Tris, pH 7.4, 0.01% Nonidet-P40, 10 mM DTT) in a black 384-well low-volume plate (Corning No. 3676).
  • To each well was then added 10 ⁇ L of a 20 nM solution of YFP-ubiquitin-Tb substrate in the same buffer.
  • the plate was read on a BMG Labtech Pherastar plate reader using the LanthaScreen filter module.
  • the emission ratio was calculated as the raw acceptor intensity divided by the raw donor intensity when measured using a 200- ⁇ s signal integration window following a 100- ⁇ s delay. No background subtraction or cross talk correction was required.
  • Kinetic reads were performed similarly against varying concentrations of UCH-L3, with the reac- tions read every minute for 90 min.
  • Inhibitor titrations were performed using 15 pM UCH-L3 and 10 nM YFP- ubiquitin-Tb in a 1 h reaction against a dilution series of ubiquitin aldehyde or ubiquitin as inhibitor.
  • Z' values were determined at various percentage conversions of substrate, using different concentration of UCH-L3.
  • 24 positive control wells and 24 negative control wells were measured and Z' was calculated according to the equation (Zhang et ⁇ l, J. Biomol. Screen. 4:61-1Z (1999).
  • Z' 1 - [3 ⁇ c + + 3 ⁇ c -)/
  • Negative control wells contained 50 nM ubiquitin- aldehyde to inhibit UCH-L3. Normalized emission ratios were calculated relative to wells that contained maximal and minimal FRET signal and then multiplied by 100.
  • Time-resolved spectra and emission signal decay of intact and cleaved YFP-Ub-AC-Tb Time-resolved spectra of 10 nM YFP-ubiquitin-Tb that had been incubated with or without excess UCH-L3 were measured using a Tecan Safire 2 plate reader. Samples were 20 ⁇ L and were read in a white 384-well low-volume plate (Corning). Excitation was set to 332 nm (20 nm bandwidth), and emission measurements were collected from 475 to 650 nm in 1- nm increments using a 200- ⁇ s signal integration window following a 100- ⁇ s delay and averaged over 100 measurements (flashes) per wavelength. Emission signal decays were measured using a BMG Labtech Pherastar plate reader.
  • a 400 nM solution of UCH-L3 (Bostonbiochem; Catalog #: E-325) in assay buffer (TR-FRET dilution buffer (PV3574) with 10 mM DTT) is prepared. Twenty microliters of the enzyme solution is added to the first column of a Corning black 384 low volume plate (#3676), and a serial dilution is performed across the plate with assay buffer (10 ⁇ L).
  • a 20 nM solution of YFP-ubiquitin-Tb substrate is prepared with assay buffer, and 10 ⁇ L of this solution is added to each well.
  • Final concentration of UCH-L3 in first well is 200 nM.
  • Final concentration of YFP-ubiquitin— Tb substrate in the assay is 10 nM.
  • Figure 41C shows a sigmodial dose response (variable slope) to obtain the EC50 value for a titration of a YFP-ubiquitin-Tb substrate.
  • the corresponding best fit values are:
  • a fluorescein-MEKl conjugate is prepared from wt MEKl (inactive) (Invitrogen, cat# P3093).
  • MEKl samples are dialyzed against HBS (137 mM NaCl, 2.7 mM KCl 5 and 10 mM Hepes pH 7.5).
  • 5-IAF 5-iodoacetaminofluorescein
  • 5-FAM 5-FAM
  • SE 5- earboxyfluorescein, succinimdyl ester
  • the reactive dyes are removed by desalting the MEKl samples over using NAP-5 columns into HBS.
  • the labeled MEKl preparations are stored frozen at 80 0 C.
  • E. coli expression plasmids for GFP fusions of kinase substrates are constructed using the pRSET(B) vector (Invitrogen V351-20) such that the fusion proteins encoded are comprised of (N-terminal to C-terminal), a His-tag, EmGFP, and a kinase substrate.
  • Two such substrates are EmGFP-ATF2 (19-96), and EmGFP-c-Jun(l-79).
  • the amino acid sequence of EmGFP-c-Jun is
  • BL21 StarTM (DE3) ⁇ LysS cells (Invitrogen C6020-03) are transformed with the expression plasmids for the GFP-tagged kinase substrates and plated on LB agar with ampicillin and chloramphenicol. Single colonies are selected and grown in 500 mL of either LB (Luria Broth) or Turbo PrimeTM Broth (Athena Enzyme Systems 0110) and are grown at 37 0 C at 225 rpm until the OD595 reached approximately 0.3 to 1.0 prior to induction. The cultures are induced with IPTG (0.05 to 0.5 mM) and the cells are harvested after 4-16 hours of additional growth by centrifugation and stored at -80 0 C.
  • IPTG 0.05 to 0.5 mM
  • Cell pellets from 500 mL of culture are suspended in 200 mL of Break Buffer (50 mM Tris pH 7.5, 200 mM NaCl, 0.1% Triton X-100, 20 ⁇ M leupeptin and 0.5 mM PMSF).
  • Break Buffer 50 mM Tris pH 7.5, 200 mM NaCl, 0.1% Triton X-100, 20 ⁇ M leupeptin and 0.5 mM PMSF.
  • the cells are disrupted by passing the suspension twice through a chilled high pressure homogenizer (Avestin EmulsifFlex C-50) at approximately 10,000 PSI and collected on ice.
  • the lysates are then clarified by centrifugation. at 28,000xg for 30 minutes at 4 0 C.
  • the supernatants are batch bound to 2 mL of NiNTA agarose (Invitrogen) for 1 hour at 4 0 C.
  • the resin is then collected by centrifiigation at approximately 500xg for 5 min. The supernatants are discarded and the resin is suspended in approximately 5 mL of Lysis Buffer and transferred to disposable columns. The columns are allowed to drain, and then are washed with 25 mL of Break Buffer, followed by 10 mL of Break Buffer with 25 mM imidazole by gravity. The columns are then eluted with 5 mL of Break Buffer with 250 mM Imidazole and a single fraction is collected, which is bright green. These purified GFP-tagged substrates are quantified using the empirically determined extinction coefficient for GFP of 40,000 M-lcm-1 at 480 nm and stored at -80 0 C.
  • Terbium-labeled antibodies are produced by labeling of phospho-specif ⁇ c antibodies c-Jun [pS73] (Biosource 44-292) and ATF2 [pT71] (Biosource 44-294) with amine-reactive terbium chelate (Invitrogen) following the manufacturer's recommended conditions and using antibody preparations in phosphate buffer saline without BSA.
  • EmGFP-ATF2 is used as a substrate for JNKl (Invitrogen PV3319), JNK2 (Invitrogen PV3620), ⁇ 38 ⁇ (Invitrogen PV3304), and p38 ⁇ (Invitrogen PV3679).
  • EmGFP-c-Jun is used as a substrate for JNKl and JNK2.
  • Fluorescein-MEKl is used as a substrate for cRaf (Invitrogen PV3805), BRAF catalytic domain (Invitrogen PV3849), and BRAF (Invitrogen PV3848). Kinase reactions are incubated at ambient temperature for 1 hour, after which the appropriate terbium labeled phospho-specif ⁇ c antibody is added to a final concentration of 2.5 or 5 nM for the GFP-fusion substrates.
  • fluorescein-MEKl For fluorescein-MEKl, an equal volume of a 1:10 dilution of an unlabeled phospho-specific antibody, Phospho-MEKl/2 (Ser217/221) (Cell Signalling Technology 9123S) is added to 5 ⁇ L kinase reactions, followed by 10 ⁇ L of 20 nM Tb-anti-Rabbit secondary Antibody (Invitrogen PV3773). All antibodies are diluted in TR-FRET dilution buffer (20 mM Tris, pH 7.5 and 0.01% TSfP-40; Invitrogen) prior to addition to the kinase reactions. Fluorescence measurements are captured after a one hour incubation at room temperature on a Tecan Ultra plate reader.
  • TR-FRET dilution buffer (20 mM Tris, pH 7.5 and 0.01% TSfP-40; Invitrogen
  • Jun kinases phosphorylate a host of transcription factors including c-Jun in response to appropriate stimulation. Phosphorylated c-Jun then interacts with c-Fos to form the transcriptional activator, API. Activity of JNK activity is readily assayed using GFP- fusions of the native substrate in accordance with the present invention e.g., utilizing c-Jun when paired with terbium labeled antibodies specific for phosphorylated c-Jun. See figure 20.
  • JNKs c-Jun N-terminal kinases
  • MAP kinase members of the MAP kinase family that specifically phosphorylate c-Jun at Ser-63 and Ser-73 following UV irradiation or other stress stimuli. This phosphorylation is dependant on a "docking" event mediated by, e.g., residues 30-60 of the c-Jun substrate and residues within different domains near the JNK active site.
