WO2006108518A1 - Isoliertes photoprotein gr-bolinopsin, sowie dessen verwendung - Google Patents

Isoliertes photoprotein gr-bolinopsin, sowie dessen verwendung Download PDF

Info

Publication number
WO2006108518A1
WO2006108518A1 PCT/EP2006/002939 EP2006002939W WO2006108518A1 WO 2006108518 A1 WO2006108518 A1 WO 2006108518A1 EP 2006002939 W EP2006002939 W EP 2006002939W WO 2006108518 A1 WO2006108518 A1 WO 2006108518A1
Authority
WO
WIPO (PCT)
Prior art keywords
photoprotein
nucleic acid
bolinopsin
sequence
acid molecules
Prior art date
Application number
PCT/EP2006/002939
Other languages
English (en)
French (fr)
Inventor
Stefan Golz
Eugene Vysotski
Svetlana Markova
Ludmila Burakova
Ludmila Frank
Original Assignee
Bayer Healthcare Ag
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Bayer Healthcare Ag filed Critical Bayer Healthcare Ag
Publication of WO2006108518A1 publication Critical patent/WO2006108518A1/de

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/43504—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
    • C07K14/43595—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from coelenteratae, e.g. medusae

Definitions

  • the invention relates to the photoprotein gr-bolinopsin, its nucleotide and amino acid sequence, as well as the activity and use of the photoprotein gr-bolinopsin.
  • Bioluminescence is the phenomenon of light generation by living beings. It is the result of biochemical reactions in cells, in which the chemical energy is released in the form of light quanta (so-called cold emission by chemiluminescence). Such generated light is monochromatic because it is emitted in a discrete electron transition, but can be shifted to longer wavelength spectral regions by secondary luminescent dyes (e.g., fluorescent jellyfish of the genus Aequora).
  • secondary luminescent dyes e.g., fluorescent jellyfish of the genus Aequora
  • the biological function is manifold: in the depth of the sea between 200 and 1000 m (mesopelagic), around 90% of all living beings light up.
  • the light signals are used here for partner advertising, deception and bait. Even fireflies and fireflies use the light signals to find a partner.
  • the importance of lighting bacteria, fungi and unicellular algae, however, is unclear. It is thought to be used to coordinate many individuals of a large population or to be a biological clock.
  • a variety of coelenterates are bioluminescent (Morin et al., 1974). These organisms emit blue or green light.
  • the aequorin from Aequoria victoria (Shimomura et al., 1969), identified as the first light-producing protein in 1962, emitted a blue light and non-green light as an isolated protein, as observed phenotypically in Aequoria victoria.
  • the green fluorescent protein (GFP) could be isolated from Aequoria victoria, which makes the medusa phenotypically green due to the stimulation by the aequorin (Johnson et al, 1962, Hastings et al., 1969, Inouye et al, 1994).
  • Clytin Inouye et al., 1993
  • mitrocomin (Fagan et al., 1993)
  • obelin Illarionov et al., 1995) could also be identified and described as further
  • Table 1 Overview of some photoproteins. Given is the name, the organism from which the protein has been isolated and the identification number (Acc No.) of the database entry.
  • Table 2 Overview of some photoproteins. Given is the organism from which the protein has been isolated, the name of the photoprotein and a selection of patents or applications.
  • Bioluminescence is widely used in the art today, e.g. in the form of bio-indicators for environmental pollution or in biochemistry for the sensitive detection of proteins, for the quantification of certain compounds or as so-called “reporters” in the study of cellular gene regulation.
  • Photoproteins differ not only in their nucleotide and amino acid sequence, but also in their biochemical and physical properties.
  • Reporter or indicator genes are generally genes whose gene products can easily be detected by simple biochemical or histochemical methods. There are at least two types of reporter genes.
  • Resistance genes are genes whose expression confers on a cell resistance to antibiotics or other substances whose presence in the growth medium leads to cell death when the resistance gene is absent.
  • reporter genes The products of reporter genes are used in genetic engineering as fused or unfused indicators. Among the most common reporter genes is beta-galactosidase (Alam et al., 1990), alkaline phosphatase (Yang et al., 1997, Cullen et al., 1992), luciferases, and other photoproteins (Shinomura, 1985, Phillips GN, 1997; Snowdowne et al., 1984).
  • Luminescence refers to the emission of photons in the visible spectral range, this being done by excited emitter molecules. In contrast to fluorescence, the energy is not supplied from outside in the form of radiation of shorter wavelength.
  • Chemiluminescence is a chemical reaction that leads to an excited molecule that glows when the excited electrons return to their ground state. When this reaction is catalyzed by an enzyme, it is called bioluminescence.
  • the enzymes involved in the reaction are generally referred to as luciferases.
  • the reaction products were incubated for 30 minutes at 37 ° C with proteinase K to inactivate the polymerase and the cDNA was precipitated with ethanol.
  • the expression cDNA library was performed according to the manufacturer's instructions using the "SMART cDNA Library Construction Kit” from Clontech (USA) The cloning took place in the expression vector pTriplEx2 (Clontech, USA) .
  • the expression vectors were obtained by electroporation into bacteria of the strain E. coli XLI -Bue transformed.
  • the bacteria were plated on LB broth and incubated for 24 hours at 37 ° C. Subsequently, replica plating was performed by transferring the bacteria to another agar plate using a nitrocellulose filter. The replica plate was again incubated for 24 hours at 37 ° C and the grown bacterial colonies transferred to LB liquid medium. After the addition of IPTG (final concentration 0.1 mM), the bacteria were incubated for 4 hours at 37 ° C on a shaker. The bacteria were harvested by centrifugation and (9.0 5 mM EDTA, 20 mM Tris-HCL pH) resuspending the bacterial mass in 0.5 ml of lysis buffer at 0 0 C. Subsequently, the digestion of the bacteria by ultrasound.
  • the lysates were incubated at 4 ° C for 3 hours after the addition of coelenterazines (final concentration 10E-07 M). Subsequently, the measurement of the bioluminescence after the addition of calcium chloride (final concentration 20 mM) in the luminometer.
  • a photoprotein was identified.
  • the photoprotein was termed gr-bolinopsin.
  • the photoprotein gr-bolinopsin is shown in detail.
  • the photoprotein gr-bolinopsin shows the highest nucleic acid-level homology to bolinopsin from Bolinopsis infundibulum with an identity of 84% ( Figure 6).
  • the BLAST method was used (Altschul et al., 1997).
  • the invention also relates to functional equivalents of gr-bolinopsin.
  • Functional equivalents are those proteins which have comparable physicochemical properties and are at least 70% homologous to SEQ ID NO: 2.
  • a homology of at least 80% or 90% is preferred.
  • Particularly preferred is a homology of at least 95%.
  • the invention also relates to functional fragments and their use of the gr-bolinopsin.
  • Functional fragments are those fragments that have similar physicochemical or biochemical properties.
  • the invention also relates to biological modifications of gr-bolinopsin, such as modifications resulting from glycosylations, phosphorylations, sulfations, or carboxylations, which have similar physicochemical or biochemical properties.
  • the invention also relates to complexes of gr-bolinopsin and their use which possess bioluminescent or fluorescent properties with other partner molecules.
  • Complexing partners may be, for example, one or more further proteins or also molecules of other classes.
  • a protein complex according to the invention is an aggregation of at least two proteins, which may be identical or different.
  • the invention also relates to gr-bolinopsin molecules and their use, which have arisen by biological processing such as activation by proteases (proteolysis). This process can be in vivo or in vitro.
  • the photoprotein gr-bolinopsin is suitable as a reporter gene for cellular systems especially for receptors, for ion channels, for transporters, for transcription factors or for inducible systems.
  • the photoprotein gr-bolinopsin is suitable as reporter gene in bacterial and eukaryotic systems, especially in mammalian cells, in bacteria, in yeasts, in bacculo, in plants.
  • the photoprotein gr-bolinopsin is suitable as a reporter gene for cellular systems in combination with bioluminescent or chemiluminescent systems especially systems with luciferases, with oxygenases, with phosphatases.
  • the photoprotein gr-bolinopsin is particularly suitable as a fusion protein for receptors, ion channels, transporters, transcription factors, proteinases, kinases, phosphodiesterases, hydrolases, peptidases, transferases, membrane proteins, glycoproteins.
  • the photoprotein gr-bolinopsin is suitable for immobilization, in particular by antibodies, by biotin, by magnetic or magnetizable carriers.
  • the photoprotein gr-bolinopsin is suitable as a protein for systems of energy transfer especially the FRET (Fluorescence Resonance Energy Transfer), BRET (Bioluminescence Resonance Energy Transfer), FET (field effect transistors), FP (fluorescence polarization), HTRF (Homogeneous time -resolved fluorescence) systems.
  • FRET Fluorescence Resonance Energy Transfer
  • BRET Bioluminescence Resonance Energy Transfer
  • FET field effect transistors
  • FP fluorescence polarization
  • HTRF Homogeneous time -resolved fluorescence
  • the photoprotein gr-bolinopsin is suitable for labeling substrates or ligands specifically for proteases, for kinases, for transferases.
  • the photoprotein gr-bolinopsin is suitable for expression in bacterial systems specifically for titer determination, as a substrate for biochemical systems specifically for proteinases and kinases.
  • the photoprotein gr-bolinopsin is useful as a marker specifically coupled to antibodies coupled to enzymes coupled to receptors coupled to ion channels and other proteins.
  • the photoprotein gr-bolinopsin is suitable as a reporter geri in the pharmacological drug discovery especially in HTS (High Throughput Screening).
  • the photoprotein gr-bolinopsin is suitable as a component of detection systems especially for ELISA (enzyme-linked immunosorbent assay), for immunohistochemistry, for Western blot, for confocal microscopy.
  • ELISA enzyme-linked immunosorbent assay
  • the photoprotein gr-bolinopsin is suitable as a marker for the analysis of interactions specifically for protein-protein interactions, for DNA-protein interactions, for DNA-RNA interactions, for RNA-RNA interactions, for RNA-protein interactions ( DNA: deoxyribonucleic acid; RNA: ribonucleic acid).
  • the photoprotein gr-bolinopsin is useful as a marker or fusion protein for expression in transgenic organisms, especially in mice, in rats, in hamsters and other mammals, in primates, in fish, in worms, in plants.
  • the photoprotein gr-bolinopsin is useful as a marker or fusion protein for analysis of embryonic development.
  • the photoprotein gr-bolinopsin is useful as a marker via a coupling agent specifically via biotin, via NHS (N-hydroxysulfosuccimide), via CN-Br.
  • the photoprotein gr-bolinopsin is suitable as a reporter coupled to nucleic acids, especially to DNA, to RNA.
  • the photoprotein gr-bolinopsin is suitable as a reporter coupled to proteins or peptides.
  • the photoprotein gr-bolinopsin is suitable as a reporter for the measurement of intracellular or extracellular calcium concentrations.
  • the photoprotein gr-bolinopsin is suitable for the characterization of signaling cascades in cellular systems.
  • the coupled to nucleic acids or peptides photoprotein gr-bolinopsin is useful as a probe specifically for Northern blots, for Southern blots, for Western blots, for ELISA, for nucleic acid sequencing, for protein analysis, chip analyzes.
