WO2006034456A2 - Compositions and methods for detecting and treating tumors - Google Patents

Compositions and methods for detecting and treating tumors Download PDF

Info

Publication number
WO2006034456A2
WO2006034456A2 PCT/US2005/034179 US2005034179W WO2006034456A2 WO 2006034456 A2 WO2006034456 A2 WO 2006034456A2 US 2005034179 W US2005034179 W US 2005034179W WO 2006034456 A2 WO2006034456 A2 WO 2006034456A2
Authority
WO
WIPO (PCT)
Prior art keywords
ephb4
cell
tumor
test cell
gene
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2005/034179
Other languages
English (en)
French (fr)
Other versions
WO2006034456A3 (en
Inventor
Ramachandra Reddy
Parkash Gill
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Vasgene Therapeutics Inc
Original Assignee
Vasgene Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Vasgene Therapeutics Inc filed Critical Vasgene Therapeutics Inc
Priority to EP05816052A priority Critical patent/EP1799867A2/en
Priority to AU2005286663A priority patent/AU2005286663A1/en
Priority to CA002581430A priority patent/CA2581430A1/en
Priority to JP2007533654A priority patent/JP2008514925A/ja
Publication of WO2006034456A2 publication Critical patent/WO2006034456A2/en
Publication of WO2006034456A3 publication Critical patent/WO2006034456A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/575Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/5758Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6876Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
    • C12Q1/6883Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material
    • C12Q1/6886Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material for cancer
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/112Disease subtyping, staging or classification

Definitions

  • Cancers are a significant cause of mortality in.the adult American population. However, in many instances early stage cancers are treatabtaby surgical removal (resection). Surgical treatment can be combined with chemotherapeutic agents to achieve an even higher survival rate in certain cancers. In most cancers, survival rate drops precipitously in patients with metastatic (late stage) colon cancer.
  • the disclosure relates to the discovery that indicators of heightened EphB4 activity are associated with cancerous states, and particularly with metastatic cancer. Such indicators include EphB4 mRNA and protein levels.
  • the EphB4 gene is amplified in many cancers, and particularly in metastatic cancers. EphB4 amplification shows correlation with EphB4 protein levels. Accordingly, EphB4 gene amplification (e.g., copy number) may also be used to detect and evaluate cancerous states.
  • the disclosure provides methods for identifying a tumor that is suitable for treatment with an inhibitor of EphB4 expression or function.
  • Such methods may include detecting in the tumor a cell having one or more of the following characteristics: (a) abnormally high expression of EphB4 protein; (b) abnormally high expression of EphB4 mRNA; and (c) gene amplification of the EphB4 gene.
  • a tumor comprising cells having one or more of characteristics (a)-(c) is likely to be sensitive to treatment with an inhibitor of EphB4 expression or function. It should be noted that tumors that do not directly express EphB4 may also be sensitive to treatments targeted at these proteins, as these proteins are known to be expressed in the vascular endothelium and to participate in the formation of new capillaries that service growing tumors.
  • An inhibitor of EphB4 expression or function may be, for example, (i) an EphB4-selective compound (e.g., a nucleic acid compound that hybridizes to an EphB4 transcript under physiological conditions and decreases the expression of EphB4 in a cell, or a polypeptide that inhibits a cellular function of EphB4).
  • an EphB4-selective compound e.g., a nucleic acid compound that hybridizes to an EphB4 transcript under physiological conditions and decreases the expression of EphB4 in a cell, or a polypeptide that inhibits a cellular function of EphB4.
  • the disclosure provides methods for evaluating gene amplification of the EphB4 gene in a test cell.
  • Such methods may comprise detecting the EphB4 gene copy number in a test cell, wherein an increase in the EphB4 gene copy number in the test cell relative to that in a control cell is indicative of gene amplification of the EphB4 gene in the test cell.
  • the EphB4 gene copy number can be detected by hybridization-based assays (e.g., Southern blot, in situ hybridization (ISH), and comparative genomic hybridization (CGH)), or by amplification-based assays (e.g., quantative PCR).
  • the EphB4 gene copy number is detected by using a microarray-based platform.
  • test cells in these methods are mammalian cells such as human cells.
  • the test cell is a tumor cell which includes, but is not limited to, a squamous cell carcinoma of the head and neck (HNSCC), a prostate tumor cell, a breast tumor cell, a colorectal carcinoma cell, a lung tumor cell, a bladder tumor cell, and a brain tumor cell.
  • Test cells may be obtained from a subject suspected of having a tumor, or a subject that is known to have a tumor. In the latter case, a test cell can be obtained from a tumor tissue, a primary tumor, or a tissue that is suspected of harboring metastatic cells derived from the primary tumor.
  • a test cell is obtained from lymph nodes or bone marrow.
  • a test cell is obtained from (present in) a bodily fluid selected from the group consisting of blood, serum, plasma, a blood-derived fraction, lymph fluid, pleural fluid, stool, urine, and a colonic effluent.
  • a test cell is present in a pool of test cells.
  • the disclosure provides methods for evaluating the cancer status of a cell in a subject.
  • Such methods comprise: (a) obtaining a test cell from a subject suspected of having or known to have a tumor; (b) detecting the EphB4 gene copy number in the test cell, wherein an increase in the EphB4 gene copy number in the test cell relative to that in a control cell indicates that the test cell is a tumor cell.
  • the EphB4 gene copy number can be detected by hybridization-based assays (e.g., Southern blot, in situ hybridization (ISH), and comparative genomic hybridization (CGH)), or by amplification-based assays (e.g., quantative PCR).
  • test cells in these methods are mammalian cells such as human cells.
  • the test cell is a tumor cell which includes, but is not limited to, a squamous cell carcinoma of the head and neck (HNSCC), a prostate tumor cell, a breast tumor cell, a colorectal carcinoma cell, a lung tumor cell, a bladder tumor cell, and a brain tumor cell.
  • HNSCC squamous cell carcinoma of the head and neck
  • test cells can be obtained from a tumor tissue, a primary tumor, or a tissue that is suspected of harboring metastatic cells derived from the primary tumor.
  • a test cell is obtained from lymph nodes or bone marrow.
  • a test cell is obtained from or present in a bodily fluid selected from the group consisting of blood, serum, plasma, a blood-derived fraction, lymph fluid, pleural fluid, stool, urine, and a colonic effluent.
  • a test cell is present in a pool of test cells.
  • the disclosure provides methods for evaluating the prognosis of a subject, comprising: (a) obtaining a test cell from a subject suspected of having or known to have a tumor; (b) detecting an indicator of elevated EphB4 activity in the test cell, wherein an increase in the indicator of EphB4 activity in the test cell relative to that in a control cell indicates that the subject is at increased risk for having or developing a metastatic cancer.
  • the indicator of EphB4 activity includes EphB4 mRNA, EphB4 protein, and EphB4 gene copy number.
  • the EphB4 mRNA can be detected by a hybridization-based assay using an EphB4 nucleotide probe or by an amplification-based assay using an EphB4 nucleotide primer.
  • the nucleotide probe or primer used in the methods is labeled.
  • the EphB4 protein can be detected by an immuno-assay using an EphB4 antibody, including but is not limited to, EphB4 antibody No. 1, 23, 35, 47, 57, 79, 85L, 85H, 91, 98, 121, 131, or 138.
  • the antibody used in the methods is labeled.
  • the EphB4 gene copy number can be detected by hybridization-based assays or by amplification-based assays.
  • the indicator of EphB4 is detected by using a microarray-based platform.
  • the increase of the indicator of EphB4 in the test cell is at least three fold relative to that in a control cell.
  • test cells in these methods are mammalian cells such as human cells.
  • the test cell is a tumor cell which includes, but is not limited to, a squamous cell carcinoma of the head and neck (HNSCC), a prostate tumor cell, a breast tumor cell, a colorectal carcinoma cell, a lung tumor cell, a bladder tumor cell, and a brain tumor cell.
  • HNSCC head and neck
  • test cells can be obtained from a tumor tissue (e.g., a primary tumor), or a tissue that is suspected of harboring metastatic cells derived from the primary tumor.
  • a test cell is obtained from lymph nodes or bone marrow.
  • a test cell is obtained from or present in a bodily fluid selected from the group consisting of blood, serum, plasma, a blood-derived fraction, lymph fluid, pleural fluid, stool, urine, and a colonic effluent.
  • a test cell is present in a pool of test cells.
  • the disclosure provides methods for treating a patient suffering from a cancer, comprising: (a) identifying in the patient a tumor having a plurality of cancer cells having a gene amplification of the EphB4 gene; and (b) administering to the patient an EphB4-selective therapeutic compound (e.g., a nucleic acid compound that hybridizes to an EphB4 transcript under physiological conditions and decreases the expression of EphB4 in a cell, or a polypeptide that inhibits a cellular function of EphB4).
  • an EphB4-selective therapeutic compound e.g., a nucleic acid compound that hybridizes to an EphB4 transcript under physiological conditions and decreases the expression of EphB4 in a cell, or a polypeptide that inhibits a cellular function of EphB4.
  • Such methods may include, as a diagnostic part, identifying in the patient a tumor having a plurality of cancer cells having gene amplification of the EphB4.
  • kits for detecting gene amplification of the EphB4 gene in a test cell may comprise: (a) one or more nucleic acid capable of hybridizing to the EphB4 gene under high stringency conditions; and (b) a control nucleic acid comprising human genomic DNA having one copy of EphB4 at the normal position.
  • the nucleic acids of the kit may be used in hybridization-based assays as probes or in amplification-based assays as primers.
  • the disclosure provides kits for detecting gene amplification of the EphB4 gene in a test cell.
  • kits may comprise: (a) one or more nucleic acid capable of hybridizing to the EphB4 gene under high stringency conditions; and (b) at least one control cell line that exhibits a mean of about two copies of EphB4 gene.