  • SB202190 is a potent and selective p38 MAP kinase inhibitor. This compound inhibits p38 ⁇ and p38 ⁇ , but not the p38 ⁇ or p38 ⁇ isoforms, ERK2, other members of the MAP kinase family, or their upstream activators. This selectivity makes SB202190 a useful tool for dissecting the role of p38 in signaling pathways. SB202190 is reported to have an IC50 of 30 nM for p38 ⁇ and p38 ⁇ .
  • the p38 MAP kinases, ⁇ 38 ⁇ , p38 ⁇ , p38 ⁇ , and p38 ⁇ are evaluated against the inhibitor SB202190 (BioSource, Catnarillo, CA). Enzyme concentrations are based on EC80- values in the presence of 10 ⁇ M ATP, which corresponds to the ATP EC50 for the enzymes tested. Enzyme concentrations are 4.5 ⁇ g/mL (p38 ⁇ ), 1.2 ⁇ g/mL (p38 ⁇ ), 0.3 ⁇ g/mL (p38 ⁇ ), and 1.3 ⁇ g/mL (p38 ⁇ ).
  • the inhibition curves are performed in Kinase buffer A (Invitrogen, CA) starting at 30 ⁇ M SB202190 using 1 A log dilutions down to 3 pM. Inhibition data is generated using 400 nM ATF2-GFP fusion protein as the MAP kinase substrate. Reactions are allowed to proceed for 1 hour at 22 0 C in a 10 ⁇ L volume. The reactions are stopped by a 10 ⁇ L addition of 20 mM EDTA and 5 nM terbium- labeled, anti-phosphospecific ATF2 antibody. The results are read 60 minutes later on a Tecan Ultra384 plate reader in TR-FRET mode. The excitation wavelength used is 340 nm and emission is monitored at 495 and 520 nm. The 520:495 ratio is plotted versus inhibitor concentration using Prism (GraphPad Software, San Diego, CA) to determine IC50 values. See figure 21
  • Example 17 Extraction. Labeling and Purification of MCGG-Ubiquitiri
  • the expression plasmid (pEXP14-Ub-MCGG) encodes a Methionine-Cysteine- Glycine-Glycine (MCGG) addition mutant to the N-terminus of ubiquitin.
  • the pEXP14-Ub- MCGG vector was produced by PCR amplifying the Ub protein with recombination sites compatible with the entry vector pDonr221 (Invitrogen, Caf#12536-017). The PCR product was recombined into pDonr221.
  • pDonr221 was used in a Gateway® reaction with the destination vector pDEST14 (Invitrogen, cat# 11801-016).
  • MCGG Methionine-Cysteine-Glycine- Glycine
  • the expression plasmid is transferred into chemically competent DH5 ⁇ cells using the method supplied by the vendor; followed by plating onto LB agar plates containing 0.1 mg/mL ampicillin. A colony is selected to inoculate 50 mL of LB broth containing 0.1 mg/mL ampicillin that is grown overnight at 37°C.
  • the MCGG-ubiquitin cell paste is resuspended in Hepes Buffered Saline containing 1 mM EDTA and 10 mM DTT using a handheld polytron biohomogenizer.
  • the resuspended cells are lysed by passing through an Avestin Emulsif ⁇ ex C50 homogemzer at 10,000 - 15,000 psi.
  • the homogenized cells are centrifuged at 8900 rpm ( ⁇ 12,000 x g) for 20 min in a JA-14 rotor at 4 0 C. The supernatant is collected, and perchloric acid is added on ice to
  • MCGG- ubiquitin is eluted from the column with a salt gradient from 0 - 0.5 M sodium chloride monitoring at 280 nm (typical elution: between 0.14 - 0.22 M salt).
  • Fractions containing the desired protein are pooled together and dialyzed against Hepes Buffered Saline pH 7.5 overnight in 3500 MWCO Spectra/Por3 dialysis membrane. The dialyzed fractions are stored at -8O 0 C until required for labeling.
  • the MCGG-Ubiquitin is defrosted and the concentration is determined by absorbance at 280 nm based upon the molar extinction coefficient of ubiquitin of 1280 M-I cm-1 (molecular weight of MCGG-Ubiquitin: 8912 Da).
  • TCEP tri-(2- carboxyethyl)phosphine hydrochloride
  • the labeled ubiquitins are dialyzed against Hepes Buffered Saline overnight in 3500 MWCO Spectra/Por3 dialysis membrane to remove unreacted dye.
  • the labeled proteins are purified on a HiLoad 26/60 Superdex 75 prepgrade column. The labeled proteins typically elute between 0.6 - 0.7 column volumes.
  • Fractions containing the desired labeled protein are pooled together and concentrated with an Amicon Ultrafiltration cell with a Millipore 3000 NMWL membrane to a concentration between 0.5 - 1 mg/mL based upon absorption at 492 nm for fluorescein-ubiquitin (molar extinction coefficient at 492 nm: 83,000 M-I cm-1), 343 nm for terbium-ubiquitin (molar extinction coefficient at 343 nm: 12,570 M-I cm-1), and 280 nm for biotin-ubiquitin (molar extinction coefficient at 280 nm: 1280 M-I cm-1).
  • Molecular weight of fluorescein-ubiquitin 9341 Da; Terbium-ubiquitin: 9912 Da; and biotin-ubiquitin: 9238 Da.
  • the proteins are stored at -2O 0 C.
  • Example 18 Intrachain TR-FRET Ubiquitination Reaction The following solutions are combined in a black Corning 384 well low volume plate
  • the ATP Regeneration Solution is adapted from Yao, T.; Cohen, R. E. J. Biol. Chem. 2000, 275, 36862-36868.
  • the plate is sealed with foil to prevent evaporation and placed at 37°C for 6 - 8 hours. Following the incubation, 10 ⁇ L of TR-FRET Dilution Buffer (20 mM Tris, pH 7.5 and 0.01% NP-40) is added to each well and the plate is read on either a Tecan Ultra or a
  • Example 19 Peconiugating Assay Using Different Ubiquitin-like proteins (XJbI) UbI Fusion Proteins BL21 StarTM (DE3) pLysS cells (Invitrogen, Cat# C6020-03) are transformed with the expression plasmids for the SUMO 1/2/3 or Nedd8 substrates and plated on LB agar with ampicillin and chloramphenicol. Single colonies are selected and grown overnight in 50 mL of LB (Luria Broth) medium with ampicillin (100 mg/L) and chloramphenicol (34 mg/L) at 37 0 C and 225 rpm.
  • LB Lia Broth
  • 500 mL of LB medium is inoculated with 5 mL of each overnight culture and grown at 37 0 C at 225 rpm until the OD600 reached approximately 0.6. The cultures are then shifted to 25 0 C and grown for an addition hour followed by induction with 1 mM PTG. The cells are harvested after 4 hours of additional growth by centrifugation and stored at -80 °C. Cell pellets from 500 mL of culture are suspended in 200 mL of Lysis
  • Buffer 25 mM Tris pH 7.5, 100 mM NaCl.
  • the cells are disrupted by passing the suspension twice through a chilled high pressure homogenizer (Avestin EmulsifFlex C-50) at 10-15,000 pounds per square inch. (PSI) and collected on ice.
  • the lysates are then clarified by centrifugation at 28,000 x g for 20 minutes at 4 0 C.
  • the superaatants are batch bound to 2 mL of NiNTA agarose (Invitrogen) for 1 hour at 4 0 C.
  • the resin is collected by centrifugation at 153 x g for 5 min. The supernatants are discarded and the resin is suspended in approximately 5 mL of Lysis Buffer and transferred to a disposable column.
  • the columns are allowed to drain, and are then washed with 20 mL of Lysis Buffer, followed by 10 mL of Lysis Buffer with 30 mM imidazole by gravity.
  • the column is then eluted with 4 mL of 25 mM Tris, 50 mM NaCl, and 300 mM Imidazole pH 7.5 and a single fraction is collected, e.g., which is bright green.
  • Dithiothreitol (DTT) is added to the eluted protein to a final concentration of 10 mM.
  • HBS 137 mM NaCl, 2.7 mM KCl, and 10 mM Hepes pH 7.5
  • NAP-5 column GE Healthcare 17-0853-01
  • Thiol reactive terbium chelate is then dissolved in water to 1 mg/mL and added in 2-fold molar excess to the desalted protein.
  • the labeling reactions are allowed to proceed at room temperature for 3 hours, and the products are desalted over a NAP-5 column or dialyzed overnight into HBS.
  • To ⁇ az-SUMO2-AC MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSEFATMVSKGEELF
  • RL ⁇ YSGKQMNDEKTAADYKILGGSVLHLVLALRGGAC (SEQ ID NO:20) Deconjugating Assays for the Ubiquitin-like proteins (Ub ⁇ > A reaction buffer of TR-FRET Dilution Buffer with 2 mM DTT was used in these assays. A titration of SENPl, SENP2, or NEDPl enzymes (Boston Biochem E-700, E-710, or E-800) was performed across the plate with a final volume of 10 ⁇ L in each well. To the respective enzyme, 10 ⁇ L of a 25 nM solution of the SUMOl, SUMO2, SUMO3, or Nedd8 deconjugating substrate was added.