  • the photoprotein gr-bolinopsin is suitable for labeling pharmacological formulations especially of infectious agents, of antibodies, of "small molecules”.
  • the photoprotein gr-bolinopsin is suitable for geological investigations especially for sea, groundwater and river currents.
  • the photoprotein gr-bolinopsin is suitable for expression in expression systems, especially in in vitro translation systems, in bacterial systems, in yeast systems, in bacculo systems, in viral systems, in eukaryotic systems.
  • the photoprotein gr-bolinopsin is suitable for the visualization of tissues or cells during surgery, especially in invasive, non-invasive, minimally invasive.
  • the photoprotein gr-bolinopsin is also suitable for the marking of tumor tissue and other phenotypically altered tissues especially in the histological examination, in surgical procedures.
  • the photoprotein gr-bolinopsin is suitable for use as a reporter gene in combination with other photoproteins, luciferases or fluorescent proteins.
  • the photoprotein gr-bolinopsin is suitable for the multiplexing process.
  • the photoprotein gr-bolinpsin is also suitable for use in RNAi or siRNA experiments.
  • the invention also relates to the purification of the photoprotein gr-bolinopsin specifically as a wild-type protein, as a fusion protein, as a mutagenized protein or fragments of the photoprotein gr-bolinopsin.
  • the invention also relates to the use of the photoprotein gr-bolinopsin in the field of cosmetics, especially bath preparations, lotions, soaps, body colors, toothpaste, body powders.
  • the invention also relates to the use of the photoprotein gr-bolinopsin for coloring foodstuffs, bath additives, ink, textiles, plastics.
  • the invention also relates to the use of photoprotein gr-bolinopsin for coloring paper, especially greetings cards, paper products, wallpaper, craft items.
  • the invention also relates to the use of the photoprotein gr-bolinopsin for coloring liquids especially for water pistols, for fountains, for drinks, for ice cream.
  • the invention also relates to the use of the photoprotein gr-bolinopsin for the manufacture of toys especially of finger paint, make-up.
  • the invention relates to nucleic acid molecules encoding the polypeptide disclosed by SEQ ID NO: 2.
  • the invention relates to the polypeptide having the amino acid sequence disclosed in SEQ ID NO: 2.
  • the invention further relates to nucleic acid molecules selected from the group consisting of
  • nucleic acid molecules encoding a polypeptide comprising the amino acid sequence disclosed by SEQ ID NO: 2;
  • nucleic acid molecules containing the sequence represented by SEQ ID NO: 1 b) nucleic acid molecules whose complementary strand hybridizes with a nucleic acid molecule from a) or b) under stringent conditions and which have the biological function of a photoprotein;
  • nucleic acid molecules which differ from those mentioned under c) due to the degeneration of the genetic code
  • nucleic acid molecules which show a sequence homology of at least 95% to SEQ ID NO: 1, and whose protein product has the biological function of a photoprotein;
  • nucleic acid molecules which show a sequence homology of at least 65% to SEQ ID NO: 1, and whose protein product has the biological function of a photoprotein.
  • the invention also relates to nucleic acid molecules which have a sequence homology of at least 95%, 90%, 85%, 80%, 75%, 70%, 65% or 60% to SEQ ID NO: 1 and encode a polypeptide having the properties a photoprotein possesses.
  • the invention relates to the abovementioned nucleic acid molecules in which the sequence contains a functional promoter 5 'to the photoprotein coding sequence.
  • the invention also relates to nucleic acid molecules as described above that are part of recombinant DNA or RNA vectors.
  • the invention relates to organisms containing such a vector.
  • the invention relates to oligonucleotides having more than 10 consecutive nucleotides which are identical or complementary to the DNA or RNA sequence of the gr-bolinopsin molecules or of the other molecules according to the invention.
  • the invention relates to photoproteins encoded by the previously described nucleotide sequences.
  • the invention relates to methods for expressing the inventive photoprotein polypeptides in bacteria, eukaryotic cells or in in vitro expression systems.
  • the invention also relates to methods for the purification / isolation of a photoprotein polypeptide according to the invention.
  • the invention relates to peptides having more than 5 consecutive amino acids, which are recognized immunologically by antibodies against the photoproteins according to the invention.
  • the invention relates to the use of the nucleic acids according to the invention, which encode photoproteins, as marker or reporter genes, in particular for the pharmacological search for active ingredients and diagnostics.
  • the invention relates to the use of the photoproteins according to the invention or a nucleic acid according to the invention which codes for a photoprotein as marker or reporter or as marker or reporter gene.
  • the invention relates to the use of the photoprotein gr-bolinopsin (SEQ ID NO: 2) or the use of a grin-bolinopsin for the photoprotein encoding nucleic acid as a marker or reporter or as a marker or reporter gene in particular for the pharmacological drug discovery and diagnostics.
  • the invention relates to the use of the nucleic acid shown in SEQ ID NO: 1 as a marker or reporter gene, in particular for the pharmacological drug discovery and diagnostics.
  • the invention also relates to polyclonal or monoclonal antibodies which recognize a polypeptide according to the invention.
  • the invention also relates to monoclonal or polyclonal antibodies which recognize the photoprotein gr-bolinopsin (SEQ ID NO: 2).
  • Expression refers to the production of a molecule which, after introduction of the gene into a suitable host cell, permits the transcription and translation of the foreign gene cloned in an expression vector.
  • Expression vectors contain the control signals required for the expression of genes in cells of prokaryotes or eukaryotes.
  • expression vectors can be constructed in two different ways.
  • transcription fusions the protein encoded by the cloned foreign gene is synthesized as an authentic, biologically active protein.
  • the expression vector carries all the 5 'and 3' control signals required for expression.
  • the protein encoded by the cloned foreign gene is expressed as a hybrid protein together with another protein that is easily detected.
  • the 5 "and 3 'control signals required for expression, including the start codon and possibly some of the sequences coding for the N-terminal regions of the hybrid protein to be formed are derived from the vector.
  • the additional introduced protein portion not only stabilizes the protein encoded by the encoded foreign gene from degradation by cellular proteases in many cases, but can also be used to detect and isolate the hybrid protein formed. Expression can be transient as well as stable. Suitable host organisms are bacteria, yeasts, viruses as well as eukaryotic systems.
  • protein purification The isolation of proteins (even after overexpression) is often referred to as protein purification.
  • protein purification a variety of established methods and procedures are available.
  • Solid-liquid separation is a basic operation in protein isolation. Both in the separation of the cells from the culture medium and in the clarification of the crude extract after cell disruption and removal of cell debris, in the separation of precipitates after precipitation, etc., the process step is required. It is done by centrifugation and filtration.
  • the cell wall must be destroyed or rendered permeable.
  • high pressure homogenizers or stirred ball or glass bead mills are used.
  • mechanical cell integrations and ultrasound treatment are used.
  • Inorganic salts as concomitants of proteins are often undesirable for specific applications. You can u.a. be removed by gel filtration, dialysis and diafiltration.
  • the photoprotein gr-bolinopsin is encoded by the following nucleotide sequence (SEQ ID NO: 1):
  • Fig. 1 shows the plasmid map of the vector pTriplEX2-gr-Bolinopsin.
  • Fig. 2 shows the plasmid map of the vector pcDNA3-gr-bolinopsin
  • Fig. 3 shows the exitation of gr-bolinopsin.
  • Y intensity
  • X wavelength [nm].
  • Fig. 4 shows the fluorescence of gr-bolinopsin.
  • Y intensity;
  • X wavelength [nm].
  • Fig. 5 shows the bioluminescence of gr-bolinopsin.
  • Y intensity;
  • X wavelength [nm].
  • FIG. 6 shows the alignment of gr-bolinopsin and bolinopsin at the amino acid level.
  • Fig. 7 shows the result of bioluminescence measurement of gr-bolinopsin after bacterial expression.
  • Y Luminescence in RLU [relative light units].
  • E. coli BL21 (DE3) were transformed with pTriplEx2-gr-bolinopsin and expression induced.
  • RLU relative light units. Black bars: gr-bolinopsin lysate; gray bars: control lysate (without gr-bolinopsin expression).
  • the plasmid pTriplEx2 Clontech was used as a vector for the preparation of the construct shown below.
  • the derivative of the vector was termed pTriplEx2-gr-bolinopsin.
  • the vector pTriplEx2-gr-bolinopsin was used to express gr-bolinopsin in bacterial systems.
  • Fig. 1 shows the plasmid map of the vector pTriplEX2-gr-bolinopsin.
  • the plasmid pcDNA3.1 (+) from Clontech was used as a vector for the preparation of the construct shown below.
  • the derivative of the vector was termed pcDNA3-gr-bolinopsin.
  • the vector pcDNA3-gr-bolinopsin was used to express gr-bolinopsin in eukaryotic systems.
  • Fig. 2 shows the plasmid map of the vector pcDNA3-gr-bolinopsin.
  • Bacterial expression was carried out in E. coli strain BL21 (DE3) by transformation of the bacteria with the expression plasmids pTriplEX2-gr-bolinopsin and pTriplEX2.
  • the transformed bacteria were incubated in LB medium at 37 ° C. for 3 hours and the expression induced for 4 hours by addition of PTG to a final concentration of 1 mM.
  • the induced bacteria were harvested by centrifugation, resuspended in PBS + 5mM EDTA and disrupted by sonication.
  • the lysate was incubated with coelenterazine in the dark for 3 hours.
  • the bioluminescence in the luminometer was measured. The integration time of the measurement was 40 seconds.
  • Fig. 7 shows the results of the bioluminescence measurement of gr-bolinopsin.
  • the constitutive eukaryotic expression was carried out in CHO cells by transfecting the cells with the expression plasmids pcDNA3-gr-bolinopsin and pcDNA3.1 (+) in transient Experiments. For this purpose, 10,000 cells per well in DMEM-F12 medium were plated on 96-well microtiter plates and incubated overnight at 37 ° C. The transfection was carried out using the Fugene 6 kit (Roche) according to the manufacturer's instructions. The transfected cells were incubated overnight at 37 ° C in DMEM-F12 medium.
  • Fig. 6 shows the alignment of gr-bolinopsin with bolinopsin at the amino acid level.
  • E. coli BL21 (DE3) were transformed with the plasmids pTriplEX2-gr-bolinopsin and pTriplEX2. Induction was by adding 1 mM IPTG and incubating for 4 hours at 37 ° C. Subsequently, the bacteria were harvested and resuspended in PBS. The lysis was carried out by ultrasound. Subsequently, the fluorescence or bioluminescence was measured.
  • Fig. 3 shows the exitation of gr-bolinopsin
  • Fig. 4 shows the fluorescence of gr-bolinopsin
  • Fig. 5 shows the bioluminescence of gr-bolinopsin
  • E. coli BL21 (DE3) were transformed with the plasmids pTriplEX2-gr-bolinopsin and pTriplEX2. Induction was by adding 1 mM IPTG and incubating for 4 hours at 37 ° C. Subsequently, the bacteria were harvested and resuspended in PBS. The lysis was carried out by ultrasound. Subsequently, the fluorescence or bioluminescence was measured under the buffer conditions indicated.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Biophysics (AREA)
  • Medicinal Chemistry (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • Toxicology (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Saccharide Compounds (AREA)