  • the kits may further comprise at least one control cell line that exhibits a mean of about four copies of EphB4 gene.
  • Figure 1 shows amino acid sequence of the B4ECv3 protein (predicted sequence of the precursor including uncleaved Eph B4 leader peptide is shown).
  • Figure 2 shows amino acid sequence of the B4ECv3NT protein (predicted sequence of the precursor including uncleaved Eph B4 leader peptide is shown).
  • Figure 3 shows amino acid sequence of the B2EC protein (predicted sequence of the precursor including uncleaved Ephrin B2 leader peptide is shown).
  • Figure 4 shows amino acid sequence of the B4ECv3-FC protein (predicted sequence of the precursor including uncleaved Eph B4 leader peptide is shown).
  • Figure 5 shows amino acid sequence of the B2EC-FC protein (predicted sequence of the precursor including uncleaved Ephrin B2 leader peptide is shown).
  • Figure 6 shows the domain structure of the recombinant soluble EphB4EC proteins. Designation of the domains are as follows: L - leader peptide, G - globular (ligand-binding domain), C - Cys-rich domain, Fl , F2 - fibronectin type III repeats, H - 6 x His-tag.
  • Figure 7 shows EphB4 expression and gene amplification in HNSCC primary tissues and metastases.
  • the right hand column are frozen sections of lymph node metastasis stained with EphB4 polyclonal antibody (top right) and visualized with DAB. Control (middle) was incubation with goat serum and H&E (bottom) reveals the location of the metastatic foci surrounded by stroma which does not stain.
  • Figure 8 shows EphB4 expression and gene amplification in HNSCC cell lines.
  • Figure 9 shows expression of EphB4 in prostate cell lines.
  • FIG 10 shows expression of EphB4 in prostate cancer tissue.
  • Representative QRT-PCR of RNA extracted from cancer specimens and adjacent BPH tissues (lower right).
  • Figure 11 shows that EphB4 and EphrinB2 are expressed in mesothelioma cell lines as shown by RT-PCR (A) and Western Blot (B).
  • Figure 12 shows expression of ephrin B2 and EphB4 by in situ hybridization in mesothelioma cells. NCI H28 mesothelioma cell lines cultured in chamber slides hybridized with antisense probe to ephrin B2 or EphB4 (top row). Control for each hybridization was sense (bottom row). Positive reaction is dark blue cytoplasmic stain.
  • Figure 13 shows cellular expression of EphB4 and ephrin B2 in mesothelioma cultures.
  • Figure 14 shows expression of ephrin B2 and EphB4 in mesothelioma tumor. Immunohistochemistry of malignant mesothelioma biopsy. H&E stained section to reveals tumor architecture; bottom left panel is background control with no primary antibody. EphB4 and ephrin B2 specific staining is brown color. Original magnification 200X. Figure 15 shows that Ephrin B2, but not EphB4 is expressed in KS biopsy tissue.
  • Double-label confocal immunofluorescence microscopy with antibodies to ephrin B2 (red) LANAl (green), or EphB4 (red) of frozen KS biopsy material directly demonstrates co-expression of LANAl and ephrin B2 in KS biopsy. Coexpression is seen as yellow color.
  • FIG. 16 shows that HHV-8 induces arterial marker expression in Kaposi's sarcoma cells.
  • A Western blot for ephrin B2 on various cell lysates.
  • SLK-vGPCR is a stable clone of SLK expressing the HHV-8 vGPCR, and SLK-pCEFL is control stable clone transfected with empty expression vector.
  • SLK cells transfected with LANA or LANA ⁇ 440 are SLK- LANA and SLK- ⁇ 440 respectively. Quantity of protein loading and transfer was determined by reprobing the membranes with /3-actin monoclonal antibody.
  • Figure 17 shows expression of EphB4 in bladder cancer cell lines (A), and regulation of EphB4 expression by EGFR signaling pathway (B).
  • Figure 18 shows a genomic nucleotide sequence of human EphB4.
  • Figure 19 shows a cDNA nucleotide sequence of human EphB4.
  • Figure 20 shows a genomic nucleotide sequence of human Ephrin B2.
  • Figure 21 shows a cDNA nucleotide sequence of human Ephrin B2.
  • Figure 22 shows an amino acid sequence of human EphB4.
  • Figure 23 shows an amino acid sequence of human Ephrin B2.
  • FIG. 24 shows examples of EphB4 antibodies and epitope mapping of these antibodies.
  • the topology of the EphB4 extracellular domain is shown, including a globular domain (G), a cystein-rich domain (C), and two fibronectin type 3 domains (Fl and F2).
  • G globular domain
  • C cystein-rich domain
  • Fl and F2 two fibronectin type 3 domains
  • the current disclosure is based in part on the discovery that signaling through the Ephrin B2/EphB4 ligand/receptor pathway contributes to tumorigenesis.
  • Applicants detected expression or elevated expression of Ephrin B2 or EphB4 in tumor tissues and developed anti-tumor therapeutic agents for blocking either expression or activity of Ephrin B2 or EphB4.
  • EphB4 gene is amplified in some tumors, for example, squamous cell carcinoma of the head and neck (HNSCC), prostate cancer, breast cancer, colorectal carcinoma, lung cancer, bladder cancer, and brain cancer.
  • HNSCC head and neck
  • the disclosure provides detection methods and diagnostic methods that comprise assessing gene amplification of EphB4 in a test cell sample.
  • the disclosure contemplates gene amplification of Ephrin B2 in tumors, and thus provides detection methods and diagnostic methods that comprise assessing gene amplification of Ephrin B2 in a test cell sample.
  • the discussion below will mostly refer to methods and compositions directed to EphB4. However, one of ordinary skill in the art will readily recognize that similar methods and compositions can be derived using Ephrin B2.
  • Ephrin B2 and EphB4 refers to Ephrin B2 and EphB4.
  • the present invention contemplates any ephrin ligand and/or Eph receptor within their respective family, which is expressed in a tumor.
  • the ephrins (ligands) are of two structural types, which can be further subdivided on the basis of sequence relationships and, functionally, on the basis of the preferential binding they exhibit for two corresponding receptor subgroups. Structurally, there are two types of ephrins: those which are membrane- anchored by a glycerophosphatidylinositol (GPI) linkage and those anchored through a transmembrane domain.
  • GPI glycerophosphatidylinositol
  • the ligands are divided into the Ephrin-A subclass, which are GPI-linked proteins which bind preferentially to EphA receptors, and the Ephrin- B subclass, which are transmembrane proteins which generally bind preferentially to EphB receptors.
  • Eph family receptors are a family of receptor protein-tyrosine kinases which are related to Eph, a receptor named for its expression in an erythropoietin-producing human hepatocellular carcinoma cell line. They are divided into two subgroups on the basis of the relatedness of their extracellular domain sequences and their ability to bind preferentially to Ephrin-A proteins or Ephrin-B proteins. Receptors which interact preferentially with Ephrin-A proteins are EphA receptors and those which interact preferentially with Ephrin-B proteins are EphB receptors.
  • EphB4 is specific for the membrane-bound ligand Ephrin B2 (Sakano, S. et al 1996; Brambilla R. et al 1995).
  • Ephrin B2 belongs to the class of Eph ligands that have a transmembrane domain and cytoplasmic region with five conserved tyrosine residues and PDZ domain.
  • Eph receptors are activated by binding of clustered, membrane attached ephrins (Davis S et al, 1994), indicating that contact between cells expressing the receptors and cells expressing the ligands is required for Eph activation.
  • an Eph receptor dimerizes and autophosphorylate the juxtamembrane tyrosine residues to acquire full activation (KaIo MS et al, 1999, Binns KS, 2000).
  • reverse signaling can occur through the ephrin Bs. Eph engagement of ephrins results in rapid phosphorylation of the conserved intracellular tyrosines (Bruckner K, 1997) and somewhat slower recruitment of PDZ binding proteins (Palmer A 2002).
  • Eph/ephrins may be associated with increased potentials for tumor growth, tumorigenicity, and metastasis (Easty DJ, 1999; Kiyokawa E, 1994; Tang XX, 1999; Vogt T, 1998; Liu W, 2002; Stephenson SA, 2001; Steube KG 1999; Berclaz G, 1996).
  • One aspect of the present disclosure provides detection methods for evaluating status of a tumor or tumor prognosis, wherein the tumor expresses Ephrin B2 and/or EphB4. Such methods comprise assessing gene amplification of Ephrin B2 or EphB4 in a test cell sample.
  • Another aspect of the present disclosure provides therapeutic methods for reducing the growth rate of a tumor expressing Ephrin B2 and/or EphB4. Such methods comprise administering an amount of a therapeutic agent that inhibits expression or activity of Ephrin B2, EphB4, or both.
  • the present invention is based at least in part on Applicants' discovery that EphB4 gene is amplified in some tumors, for example, squamous cell carcinoma of the head and neck (HNSCC), prostate cancer, breast cancer, colorectal carcinoma, lung cancer, bladder cancer, and brain cancer.
  • HNSCC head and neck
  • expression of EphB4 was found to be correspondingly elevated in those tumors with the EphB4 gene amplification.
  • EphB4 gene amplification can be diagnostic of neoplasia or the potential therefor.
  • detecting the elevated expression of human EphB4- encoded products e.g., mRNAs and proteins
  • other genetic alterations leading to elevated EphB4 expression may also be involved in tumorigenesis, such as mutations in regulatory regions of the EphB4 gene.
  • the present invention provides the methods for evaluating (assessing or measuring) tumor status, tumor prognosis, and survivability in a subject (individual or patient), which comprise detection of an indicator of EphB4 activity.
  • the indicator of EphB4 activity includes EphB4 gene copy number, EphB4 mRNA, and EphB4 protein. EphB4 mRNA and EphB4 protein are also referred to herein as gene expression products of EphB4.