  • FIG 39A shows cleavage of the SUMOl deconjugating substrate (Topaz-SUMOl-Tb) and the Nedd8 deconjugating substrate (Topaz- Nedd8-Tb) by SENPl and NEDPl, respectively.
  • Figure 39B shows cleavage of the SUMO2 (Topaz-SUMO2-Tb) and SUM03 (To ⁇ az-SUM03-Tb) deconjugating substrate by SENP2
  • the inhibitor SP600125 (also called JNK inhibitor 1) is a potent and selective, ATP- competitive JNK inhibitor.
  • Jnkl or Jnk2 (300 ng/mL and 650 ng/mL, respectively) are assayed against 200 nM GFP-ATF2 in the presence of 2 uM ATP and a 3 fold-dilution series of SP600125 (Calbiochem) ranging from 10 uM to 56.5 pM for 1 hour in a 10 uL reaction using kinase assay buffer (50 mM HEPES pH 7.5, 0.01% BRIJ-35, 10 mM MgC12, and 1 mM EGTA; Invitrogen).
  • kinase assay buffer 50 mM HEPES pH 7.5, 0.01% BRIJ-35, 10 mM MgC12, and 1 mM EGTA; Invitrogen).
  • EDTA and Tb-labeled anti ATF2 are added in TR-FRET dilution buffer (20 mM Tris, pH 7.5 and 0.01% NP-40; Invitrogen) to a final concentration of 10 mM and 2 nM, respectively in a final volume of 20 uL. After 1 hour the plate is read as described previously. Each reaction is performed in triplicate and the data tabulated.
  • a dilution series of JNKl is first assayed in order to determine the concentration of kinase required to effect an 80% change in the TR-FRET value between non- phosphorylated and fully-phosphorylated product.
  • This concentration of kinase is used for Z' and interfering compound experiments, and control wells containing 5 -times this concentration of kinase are measured to verify that the experiments is performed near the EC80 for kinase.
  • 48 positive control wells and 48 negative control (no ATP) wells are measured and Z' calculated.
  • the Z' values were determined for an assay of JNKl activity using GFP-cJun (1-179) as the substrate, using an EC80 concentration of JNKl. In a 20 ⁇ L final assay volume, a Z' of
  • 0.93 was determined, using 48 positive and negative control wells in a low- volume 384- well plate. To simulate conditions for an assay (in the absence of liquid handling capacity to carry out such an assay), 4 ⁇ L of each control well was transferred to an empty well, and the Z' determined to be 0.88. Based upon these results, the assay can be readily miniaturized below at least 10 ⁇ L reaction final assay volume, given proper liquid handling abilities.
  • fluorescence-based HTS assays that are resistant to optical interference from the high concentrations of library compounds that are present in HTS screens.
  • Three common sources of interference are "color quenchers” (compounds that cause inner-filter effects by absorbing either excitation or emission light), autofluorescent compounds, and light scatter from precipitated compounds.
  • color quenchers compounds that cause inner-filter effects by absorbing either excitation or emission light
  • autofluorescent compounds compounds that cause inner-filter effects by absorbing either excitation or emission light
  • light scatter from precipitated compounds To demonstrate the resistance of terbium-based TR-FRET assays to these common interferences, positive- and negative-control wells were spiked with interfering compounds prior to being read.
  • Color quenchers NADPH, tartrazine, and allura red
  • Tartrazine and allura red are the major chromophores in the food dies FD&C Yellow #5 and FD&C Red #40, respectively.
  • Highly fluorescent compounds coumarin and fluorescein were present at 100 nM, representing an assay concentration of 200 nM.
  • This concentration of fluorescein represents 10-times the highest fluorescence intensity of any compound in the LOPAC 1280 library (Sigma) at 10 ⁇ M when read with a fluorescein filter set.
  • non-dairy coffee creamer was used at 0.5 mg/mL as a light-scattering agent. At this concentration, the solution is visibly turbid. In all these cases, negligible effect was seen on the ratiometric assay readout. In the raw donor and acceptor intensity data (not shown), only the wells containing allura red showed a noticeable ( ⁇ 30% decrease) effect of interfering compound; however, the magnitude of this affect was similar in both data channels, and were corrected by "ratioing" the data. Interference from fluorescent or light-scattering compounds was avoided by the time-resolved nature of the readout: any interference had decayed to background levels long before the measurements were made.
  • Example 22 Assay of Kinase from Cell Lvsate RAW 264.7 ceils (mouse macrophage cell line) were serum starved overnight and stimulated (or not) with lOug/ml of Anisomycin for 15 minutes prior to lysates being prepared. Lysates were prepared following a standard protocol, e.g., as described in the Kinase Activity Assay Kit protocol, Rev. Al 12/9/05, Catalog#KNZ0031, BioSource (California). The protocol is outlined below.
  • OmniaTM Lysate Assay When using the OmniaTM Lysate Assay to determine MAPKAP-K2 activity in cell lysates, the following procedure for sample preparation may be used. This protocol has been successfully applied to several cell lines of human and mouse origin. 1. Thaw Omnia Cell Extraction Buffer (BioSource, California) on ice. 2. Set up and stimulate cells as desired.
  • the clarified cell extract should be stored at -80°C until ready for analysis. Avoid repeated freeze-thaw cycles. In preparation for performing the assay, allow the samples, to thaw on ice. Mix well prior to analysis.
  • Lysate was serially diluted in buffer and 5 uL aliquots were assayed against 400 nM GFP-c Jun in assay buffer containing 100 uM ATP. Assays were stopped by addition of
  • this example utilizes two technologies, a LanthaScreen TR-FRET reagent (terbium-labeled, ubiquitin specific monoclonal antibody) that provides a donor label and a recombinant Green Fluorescent
  • ubiquitination target e.g., I ⁇ B ⁇
  • a ubiquitination target e.g., I ⁇ B ⁇
  • a pcDNA-EmGFP-IkBa expression clone (CMV promoter, TK poly A) was generated by gateway cloning technology (Invitrogen). LR recombination reaction was performed using pcDNA6.2-N-EmGFP-DEST ( Figure 32A) and Ultimate ORF clone IOH4138 substrates. The coding sequence for EmGFP-IkBa is shown in Figure 32B. This
  • DNA construct was transfected into GripTite 293 cells using Lipofectamine 2000 transfection reagent (Invitrogen). Once the cells established stable resistance to blasticidin (and stable expression of GFP), cells were sorted by FACS and clones were isolated for further assay development.
  • This example describes a GFP-I ⁇ B ⁇ fusion protein expressing HEK293 cell line (isolated clonally by FACS). This cell line is responsive to the inflammatory effects of
  • Monoclonal antibodies that specifically bind to ubiquitin or poly-ubiquitin chains were labeled with ITC-terbium chelate (roughly 7-10 labels/Ab).
  • Amine-reactive ITC-Tb chelate (Invitrogen) was conjugated to monoclonal antibodies using the manufacture's protocol. Briefly, 500 ug of antibody (dialyzed into Hepes-buffered saline, pH 7.5) was reacted with 1:10 volume of 50ug ITC-Tb-chelate (resuspended in IM Na-Bicarbonate buffer, pH 9.5). The conjugation was allowed to proceed overnight at room temperature and dialyzed into Hepes buffered saline on the following day. Tb labeling efficiency was determined using Absorbance methods.
  • the cells were lysed 30 minutes on ice with 50 uL of phospho-elisa lysis buffer (based on 2OmM tris/1% NP40 with protease inhibitors added) and briefly agitated on tabletop plate mixer (Phospho-ELISA lysis buffer composition (Ix): 2OmM Tris-HCl ⁇ H7.4, 1% NP40, 5mM EDTA, 5mM NaPP, 15OmM NaCl, 2mM VO4, 1 :200 dilution of protease inhibitor cocktail (Sigma, P8340)).
  • Phospho-ELISA lysis buffer composition (Ix) 2OmM Tris-HCl ⁇ H7.4, 1% NP40, 5mM EDTA, 5mM NaPP, 15OmM NaCl, 2mM VO4, 1 :200 dilution of protease inhibitor cocktail (Sigma, P8340)).