Abstract

Die Erfindung betrifft das Photoprotein gr-Bolinopsin, dessen Nukleotid- und Aminosäuresequenz, sowie die Aktivität und Verwendung des Photoproteins gr-Bolinopsin.

Description

Isoliertes Photoprotein gr-Bolinopsin, sowie dessen Verwendung
Die Erfindung betrifft das Photoprotein gr-Bolinopsin, dessen Nukleotid- und Aminosäuresequenz, sowie die Aktivität und Verwendung des Photoproteins gr-Bolinopsin.
Photoproteine
Als Biolumineszenz bezeichnet man das Phänomen der Lichterzeugung durch Lebewesen. Sie ist das Ergebnis von biochemischen Reaktionen in Zellen, bei denen die chemische Energie in Form von Lichtquanten abgegeben wird (sog. kalte Emission durch Chemolumineszenz). Derartig erzeugtes Licht ist monochromatisch, denn es wird bei einem diskreten Elektronen-Übergang abgestrahlt, kann aber durch sekundäre Leuchtfarbstoffe (z.B. fluoreszierende Proteine bei Leuchtquallen der Gattung Aequora) in längerwellige Spektralbereiche verschoben werden.
Die biologische Funktion ist vielfältig: In der Meerestiefe zwischen 200 und 1000 m (Mesopelagial) leuchten rund 90% aller Lebewesen. Die Leuchtsignale werden hier zur Partnerwerbung, Täuschung und als Köder eingesetzt. Auch Glühwürmchen und Leuchtkäfer nutzen die Lichtsignale zur Partnersuche. Die Bedeutung des Leuchtens von Bakterien, Pilzen und einzelligen Algen ist dagegen unklar. Es wird vermutet, dass es zur Koordination von vielen Einzel-Individuen einer großen Population eingesetzt wird oder eine Art biologische Uhr darstellt.
Eine Vielzahl an Coelenteraten ist biolumineszent (Morin et al., 1974). Diese Organismen emittieren blaues oder grünes Licht. Das 1962 als erstes Licht produzierendes Protein identifizierte Aequorin aus Aequoria victoria (Shimomura et al., 1969) emittierte als isoliertes Protein ein blaues Licht und nicht grünes Licht wie phänotypisch beobachtet bei Aequoria victoria. Später konnte das grün fluoreszierende Protein (GFP) aus Aequoria victoria isoliert werden, das aufgrund der Anregung durch das Aequorin die Meduse phänotypisch grün erscheinen lässt (Johnson et al, 1962; Hastings et al., 1969; Inouye et al, 1994). Als weitere Photoproteine konnten noch Clytin (Inouye et al., 1993), Mitrocomin (Fagan et al., 1993) und Obelin (Illarionov et al., 1995) identifiziert und beschrieben werden.
Tabelle 1: Übersicht über einige Photoproteine. Angegeben ist der Name, der Organismus aus dem das Protein isoliert worden ist und die Identifikationsnummer (Acc. No.) des Datenbankeintrages.
Figure imgf000003_0001
Tabelle 2: Übersicht über einige Photoproteine. Angegeben ist der Organismus aus dem das Protein isoliert worden ist, der Name des Photoproteins und eine Auswahl an Patenten bzw. Anmeldungen.
Figure imgf000003_0002
Biolumineszenz wird heute in der Technik vielfaltig genutzt, z.B. in Form von Bio-Indikatoren für Umweltverschmutzung oder in der Biochemie zum empfindlichen Nachweis von Proteinen, zur Quantifizierung bestimmter Verbindungen oder als sogenannte "Reporter" bei der Untersuchung zellulärer Gen-Regulation.
Die Photoproteine unterscheiden sich nicht nur aufgrund ihrer Nukleotid- und Aminosäuresequenz, sondern auch aufgrund ihrer biochemischen und physikalischen Eigenschaften.
Es konnte gezeigt werden, dass durch die Veränderung der Aminosäuresequenz von Photoproteinen die physikalischen und biochemischen Eigenschaften verändert werden können. Beispiele von mutagenisierten Photoproteinen sind in der Literatur beschrieben (US 6,495,355; US 5,541,309; US 5,093,240; Shimomura et al., 1986). Die Lichterzeugung durch die oben genannten Photoproteine erfolgt durch die Oxidation von Coelenterazin (Haddock et al., 2001; Jones et al., 1999).
Reportersysteme
Als Reporter- oder Indikatorgen bezeichnet man generell Gene, deren Genprodukte sich mit Hilfe einfacher biochemischer oder histochemischer Methoden leicht nachweisen lassen. Man unterscheidet mindestens 2 Typen von Reportergenen.
1. Resistenzgene. Als Resistenzgene werden Gene bezeichnet, deren Expression einer Zelle die Resistenz gegen Antibiotika oder andere Substanzen verleiht, deren Anwesenheit im Wachstumsmedium zum Zelltod führt, wenn das Resistenzgen fehlt.
2. Reportergene. Die Produkte von Reportergenen werden in der Gentechnologie als fusionierte oder unfusionierte Indikatoren verwendet. Zu den gebräuchlichsten Reportergenen gehört die beta-Galaktosidase (Alam et al., 1990), alkalische Phosphatase (Yang et al., 1997; Cullen et al., 1992), Luciferasen und andere Photoproteine (Shinomura, 1985; Phillips GN, 1997; Snowdowne et al., 1984).
Als Lumineszenz bezeichnet man die Abstrahlung von Photonen im sichtbaren Spektralbereich, wobei diese durch angeregte Emittermoleküle erfolgt. Im Unterschied zur Fluoreszenz wird hierbei die Energie nicht von Außen in Form von Strahlung kürzerer Wellenlänge zugeführt.
Man unterscheidet Chemilumineszenz und Biolumineszenz. Als Chemolumineszenz bezeichnet man eine chemische Reaktion die zu einem angeregten Molekül führt, das selbst leuchtet, wenn die angeregten Elektronen in den Grundzustand zurückkehren. Wird diese Reaktion durch ein Enzym katalysiert, spricht man von Biolumineszenz. Die an der Reaktion beteiligten Enzyme werden generell als Luziferasen bezeichnet.
Einordung der Spezies Bolinopsis infundibulum
Eumetazoa → Radiata → Ctenophora → Tentaculata → Lobata → Bolinopsidae → Bolinopsis infundibulum
Isolierung der cDNA
Zur Untersuchung der Biolumineszenz-Aktivität der Spezies Bolinopsis infundibulum wurden Exemplare im Weißen Meer (Biologische Station Kartesh, Russland) gefangen und in flüssigem Stickstoff gelagert. Zur Erstellung der cDNA-Bibliotheken von Bolinopsis infundibulum wurde die poly(a)+ RNA mit Hilfe des „Straight A" Isolationsmethode von Novagen (USA) isoliert. Zur Herstellung der cDNA wurde eine RT-PCR durchgeführt. Hierzu wurden 1 μg RNA mit Reverser Transkriptase (Superscribt Gold H) nach folgendem Schema inkubiert:
PCR 1. 30 Sekunden 950C
2. 6 Minuten 68°C
3. 10 Sekunden 950C
4. 6 Minuten 68°C
17 Zyklen von Schritt 4 nach Schritt 3
Die Reaktionsprodukte wurden zur Inaktivierung der Polymerase für 30 Minuten bei 37°C mit Proteinase K inkubiert und die cDNA mit Ethanol präzipitiert. Die Expression-cDNA Bank wurde mit Hilfe des „SMART cDNA Library Construction Kits" der Firma Clontech (USA) nach Herstellerangaben durchgeführt. Die Klonierung erfolgte in den Expressionsvektor pTriplEx2 (Clontech; USA). Die Expressionsvektoren wurden durch Elektroporation in Bakterien des Stammes E. coli XLl -B lue transformiert.
Die Bakterien wurden auf LB-Nährböden plattiert und für 24 Stunden bei 37°C inkubiert. Anschließend wurde eine Replikaplattierung durchgeführt, indem die Bakterien mit Hilfe eines Nitrocellulosefilters auf eine weitere Nährbodenplatte übertragen wurde. Die Replikaplatte wurde wiederum für 24 Stunden bei 37°C inkubiert und die gewachsenen Bakterienkolonien in LB- Flüssigmedium übertragen. Nach der Zugabe von IPTG (Endkonzentration 0,1 mM) wurden die Bakterien für 4 Stunden bei 37°C auf einem Schüttler inkubiert. Die Bakterien wurden durch Zentrifugation geerntet und die Bakterienmasse in 0,5 ml Aufschlusspuffer (5 mM EDTA, 20 mM Tris-HCL pH 9,0) bei 00C resuspendiert. Anschließend erfolgte der Aufschluss der Bakterien durch Ultraschall.
Die Lysate wurden nach der Zugabe von Coelenterazine (Endkonzentration 10E-07 M) bei 4°C für 3 Stunden inkubiert. Anschließend erfolgte die Messung der Biolumineszenz nach der Zugabe von Calziumchlorid (Endkonzentration 20 mM) im Luminometer.