  • the present invention provides methods of detecting EphB4 gene amplification. Detection of gene amplification can be evaluated by determining the copy number of a target gene. Generally, a normal diploid cell has two copies of a given autosomal gene. The copy number can be increased, however, by gene amplification or duplication, for example, in cancer cells. Methods of evaluating the copy number of a particular gene are well known in the art, and include, inter alia, hybridization based and amplification based assays.
  • a number of hybridization based assays can be used to detect the copy number of a target gene in the cells of a biological sample.
  • One such method is Southern blot (see Ausubel et al., or Sambrook et al.), where the genomic DNA is typically fragmented, separated electrophoretically, transferred to a membrane, and subsequently hybridized to a specific probe.
  • Comparison of the intensity of the hybridization signal from a test cell sample with a signal from a control cell comprising normal non-amplified genomic DNA can provide an estimate of the relative EphB4 gene copy number.
  • An increased signal compared to a control represents the presence of gene amplification.
  • in situ hybridization for example, fluorescence in situ hybridization (FISH) (see Angerer, 1987 Meth. Enzymol, 152: 649).
  • FISH fluorescence in situ hybridization
  • in situ hybridization comprises the following major steps: (1) fixation of tissue or biological structure to be analyzed; (2) prehybridization treatment of the biological structure to increase accessibility of target DNA, and to reduce nonspecific binding; (3) hybridization of the mixture of nucleic acids to the nucleic acid in the biological structure or tissue; (4) post-hybridization washes to remove nucleic acid fragments not bound in the hybridization, and (5) detection of the hybridized nucleic acid fragments.
  • the probes used in such applications are typically labeled, for example, with radioisotopes or fluorescent reporters.
  • Preferred probes are sufficiently long, for example, from about 50, 100, or 200 nucleotides to about 1000 or more nucleotides, to enable specific hybridization with the target nucleic acid(s) under stringent conditions.
  • CGH comparative genomic hybridization
  • a "test" collection of nucleic acids is labeled with a first label
  • a second collection for example, from a normal cell or tissue
  • the ratio of hybridization of the nucleic acids is determined by the ratio of the first and second labels binding to each fiber in an array. Difference in the ratio of the signals from the two labels (e.g., due to gene amplification in the test collection) is detected and the ratio provides a measure of the EphB4 gene copy number.
  • a cytogenetic representation of gene copy number variation can be generated by CGH, which provides fluorescence ratios along the length of chromosomes from differentially labeled test and reference genomic DNAs.
  • Hybridization protocols suitable for use with the methods of the invention are described, for example, in Albertson (1984) EMBO J. 3:1227-1234; Pinkel (1988) Proc. Natl. Acad. ScI USA, 85:9138-9142; EPO Pub. No. 430:402; Methods in Molecular Biology, Vol. 33: In Situ Hybridization Protocols, Choo, ed., Humana Press, Totowa, NJ. (1994).
  • amplification-based assays can also be used to measure the copy number of a target gene (e.g., EphB4).
  • a target nucleic acid sequence acts as a template in an amplification reaction (for example, Polymerase Chain Reaction or PCR).
  • an amplification reaction for example, Polymerase Chain Reaction or PCR.
  • the amount of amplification product will be proportional to the amount of template in the original sample.
  • Comparison to appropriate controls provides a measure of the copy number of the gene, according to the principles discussed above.
  • Methods of real-time quantitative PCR using TaqMan probes are well known in the art. Detailed protocols for real-time quantitative PCR are provided, for example, for RNA in: Gibson et al., 1996, A novel method for real time quantitative RT-PCR. Genome Res.,
  • TaqMan-based assay can also be used to quantify EphB4 gene copy number.
  • TaqMan based assays use a fluorogenic oligonucleotide probe that contains a 5' fluorescent dye and a 3' quenching agent. The probe hybridizes to a PCR product, but cannot itself be extended due to a blocking agent at the 3' end.
  • the 5' nuclease activity of the polymerase e.g., AmpliTaq
  • EphB4-forward 5'-TCC TGC AAG GAG ACC TTC AC-3'
  • EphB4-reverse 5'-CAG AGG CCT CGC AAC TAC AT-3' Predicted size of PCR product: 195 bp
  • primers are preferably employed with a set of control primers directed to a gene that is not expected to have increased copy number, such as below: GAPDH-forward: 5'-GAG GGG TGA TGT GGG GAG TA-3'
  • GAPDH-reverse 5'-GAG CTT CCC
  • Predicted size 206 bp Annealing temperature for both sets of primers: 64 °C.
  • ligase chain reaction (LCR) (see, Wu and Wallace, Genomics, 4: 560, 1989; Landegren et al., Science, 241 : 1077, 1988; and Barringer et al., Gene, 89: 117, 1990), transcription amplification (Kwoh et al., Proc. Natl. Acad. Sci. USA, 86: 1173, 1989), self-sustained sequence replication (Guatelli et al., Proc Nat Acad Sci, USA 87:1874, 1990), dot PCR, and linker adapter PCR, for example.
  • LCR ligase chain reaction
  • Another powerful method for determining gene copy numbers employs microarray- based platforms.
  • Microarray technology may be used because it offers high resolution.
  • the traditional CGH generally has a 20 Mb limited mapping resolution; whereas in microarray-based CGH, the fluorescence ratios of the differentially labeled test and reference genomic DNAs provide a locus-by-locus measure of DNA copy-number variation, thereby achieving increased mapping resolution.
  • the fluorescence ratios of the differentially labeled test and reference genomic DNAs provide a locus-by-locus measure of DNA copy-number variation, thereby achieving increased mapping resolution.
  • the present invention relates to detection of gene expression products (e.g., EphB4 mRNAs or proteins).
  • gene expression products e.g., EphB4 mRNAs or proteins.
  • mRNA transcription can be measured by a variety of techniques, including Northern blotting (Thomas (1980) Proc. Natl. Acad. Sci. USA 77:5201-5205), dot blots, and in situ hybridization.
  • Northern blotting Thimas (1980) Proc. Natl. Acad. Sci. USA 77:5201-5205
  • dot blots dot blots
  • in situ hybridization A variety of methods for measuring expression of the gene product exist, including Western blotting and immunohistochemical staining.
  • Western blots are run by spreading a protein sample on a gel, usually an SDS gel, blotting the gel with a cellulose nitrate filter, and probing the filters with labeled antibodies.
  • a cell sample is prepared, typically by dehydration and fixation, followed by reaction with labeled antibodies specific for the gene product coupled, where the labels are usually visually detectable, such as enzymatic labels, fluorescent labels, luminescent labels, and the like.
  • labeled antibodies specific for the gene product coupled where the labels are usually visually detectable, such as enzymatic labels, fluorescent labels, luminescent labels, and the like.
  • an increased level of the indicator of EphB4 activity is directly related to the invasiveness of the tumor and the likelihood that the tumor has metastasized or will metastasize.
  • the patients who test positively for EphB4 gene amplification are less likely to survive (poor prognosis) and will usually suffer a shorter time to relapse after surgical removal of the tumor than patients without such gene amplification.
  • the patients displaying gene amplification may benefit from aggressive treatment regimens after surgical removal of their tumors. Conversely, patients who do not display gene amplification may be less likely to require such rigorous treatment.
  • the present invention is useful for screening a wide variety of neoplastic diseases, including both solid tumors and hematopoietic cancers.
  • neoplastic diseases include, but are not limited to, carcinomas such as adenocarcinomas and melanomas; mesodermal tumors such as neuroblastomas and retinoblastomas; sarcomas such as osteosarcomas, Ewing's sarcoma, and various leukemias; and lymphomas.
  • carcinomas such as adenocarcinomas and melanomas
  • mesodermal tumors such as neuroblastomas and retinoblastomas
  • sarcomas such as osteosarcomas, Ewing's sarcoma, and various leukemias
  • lymphomas are particularly useful for carcinomas of the prostate, head and neck, breast, ovaries, colon and rectum, lung, stomach, brain, and liver.
  • a method of diagnosing a neoplastic tissue in a human is provided.
  • Test samples e.g., tissues or bodily fluids
  • the copy number of human EphB4 gene is determined.
  • levels of human EphB4 gene expression products can be determined. These include protein and mRNA.
  • an appropriate patient sample is obtained.
  • a tissue sample from the surgically removed tumor will be obtained and prepared for testing by conventional techniques.
  • lymphomas and leukemias lymphocytes, leukemic cells, or lymph tissues will be obtained and appropriately prepared.
  • test tissues or cells are obtained from a tumor (e.g., the primary tumor) or a tissue suspected of being neoplastic. Normally, the test tissues or cells are desirably separated from normal appearing tissue for analysis. This can be done by paraffin or cryostat sectioning or flow cytometry, as is known in the art.
  • test tissues or cells are obtained from a tissue that is suspected of having metastatic cells derived from the primary tumor, such as a lymph node or a tissue that is close to the primary tumor.
  • a tissue that is suspected of having metastatic cells derived from the primary tumor such as a lymph node or a tissue that is close to the primary tumor.
  • non-neoplastic tissue or any normal tissue can be used to determine a baseline level of gene expression or gene copy number, against which the amount of EphB4 gene expression or gene amplification can be compared.
  • test samples such as bodily fluids will also find use with particular tumors.
  • a bodily fluid can be assayed to detect the elevated levels of the gene expression product or of gene amplification.
  • Suitable body fluids include blood, serum, plasma, a blood-derived fraction, lymph fluid, saliva, sputum, stool, urine, a colonic effluent, breast exudate, and a wide variety of useful immunoassays are described in the patent and scientific literature. See, for example, U.S. Pat. Nos.
  • measurement of gene amplification will be performed quantitatively so that the number of EphB4 gene copies can be estimated.