  • Emission values at 520 were divided by those at 340 to normalize against well-to-well variations in antibody concentrations. Ab fluorescence values at 520 were also subtracted from the 520 values of samples in order to obtain a "background subtracted" value for each sample. Examples of dose-response curve for TNF ⁇ stimulation of ubiquitination of GEP-IKBO. are shown in Figures 30.
  • Figure 3OA utilized a Tb-anti-ubiquitin antibody (FK-2).
  • Figure 3OB shows data utilizing a Tb-anti-polyubiquitin antibody (FK-I).
  • GFP-I ⁇ B ⁇ /HEK293 cells were treated with TNF ⁇ in a dose-responsive manner and lysed using a tris/1% NP-40-based lysis buffer. Tb-antibodies were then tested for their ability to bind to the GFP-I ⁇ B ⁇ -Ub complexes, using a TR-FRET readout (excitation at 340/ emission 495 and 520, lOOus lag time, 200us integration time).
  • This assay allows the user to assay an inflammation pathway (specifically), however the approach may be useful as a platform for a variety of targets from other disease pathways (e.g., ubiquitination of p53, caspases, etc).
  • protein ubiquitination assays including those related to ubiquitination-like proteins (e.g., SUMOylation, NEDDylation and ISGylation) can be performed using protein arrays.
  • proteins ubiquitination-like proteins e.g., SUMOylation, NEDDylation and ISGylation
  • Ubiquitination conjugation mix was prepared using a ubiquitin conjugation kit from Biomol. Briefly, for a 120ul reaction, the following mix was prepared:
  • the arrays were incubated with streptavidin-AF647 (0.75ug/ml) for 45 minutes at 4°C. The slides were then washed three times with buffer (5OmM Tris pH 7.5, 5mM MgSO4, 0.1% Tween 20) dried and scanned. Data from the protein arrays were acquired with GenePix Pro (Molecular Devices) and the data processed in Microsoft Excel. Results
  • This example demonstrates protein ubiquitination on protein arrays.
  • High content protein arrays are likely to be useful tools for the identification of substrates of cell machinery that either ubiquitinate, SUMOylate or NEDDylate proteins, such as to facilitate degradation, a change in protein function or alter protein localization within a cell (Pray, T. R. et al. Drug Resist Updat 5: 249-58 (2002)).
  • Example 25 - LPS induced phosphorylation of GFP-ATF2 in THPl cell lvsates THPl (ATTC, Part #TIB-202) cells were stimulated by adding varying amounts of LPS (Calbiochem, part# 437628) to me cells for 30 minutes. The cells were washed and lysed as in Example 22, and 5 ⁇ L of lysate was added to 5 ⁇ L of 400 nM GFP- ATF2 and 200 ⁇ M ATP. After 60 minutes, phosphorylated product was detected by adding Tb-anti- pATF2 (Invitrogen part #PV445) antibody and EDTA to quench the kinase reaction. Data was collected using a Tecan Ultra 384 plate reader (Tecan Group Ltd., Switzerland). Results are shown in Figure 37A.
  • Example 26 Inhibition of JNK activation by SP600125 measured in THPl cell lysates THPl cells were stimulated with LPS (60 ng/mL) in the presence of SP600125, a potent inhibitor of JNK activity, but a weak inhibitor of kinases that activate JNK.
  • the assay was performed as described in Example 25. The observed IC50 values is consistent with published work suggesting that SP600125 acts at (but not up stream of) JNK activity. Results are shown in Figure 37B.
  • a mammalian expression vector for the stable expression of a HEK293-GFP-IkBa cell line was generated by subcloning the IkBa fragment into pCDNATM6.2/N-EmGFP Dest using Invitrogen's Gateway® technology. The resulting vector pCDNA ⁇ M 6.2-GFP-IkBa was validated by sequencing.
  • the expression vector was transfected into the HEC293 cell line using LipofectamineTM LTX according to manufacturer's protocol.
  • the transfected cells were selected with blasticidin S HCl (5 ⁇ g/ml) for 14 days and sorted for GFP expressing cells by flow cytometry. Individual clones were generated by single cell sorting and the best performing clone was selected for all subsequent experiments.
  • HEK293-GFP-IkBa cells were stimulated for 30 min with varying amounts of TNF- ⁇ , after which the cells were washed and lysed (20 mM Tris, pH 7.4; 1% NP-40; 5 mM EDTA; 5 mM sodium pyrophosphate; 5 mM NaF; 150 mM NaCl; 2 mM VO4; 1:100 Phosphatase inhibitor mix 1 SIGMA P-2850; 1:100 Protease inhibitor mix SIGMA P-8340).
  • Example 28 Inhibition of TNF-q induced phosphorylation of GFP-I ⁇ B ⁇ This experiment was performed as described in Example 27, using a stimulation concentration of 1000 pg/mL LPS, with an additional 60 min incubation of the inhibitor preceding the stimulation with TNF- ⁇ .
  • the inhibitors used were IKK- inhibitor IV, BMS- 345541 and W ⁇ thaferin. Results are shown in Figure 38B.
  • An expression plasmid (pEXP17-CGG-Ubl) was constructed to encode a Cysteine- Glycine-Glycine (CGG) insertion to the N-terminus of SUMOl/2/3 or IS ⁇ eddS.
  • the pEXP17- CGG-UBl vectors were produced by PCR amplifying the Ub-like protein with recombination sites compatible with the entry vector pDonr221 (Invitrogen, Cat#12536-017). The PCR product was recombined into ⁇ Donr221.
  • pDonr221 was used in a Gateway® reaction with the destination vector pDEST17 (Invitrogen, cat#11803).
  • essentially any compatible vector for expressing a Cysteine-Glycine-Glycine (CGG) insertion to the N-terminus of SUMOl/2/3 or Nedd8 would be suitable for this procedure.
  • the expression plasmid is transferred into chemically competent BL21 StarTM (DE3) cells using the method supplied by the vendor; followed by plating onto LB agar plates containing 0.1 mg/mL ampicillin.
  • a colony is selected to inoculate 50 mL of LB broth containing 0.1 mg/mL ampicillin that is grown overnight at 37 0 C. From the overnight culture, 5 mL is used to inoculate 500 mL of LB broth containing 0.1 mg/mL ampicillin and is grown at 37 0 C until an optical density of >0.6 at 600 nm is reached.
  • IPTG isopropyl- ⁇ -D-thiogalactopyranoside
  • IPTG isopropyl- ⁇ -D-thiogalactopyranoside
  • the cells are induced for 4 hrs at 25 0 C.
  • the cells are harvested by centrifugation at 4200 rpm (in a JS-4.2 rotor) fox 20 min at 4 0 C.
  • the supernatant is discarded, and the cell paste is stored at -80 0 C.
  • the CGG-UbI cell paste is resuspended in Hepes Buffered Saline containing 1 mM EDTA and 10 mM DTT using a handheld polytron biohomogenizer.
  • the resuspended cells are lysed by passing through an Avestin Emulsiflex C50 homogenizer at 10,000 — 15,000 psi.
  • the homogenized cells are centrifuged at 13,500 rpm ( ⁇ 28,000 x g) for 20 min in a JA- 14 rotor at 4 0 C.
  • the collect supernatants are batch bound to 2 mL of Ni-NTA agarose (Invitrogen) for 1 hour at 4 0 C.
  • the resin is then collected by centrifugation at 153 x g for 5 min. The supernatants are discarded and the resin is suspended in approximately 5 mL of Lysis Buffer and transferred to a disposable column. The columns are allowed to drain, and then are then washed with 20 mL of Lysis Buffer, followed by 10 mL of Lysis Buffer with 30 mM imidazole by gravity. The column is then eluted with 4 mL of HBS with 300 mM imidazole pH 7.5. Dithiothreitol (DTT) is added to the eluted protein to a final concentration of 1O mM.
  • DTT Dithiothreitol
  • the protein is then loaded onto a HighTrap Q HP (SUMO 1/2/3) (GE Healthcare 17- 1153-01) or HighTrap SP HP (Nedd8) (GE Healthcare 17-1151-01) column.
  • a linear gradient of 0 to 400 mM NaCl over 30 column volumes is performed by the AKTA purifier.
  • the desired protein elutes between 150 - 300 mM NaCl.
  • the fractions containing the desired protein are pooled and DTT is added to a final concentration of 1O mM.
  • HBS 137 mM NaCl, 2.7 mM KCl, and 10 mM Hepes pH 7.5
  • NAP-5 column GE Healthcare 17-0853-01
  • thiol reactive terbium chelate Invitrogen, PV3580
  • fluorescein labeling of the proteins thiol reactive fluorescein (Invitrogen, F- 150) is dissolved in DMSO to 5 mg/mL and added in a 5 fold excess to the desalted protein.