Es wurde ein Photoprotein identifiziert. Das Photoprotein wurde als gr-Bolinopsin bezeichnet. Im Folgenden wird das Photoprotein gr-Bolinopsin im einzelnen dargestellt. gr-BoIinopsin
Das Photoprotein gr-Bolinopsin zeigt die höchste Homologie auf Nukleinsäureebene zu Bolinopsin aus Bolinopsis infundibulum mit einer Identität von 84 % (Fig. 6). Zum Sequenzvergleich wurde das BLAST-Verfahren verwendet (Altschul et al., 1997).
Die Erfindung betrifft auch funktionelle Äquivalente von gr-Bolinopsin. Funktionelle Äquivalente sind solche Proteine, die vergleichbare physikochemische Eigenschaften haben und mindestens 70 % homolog sind zu SEQ ID NO: 2. Bevorzugt ist eine Homologie von mindestens 80 % oder 90 %. Besonders bevorzugt ist eine Homologie von mindestens 95 %.
Die Erfindung betrifft auch funktionelle Fragmente und deren Verwendung des gr-Bolinopsin. Funktionelle Fragmente sind solche Fragmente, die ähnliche physikochemische oder biochemische Eigenschaften aufweisen.
Die Erfindung betrifft auch biologische Modifikationen des gr-Bolinopsins, wie beispielsweise durch Glykosylierungen, Phosphorylierungen, Sulfatierungen, oder Carboxylierungen hervorgegangene Modifikationen, welche ähnliche physikochemische oder biochemische Eigenschaften besitzen.
Biologische Modifikationen können auch durch alternatives Splicing entstehen.
Die Erfindung betrifft auch Komplexe des gr-Bolinopsins und deren Verwendung, welche biolumineszente oder fluorszente Eigenschaften besitzen mit anderen Partner-Molekülen. Komplexbildungspartner können beispielsweise ein oder mehrere weitere Proteine oder aber auch Moleküle anderer Klassen sein.
Ein Proteinkomplex im Sinne der Erfindung ist eine Aggregation aus mindestens zwei Proteinen, die identisch oder verschieden sein können.
Die Erfindung betrifft auch gr-Bolinopsin Moleküle und deren Verwendung, welche durch biologische Prozessierung wie beispielsweise Aktivierung durch Proteasen (Proteolyse) entstanden sind. Dieser Prozess kann in vivo oder in vitro ablaufen.
Das Photoprotein gr-Bolinopsin eignet sich als Reportergen für zelluläre Systeme speziell für Rezeptoren, für Ionenkanäle, für Transporter, für Transkriptionsfaktoren oder für induzierbare Systeme.
Das Photoprotein gr-Bolinopsin eignet sich als Reportergen in bakteriellen und eukaryotischen Systemen speziell in Säugerzellen, in Bakterien, in Hefen, in Bacculo, in Pflanzen. Das Photoprotein gr-Bolinopsin eignet sich als Reportergene für zelluläre Systeme in Kombination mit biolumineszenten oder chemolumineszenten Systemen speziell Systemen mit Luziferasen, mit Oxygenasen, mit Phosphatasen.
Das Photoprotein gr-Bolinopsin eignet sich als Fusionsprotein speziell für Rezeptoren, für Ionenkanäle, für Transporter, für Transkriptionsfaktoren, für Proteinasen, für Kinasen, für Phosphodiesterasen, für Hydrolasen, für Peptidasen, für Transferasen, für Membranproteine, für Glykoproteine.
Das Photoprotein gr-Bolinopsin eignet sich zur Immobilisierung speziell durch Antikörper, durch Biotin, durch magnetische oder magnetisierbare Träger.
Das Photoprotein gr-Bolinopsin eignet sich als Protein für Systeme des Energietransfers speziell der FRET- (Fluorescence Resonance Energy Transfer), BRET- (Bioluminescence Resonance Energy Transfer), FET (field effect transistors), FP (fluorescence polarization), HTRF (Homogeneous time-resolved fluorescence) Systemen.
Das Photoprotein gr-Bolinopsin eignet sich als Markierung von Substraten oder Liganden speziell für Proteasen, für Kinasen, für Transferasen.
Das Photoprotein gr-Bolinopsin eignet sich zur Expression in bakteriellen Sytemen speziell zur Titerbestimmung, als Substrat für biochemische Systeme speziell für Proteinasen und Kinasen.
Das Photoprotein gr-Bolinopsin eignet sich als Marker speziell gekoppelt an Antikörper, gekoppelt an Enzyme, gekoppelt an Rezeptoren, gekoppelt an Ionenkanäle und andere Proteine.
Das Photoprotein gr-Bolinopsin eignet sich als Reportergeri bei der pharmakologischen Wirkstoffsuche speziell im HTS (High Throughput Screening).
Das Photoprotein gr-Bolinopsin eignet sich als Komponente von Detektionssystemen speziell für ELISA (enzyme-linked immunosorbent assay), für Immunohistochemie, für Western-Blot, für die konfokale Mikroskopie.
Das Photoprotein gr-Bolinopsin eignet sich als Marker für die Analyse von Wechselwirkungen speziell für Protein-Protein- Wechselwirkungen, für DNA-Protein- Wechselwirkungen, für DNA- RNA-Wechselwirkungen, für RNA-RNA- Wechselwirkungen, für RNA-Protein- Wechselwirkungen (DNA : deoxyribonucleic acid; RNA : ribonucleic acid ). Das Photoprotein gr-Bolinopsin eignet sich als Marker oder Fusionsprotein für die Expression in transgenen Organismen speziell in Mäusen, in Ratten, in Hamstern und anderen Säugetieren, in Primaten, in Fischen, in Würmern, in Pflanzen.
Das Photoprotein gr-Bolinopsin eignet sich als Marker oder Fusionsprotein zur Analyse der Embryonalentwicklung-.
Das Photoprotein gr-Bolinopsin eignet sich als Marker über einen Kopplungsvermittler speziell über Biotin, über NHS (N-hydroxysulfosuccimide), über CN-Br.
Das Photoprotein gr-Bolinopsin eignet sich als Reporter gekoppelt an Nukleinsäuren speziell an DNA, an RNA.
Das Photoprotein gr-Bolinopsin eignet sich als Reporter gekoppelt an Proteine oder Peptide.
Das Photoprotein gr-Bolinopsin eignet sich als Reporter zur Messung von intra- oder extrazellulären Calziumkonzentrationen.
Das Photoprotein gr-Bolinopsin eignet sich zur Charakterisierung von Signalkaskaden in zellulären Systemen.
Das an Nukleinsäuren oder Peptiden gekoppelte Photoprotein gr-Bolinopsin eignet sich als Sonde speziell für Northern-Blots, für Southern-Blots, für Western-Blots, für ELISA, für Nukleinsäuresequenzierungen, für Proteinanalysen, Chip-Analysen.
Das Photoprotein gr-Bolinopsin eignet sich Markierung von pharmakologischen Formulierungen speziell von infektiösen Agentien, von Antikörpern, von „small molecules".
Das Photoprotein gr-Bolinopsin eignet sich für geologische Untersuchungen speziell für Meeres-, Grundwasser- und Flussströmungen.
Das Photoprotein gr-Bolinopsin eignet sich zur Expression in Expressionssystemen speziell in in- vitro Translationssystemen, in bakteriellen Systemen, in Hefe Systemen, in Bacculo Systemen, in viralen Systemen, in eukaryotischen Systemen.
Das Photoprotein gr-Bolinopsin eignet sich zur Visualisierung von Geweben oder Zellen bei chirurgischen Eingriffen speziell bei invasiven, bei nicht-invasiven, bei minimal-invasiven.
Das Photoprotein gr-Bolinopsin eignet sich auch zur Markierung von Tumorgeweben und anderen phänotypisch veränderten Geweben speziell bei der histologischen Untersuchung, bei operativen Eingriffen. Das Photoprotein gr-Bolinopsin eignet sich zur Verwendung als Reportergen in Kombination mit anderen Photoproteinen, Luziferasen oder fluoreszenten Proteinen.
Das Photoprotein gr-Bolinopsin eignet sich für das multiplexing Verfahren.
Das Photoprotein gr-Bolinpsin eignet sich auch für die Verwendung in RNAi oder siRNA Experimenten.
Die Erfindung betrifft auch die Reinigung des Photoprotein gr-Bolinopsin speziell als wildtyp Protein, als Fusionsprotein, als mutagenisiertes Protein oder Fragmente des Photoproteins gr- Bolinopsin.