  • Status of the disease may correlate directly with the number of gene copies present in the tumor cells. For example, patients displaying gene amplification (e.g., three copies of the EphB4 gene) are at a higher risk of relapse than patients not displaying gene amplification (e.g., two copies of EphB4 gene).
  • patients displaying gene amplification e.g., three copies of the EphB4 gene
  • patients not displaying gene amplification e.g., two copies of EphB4 gene.
  • the number of EphB4 gene copies increases, the invasiveness and likelihood of metastasis also appears to increase.
  • the number of EphB4 gene copies should be taken as an important factor in assessing the tumor status along with the traditional factors, including lymph node status, estrogen receptor status, progesterone receptor status, and the like. With all this information available, the treating physician is best able to assess the tumor status and recommend the best treatment strategy to benefit the patient.
  • the human EphB4 gene is considered to be amplified if the cell contains more than the normal copy number (2) of this gene per genome.
  • the various techniques for detecting gene amplification are well known in the art. Gene amplification can be determined, for example, by Southern blot analysis, wherein cellular DNA from a human tissue is digested, separated, and transferred to a filter where it is hybridized with a probe containing complementary nucleic acids. Alternatively, quantitative polymerase chain reaction (PCR) employing primers can be used to determine gene amplification. Appropriate primers will bind to sequences that bracket human EphB4 coding sequences. Other techniques for determining gene copy number as are known in the art can be used without limitation.
  • the gene product which is measured may be either mRNA or protein.
  • elevated expression means an increase in mRNA production or protein production over that which is normally produced by non-cancerous cells.
  • tumors include, but are not limited to, HNSCC, lung, breast, brain, colorectal, bladder, prostate, brain, liver, skin, and stomach.
  • Non-cancerous cells for use in determining baseline expression levels can be obtained from cells surrounding a tumor, from other humans or from human cell lines.
  • any increase can have diagnostic value, but generally the mRNA or protein expression will be elevated at least about 2-fold, 3-fold, 5-fold, 10-fold, 20-fold, and in some cases up to about 50-fold over that found in non-cancerous cells.
  • the techniques employed for detecting mRNA or protein are well known and routine in the art. Increased production of mRNA or protein may be detected, for example, using the techniques of Northern blot analysis or Western blot analysis, respectively, or other known techniques such as ELISA, immunoprecipitation, RIA and the like. All these techniques are well known to the skilled artisan.
  • nucleic acid probes or primers for the determining of human EphB4 gene amplification or elevated expression of mRNA are provided.
  • the probe may comprise ribo- or deoxyribonucleic acids, and may contain the entire human EphB4 coding nucleotide sequence, a sequence complementary thereto, or fragments thereof.
  • a probe may contain, for example, nucleotides as shown in Figures 18 and 19.
  • probes or primers will contain at least about 14 contiguous nucleotides of the human sequence but may desirably contain about 40, 50 or 100 nucleotides.
  • Probes are typically labelled with a fluorescent tag, a radioisotope, or the like to render them easily detectable. Preferably the probes will hybridize under stringent hybridization conditions.
  • the probes of the invention are complementary to the human EphB4 gene. This means that they share a high sequence identity (e.g., 95%, 98%, 99% or 100%) with the human EphB4 sequence.
  • EphB4 protein can be produced, according to the invention, substantially free of other human proteins.
  • those of skill in the art can express the cDNA in a non-human cell. Lysates of such cells provide proteins substantially free of other human proteins. The lysates can be further purified, for example, by immunoprecipitation, or by affinity chromatography.
  • the antibodies of the invention are specifically reactive with EphB4 protein. Preferably, they do not cross-react with EphB4 from other species. They can be polyclonal or monoclonal, and can be raised against a native EphB4, or an EphB4 fusion protein, or synthetic peptide.
  • the antibodies are specifically immunoreactive with EphB4 epitopes which are not present on other human proteins. Optionally, some antibodies are reactive with epitopes unique to human EphB4 and not present on the mouse homolog.
  • the antibodies are useful in conventional analyses, such as Western blot analysis, ELISA, immunohistochemistry, and other immunological assays for the detection of proteins.
  • Kits which contain the necessary reagents for determining gene copy number, such as probes or primers specific for the EphB4 gene, as well as written instructions. The instructions can provide calibration curves to compare with the determined values. Kits are also provided to determine elevated expression of mRNA (e.g., containing probes) or EphB4 protein (e.g., containing antibodies). Instructions will allow one to determine whether the expression levels of EphB4 are elevated. Reaction vessels and auxiliary reagents such as chromogens, buffers, and enzymes, may also be included in the kits.
  • the present invention provides a therapeutic modality for interfering with the expression or activity of EphB4 and/or Ephrin B2.
  • the method can be applied in vivo, in vitro, or ex vivo, and will be particularly useful in cancers having one or more indicators of elevated EphB4 activity.
  • Therapeutic agents may include nucleic acids, polypeptides, antibodies, and small molecule compounds. Examples of these therapeutic agents have been described in U.S. Patent Application Nos. 10/800,077 and 10/800,350, and in PCT Application Nos. US04/07491 and US04/07755.
  • nucleic acid therapeutic agents which can be single-, double-, or multiple-stranded, and can comprise modified or unmodified nucleotides or non-nucleotides or various mixtures, and combinations thereof.
  • nucleic acid therapeutic agents include, but are not limited to, antisense nucleic acids, dsRNA, siRNA, and enzymatic nucleic acid compounds (e.g., riozyme or DNA enzyme).
  • the disclosure features one or more nucleic acid therapeutic agents that independently or in combination modulate expression of the Ephrin B2 gene encoding an Ephrin B2 protein (e.g., Genbank Accession No.: NPJ304084) or the EphB4 receptor gene which encodes an EphB4 protein (e.g., Genbank Accession No.: NP_004435).
  • an Ephrin B2 protein e.g., Genbank Accession No.: NPJ304084
  • the EphB4 receptor gene which encodes an EphB4 protein
  • exemplary EphB4 antisense nucleic acids are provided in Table 1 below, and exemplary EphB4 siRNAs are provided in Table 2 below.
  • exemplary Ephrin B2 antisense nucleic acids are provided in Table 3 below, and exemplary Ephrin B2 siRNAs are provided in Table 2 below.
  • Eph B4 166 ATG TGC TGG ACA CTG GCC AA (2884-2903) ++++ 70
  • Eph B4 142 ATC CCG TAA CTC CAG GCA TC (2403-2422) ++ 40
  • Eph B4 108 TAC TGT CCG TGT TTG TCC GA (1723-1742) ++ 45 Eph B4 107 ATA TTC TGC TTC TCT CCC AT (1703-1722) ++++ 70
  • Eph B4 102 ATC AGG GCC AGC TGC TCC CG (1603-1622) +++ 50
  • Eph B4 94 ACG TCT TCA GGA ACC GCA CG (1443-1462) ++++ 80
  • Eph B4 86 AGG TAC CTC TCG GTC AGT GG (1283-1302) ++ 50
  • Eph B4 82 CAG TGA CCT CAA AGG TAT AG (1203-1222) ++++ 70
  • Eph B4 78 GGG TCA AAA GTC AGG TCT CC (1123-1142) ++++ 70
  • Eph B4 76 CTC CGG GTC GGC ACT CCC GG (1083-1102) +++ 60
  • Eph B4 72 AGG TGC AGG GAG GAG CCG TT (1003-1022) ++++ 70
  • Eph B4 66 ACG GCT GAT CCA ATG GTG TT (883-902) ++ 50
  • Eph B4 65 AGA GTG GCT ATT GGC TGG GC (863-882( ++++ 60
  • Eph B4 1562 caucacagccagacccaacuu siRNA 2303 cucuuccgaucccaccuacuu
  • the present invention provides polypeptide therapeutic agents which include soluble polypeptides, antibodies and antigen-binding portions of antibodies.
  • the disclosure provides soluble EphB4 polypeptides comprising an amino acid sequence of an extracellular domain of an EphB4 protein.
  • the soluble EphB4 polypeptides bind specifically to an EphrinB2 polypeptide.
  • the term "soluble" is used merely to indicate that these polypeptides do not contain a transmembrane domain or a portion of a transmembrane domain sufficient to compromise the solubility of the polypeptide in a physiological salt solution.
  • Soluble polypeptides are preferably prepared as monomers that compete with EphB4 for binding to ligand such as EphrinB2 and inhibit the signaling that results from EphB4 activation.
  • a soluble polypeptide may be prepared in a multimeric form, by, for example, expressing as an Fc fusion protein or fusion with another multimerization domain. Such multimeric forms may have complex activities, having agonistic or antagonistic effects depending on the context.
  • the soluble EphB4 polypeptide comprises a globular domain of an EphB4 protein.
  • a soluble EphB4 polypeptide may comprise a sequence at least 90% identical to residues 1- 522 of the amino acid sequence defined by Figure 22.
  • a soluble EphB4 polypeptide may comprise a sequence at least 90% identical to residues 1-412 of the amino acid sequence defined by Figure 22.
  • a soluble EphB4 polypeptide may comprise a sequence at least 90% identical to residues 1-312 of the amino acid sequence defined by Figure 22.
  • a soluble EphB4 polypeptide may comprise a sequence encompassing the globular (G) domain (amino acids 29-197 of Figure 22), and optionally additional domains, such as the cysteine- rich domain (amino acids 239-321 of Figure 22), the first fibronectin type 3 domain (amino acids 324-429 of Figure 22) and the second fibronectin type 3 domain (amino acids 434-526 of Figure 22).
  • Preferred polypeptides described herein and demonstrated as having ligand binding activity include polypeptides corresponding to 1-537, 1-427 and 1-326, respectively, of the amino acid sequence shown in Figure 22.
  • a soluble EphB4 polypeptide may comprise a sequence as set forth in Figure 1 or 2.