  • the labeling reactions are allowed to proceed at room temperature for 4 hours, and the products are desalted over a NAP-5 column or dialyzed overnight into HBS.
  • the following reagents were supplied by BioMol with the following SKU #: El (UW9330); Ubc9 (UW9320); GST-RanBP2 (UW9455); and GST-SPlOO (UW9825).
  • El UW9330
  • Ubc9 UW9320
  • GST-RanBP2 UW9455
  • GST-SPlOO UW9825
  • the plate is sealed with foil to prevent evaporation and placed at 37°C for 1-3 hours.
  • 10 ⁇ L of TR-FRET Dilution Buffer (20 mM Tris, pH 7.5 and 0.01% NP-40) containing 40 nM Tb-anti-GST (Invitrogen, PV4216) is added to each well and the plate is allowed to equilibrate at room temperature for 30 minutes.
  • Figure 40 shows representative data of a Anti-epitope TR-FRET SUMOylation assay of GST-SPlOO with a Fluorescein-SUMO 1/2/3 and a Tb-anti-GST antibody.
  • Example 30 Deubiquitination assays using a fusion protein between a GFP and a ubiquitin
  • a reaction buffer of TR-FRET Dilution Buffer with 2 mM DTT was used in these assays.
  • a titration of SENPl, SENP2, or NEDPl enzymes (Boston Biochem E-700, E-710, or E-800) was performed across the plate with a final volume of 10 ⁇ L in each well.
  • 10 ⁇ L of a 25 nM solution of the SUMOl, SUMO2, SUMO3, or Nedd8 deconjugating substrate was added. Fluorescence measurements were captured after a one hour incubation at room temperature on a BMG Labtech Pherastar plate reader. Intensities were measured at 520 nm (20 nm bandwidth) and 495 nm (10 nm bandwidth), with excitation at 340 nm (30 nm bandwidth).
  • GFP-Ub-Tb was tested as a substrate (at 10 nM) against UCH-L3 ( ⁇ ), USP-2 (•), USP-15 (A), UCH-Ll (T), USP-5 ( ⁇ ) and USP-14 (o).
  • UCH-L3 BioMol; UW9745
  • USP-2 BioMol; UW9850
  • USP-15 BioMol; UW9845
  • UCH-Ll BostonBiochem; E- 340
  • USP-5 BostonBiochem; E-322
  • USP-14 BostonBiochem; E-342
  • USP-14 is not expected to show activity in the absence of association with components of the 26S proteasome.
  • USP-2 and USP-15 are indistinguishable.
  • Figure 41A The tight-binding DUB inhibitor, ubiquitin aldehyde, was titrated against 0.1 nM
  • This example provides exemplary literature related to compositions and methods of the invention and is meant to provide examples of non-limiting methods and compositions of the present invention. It shows an example of a User Guide for LanthascreenTM Ubiquitin
  • Sections 1.0 and 2.0 provide, inter alia, examples of reagents capable of use in the methods of the present invention and possible amounts ⁇ e.g., weights) of which these reagents can be packaged in.
  • Section 3.0 is an introduction describing, inter alia, FRET, TR-FRET and common lanthanides used in FRET, including TR-FRET.
  • Section 4.0 describes, inter alia, non-limiting examples of instrument settings and general principles related to the present invention.
  • Section 5.0 describes various non-limiting examples of assay formats related to detecting and/or measuring ubiquination.
  • Section 5.0 includes sample assay conditions.
  • sample assay conditions One skilled in the art will recognize that these conditions are exemplary and the present invention includes other conditions that allow, in this case, a ubiquination reaction to occur and allows for detection of ubiquination as described herein.
  • the conditions described for the anti- epitope ubiquination assay are provides as exemplary and/or optimal conditions.
  • a similar ubiquitination assay can be carried out wherein the antibody binds the protein ⁇ e.g., binds native protein sequences) and not necessarily an epitope tag incorporated into the protein or polypeptide.
  • Section 6.0 describes examples of ubiquination assays of the present invention involving GFP fusion proteins.
  • the present invention is not limited to the use of GFP as a fluorescent protein or polypeptide.
  • the present invention includes the use of any compatible fluorescent protein or polypeptide.
  • GFP is shown as an example of a fluorescent protein or polypeptide that is compatible with a terbium donor.
  • Section 7.0 demonstrates, inter alia, the robustness/data quality for exemplary methods of the present invention using ratiometric measurements.
  • TR-FRET time-resolved FRET
  • the premise of a TR-FRET assay is the same as that of a standard FRET assay: when a suitable pair of fluorophores are brought within close proximity of one another, excitation of the first fluorophore (the donor) can result in energy transfer to the second fluorophore (the acceptor). This energy transfer is detected by an increase in the fluorescence emission of the acceptor, and a decrease in the fluorescence emission of the donor.
  • FRET is often expressed as a ratio of the intensities of the acceptor and donor fhiorophores.
  • the ratiometric nature of such a value corrects for differences in assay volumes between wells, and corrects for quenching effects due to colored compounds.
  • TR-FRET assays use a long-lifetime lanthanide chelate as the donor species.
  • Lanthanide chelates are unique in that their excited state lifetime (the average time that the molecule spends in the excited state after accepting a photon) can be on the order of a millisecond or longer. This is in sharp contrast to the lifetime of common fluorophores used in standard FRET assays, which are typically in the nanosecond range. Because interference from autofluorescent compounds or scattered light is also on the nanosecond timescale, these factors can negatively impact standard FRET assays.
  • TR-FRET assays are performed by measuring FRET after a suitable delay, typically 50 to 100 microseconds after excitation by a flashlamp excitation source in a microtiter plate reader. This delay not only overcomes interference from background fluorescence or light scatter, but also avoids interference from direct excitation due to the non-instantaneous nature of the flashlamp excitation source.
  • the most common lanthanides used in TR-FRET assays for HTS are terbium and europium. Terbium offers unique advantages over europium when used as the donor species in a TR-FRET assay.
  • terbium-based TR-FRET assays can use common fluorophores such as fluorescein as the acceptor.
  • fluorescein-labeled reagents may be used rather than biotinylated molecules that must then be indirectly labeled via streptavidin- mediated recruitment of APC as is commonly performed in europium-based assays.
  • the terbium donor is excited using a 340 nm excitation filter with a 30 nm bandwidth.
  • the exact specifications of the excitation filter are not critical, and filters with similar specifications will work well.
  • excitation filters that work with, europium-based TR-FRET systems will perform well with the LanthaScreenTM terbium chelates.
  • the terbium emission spectrum is characterized by four sharp emission peaks, with silent regions between each peak.
  • the first terbium emission peak (centered between approximately 485 and 505 nm) overlaps with the maximum excitation peak of fluorescein. Energy transfer to fluorescein is then measured in the silent region, between the first two terbium emission peaks.
  • a filter centered at 520 nm with a 25 nm bandwidth is used for this purpose. The specifications of this filter are more significant than those of the excitation filter.
  • standard "fluorescein" filters may not be used, because such filters also pass light associated with the terbium spectra as well.
  • the emission of fluorescein due to FRET is referenced (or "ratioed") to the emission of the first terbium peak, using a filter that isolates this peak. This is typically accomplished with a filter centered at 490 or 495 nm, with a 10 nm bandwidth. In general, a 490 nm filter will reduce the amount of fluorescein emission that "bleeds through” into this measurement, although instrument dichroic mirror choices (such as those on the Tecan Ultra instrument) may necessitate the use of a 495 nm filter. The effect on the quality of the resulting measurements is minimal in either case.