Die Erfindung betrifft auch die Verwendung des Photoprotein gr-Bolinopsin auf dem Gebiet der Kosmetik speziell von Badezusätzen, von Lotionen, von Seifen, von Körperfarben, von Zahncreme, von Körperpudern.
Die Erfindung betrifft auch die Verwendung des Photoprotein gr-Bolinopsin zur Färbung speziell von Nahrungsmitteln, von Badezusätzen, von Tinte, von Textilien, von Kunststoffen.
Die Erfindung betrifft auch die Verwendung des Photoprotein gr-Bolinopsin zur Färbung von Papier speziell von Grußkarten, von Papierprodukten, von Tapeten, von Bastelartikeln.
Die Erfindung betrifft auch die Verwendung des Photoprotein gr-Bolinopsin zur Färbung von Flüssigkeiten speziell für Wasserpistolen, für Springbrunnen, für Getränke, für Eis.
Die Erfindung betrifft auch die Verwendung des Photoprotein gr-Bolinopsin zur Herstellung von Spielwaren speziell von Fingerfarbe, von Schminke.
Die Erfindung betrifft Nukleinsäuremoleküle, die das Polypeptid offenbart durch SEQ ID NO: 2 kodieren.
Die Erfindung betrifft das Polypeptid mit der Aminosäuresequenz, die in SEQ ID NO: 2 offenbart ist.
Die Erfindung bezieht sich des weiteren auf Nukleinsäuremoleküle, ausgewählt aus der Gruppe bestehend aus
a) Nukleinsäuremolekülen, die ein Polypeptid kodieren, welches die Aminosäuresequenz offenbart durch SEQ ID NO: 2 umfasst;
b) Nukleinsäuremolekülen, welche die durch SEQ ID NO: 1 dargestellte Sequenz enthalten; c) Nukleinsäuremolekülen, deren komplementärer Strang mit einem Nukleinsäuremolekül aus a) oder b) unter stringenten Bedingungen hybridisiert und welche die biologische Funktion eines Photoproteins aufweisen;
d) Nukleinsäuremolekülen, welche sich auf Grund der Degenerierung des genetischen Kodes von den unter c) genannten unterscheiden;
e) Nukleinsäuremolekülen, welche eine Sequenzhomologie von mindestens 95 % zu SEQ ED NO: 1 zeigen, und deren Proteinprodukt die biologische Funktion eines Photoproteins aufweist; und
f) Nukleinsäuremolekülen, welche eine Sequenzhomologie von mindestens 65 % zu SEQ ID NO: 1 zeigen, und deren Proteinprodukt die biologische Funktion eines Photoproteins aufweist.
Die Erfindung betrifft auch Nukleinsäuremoleküle, die eine Sequenzhomologie von mindestens 95 %, 90 %, 85 %, 80 %, 75 %, 70 %, 65 % oder 60 % zu SEQ ID NO: 1 aufweisen und für ein Polypeptid kodieren, welches die Eigenschaften eines Photoproteins besitzt.
Die Erfindung betrifft die oben genannten Nukleinsäuremoleküle, bei denen die Sequenz einen funktionalen Promotor 5' zu der das Photoprotein kodierenden Sequenz enthält.
Die Erfindung betrifft auch Nukleinsäuremoleküle wie vorhergehend beschrieben, die Bestandteil von rekombinanten DNA oder RNA Vektoren sind.
Die Erfindung betrifft Organismen, die einen solchen Vektor enthalten.
Die Erfindung bezieht sich auf Oligonukleotide mit mehr als 10 aufeinanderfolgenden Nukleotiden, die identisch oder komplementär zur DNA oder RNA Sequenz der gr-Bolinopsin Moleküle oder der weiteren erfindungsgemäßen Molekülen sind.
Die Erfindung betrifft Photoproteine, die durch die vorhergehend beschriebenen Nukleotidsequenzen kodiert sind.
Die Erfindung bezieht sich auf Verfahren zur Expression der erfϊndungsgemäßen Photoprotein Polypeptide in Bakterien, eukaryontischen Zellen oder in in vitro Expressionssystemen.
Die Erfindung betrifft auch Verfahren zur Aufreinigung/Isolierung eines erfindungsgemäßen Photoprotein Polypeptides. Die Erfindung bezieht sich auf Peptide mit mehr als 5 aufeinanderfolgenden Aminosäuren, die immunologisch durch Antikörper gegen die erfindungsgemäßen Photoproteine erkannt werden.
Die Erfindung betrifft die Verwendung der erfindungsgemäßen, für Photoproteine kodierende Nukleinsäuren als Marker- oder Reportergene, insbesondere für die pharmakologische Wirkstoffsuche und Diagnostik.
Die Erfindung betrifft die Verwendung der erfindungsgemäßen Photoproteine bzw. eine erfindungsgemäße, für ein Photoprotein kodierende Nukleinsäure als Marker oder Reporter bzw. als Marker- oder Reportergen.
Die Erfindung betrifft die Verwendung des Photoproteins gr-Bolinopsin (SEQ ID NO: 2) bzw. die Verwendung einer für das Photoprotein gr-Bolinopsin kodierenden Nukleinsäure als Marker oder Reporter bzw. als Marker oder Reportergen insbesondere für die pharmakologische Wirkstoffsuche und Diagnostik.
Die Erfindung betrifft die Verwendung der in SEQ ID NO: 1 dargestellten Nukleinsäure als Marker- oder Reportergen, insbesondere für die pharmakologische Wirkstoffsuche und Diagnostik.
Gegenstand der Erfindung sind auch polyklonale oder monoklonale Antikörper, welche ein erfindungsgemäßes Polypeptid erkennen.
Die Erfindung betrifft auch monoklonale oder polyklonale Antikörper, die das Photoprotein gr- Bolinopsin (SEQ ID NO: 2) erkennen.
Expression der erfindungsgemäßen Photoproteine
Als Expression bezeichnet man die Produktion eines Moleküls, das nach dem Einbringen des Gens in eine geeignete Wirtszelle die Transcription und Translation des in einen Expressionsvektor Monierte Fremdgen erlaubt. Expressionsvektoren enthalten die für die Expression von Genen in Zellen von Prokaryoten oder Eukaryonten erforderlichen Kontrollsignale.
Expressionsvektoren können prinzipiell auf zwei verschiedene Weisen konstruiert werden. Bei den sogenannten Transcriptionsfusionen wird das vom einklonierten Fremdgen codierte Protein als authentisches, biologisch aktives Protein synthetisiert. Der Expressionsvektor trägt hierzu alle zur Expression benötigten 5'- und 3'- Kontrollsignale.
Bei den sogenannten Translationsfusionen wird das vom einklonierten Fremdgen codierte Protein als Hybridprotein zusammen mit einem anderen Protein exprimiert, das sich leicht nachweisen lässt. Die zur Expression benötigten 5"- und 3'- Kontrollsignale inklusive des Startcodons und eventuell ein Teil der für die N-terminalen Bereiche des zu bildenden Hybridproteins codierenden Sequenzen stammen vom Vektor. Der zusätzliche eingeführte Proteinteil stabilisiert nicht nur in vielen Fällen das vom einklonierten Fremdgen codierte Protein vor dem Abbau durch zelluläre Proteasen, sondern lässt sich auch zum Nachweis und zur Isolierung des gebildeten Hybridproteins einsetzen. Die Expression kann sowohl transient, als auch stabil erfolgen. Als Wirtsorganismen eignen sich sowohl Bakterien, Hefen, Viren als auch eukaryotische Systeme.
Reinigung der erfindungsgemäßen Photoproteine
Die Isolierung von Proteinen (auch nach Überexpression) wird häufig als Proteinreinigung bezeichnet. Zur Proteinreinigung steht eine Vielzahl an etablierten Methoden und Verfahren zur Verfügung.
Die Fest-Flüssig-Trennung ist eine Grundoperation bei Proteinisolierungen. Sowohl bei der Abtrennung der Zellen vom Kulturmedium als auch bei der Klärung des Rohextraktes nach Zellaufschluss und Entfernung der Zelltrümmer, bei der Abtrennung von Niederschlägen nach Fällungen usw. ist der Verfahrensschritt erforderlich. Er erfolgt durch Zentrifugation und Filtration.
Durch Gewinnung intrazellulärer Proteine muss die Zellwand zerstört bzw. durchlässig gemacht werden. Je nach Maßstab und Organismus werden dazu Hochdruckhomogenisatoren oder Rührwerkskugel- bzw. Glasperlenmühlen eingesetzt. Im Labormaßstab kommen u.a. mechanische Zellintegrationen und Ultraschallbehandlung zum Einsatz.