  • expression of such EphB4 polypeptides in a suitable cell, such as HEK293T cell line will result in cleavage of a leader peptide. Although such cleavage is not always complete or perfectly consistent at a single site, it is known that EphB4 tends to be cleaved so as to remove the first 15 amino acids of the sequence shown in Figure 22.
  • the disclosure provides unprocessed soluble EphB4 polypeptides that bind to EphrinB2 and comprise an amino acid sequence selected from the following group (numbering is with respect to the sequence of Figure 22): 1-197, 29-197, 1-312, 29-132, 1-321, 29-321, 1-326, 29-326, 1-412, 29-412, 1-427, 29-427, 1-429, 29-429, 1-526, 29-526, 1-537 and 29-537.
  • Such polypeptides may be used in a processed form, such forms having a predicted amino acid sequence selected from the following group (numbering is with respect to the sequence of Figure 22): 16-197, 16-312, 16-321, 16-326, 16-412, 16-427, 16-429, 16-526 and 16-537.
  • a soluble EphB4 polypeptide may be one that comprises an amino acid sequence at least 90%, and optionally 95% or 99% identical to any of the preceding amino acid sequences while retaining EphrinB2 binding activity.
  • any variations in the amino acid sequence from the sequence shown in Figure 21 are conservative changes or deletions of no more than 1, 2, 3, 4 or 5 amino acids, particularly in a surface loop region.
  • the soluble EphB4 polypeptide may inhibit the interaction between Ephrin B2 and EphB4.
  • the soluble EphB4 polypeptide may inhibit clustering of or phosphorylation of Ephrin B2 or EphB4. Phosphorylation of EphrinB2 or EphB4 is generally considered to be one of the initial events in triggering intracellular signaling pathways regulated by these proteins.
  • the soluble EphB4 polypeptide may be prepared as a monomeric or multimeric fusion protein.
  • the soluble polypeptide may include one or more modified amino acids. Such amino acids may contribute to desirable properties, such as increased resistance to protease digestion.
  • soluble EphB4 polypeptides having an additional component that confers increased serum half-life while still retaining EphrinB2 binding activity.
  • soluble EphB4 polypeptides are monomeric and are covalently linked to one or more polyethylene glycol (PEG) groups.
  • PEG polyethylene glycol
  • the one or more PEG may have a molecular weight ranging from about 1 kDa to about 100 kDa, and will preferably have a molecular weight ranging from about 10 to about 60 kDa or about 20 to about 40 kDa.
  • the soluble, monomeric EphB4 conjugate comprises an EphB4 polypeptide covalently linked to one PEG group of from about 20 to about 40 kDa (monoPEGylated EphB4), preferably via an €-amino group of EphB4 lysine or the N-terminal amino group.
  • EphB4 is randomly PEGylated at one amino group out of the group consisting of the e-amino groups of EphB4 lysine and the N-terminal amino group.
  • monoPEGylated EphB4 has superior properties in regard to the therapeutic applicability of unmodified soluble EphB4 polypeptides and poly-PEGylated EphB4. Nonetheless, the disclosure also provides poly-PEGylated EphB4 having PEG at more than one position. Such polyPEGylated forms provide improved serum-half life relative to the unmodified form.
  • a soluble EphB4 polypeptide is stably associated with a second stabilizing polypeptide that confers improved half-life without substantially diminishing EphrinB2 binding.
  • a stabilizing polypeptide will preferably be immunocompatible with human patients (or animal patients, where veterinary uses are contemplated) and have little or no significant biological activity.
  • the stabilizing polypeptide is a human serum albumin, or a portion thereof.
  • a human serum albumin may be stably associated with the EphB4 polypeptide covalently or non-covalently. Covalent attachment may be achieved by expression of the EphB4 polypeptide as a co-translational fusion with human serum albumin.
  • the albumin sequence may be fused at the N-terminus, the C- terminus or at a non-disruptive internal position in the soluble EphB4 polypeptide.
  • Exposed loops of the EphB4 would be appropriate positions for insertion of an albumin sequence.
  • Albumin may also be post-translationally attached to the EphB4 polypeptide by, for example, chemical cross-linking.
  • An EphB4 polypeptide may also be stably associated with more than one albumin polypeptide.
  • soluble EphB4 polypeptides examples are provided in the Examples below.
  • the disclosure provides soluble EphrinB2 polypeptides comprising an amino acid sequence of an extracellular domain of an EphrinB2 protein.
  • the soluble EphrinB2 polypeptides bind specifically to an EphB4 polypeptide.
  • the term "soluble" is used merely to indicate that these polypeptides do not contain a transmembrane domain or a portion of a transmembrane domain sufficient to compromise the solubility of the polypeptide in a physiological salt solution.
  • Soluble polypeptides are preferably prepared as monomers that compete with EphrinB2 for binding to ligand such as EphB4 and inhibit the signaling that results from EphrinB2 activation.
  • a soluble polypeptide may be prepared in a multimeric form, by, for example, expressing as an Fc fusion protein or fusion with another multimerization domain. Such multimeric forms may have complex activities, having agonistic or antagonistic effects depending on the context.
  • a soluble EphrinB2 polypeptide may comprise residues 1-225 of the amino acid sequence defined by Figure 22.
  • a soluble EphrinB2 polypeptide may comprise a sequence defined by Figure 3.
  • EphrinB2 polypeptides in a suitable cell, such as HEK293T cell line, will result in cleavage of a leader peptide. Although such cleavage is not always complete or perfectly consistent at a single site, it is known that EphrinB2 tends to be cleaved so as to remove the first 26 amino acids of the sequence shown in Figure 22. Accordingly, as specific examples, the disclosure provides unprocessed soluble EphrinB2 polypeptides that bind to EphB4 and comprise an amino acid sequence corresponding to amino acids 1-225 of Figure 22.
  • polypeptides may be used in a processed form, such forms having a predicted amino acid sequence selected from the following group (numbering is with respect to the sequence of Figure 22): 26-225.
  • the soluble EphrinB2 polypeptide may inhibit the interaction between Ephrin B2 and EphB4.
  • the soluble EphrinB2 polypeptide may inhibit clustering of or phosphorylation of EphrinB2 or EphB4.
  • the soluble EphrinB2 polypeptide may be prepared as a monomeric or multimeric fusion protein.
  • the soluble polypeptide may include one or more modified amino acids. Such amino acids may contribute to desirable properties, such as increased resistance to protease digestion.
  • the present invention provides antibodies against
  • Ephrin B2 or EphB4 refers to an antibody that inhibits function of Ephrin B2 or EphB4.
  • the antagonist antibody binds to an extracellular domain of Ephrin B2 or EphB4.
  • antibodies of the invention may be polyclonal or monoclonal; intact or truncated, e.g., F(ab')2, Fab, Fv; xenogeneic, allogeneic, syngeneic, or modified forms thereof, e.g., humanized, chimeric, etc. Examples of these antibodies include, but are not limited to, EphB4 antibody Nos. 1, 23, 35, 47, 57, 79, 85L, 85H, 91, 98, 121, 131, and 138 as shown in Figure 24.
  • Hybridomas producing antibody No. 23 (epitope within amino acids 16-198), antibody No. 91 (kinase activating antibody; epitope within amino acids 324-429), antibody No. 98 (epitope within amino acids 430-537), antibody No. 131 (epitope within amino acids 324-429), and antibody No. 138 (epitope within amino acids 430-537) were deposited in the American Type Culture Collection (ATCC), 10801 University Boulevard, Manassas, VA 20110-2209. The ATCC Deposit Designation Nos. for antibody No. 23, No. 91, No. 98, No. 131, and No.
  • ATCC American Type Culture Collection
  • the present disclosure provides methods of inhibiting or reducing tumor growth and methods of treating an individual suffering from cancer.
  • one or more of these therapeutic methods is applied after gene amplification (EphB4 or Ephrin B2) has been detected by the methods as described above.
  • EphB4 or Ephrin B2 gene amplification
  • These methods involve administering to the individual a therapeutically effective amount of one or more therapeutic agent as described above, or a conventional anti-tumor compounds as described below, or both. These methods are particularly aimed at therapeutic and prophylactic treatments of animals, and more particularly, humans.
  • the tumor includes a tumor inside an individual, a tumor xenograft, or a tumor cultured in vitro.
  • nucleic acid therapeutic agents of the present disclosure are useful for treating or preventing a cancer (tumor), including, but not limited to, colorectal carcinoma, breast cancer, ovary cancer, mesothelioma, prostate cancer, bladder cancer, lung cancer, brain cancer, stomach cancer, HNSCC, Kaposi sarcoma, and leukemia.
  • one or more therapeutic agents can be administered, together (simultaneously) or at different times (sequentially).
  • therapeutic agents can be administered with more than two types of compounds for treating cancer.
  • a therapeutic agent of the present invention can be used in combination with one of the conventional anti-tumor therapeutic approaches.
  • Such methods can be used in prophylactic cancer prevention, prevention of cancer recurrence and metastases after surgery, and as an adjuvant of other conventional cancer therapy.
  • conventional cancer therapies e.g., chemotherapy, radiation therapy, phototherapy, immunotherapy, and surgery
  • a wide array of conventional compounds have been shown to have anti-neoplastic activities. These compounds have been used as pharmaceutical agents in chemotherapy to shrink solid tumors, prevent metastases and further growth, or decrease the number of malignant cells in leukemic or bone marrow malignancies.
  • a therapeutic agent of the present disclosure When a therapeutic agent of the present disclosure is administered in combination with another conventional anti-neoplastic (anti-tumor or chemotherapeutic) agent, either concomitantly or sequentially, such therapeutic agent is shown to enhance the therapeutic effect of the anti-tumor agent or overcome cellular resistance to such anti-tumor agent. This allows decrease of dosage of an anti-tumor agent, thereby reducing the undesirable side effects, or restores the effectiveness of an anti-neoplastic agent in resistant cells.