  • Filters suitable for LanthaScreenTM assays are available from Chroma (Rockingham, VT) as filter set PVOOl, or from other vendors.
  • a LanthaScreenTM filter module for the BMG LABTECH PHERAstar is available direct from BMG LABTECH (Durham, NC).
  • instrument settings are typical to the settings used with europium-based technologies.
  • guidelines provided by the instrument manufacturer can be used as a starting point for optimization.
  • a delay time of 100 ⁇ s, followed by a 200 ⁇ s integration time, would be typical for a LanthaScreenTM assay.
  • the number of flashes or measurements per well is highly instrument dependent and should be set as advised by your instrument manufacturer.
  • LanthaScreenTM assays can be run on any filter-based instrument capable of time-resolved FRET, such as the Tecan Ultra, BMG LABTECH PHERAStar, Molecular Devices Analyst, or PerkinElmer Envision.
  • LanthaScreenTM assays have also been performed successfully on the Tecan Saf ⁇ re 2 monochromator-based instrument and the Molecular Devices M5 instrument. Contact Invitrogen. Technical. Services for instrur ⁇ ent-specif ⁇ c setup guidelines.
  • the LanthaScreenTM ubiquitination products provide sensitive HTS reagents to monitor changes in the rate of formation, or the amount of mono and polyubiquitination of proteins.
  • TR-FRET donor i.e. terbium
  • acceptor i.e. fluorescein
  • universal assay reagents were created that can be used to rapidly develop screening assays for ubiquitin conjugating enzymes. Due to the selective labeling process, all of the lysines within ubiquitin are unmodified, and the labeled ubiquitin reagents are readily incorporated into ubiquitin-protein conjugates and poly-ubiquitin chains.
  • fluorescein, terbium, or biotin- ubiquitin are incubated with ubiquitin conjugating enzymes (El, E2, and E3), a target protein to be ubiquitinated, and ATP.
  • the enzymes conjugate the labeled ubiquitins onto the target protein, resulting in mono or polyubiquitination.
  • a detection reagent i.e. a Tb-anti-epitope tag antibody or LanthaScreenTM' Tb-Streptavidin
  • a detection reagent i.e. a Tb-anti-epitope tag antibody or LanthaScreenTM' Tb-Streptavidin
  • the extent of target protein ubiquitination is directly related to the TR-FRET signal.
  • an increase in the TR-FRET signal signifies the ubiquitination. of the target protein, whereas no increase in the TR-FRET signal would suggest that the target protein is not ubiquitinated.
  • a drug is introduced to measure the effectiveness of the compound to inhibit or promote the ubiquitination of the target protein. If the drug inhibits the ubiquitination reaction, a decrease in the TR-FRET signal (compared to control wells) would be observed due to a decrease in the ubiquitination of the target protein. Conversely, an increase in the TR-FRET signal would be observed if the drug promotes the ubiquitination of the target protein.
  • Tb-labeled anti-species antibodies from the LanthaScreenTM toolbox provides additional assay formats for detecting ubiquitination when a specific primary antibody to the target protein is available.
  • the versatility of the LanthaScreenTM ubiquitination reagents allows one to easily construct a custom assay that will integrate the advantages of TR-FRET HTS with ⁇ iimaL development time.
  • Example assay conditions for the LanthaScreen TR-FRET ubiquitination assays are outlined below.
  • the assay parameters were experimentally determined based upon the ubiquitin conjugating enzyme UbcHl (E2-25k), and are provided as a starting point for optimization.
  • the addition of dithiothreitol (DTT) is optional, and may be required to activate some ubiquitin conjugating enzymes.
  • DTT dithiothreitol
  • EDTA can be added at a concentration equal to the Mg 2+ concentration within the reaction to prevent ATP hydrolysis.
  • the anti-epitope ubiquitination assay can be used when, the target protein contains an epitope tag. Since the TR-FRET donor (Tb) is located on the introduced antibody, this assay can be used for the detection of mono or polyubiquitination because ubiquitin chain formation is not required to complete the TR-FRET pairings ( Figure 27 (Fluorescein Anti- epitope/Terbium Ub)).
  • Tb-anti-GST final concentration: 1 nM
  • Intrachain Ubi ⁇ uitination Assay The intrachain ubiquitination assay is used for detecting the polyubiquitination of a target protein. Since both, the TR-FRET donor and acceptor are located on ubiquitin itself, no development step or reagent addition step is required. ( Figure 22) This allows the intrachain ubiquitination reaction to be used for real time ubiquitination readout (or ubiquitination kinetics), or as an endpoint assay. The conditions outlined below are for an endpoint assay readout.
  • the assay volume should be increased to 20 ⁇ L, and the concentration of the Fluorescein-Ubiquitin and LanthaScreenTM Tb-Ubiquitin should be decreased to 150 nM and 12.5 nM, respectively, to prevent the observation of diffusional enhanced FRET.
  • the addition of a small amount of detergent ( ⁇ 0.01% Nonidet P-40) to the reaction is also recommended to prevent adsorption of the proteins to the plate.
  • the Biotin/Streptavidin ubiquitination assay can also be used to detect the polyubiquitination of a target protein.
  • the TR-FRET donor (Tb) is introduced with the addition of LanthaScreenTM Tb-Streptavidin during the development step.
  • Biotin-Ubiquitin 40O nM 2.5 ⁇ L 10O nM
  • Pre-mixing of Solutions for Addition to Plate resulted in minor variances in the TR-FRET signal. If pre-m ⁇ x ⁇ ng is performed, higher Z' values were achieved when the ATP solution was added as a second step to initiate the ubiquitination reaction. Pre-mixing conditions should be assessed to identify optimal assay conditions.
  • Green Fluorescent Protein is an excellent FRET acceptor of the
  • GFP-fusion proteins can be used in a ubiquitination assay with LanthaScreenTM Tb-Ubiquitin or Tb-Streptavidin/Biotin-Ubiquitin.
  • GFP replaces fluorescein as the TR-FRET acceptor, and can. still be read with the standard LanthaScreenTM filter sets.
  • the TR-FRET value is a unitless ratio derived from the underlying donor and acceptor signals. Because the underlying donor and acceptor signals are dependent on instrument settings (such as instrument gain), the TR-FRET ratio, signal-to-noise (S/N), signal-to-background (S/B), and the resulting "top" and "bottom” of an assay window will depend on these settings as well, and will vary from instrument to instrument. What is important in determining the robustness of an assay is not the size of the window as much as the size of the errors in the data relative to the difference in the maximum and minimum values.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • Urology & Nephrology (AREA)
  • Biotechnology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Microbiology (AREA)
  • Biomedical Technology (AREA)
  • Analytical Chemistry (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • Physics & Mathematics (AREA)
  • Hematology (AREA)
  • General Health & Medical Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Genetics & Genomics (AREA)
  • Cell Biology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biophysics (AREA)
  • Food Science & Technology (AREA)
  • Medicinal Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Investigating Or Analysing Materials By The Use Of Chemical Reactions (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Peptides Or Proteins (AREA)
PCT/US2006/060373 2005-10-28 2006-10-30 Kinase and ubiquination assays Ceased WO2007051207A2 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
EP06839622A EP1955071A4 (en) 2005-10-28 2006-10-30 ASSAYS OF ACTIVITY KINASE AND UBIQUITINATION
JP2008538212A JP2009513681A (ja) 2005-10-28 2006-10-30 キナーゼおよびユビキネーションアッセイ法