Sowohl für extrazelluläre als auch intrazelluläre Proteine (nach Zellaufschluss) sind verschiedene Fällungsverfahren mit Salzen (insbesondere Ammoniumsulfat) oder organischen Lösungsmitteln (Alkohole, Aceton) eine schnelle und effiziente Methode zur Konzentration von Proteinen. Bei der Reinigung intrazellulärer Proteine ist die Entfernung der löslichen Nukleinsäuren erstrebenswert (Fällung z.B. mit Streptomycin- oder Protaminsulfat). Bei der Gewinnung extrazellulärer Proteine werden häufig Träger (z.B. Stärke, Kieselgur) vor Zugabe der Fällungsmittel zugesetzt, um besser handhabbare Niederschläge zu erhalten.
Für die Feinreinigung stehen zahlreiche chromatographische und Verteilungsverfahren zur Verfügung (Absorptions- und Ionenaustauschchromatographie, Gelfϊltration, Affinitätschromatographie, Elektrophoresen). Eine Säulenchromatographie wird auch im technischen Maßstab angewandt. Für den Labormaßstab ist vor allem die Affinitätschromatographie von Bedeutung, die Reinigungsfaktoren bis zu mehreren 100 pro Schritt ermöglicht. Extrazelluläre Proteine fallen in relativ verdünnten Lösungen an. Sie müssen ebenso wie extrazelluläre Proteine vor ihrer weiteren Verwendung konzentriert werden. Neben den schon erwähnten Verfahren hat sich - auch im industriellen Maßstab - die Ultrafiltration bewährt.
Anorganische Salze als Begleitstoffe von Proteinen sind für spezifische Anwendungen häufig unerwünscht. Sie können u.a. durch Gelfiltration, Dialyse und Diafiltration entfernt werden.
Zahlreiche Proteine kommen als Trockenpräparate zum Einsatz. Als Trocknungsverfahren sind die Vakuum-, Gefrier- und Sprühtrocknung von Bedeutung.
Nukleotid- und Aminosäuresequenzeu
Das Photoprotein gr-Bolinopsin wird durch die folgende Nukleotidsequenz kodiert (SEQ ID NO: 1):
GAGTTTTAATACTTTCAACACTACTATATAACAAATAATTTGAGCAAAAAACAACAAGATG TCAGGACTGAACGAGACGAACAACGAGAGTTACAGATACCTGAGGAGCGTGGGTAACGACT GGCAGTTCAACGTAGAGGATCTCCACCCAAAAATGGTGTCCCGACTCTACAAGAGGTTTGA CACCTTCGATCTGGATTGCGACGGTAAAATGGAGCTCGATGAAATCCTGTACTGGCCGGAC AGAATGAGGCAACTGGTAAATGCTACTGACGAACAGGTTGAGCAGATGAGGGCTGCTTGCC ACAAATTCTTCGTCAACAAAGGAGTGCATCCAGAAAATGGGCTGCTCAGAGAGAACTGGGT TGAGTCTAACAGAGTCTTTGCCGAGGCTGAAAGAGAAAGGGAGCGACGTGGTGAAGACTCT ATGATTGCTCTACTGTCCAACGCTTACTATGATGTCCTGGATGATGACGGTGATGGTACTG TTGACGTCGATGAGCTGAAGACGATGATGAAAGCCTTCGATGTACCCCAGGAGGCTGCTTA CACCTTCTTCGAGAAGGCTGACACGGACAAGAGTGGAÄAACTTGAACGACCTGAGCTGGTG CATCTCTTCAGAAAGTTCTGGATGGAGCCTTATGATCCTCAGTGGGACGGTGTCTACGCTT ACAAATACTAACGGAATAATGATCTCGATCAAATGATGTATCCTTTAAGGATATTAACTCT TTAAAAATGCTACTTTGATATTATTGTTTACAGCTTTAAATGTTAACATTCGGATATCTAT TGCAATTTGAGTTGATACCTTGTCATATGCAAATACTTACCAAAACTACGGTTAGTTACCA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAA -3S .
Daraus ergibt sich eine Aminosäuresequenz von (SEQ ID NO: 2):
MSGLNETNNESYRYLRSVGNDWQFNVEDLHPKMVSRLYKRFDTFDLDCDGKMELDEILYWP DRMRQLVNATDEQVEQMRAACHKFFVNKGVHPENGLLRENWVESNRVFAEAERERERRGED SMIALLSNAYYDVLDDDGDGTVDVDELKTMMKAFDVPQEAAYTFFEKADTDKSGKLERPEL VHLFRKFWMEPYDPQWDGVYAYKY Diese Sequenzen finden sich im Sequenzlisting wieder.
Kurze Beschreibung der Figuren
Fig. 1 : Die Fig. 1 zeigt die Plasmidkarte des Vektors pTriplEX2-gr-Bolinopsin.
Fig. 2: Die Fig. 2 zeigt die Plasmidkarte des Vektors pcDNA3-gr-Bolinopsin
Fig. 3: Die Fig. 3 zeigt die Exitation von gr-Bolinopsin. Y : Intensität; X : Wellenlänge [nm].
Fig. 4: Die Fig. 4 zeigt die Fluoreszenz von gr-Bolinopsin. Y : Intensität; X : Wellenlänge [nm].
Fig. 5: Die Fig. 5 zeigt die Biolumineszenz von gr-Bolinopsin. Y : Intensität; X : Wellenlänge [nm].
Fig. 6: Die Fig. 6 zeigt das Alignment von gr-Bolinopsin und Bolinopsin auf Aminosäureebene.
Fig. 7: Die Fig. 7 zeigt das Ergebnis der Biolumineszenzmessung von gr-Bolinopsin nach bakterieller Expression. Y : Lumineszenz in RLU [relative light units]. E. coli BL21(DE3) wurden mit pTriplEx2-gr-Bolinopsin transformiert und die Expression induziert. RLU = relative light units. Schwarze Balken : gr-Bolinopsin Lysat; graue Balken : Kontrolllysat (ohne gr-Bolinopsin Expression).
Beispiele
Beispiel 1
Als Vektor zur Herstellung des im folgenden dargestellten Konstruktes wurde das Plasmid pTriplEx2 der Firma Clontech verwendet. Das Derivat des Vektors wurde als pTriplEx2-gr- Bolinopsin bezeichnet. Der Vektor pTriplEx2-gr-Bolinopsin wurde zur Expression von gr- Bolinopsin in bakteriellen Systemen verwendet.
Die Fig. 1 zeigt die Plasmidkarte des Vektors pTriplEX2-gr-Bolinopsin .
Beispiel 2
Als Vektor zur Herstellung des im folgenden dargestellten Konstruktes wurde das Plasmid pcDNA3.1(+) der Firma Clontech verwendet. Das Derivat des Vektors wurde als pcDNA3-gr- Bolinopsin bezeichnet. Der Vektor pcDNA3-gr-Bolinopsin wurde zur Expression von gr- Bolinopsin in eukaryotischen Systemen verwendet.
Die Fig. 2 zeigt die Plasmidkarte des Vektors pcDNA3-gr-Bolinopsin .
Beispiel 3
Bakterielle Expression
Die bakterielle Expression erfolgte im E. coli Stamm BL21(DE3) durch Transformation der Bakterien mit den Expressionsplasmiden pTriplEX2-gr-Bolinopsin und pTriplEX2. Die transformierten Bakterien wurden in LB-Medium bei 370C für 3 Stunden inkubiert und die Expression für 4 Stunden durch Zugabe von PTG bis zu einer Endkonzentration von 1 mM induziert. Die induzierten Bakterien wurden durch Zentrifugation geerntet, in PBS + 5 mM EDTA resuspendiert und durch Ultraschall aufgeschlossen. Das Lysat wurde 3 Stunden mit Coelenterazin im dunkeln inkubiert. Direkt nach der Zugabe von 5 mM Calziumchlorid wurde die Biolumineszenz im Luminometer gemessen. Die Integrationszeit der Messung betrug 40 Sekunden.
Die Fig. 7 zeigt die Ergebnisse der Biolumineszenzmessung von gr-Bolinopsin.
Beispiel 4
Eukaryotische Expression
Die konstitutive eukaryotische Expression erfolgte in CHO-Zellen durch Transfektion der Zellen mit den Expressionsplasmiden pcDNA3-gr-Bolinopsin und pcDNA3.1(+) in transienten Experimenten. Hierzu wurden 10000 Zellen pro Loch in DMEM-F12 Medium auf 96 Loch Mikrotiterplatten plattiert und über Nacht bei 37°C inkubiert. Die Transfektion erfolgte mit Hilfe des Fugene 6 Kits (Roche) nach Herstellerangaben. Die transfizierten Zellen wurden über Nacht bei 37°C in DMEM-F12 Medium inkubiert.
Beispiel 5
BLAST
Ergebnis einer BLAST- Analyse von gr-Bolinopsin auf der Aminosäureebene.
>pdb|UF2|A Chain A, Crystal Structure Of W92f Obelin Mutant From Obelia Longissima At 1.72 Angstrom Resolution pdb|lS3β|A Chain A, Crystal Structure Of A Ca2+-Discharged Photoprotein: Implications For The Mechanisms Of The Calcium Trigger And The Bioluminescence
Length = 195, Score = 77.4 bits (189), Expect = 2e-13, Identities = 51/177 (28%), Positives = 85/177 (48%), Gaps = 4/177 (2%)
>emb I CAD87671.1 I unnamed protein product [Obelia longissima]
Length = 195, Score = 77.0 bits (188), Expect = 3e-13, Identities = 51/177 (28%), Positives = 85/177 (48%), Gaps = 4/177 (2%)
>emb I CAD87675.1 i unnamed protein product [synthetic construct]
Length = 195, Score = 77.0 bits (188), Expect = 3e-13, Identities = 51/177 (28%), Positives = 85/177 (48%), Gaps = 4/177 (2%)
>emb| CAD87673.1 I unnamed protein product [synthetic construct]
Length = 195, Score = 77.0 bits (188), Expect = 3e-13, Identities = 51/177 (28%), Positives = 85/177 (48%), Gaps = 4/177 (2%)
>emb| CAD87672.1 I unnamed protein product [synthetic construct]
Length = 195, Score = 77.0 bits (188), Expect = 3e-13, Identities = 51/177 (28%), Positives = 85/177 (48%), Gaps = 4/177 (2%)
>gb|AAA67708.11 unnamed protein product sp| Q27709 I OBLjDBELO Obelin precursor (OBL) pdb|lEL4|A Chain A, Structure Of The Calcium- Regulated Photoprotein Obelin Determined By Sulfur Sas Length = 195, Score = 77.0 bits (188), Expect = 3e-13, Identities = 51/177 (28%), Positives = 85/177 (48%), Gaps = 4/177 (2%)