  • another conventional anti-neoplastic (anti-tumor or chemotherapeutic) agent either concomitantly or sequentially, such therapeutic agent is shown to enhance the therapeutic effect of the anti-tumor agent or overcome cellular resistance to such anti-tumor agent. This allows decrease of dosage of an anti-tumor agent, thereby reducing the undesirable side effects, or restores the effectiveness of an anti-neoplastic agent in resistant cells.
  • Conventional anti-tumor compounds include, merely to illustrate: aminoglutethimide, amsacrine, anastrozole, asparaginase, beg, bicalutamide, bleomycin, buserelin, busulfan, campothecin, capecitabine, carboplatin, carmustine, chlorambucil, cisplatin, cladribine, clodronate, colchicine, cyclophosphamide, cyproterone, cytarabine, dacarbazine, dactinomycin, daunorubicin, dienestrol, diethylstilbestrol, docetaxel, doxorubicin, epirubicin, estradiol, estramustine, etoposide, exemestane, filgrastim, fludarabine, fludrocortisone, fluorouracil, fluoxymesterone, flutamide, gemcitabine, genistein, goserelin
  • chemotherapeutic anti-tumor compounds may be categorized by their mechanism of action into, for example, following groups: anti-metabolites/anti-cancer agents, such as pyrimidine analogs (5-fluorouracil, floxuridine, capecitabine, gemcitabine and cytarabine) and purine analogs, folate antagonists and related inhibitors (mercaptopurine, thioguanine, pentostatin and 2-chlorodeoxyadenosine (cladribine)); antiproliferative/antimitotic agents including natural products such as vinca alkaloids (vinblastine, vincristine, and vinorelbine), microtubule disruptors such as taxane (paclitaxel, docetaxel), vincristin, vinblastin, nocodazole, epothilones and navelbine, epidipodophyllotoxins (etoposide, teniposide), DNA damaging agents (actinomycin, amsacrine, anthra
  • administration of the therapeutic agents may be continued while the other therapy is being administered and/or thereafter.
  • Administration of the therapeutic agents may be made in a single dose, or in multiple doses.
  • administration of the therapeutic agents is commenced at least several days prior to the conventional therapy. In other instances, administration is begun either immediately before or at the time of the administration of the conventional therapy.
  • the therapeutic agents (compounds) of the present disclosure are formulated with a pharmaceutically acceptable carrier.
  • Such therapeutic agents can be administered alone or as a component of a pharmaceutical formulation (composition).
  • the agents may be formulated for administration in any convenient way for use in human or veterinary medicine.
  • Wetting agents, emulsifiers and lubricants, such as sodium lauryl sulfate and magnesium stearate, as well as coloring agents, release agents, coating agents, sweetening, flavoring and perfuming agents, preservatives and antioxidants can also be present in the compositions.
  • Formulations of the subject agents include those suitable for oral/ nasal, topical, parenteral, rectal, and/or intravaginal administration.
  • the formulations may conveniently be presented in unit dosage form and may be prepared by any methods well known in the art of pharmacy.
  • the amount of active ingredient which can be combined with a carrier material to produce a single dosage form will vary depending upon the host being treated, the particular mode of administration.
  • the amount of active ingredient which can be combined with a carrier material to produce a single dosage form will generally be that amount of the compound which produces a therapeutic effect.
  • methods of preparing these formulations or compositions include combining another type of anti-tumor therapeutic agent and a carrier and, optionally, one or more accessory ingredients.
  • the formulations can be prepared with a liquid carrier, or a finely divided solid carrier, or both, and then, if necessary, shaping the product.
  • Formulations for oral administration may be in the form of capsules, cachets, pills, tablets, lozenges (using a flavored basis, usually sucrose and acacia or tragacanth), powders, granules, or as a solution or a suspension in an aqueous or non-aqueous liquid, or as an oil- in-water or water-in-oil liquid emulsion, or as an elixir or syrup, or as pastilles (using an inert base, such as gelatin and glycerin, or sucrose and acacia) and/or as mouth washes and the like, each containing a predetermined amount of a subject therapeutic agent as an active ingredient.
  • lozenges using a flavored basis, usually sucrose and acacia or tragacanth
  • one or more therapeutic agents may be mixed with one or more pharmaceutically acceptable carriers, such as sodium citrate or dicalcium phosphate, and/or any of the following: (1) fillers or extenders, such as starches, lactose, sucrose, glucose, mannitol, and/or silicic acid; (2) binders, such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinyl pyrrolidone, sucrose, and/or acacia; (3) humectants, such as glycerol; (4) disintegrating agents, such as agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate; (5) solution retarding agents, such as paraffin; (6) absorption accelerators, such as quaternary ammonium compounds; (7) wetting agents, such as, for example,
  • the pharmaceutical compositions may also comprise buffering agents.
  • Solid compositions of a similar type may also be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugars, as well as high molecular weight polyethylene glycols and the like.
  • Liquid dosage forms for oral administration include pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups, and elixirs.
  • the liquid dosage forms may contain inert diluents commonly used in the art, such as water or other solvents, solubilizing agents and emulsifiers, such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof.
  • the oral compositions can also include adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, coloring, perfuming, and preservative agents.
  • Suspensions in addition to the active compounds, may contain suspending agents such as ethoxylated isostearyl alcohols, polyoxyethylene sorbitol, and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth, and mixtures thereof.
  • suspending agents such as ethoxylated isostearyl alcohols, polyoxyethylene sorbitol, and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth, and mixtures thereof.
  • topical formulations may further include one or more of the wide variety of agents known to be effective as skin or stratum corneum penetration enhancers. Examples of these are 2- pyrrolidone, N-methyl-2-pyrrolidone, dimethylacetamide, dimethylformamide, propylene glycol, methyl or isopropyl alcohol, dimethyl sulfoxide, and azone. Additional agents may further be included to make the formulation cosmetically acceptable. Examples of these are fats, waxes, oils, dyes, fragrances, preservatives, stabilizers, and surface active agents. Keratolytic agents such as those known in the art may also be included. Examples are salicylic acid and sulfur.
  • Dosage forms for the topical or transdermal administration include powders, sprays, ointments, pastes, creams, lotions, gels, solutions, patches, and inhalants.
  • the subject therapeutic agents may be mixed under sterile conditions with a pharmaceutically acceptable carrier, and with any preservatives, buffers, or propellants which may be required.
  • the ointments, pastes, creams and gels may contain, in addition to a subject nucleic acid molecule, excipients, such as animal and vegetable fats, oils, waxes, paraffins, starch, tragacanth, cellulose derivatives, polyethylene glycols, silicones, bentonites, silicic acid, talc and zinc oxide, or mixtures thereof.
  • Powders and sprays can contain, in addition to a therapeutic agent, excipients such as lactose, talc, silicic acid, aluminum hydroxide, calcium silicates, and polyamide powder, or mixtures of these substances.
  • Sprays can additionally contain customary propellants, such as chlorofluorohydrocarbons and volatile unsubstituted hydrocarbons, such as butane and propane.
  • compositions suitable for parenteral administration may comprise one or more therapeutic agents in combination with one or more pharmaceutically acceptable sterile isotonic aqueous or nonaqueous solutions, dispersions, suspensions or emulsions, or sterile powders which may be reconstituted into sterile injectable solutions or dispersions just prior to use, which may contain antioxidants, buffers, bacteriostats, solutes which render the formulation isotonic with the blood of the intended recipient or suspending or thickening agents.
  • aqueous and nonaqueous carriers examples include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
  • polyols such as glycerol, propylene glycol, polyethylene glycol, and the like
  • vegetable oils such as olive oil
  • injectable organic esters such as ethyl oleate.
  • Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
  • compositions may also contain adjuvants, such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of the action of microorganisms may be ensured by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption, such as aluminum monostearate and gelatin.
  • adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents.
  • Prevention of the action of microorganisms may be ensured by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium
  • Injectable depot forms are made by forming microencapsule matrices of one or more therapeutic agents in biodegradable polymers such as polylactide-polyglycolide. Depending on the ratio of drug to polymer, and the nature of the particular polymer employed, the rate of drug release can be controlled. Examples of other biodegradable polymers include poly(orthoesters) and poly(anhydrides). Depot injectable formulations are also prepared by entrapping the drug in liposomes or microemulsions which are compatible with body tissue.
  • Formulations for intravaginal or rectally administration may be presented as a suppository, which may be prepared by mixing one or more compounds of the disclosure with one or more suitable nonirritating excipients or carriers comprising, for example, cocoa butter, polyethylene glycol, a suppository wax or a salicylate, and which is solid at room temperature, but liquid at body temperature and, therefore, will melt in the rectum or vaginal cavity and release the active compound.
  • one or more therapeutic agents are formulated with a pharmaceutically acceptable agent that allows for the effective distribution of the agent in the physical location most suitable for their desired activity.
  • Non-limiting examples of such pharmaceutically acceptable agents include: PEG, phospholipids, phosphorothioates, P- glycoprotein inhibitors (such as Pluronic P85) which can enhance entry of drugs into various tissues, biodegradable polymers, such as poly (DL-lactide-coglycolide) microspheres for sustained release delivery after implantation (Emerich, DF et al, 1999, Cell Transplant, 8, 47-58), and loaded nanoparticles such as those made of polybutylcyanoacrylate, which can deliver drugs across the blood brain barrier and can alter neuronal uptake mechanisms (Prog Neuropsychopharmacol Biol Psychiatry, 23, 941-949, 1999).