Applications Claiming Priority (10)

Application Number Priority Date Filing Date Title
US73131005P 2005-10-28 2005-10-28
US60/731,310 2005-10-28
US73581205P 2005-11-14 2005-11-14
US60/735,812 2005-11-14
US75954506P 2006-01-18 2006-01-18
US60/759,545 2006-01-18
US77423606P 2006-02-17 2006-02-17
US60/774,236 2006-02-17
US83211406P 2006-07-21 2006-07-21
US60/832,114 2006-07-21

Publications (2)

Publication Number Publication Date
WO2007051207A2 true WO2007051207A2 (en) 2007-05-03
WO2007051207A3 WO2007051207A3 (en) 2007-07-19

Family

ID=37968695

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2006/060373 Ceased WO2007051207A2 (en) 2005-10-28 2006-10-30 Kinase and ubiquination assays

Country Status (4)

Country Link
US (2) US20070264678A1 (https=)
EP (2) EP2221385A3 (https=)
JP (1) JP2009513681A (https=)
WO (1) WO2007051207A2 (https=)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2009215238A (ja) * 2008-03-11 2009-09-24 Osaka Univ 希土類発光プローブ
DE102008024567A1 (de) * 2008-05-21 2009-12-03 Georg-August-Universität Göttingen Stiftung Öffentlichen Rechts Universitätsmedizin Verfahren zur Messung einer Konzentration einer Messsubstanz in einer biologischen Probe
WO2010015376A1 (en) * 2008-08-04 2010-02-11 Medizinische Hochschule Hannover Method for determining sumoylation
US8642256B2 (en) 2005-10-28 2014-02-04 Life Technologies Corporation Kinase and ubiquination assays
EP2688912A4 (en) * 2011-03-23 2014-09-17 Agency Science Tech & Res RECOMBINANT PROTEIN BIOSENSORS AND METHOD FOR DETECTING THE PRESENCE OF AN ANALYZMOLEKÜLS

Families Citing this family (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7727752B2 (en) 2003-07-29 2010-06-01 Life Technologies Corporation Kinase and phosphatase assays
US7619059B2 (en) 2003-07-29 2009-11-17 Life Technologies Corporation Bimolecular optical probes
CA2445420A1 (en) 2003-07-29 2005-01-29 Invitrogen Corporation Kinase and phosphatase assays
US20050064485A1 (en) * 2003-09-12 2005-03-24 Kurt Vogel Multiplex binding and activity assays
WO2009142678A1 (en) 2008-03-27 2009-11-26 Promega Corporatin Protein labeling with cyanobenzothiazole conjugates
WO2010044892A1 (en) 2008-10-17 2010-04-22 President And Fellows Of Harvard College Diagnostic method based on large scale identification of post-translational modification of proteins
WO2010127980A1 (en) * 2009-05-05 2010-11-11 F. Hoffmann-La Roche Ag Fret-based binding assay
WO2011090159A1 (ja) * 2010-01-22 2011-07-28 独立行政法人科学技術振興機構 蛋白質の分解活性を測定するためのプローブ試薬
WO2012135493A1 (en) * 2011-03-31 2012-10-04 Environmental Technology Solutions Polymers and task functionalized polymers for enhanced change detection
WO2014179494A1 (en) * 2013-04-30 2014-11-06 Colorado State University Research Foundation Sensors and assays for ubiquitin or ubiquitin-like proteins
GB201417288D0 (en) * 2014-09-30 2014-11-12 Univ Dundee Cysteine labelling
US10167496B2 (en) 2015-10-01 2019-01-01 The Uab Research Foundation SUMOylation assay and related reagents