>emb I CAD87678.1 I unnamed protein product [synthetic construct]
Length = 195, Score = 76.6 bits (187), Expect = 4e-13, Identities = 51/177 (28%), Positives = 85/177 (48%), Gaps = 4/177 (2%)
>emb I CAD87677.1 I unnamed protein product [synthetic construct]
Length = 195, Score = 76.6 bits (187), Expect = 4e-13, Identities = 51/177 (28%), Positives = 85/177 (48%), Gaps = 4/177 (2%)
>emb I CAD87676.1 I unnamed protein product [synthetic construct]
Length = 195, Score = 76.6 bits (187), Expect = 4e-13, Identities = 51/177 (28%), Positives = 85/177 (48%), Gaps = 4/177 (2%)
>emb I CAD87674.1 I unnamed protein product [synthetic construct]
Length = 195, Score = 76.6 bits (187), Expect = 4e-13, Identities = 51/177 (28%), Positives = 85/177 (48%), Gaps = 4/177 (2%)
>pdb|lSL7|A Chain A, Crystal Structure Of Calcium-Loaded Apo- Obelin From Obelia Longissima
Length = 195, Score = 76.6 bits (187), Expect = 4e-13, Identities = 51/177 (28%), Positives = 85/177 (48%), Gaps = 4/177 (2%)
>pdb|lQVl|A Chain A, Atomic Resolution Structure Of Obelin From Obelia Longissima pdb|lQV0|A Chain A, Atomic Resolution Structure Of Obelin From Obelia Longissima
Length = 195, Score = 75.9 bits (185), Expect = 7e-13, Identities = 50/177 (28%), Positives = 85/177 (48%), Gaps = 4/177 (2%)
>emb| CAD87699.1 I unnamed protein product [synthetic construct]
Length = 195, Score = 74.3 bits (181), Expect = 2e-12, Identities = 50/177 (28%), Positives = 84/177 (47%), Gaps = 4/177 (2%)
>emb I CAD87697.1 I unnamed protein product [synthetic construct]
Length = 195, Score = 74.3 bits (181), Expect = 2e-12, Identities = 50/177 (28%), Positives = 84/177 (47%), Gaps = 4/177 (2%) >emb| CAD87696.1 | unnamed protein product [synthetic construct]
Length = 195, Score = 74.3 bits (181), Expect = 2e-12, Identities = 50/177 (28%), Positives = 84/177 (47%), Gaps = 4/177 (2%)
>emb| CAD87695.1 | unnamed protein product [synthetic construct]
Length = 195, Score = 74.3 bits (181), Expect = 2e-12, Identities = 50/177 (28%), Positives = 84/177 (47%), Gaps = 4/177 (2%)
>emb| CAD87698.1 I unnamed protein product [synthetic construct]
Length = 195, Score = 73.9 bits (180), Expect = 3e-12, Identities = 50/177 (28%), Positives = 84/177 (47%), Gaps = 4/177 (2%)
Beispiel 6
BLAST
Ergebnis einerBLAST-Analyse von gr-Bolinopsin aufNukleinsäureebene.
>emb I CQ975887.il Sequence 1 from Patent WO2005000885
Length = 621, Score = 389 bits (196), Expect = e-104, Identities = 433/512 (84%)
>gb|AC103993.8| Homo sapiens chromosome 8, clone RP11-67H2, complete sequence, Length = 147742, Score = 75.8 bits (38), Expect = 2e-10, Identities = 38/38 (100%)
>gb|AC099794.2| Homo sapiens chromosome 1 clone RP4-771M4, complete sequence, Length = 134341, Score = 75.8 bits (38), Expect = 2e-10, Identities = 38/38 (100%)
>gb|AC018991.10| Homo sapiens, clone RP11-448E20, complete sequence
Length = 174049, Score = 75.8 bits (38), Expect = 2e-10, Identities = 38/38 (100%)
>dbj IAP005355.2 I Homo sapiens genomic DNA, chromosome 8q23, clone: KB1189A8, completesequence , Length = 151101, Score = 75.8 bits (38), Expect = 2e-10, Identities = 38/38 (100%) Beispiel 7
Die Fig. 6 zeigt das Alignment von gr-Bolinopsin mit Bolinopsin auf Aminosäureebene.
Beispiel 8
Spektrum des Photoproteins gr-Bolinopsin
Zur Messung der spektralen Eigenschaften von gr-Bolinopsin wurden E. coli BL21(DE3) mit den Plasmiden pTriplEX2-gr-Bolinopsin und pTriplEX2 transformiert. Die Induktion erfolgte durch die Zugabe von 1 mM IPTG und einer Inkubation von 4 Stunden bei 37°C. Anschließend wurden die Bakterien geerntet und in PBS resuspendiert. Die Lyse erfolgte durch Ultraschall. Anschließend erfolgte die Messung der Fluoreszenz bzw. Biolumineszenz.
Die Fig. 3 zeigt die Exitation von gr-Bolinopsin
Die Fig. 4 zeigt die Fluoreszenz von gr-Bolinopsin
Die Fig. 5 zeigt die Biolumineszenz von gr-Bolinopsin
Beispiel 9
Ermittlung physiokochemischer Parameter von gr-Bolinopsin
Zur Ermittlung der physikochemischen Parameter von gr-Bolinopsin wurden E. coli BL21(DE3) mit den Plasmiden pTriplEX2-gr-Bolinopsin und pTriplEX2 transformiert. Die Induktion erfolgte durch die Zugabe von 1 mM IPTG und einer Inkubation von 4 Stunden bei 37°C. Anschließend wurden die Bakterien geerntet und in PBS resuspendiert. Die Lyse erfolgte durch Ultraschall. Anschließend erfolgte die Messung der Fluoreszenz bzw. Biolumineszenz unter den angegebenen Pufferbedingungen.
Figure imgf000020_0001
Literatur / Patente
US 6,495,355 US 5,541,309 US 5,093,240 US-0908909 US 6,152,358 JP-Ol 76125 GB-0024357 WO03006497 WO200168824
Alam J, Cook JL. Reporter genes: application to the study of mammalian gene transcription. Anal Biochem. 1990 Aug l;188(2):245-54
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997); Gapped BLAST and PSI-BLAST: a new generation of protein database search programs; NudeicAcids Res. 25:3389-3402
Cullen Bryan R., Malini Michael H., Secreted placental alkaline Phosphatase as a eukaryotic reporter gene. Methods in Enzymology. 216:362ff
Fagan TF, Ohmiya Y, Blinks JR, Inouye S, Tsuji FI. Cloning, expression and sequence analysis of cDNA for the Ca(2+)-binding photoprotein, mitrocomin. FEBS Lett. 1993 Nov l;333(3):301-5
Hastings, J.W. and Morin, J.G. (1969) Comparative biochemistry of calcium-activated photoproteins from the ctenophore, Mnemiopsis and the coelenterates Aequorea, Ohelia, and Pelagia. Bio!. Bull. 137, 402.
Haddock SH, Rivers TJ, Robison BH. Can coelenterates make coelenterazine? Dietary requirement for luciferin in cnidarian bioluminescence. Proc Natl Acad Sei U S A 2001 Sep 25;98(20):l 1148-51
Inouye S, Tsuji FI. (1994) Aequorea green fluorescent protein. Expression of the gene and fluorescence characteristics of the recombinant protein. FEBS Lett 1994 Mar 21;341(2-3):277-80
Inouye S, Tsuji FI. Cloning and sequence analysis of cDNA for the Ca(2+)-activated photoprotein, elytin. FEBS Lett. 1993 Jan ll;315(3):343-6. Illarionov BA, Bondar VS, Illarionova VA, Vysotski ES. Sequence of the cDNA encoding the Ca(2+)-activated photoprotein obelin from the hydroid polyp Obelia longissima. Gene. 1995 Feb 14;153(2):273-4.
Jones K, Hibbert F, Keenan M. Glowing jellyfϊsh, luminescence and a molecule called coelenterazine. Trends Biotechnol 1999 Dec; 17(12):477-81
Johnson, F.H., Shimomura, O., Saiga, Y., Gershman, L.C., Reynolds, G.T., and Waters, J.R.
(1962) Quantum efϊiciency of Cypridina luminescence, with a note on that of Aequorea. J. Cell. Comp. Physiol 60, 85-103.
Morin, J.G. and Hastings, J.W. (1971) Biochemistry of the bioluminescence of colonial hydroids and other coelenterates. J. Cell. Physiol. 77, 305-311.
Phillips GN. Structure and dynamics of green fluorescent protein. Curr Opin Struct Biol. 1997 Dec;7(6):821-7
Shimomura O, Johnson FH. Properties of the bioluminescent protein aequorin. Biochemistry. 1969 Oct;8(10):3991-7
Shimomura O., Bioluminescence in the sea: photoprotein Systems. Symp Soc Exp Biol. 1985;39:351-72
Shimomura O. Isolation and properties of various molecular forms of aequorin. Biochem J. 1986 Mar l;234(2):271-7.
Snowdowne KW, Borle AB. Measurement of cytosolic free calcium in mammalian cells with aequorin. Am J Physiol. 1984 Nov;247(5 Pt l):C396-408.
Yang Te-Tuan, Sinai Parisa, Kitts Paul A. Kain Seven R., Quantification of gene expresssion with a secreted alkaline Phosphatase reporter System. Biotechnique. 1997 23(6) 11 lOff