  • EphB4 transcripts were detected in situ hybridization. Strong signal for EphB4 specific antisense probe was detected indicating the presence of transcripts ( Figure 7B, top left). Comparison with the H&E stain (Fig. 7B, bottom left) to illustrate tumor architecture reveals that the signal was localized to the tumor cells, and was absent from the stromal areas. Ephrin B2 transcripts were also detected in tumor sample, and as with EphB4, the signal was localized to the tumor cells (Fig. 7B, top right). Neither EphB4 nor ephrin B2 sense probes hybridized to the sections, proving specificity of the signals.
  • EphB4 gene amplification may be used a diagnostic marker for tumor status (in particular, tumor metastasis).
  • EphB4 Is Upregulated and Imparts Growth Advantage in Prostate Cancer
  • A. Expression of EphB4 in prostate cancer cell lines We first examined the expression of EphB4 protein in a variety of prostate cancer cell lines by Western blot. We found that prostate cancer cell lines show marked variation in the abundance of the 120 kD EphB4. The levels were relatively high in PC3 and even higher in PC3M, a metastatic clone of PC3, while normal prostate gland derived cell lines (MLC) showed low or no expression of EphB4 (Fig. 9A).
  • MLC normal prostate gland derived cell lines
  • Fig. 9A we next checked the activation status of EphB4 in PC3 cells by phosphorylation study. We found that even under normal culture conditions, EphB4 is phosphorylated though it can be further induced by its ligand, ephrin B2 (Fig. 9B).
  • EphB4 is expressed in clinical prostate samples.
  • tumor tissues and adjacent normal tissue from prostate cancer surgical specimens were examined.
  • the histological distribution of EphB4 in the prostate specimens was determined by immunohistochemistry.
  • EphB4 expression is confined to the neoplastic epithelium (Fig. 10, top left), and is absent in stromal and normal prostate epithelium (Fig. 10, top right).
  • Fig. 10, top left neoplastic epithelium
  • Fig. 10 top right normal prostate epithelium
  • 24 of the 32 prostate cancers examined were positive.
  • EphB4 mRNA is expressed both in the normal and tumor tissues of clinical samples by quantitative RT-PCR.
  • tumor EphB4 mRNA levels were at least 3 times higher than in the normal in this case (Fig. 10, lower right).
  • EphB4 and EphrinB2 are expressed in mesothelioma cell lines
  • Ephrin B2 and EphB4 in malignant mesothelioma cell lines was determined at the RNA and protein level by a variety of methods. RT-PCR showed that all of the four cell lines express EphrinB2 and EphB4 (Fig. 1 IA). Protein expression was determined by Western blot in these cell lines. Specific bands for EphB4 were seen at 120 kD. In addition, Ephrin B2 was detected in all cell lines tested as a 37 kD band on Western blot (Fig. HB). No specific band for Ephrin B2 was observed in 293 human embryonic kidney cells, which were included as a negative control.
  • EphB4 transcription in mesothelioma cells was carried out on NCI H28 cell lines cultured on chamber slides. Specific signal for EphB4 was detected using antisense probe Ephrin B2 transcripts were also detected in the same cell line. Sense probes for both EphB4 and Ephrin B2 served as negative controls and did not hybridize to the cells ( Figure 12). Expression of EphB4 and Ephrin B2 proteins was confirmed in the cell lines by immunofluorescence analysis (Fig. 13). Three cell lines showed strong expression of EphB4, whereas expression of Ephrin B2 was present in H28 and H2052, and weakly detectable in H2373.
  • Tumor cells cultured from the pleural effusion of a patient diagnosed with pleural malignant mesothelioma were isolated and showed positive staining for both EphB4 and Ephrin B2 at passage 1 ( Figure 13, bottom row). These results confirm co-expression of EphB4 and Ephrin B2 in mesothelioma cell lines.
  • tumor biopsy samples were subjected to immunohistochemical staining for EphB4 and Ephrin B2. Antibodies to both proteins revealed positive stain in the tumor cells. Representative data is shown in Figure 14.
  • KS tumors express Ephrin B2, but not EphB4
  • EphB4 and ephrin B2 which are markers for venous and arterial endothelial cells, respectively.
  • Ephrin B2, but not EphB4 transcripts were detected in tumor cells of KS biopsies by in situ hybridization ( Figure 15A). Comparison of the positive signal with ephrin B2 antisense probe and tumor cells as shown by H&E staining shows that ephrin B2 expression is limited to the areas of the biopsy that contain tumor cells.
  • KS with EphB4 antisense probe The lack of signal in KS with EphB4 antisense probe is not due to a defect in the probe, as it detected transcripts in squamous cell carcinoma, which we have shown expresses this protein. Additional evidence for the expression of ephrin B2 in KS tumor tissue is afforded by the localization of EphB4/Fc signal to tumor cells, detected by FITC conjugated anti human Fc antibody. Because ephrin B2 is the only ligand for EphB4 this reagent is specific for the expression of ephrin B2 ( Figure 15B, left). An adjacent section treated only with the secondary reagent shows no specific signal.
  • HHV-8 vGPCR induces ephrin B2 expression
  • KS-SLK cells were stably transfected with HHV-8 LANA, or LANA ⁇ 440 or vGPCR.
  • Western Blot of stable clones revealed a five-fold induction of ephrin B2 in KS-SLK transfected with vGPCR compared to SLK-LANA or SLK- LANA ⁇ 440 (Fig. 16A).
  • SLK transfected with vector alone (pCEFL) was used as a control.
  • SLK-vGPCR and SLK-pCEFL cells were also examined for ephrin B2 and Eph B4 expression by immunofluorescence in transiently transfected KS-SLK cells.
  • Figure 16B shows higher expression of ephrin B2 in the SLK-vGPCR cells compared to SLK-pCEFL.
  • No changes in EphB4 were observed in SLK-vGPCR compared to SLK-pCEFL.
  • SLK-vGPCR cells expressed high levels of ephrin B2 compared to SLK-pCEFL cells.
  • vGPCR of HHV-8 is directly involved in the induction of Ephrin B2 and the arterial phenotype switch in KS. Since we had shown that HHV-8 induced expression of ephrin B2 in HUVEC, we next asked if this could be mediated by a transcriptional effect.
  • Ephrin B2 5 '-flanking DNA-luciferase reporter plasmids were constructed and transiently transfected into HUVECs. Ephrin B2 5 '-flanking DNA sequences -2491/-11 have minimal activity in HUVEC cells ( Figure 16C). This is consistent with ephrin B2 being an arterial, not venous marker. However, we have noted that HUVEC in culture do express some ephrin B2 at the RNA level. Cotransfection of HHV-8 vGPCR induces ephrin B2 transcription approximately 10-fold compared to the control expression vector pCEFL.
  • Figure 17 shows expression of EphB4 in bladder cancer cell lines (A), and regulation of EphB4 expression by EGFR signaling pathway (B).
  • Example 6 Production of Soluble EphB4 Polypeptides 1) Mammalian expression vectors for producing recombinant soluble derivatives of Ephrin B2 and Eph B4.
  • a vector comprising a human EphB4 (hB4) cDNA comprising the full length ORF was amplified by PCR out with primers: GGATCCgccATGGAGCTCCGGGTGCTGCT (5Bam-hB4) and GCGGCCGCTCAGTACTGCGGGGCCGGT (3Notl -B4), and cloned in BamHI-Notl cut pRK5 vector.
  • EphB4 were based on pEF6/V5-His-TOPO vector (Invitrogen), pIG (Novagen) or pRK5.
  • pEF6/V5-His-TOPO contains human elongation factor l ⁇ enhancer/promoter and blasticidin resistance marker.
  • pIG vector is designed for high-level expression of protein fusions with Fc portion of human IgGl under CMV promoter control and pRK5 is a general purpose CMV promoter-containing mammalian expression vector.
  • pEF6-B4EC-NT cDNA fragment of human EphB4 was amplified by PCR using oligo primers 5'-GGATCCGCC ATGGAGCTC CGGGTGCTGCT-3' and 5'-TGGATCCCT GCTCCCGC CAGCCCTCG CTCTCATCCA-3', and TOPO-cloned into pEF6/V5-His- TOPO vector.
  • pEF6-hB4ECv3 was derived from pEF6-B4ECNT by digesting the plasmid DNA with EcoRV and BstBI, filling-in the ends with Klenow enzyme and religating the vector.
  • EphB4 derivative encoded by pEF6-B4EC-NT does not contain epitope- or purification tags, while the similar B4ECv3 protein encoded by pEF6-hB4ECv3 contains V5 epitope tag and 6xHis tag on its C-terminus to facilitate purification from conditioned media.
  • Plasmid construct pEF6-hB2EC was created by PCR amplification of Ephrin B2 cDNA using oligo primers 5 '- TGGATCCAC CATGGCTGT GAGAAGGGAC- 3' plus 5'-ATTAATGGTGATGGT GAT GATGACTAC CCACTTCGG AACCGAGGAT GTTGTTC-3' and TOPO-cloning into pEF6/V5-His-TOPO vector.
  • Plasmid construct pIG- hB2EC-FC was created by PCR amplification of Ephrin B2 cDNA with oligo primers 5'- TAAAGCTTCCGCCATGG CTGTGAGAAGGGAC-3' and 5'-TAGGATCCACTTCGGA ACCGAGGATGTTGTT CCC-3 ', followed by TOPO-cloning and sequencing the resulting PCR fragment with consecutive subcloning in pIG hlgGl Fc fusion expression vector cut with Bam HI and Hind III.
  • pIG-hB2EC and pIG-hB4ECv3 were generated by PCR amplifying portions of EphB4 ECD cDNA using oligo primers 5'-ATAAGCTTCC GCCATGGAGC TCCGGGTGCTG-3' plus 5'-TTGGATCCTGCTCCCG CCAGCCCTCGC TCTCATC-3' with consecutive subcloning into pIG hlgGl Fc fusion expression vector cut with Bam HI and Hind III. Predicted sequences of the proteins encoded by the vectors described above.