Family Cites Families (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR2570703B1 (fr) 1984-09-26 1988-07-08 Commissariat Energie Atomique Complexes macropolycycliques de terres rares et application a titre de marqueurs fluorescents
US5220012A (en) 1984-09-26 1993-06-15 Compagnie Oris Industrie Sa Macropolycyclic rare earth complexes and application as fluorescent tracers
US5162508A (en) 1987-12-18 1992-11-10 Compagnie Oris Industrie Rare earth cryptates, processes for their preparation, synthesis intermediates and application as fluorescent tracers
WO1993011433A1 (en) 1991-12-05 1993-06-10 Wallac Oy Luminescent lanthanide chelates
US5925517A (en) 1993-11-12 1999-07-20 The Public Health Research Institute Of The City Of New York, Inc. Detectably labeled dual conformation oligonucleotide probes, assays and kits
US5622821A (en) 1994-06-29 1997-04-22 The Regents Of The University Of California Luminescent lanthanide chelates and methods of use
US6162931A (en) 1996-04-12 2000-12-19 Molecular Probes, Inc. Fluorinated xanthene derivatives
EP1203026A4 (en) 1999-07-29 2005-03-16 Dyax Corp BINDING CENTERS FOR FIBRIN
IL147854A0 (en) 1999-07-29 2002-08-14 Epix Medical Inc Multimeric compounds, contrast agents containing the same and diagnostic methods utilizing the same
GB9927331D0 (en) * 1999-11-18 2000-01-12 Fluorescience Ltd Assay for measuring enzyme activity in vivo
WO2001046694A2 (en) * 1999-12-22 2001-06-28 Biosignal Packard Inc. A bioluminescence resonance energy transfer (bret) fusion molecule and method of use
GB0007915D0 (en) * 2000-03-31 2000-05-17 Univ Bristol Protein kinase assay
DE10029210A1 (de) * 2000-06-14 2002-01-31 Vasopharm Biotech Gmbh & Co Kg Testsystem sowie dessen Verwendung
DE10108263A1 (de) * 2001-02-21 2002-09-05 Max Planck Gesellschaft Analyse von Modifizierungen und Demodifizierungen von Proteinen mit Ubiquitinverwandten Proteinen mittels FRET (Fluorescence Resonance Energy Transfer)
TWI240632B (en) 2001-07-30 2005-10-01 Epix Medical Inc Purified peptides for peptide-based multimeric targeted contrast agents
US20040053324A1 (en) * 2002-08-30 2004-03-18 Brian Wong Assays and compositions for identifying agents that modulate the activity of deubiquitinating agents
EP1498133A1 (en) * 2003-07-18 2005-01-19 Aventis Pharma Deutschland GmbH Use of a pak inhibitor for the treatment of a joint disease
CA2445420A1 (en) * 2003-07-29 2005-01-29 Invitrogen Corporation Kinase and phosphatase assays
US7619059B2 (en) 2003-07-29 2009-11-17 Life Technologies Corporation Bimolecular optical probes
US20050064485A1 (en) * 2003-09-12 2005-03-24 Kurt Vogel Multiplex binding and activity assays
JP2009513681A (ja) 2005-10-28 2009-04-02 インヴィトロジェン コーポレーション キナーゼおよびユビキネーションアッセイ法

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See references of EP1955071A4 *

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8642256B2 (en) 2005-10-28 2014-02-04 Life Technologies Corporation Kinase and ubiquination assays
JP2009215238A (ja) * 2008-03-11 2009-09-24 Osaka Univ 希土類発光プローブ
DE102008024567A1 (de) * 2008-05-21 2009-12-03 Georg-August-Universität Göttingen Stiftung Öffentlichen Rechts Universitätsmedizin Verfahren zur Messung einer Konzentration einer Messsubstanz in einer biologischen Probe
WO2010015376A1 (en) * 2008-08-04 2010-02-11 Medizinische Hochschule Hannover Method for determining sumoylation
EP2154533A1 (en) * 2008-08-04 2010-02-17 Medizinische Hochschule Hannover Method for determining SUMOylation
US8551717B2 (en) 2008-08-04 2013-10-08 Medizinische Hochschule Hannover Method for determining sumoylation
EP2688912A4 (en) * 2011-03-23 2014-09-17 Agency Science Tech & Res RECOMBINANT PROTEIN BIOSENSORS AND METHOD FOR DETECTING THE PRESENCE OF AN ANALYZMOLEKÜLS

Also Published As

Publication number Publication date
US20100151484A1 (en) 2010-06-17
WO2007051207A3 (en) 2007-07-19
EP1955071A2 (en) 2008-08-13
EP2221385A2 (en) 2010-08-25
EP1955071A4 (en) 2009-03-18
JP2009513681A (ja) 2009-04-02
EP2221385A3 (en) 2010-12-01
US20070264678A1 (en) 2007-11-15
US8642256B2 (en) 2014-02-04

Similar Documents

Publication Publication Date Title
US8642256B2 (en) Kinase and ubiquination assays
US20080138836A1 (en) Kinase and ubiquination assays
Horton et al. A substrate for deubiquitinating enzymes based on time-resolved fluorescence resonance energy transfer between terbium and yellow fluorescent protein
US20090035796A1 (en) Enzyme sensors including environmentally sensitive or fluorescent labels and uses thereof
US20120083427A1 (en) Kinase and phosphatase assays
EP1671128B1 (en) Applications of the resonance energy transfer between terbium and GFP
JP2007500710A (ja) キナーゼおよびホスファターゼアッセイ
US20050170442A1 (en) Bimolecular optical probes
US20070015231A1 (en) Assay for protein tyrosine phosphatases
Speight et al. Minimalist approaches to protein labelling: getting the most fluorescent bang for your steric buck
CN110044855A (zh) 双受体时间分辨时间分辨荧光共振能量转移法
AU2011266816B2 (en) Fluorescent -labelled diubiquitin substrate for a deubiquitinase assay
Pérez Berrocal et al. A Pro‐Fluorescent Ubiquitin‐Based Probe to Monitor Cysteine‐Based E3 Ligase Activity
EP1820024B1 (en) Ubiquitin ligase assays and related reagents
US11630109B2 (en) Sensors and assays for ubiquitin or ubiquitin-like proteins
Muli et al. High-throughput assay exploiting disorder-to-order conformational switches: application to the proteasomal Rpn10: E6AP complex
Voget et al. Early Kinetic Characterization of SARS-CoV-2 Main Protease Inhibitors: A Review and Guidance for Biochemical Assessments
Peterson et al. Real‐Time and Continuous Sensors of Protein Kinase Activity Utilizing Chelation‐Enhanced Fluorescence
US20160289650A1 (en) Fluorescent protein biosensors to probe the conformational activation of cdk/cyclin kinases
WO2010031767A2 (en) Fluorescent-labelled atpases

Legal Events

Date Code Title Description
ENP Entry into the national phase

Ref document number: 2008538212

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2006839622

Country of ref document: EP

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 06839622

Country of ref document: EP

Kind code of ref document: A2