Claims

Patentansprüche
1. Nukleinsäuremolekül, ausgewählt aus der Gruppe bestehend aus
a) Nukleinsäuremolekülen, die ein Polypeptid kodieren, welches die Aminosäuresequenz offenbart durch SEQ TD NO: 2 sowie funktionelle Fragmente derselben umfasst;
b) Nukleinsäuremolekülen, welche die in SEQ ID NO: 1 dargestellte Sequenz sowie funktionelle Fragmente derselben umfassen;
c) Nukleinsäuremolekülen, deren komplementärer Strang mit einem Nukleinsäuremolekül aus a) oder b) unter stringenten Bedingungen hybridisiert und welche die biologische Funktion eines Photoproteins aufweisen;
d) Nukleinsäuremolekülen, welche sich auf Grund der Degenerierung des genetischen Kodes von den unter c) genannten unterscheiden;
e) Nukleinsäuremolekülen, welche eine Sequenzhomologie von mindestens 95 % zu SEQ ID NO: 1 zeigen, und welche die biologische Funktion eines Photoproteins aufweisen; und
f) Nukleinsäuremolekülen, welche eine Sequenzhomologie von mindestens 85% zu SEQ ID NO: 1 zeigen, und welche die biologische Funktion eines Photoproteins aufweisen.
2. Nukleinsäure nach Anspruch 1, welche einen funktionalen Promotor 5Λ zur das Photoprotein kodierenden Sequenz enthält.
3. Rekombinante DNA oder RNA Vektoren, welche Nukleinsäuren nach Anspruch 2 enthalten.
4. Organismen, die einen Vektor gemäß Anspruch 3 enthalten.
5. Oligonukleotide mit mehr als 10 aufeinanderfolgenden Nukleotiden, die identisch oder komplementär zu einer Teilsequenz eines Nukleinsäuremoleküls gemäß Anspruch 1 sind.
6. Polypeptid, das durch eine Nukleinsäuresequenz nach Anspruch 1 kodiert ist.
7. Verfahren zur Expression der Photoprotein Polypeptide gemäss Anspruch 6 in Bakterien, eukaryontischen Zellen oder in in vitro Expressionssystemen.
8. Verfahren zur Aufreinigung/Isolierung eines Photoprotein Polypeptides gemäss Anspruch 6.
9. Peptide mit mehr als 5 aufeinanderfolgenden Aminosäuren, die immunologisch durch Antikörper gegen das Photoprotein gr-Bolinopsin erkannt werden.
10. Verwendung einer für ein Photoprotein kodierende Nukleinsäure gemäß den Ansprüchen 1 bis 3 als Marker- oder Reportergen.
11. Verwendung eines Photoproteins gemäß Anspruch 6 als Marker oder Reporter.
12. Polypeptid gemäß Anspruch 6, welches eine oder mehrere biologische Modifikationen aufweist.
13. Polypeptid gemäß Anspruch 6 oder 12, welches durch Proteolyse prozessiert wurde.
14. Fluoreszierender Proteinkomplex, beinhaltend mindestens ein Polypeptid gemäß Anspruch 6, 12 oder 13.
PCT/EP2006/002939 2005-04-13 2006-03-31 Isoliertes photoprotein gr-bolinopsin, sowie dessen verwendung WO2006108518A1 (de)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
DE200510016980 DE102005016980A1 (de) 2005-04-13 2005-04-13 Isoliertes Photoprotein gr-Bolinopsin, sowie dessen Verwendung
DE102005016980.5 2005-04-13

Publications (1)

Publication Number Publication Date
WO2006108518A1 true WO2006108518A1 (de) 2006-10-19

Family

ID=36694115

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2006/002939 WO2006108518A1 (de) 2005-04-13 2006-03-31 Isoliertes photoprotein gr-bolinopsin, sowie dessen verwendung

Country Status (3)

Country Link
DE (1) DE102005016980A1 (de)
TW (1) TW200716666A (de)
WO (1) WO2006108518A1 (de)

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005000885A1 (de) * 2003-06-23 2005-01-06 Bayer Healthcare Ag Isoliertes photoprotein bolinopsin, sowie dessen verwendung
WO2005021591A1 (de) * 2003-08-26 2005-03-10 Bayer Healthcare Ag Isoliertes photoprotein berovin, sowie dessen verwendung

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005000885A1 (de) * 2003-06-23 2005-01-06 Bayer Healthcare Ag Isoliertes photoprotein bolinopsin, sowie dessen verwendung
WO2005021591A1 (de) * 2003-08-26 2005-03-10 Bayer Healthcare Ag Isoliertes photoprotein berovin, sowie dessen verwendung

Also Published As

Publication number Publication date
DE102005016980A1 (de) 2006-11-02
TW200716666A (en) 2007-05-01

Similar Documents

Publication Publication Date Title
WO2008095622A2 (de) Sekretierte luziferase mluc7 und deren verwendung
EP1664102B1 (de) Isoliertes photoprotein mtclytin, sowie dessen verwendung
EP1572732B1 (de) Isoliertes fluoreszierendes protein aus clytia gregaria cgfp, sowie dessen verwendung
WO2006108518A1 (de) Isoliertes photoprotein gr-bolinopsin, sowie dessen verwendung
DE10339567A1 (de) Isoliertes Photoprotein Berovin, sowie dessen Verwendung
WO2006122650A2 (de) Isoliertes photoprotein aqdecay sowie dessen verwendung
DE10328067A1 (de) Isoliertes Photoprotein Bolinopsin, sowie dessen Verwendung
DE102007011241A1 (de) Isoliertes Photoprotein mtClytinDecay, sowie dessen Verwendung
WO2008095623A2 (de) Sekretierte luziferase lu164m3 und deren verwendung
WO2006010454A1 (de) Isoliertes photoprotein aequorin y89f, sowie dessen verwendung
DE102005005438A1 (de) Mutanten des fluoreszierenden Proteins CGFPs, sowie deren Verwendung
WO2007140983A1 (de) FLUORESZIERENDE PROTEINE wfCGFP, SOWIE DEREN VERWENDUNG

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application
NENP Non-entry into the national phase

Ref country code: DE

WWW Wipo information: withdrawn in national office

Country of ref document: DE

NENP Non-entry into the national phase

Ref country code: RU

WWW Wipo information: withdrawn in national office

Country of ref document: RU

122 Ep: pct application non-entry in european phase

Ref document number: 06723900

Country of ref document: EP

Kind code of ref document: A1

WWW Wipo information: withdrawn in national office

Ref document number: 6723900

Country of ref document: EP