  • 5SpeB4 TACTAGTCCGCCATGGAGCTCCGGGTGCTGCT 3NotB4GC gcggccgcttaatggtgatggtgatgatgAGCCGAAGGAGGGGTGGTGCA
  • the amplified portion was cloned by TA cloning into pEF6. Sequence of the cloned fragment (Spel-Notl fragment): actagtccgccATGGAGCTCCGGGTGCTGCTCTGCTGGGCTTCGTTGGCCGCAGCTTTG GAAGAGACCCTGCTGAACACAAAATTGGAAACTGCTGATCTGAAGTGGGTGAC ATTCCCTCAGGTGGACGGGCAGTGGGAGGAACTGAGCGGCCTGGATGAGGAAC AGCACAGCGTGCACCTACGAAGTGTGAAGTGCAGCGTGCCCCGGGCCAG GCCCACTGGCTTCGCACAGGTTGGGTCCCACGGCGGGGCGCCGTCCACGTGTAC GCCACGCTGCGCTTCACCATGCTCGAGTGCCTGTCCCTCGGGCTGGGCGC TCCTGCAAGGAGACCTTCACCGTCTTCTACTATGAGAGCGATGCGGACACGGCC ACGGCCCTCACGCCAGCCTGGATGGAACCCCTACATCAAG
  • the sequence of the Globular domain + Cys-rich domain (B4EC-GC), precursor protein is:
  • the leader sequence first 15 amino acids, so that the processed form begins Leu-Glu-Glu
  • the c-terminal hexahistidine tag may be removed or omitted.
  • the plasmid for the GC protein has the sequence: AATATTATTGAAGCATTTATCAGGGTTATTGTCTCATGAGCGGATACATA TTTGAATGTATTTAGAAAAATAAACAAATAGGGGTTCCGCGCACATTTCCCCGA AAAGTGCCACCTGACGTCGACGGATCGGGATCTCCCCTATGGTCGA CTCTCAGTACAATCTGCTCTGATGCCGCATAGTTAAGCCAGTATCTGCTCCCTGC TTGTGTTGGAGGTCGCTGAGTAGTGCGCGAGCAAAATTTAAGCTACAACAAG GCAAGGCTTGACCGACAATTGCATGAAGAATCTGCTTAGGGTTAGGCGTTTTGC GCTGCTTCGCGATGTACGGGCCAGATATACGCGTTGACATTGATTATTGACTAG GCTTTTGCAAAAAGCTTTGCAAAGATGGATAAAGTTTTAAACAGAGAGGAATCT TTGCAGCTAATGGACCTTCTAGGTCTTGAAAGGAGTCTCGTGAGGCTCCGGT GCCCG
  • a nucleic acid encoding truncated human EphB4 protein comprising the globular domain, Cys-rich domain and the first FNIII domain (GCF) was prepared by PCR with oligonucleotides:
  • the leader sequence first 15 amino acids, so that the processed form begins Leu-Glu-Glu
  • the c-terminal hexahistidine tag may be removed or omitted.
  • a vector encoding truncated human EphB4 protein having the Globular, Cys-rich and two FNIII domains with a c-terminal tag, GCF2 was derived from pEF6-FL- hB4EC by digesting with EcoRV and BstBI, treating with Klenow and religating.
  • the leader sequence first 15 amino acids, so that the processed form begins Leu-Glu-Glu
  • the c-terminal hexahistidine tag may be removed or omitted.
  • Plasmid DNA sequence aatattattgaagcatttatcagggttattgtctcatgagcggatacatatttgaatgtatttagaaaaataacaataggggt tccgcgcacatttccccgaaaagtgccacctgacgtcgacggatcgggagatctcccgatccctatggtcgactctcagtacaatct gctgatgccgcatagttaagccagtatctgctccctgcttgtgtgtggaggtcgctgagtagtgcgcgcgagcaaaggcaaggcttgaccgacaattgcatgaagaatctgcttagggttaggcgttttgcgcgcgcgaagaatctgcttagggttagg
  • a vector encoding a truncated human EphB4 protein having the normal leader sequence followed by the Cys-rich and two FNIII domains (CF2) was prepared by deleting the globular domain. Overlap PCR was performed with oligonucleotides designed to delete G: Fragment 1: 5 '-primer - 5SpeB4
  • a vector encoding a preferred GCF2 truncated protein, lacking any c-terminal tags, such as a hexahistidine tag was derived from pEF6-B4ECv3-V5-His by re-amplifying the 3' (C-terminal) part of B4ECv3 to eliminate V5 and His tags ands subcloning back into pEF6- B4ECv3-V5-His.
  • B4ECv3FIN (tgtttaaacTTACTGCTCCCGCCAGCCCTCGCTCTCATCCAGTT).
  • GCF2F is:
  • the processed sequence is:
  • GPSPSLYCREDGQWAEQPVTGCSCAPGFEAAEGNTKCRACAQGTFKPLSGEGSCQP CPANSHSNTIGSAVCQCRVGYFRARTDPRGAPCTTPPSAPRSVVSRLNGSSLHLEWS APLESGGREDLTYALRCRECRPGGSCAPCGGDLTFDPGPRDLVEPWVWRGLRPDF TYTFEVTALNGVSSLATGPVPFEPVNVTTDREVPPAVSDIRVTRSSPSSLSLAWAVPR APSGAWLDYEVKYHEKGAEGPSSVRFLKTSENRAELRGLKRGASYLVQVRARSEA GYGPFGQEHHSQTQLDESEGWREQ
  • HEK293T human embryonic kidney line
  • DMEM fetal calf serum
  • l% penicillin/streptomycin/neomycin antibiotics were maintained at 37 0 C in a humidified atmosphere of 5% CO 2 /95% air.
  • Transfections were performed using Lipofectamine 2000 reagent (Invitrogen) according to the manufacturer's protocol.
  • 293T cells were seeded at a high density to reach 80% confluence at the time of transfection. Plasmid DNA and Lipofectamine reagent at 1 :3 ratio were diluted in Opti-MEM I reduced serum medium
  • Lipofectamine complex For each 10 cm culture dish, 10 ⁇ g of plasmid DNA was used. After 20 min, above complex was added directly to cells in culture medium. After 16 hours of transfection, medium was aspirated, washed once with serum free DMEM and replaced with serum free DMEM. Secreted proteins were harvested after 48 hours by collecting conditional medium.
  • Conditional medium was clarified by centrifugation at 10,000 g for 20 min, filtered through 0.2 ⁇ m filter and used for purification.
  • HEK293 or HEK293T cells were transfected with either pEF6-B4ECv3 or pEF6-B4EC-NT plasmid constructs as described above and selected using antibiotic Blasticidin. After 24 hours of transfection, cells were seeded at low density. Next day, cells were treated with 10 ⁇ g/ml of Blasticidin. After two weeks of drug selection, surviving cells were pooled and selected further for single cell clone expansion. After establishing stable cells, they were maintained at 4 ⁇ g/ml Blasticidin. Conditioned media were tested to confirm expression and secretion of the respective recombinant proteins. Specificity of expression was confirmed by Western blot with anti-B4 monoclonal or polyclonal antibodies and B2EC-AP reagent binding and competition assays.
  • HEK293 cells were transiently transfected with a plasmid encoding secreted form of EphB4ectodomain (B4ECv3).
  • Conditional media was harvested and supplemented with 10 mM imidazole, 0.3 M NaCl and centrifuged at 20,00Og for 30 min to remove cell debris and insoluble particles. 80 ml of obtained supernatant were applied onto the pre-equilibrated column with 1 ml of Ni-NT A-agarose (Qiagen) at the flow rate of 10 ml/h.
  • B4EC-FC protein and B2EC-FC protein were similarly purified.
  • Generation of an EphB4-Serum Albumin fusion protein :
  • Human serum albumin fragment in Xbal-Notl form was PCRed out for creating fusion with GCF2 to extend GCF2 half-life and TA-cloned in pEF6.
  • the resulting vector was cut with Xba I (partial digestion) and the HSA fragment (1.8 kb) was cloned into Xba I site of pEF6-GCF2-Xba to create fusion expression vector.
  • the resulting vector had a point mutation C to T leading to Thr to He substitution in position 4 of the mature protein. It was called pEF6-GCF2-HSAmut.
  • the mature form of the HS A-EphB4 protein is as follows
  • the DNA sequence of the pEF6-GCF2 is as follows: aatattattgaagcatttatcagggttattgtctcatgagcggatacatatttgaatgtatttagaaaaataacaaataggggttccgcgc acatttccccgaaaagtgccacctgacgtcgacggatcgggagatctcccccctatggtcgactctcagtacaatctgctctgat gccgcatagttaagccagtatctgctccctgcttgtgtgtggaggtcgctgagtagtgcgcgcgagcaaatttaagctacaaggc aggc aggc aggc aaggc aaggc aaggc aagg
  • the human embryonic kidney cell line, 293T cells, were maintained in DMEM with 10% dialyzed fetal calf serum and 1% penicillin/streptomycin/neomycin antibiotics. Cells were maintained at 37 0 C in a humidified atmosphere of 5% CO2/95% air.
  • the EphB4 ectodomain fused to HSA was purified as follows: 700 ml of media was harvested from transiently transfected 293 cells grown in serum free media and concentrated up to final volume of 120 ml. Membrane: (Omega, 76 mm), 50 kDa C/O. After concentration, pH of the sample was adjusted by adding 6 ml of IM NaAc, pH 5.5. Then sample was dialyzed against starting buffer (SB): 20 mM NaAc, 20 mM NaCl, pH 5.5 for O/N. 5 ml of SP-Sepharose was equilibrated with SB and sample was loaded. Washing: 100 ml of SB. Elution by NaCl: 12 ml/fraction and increment of 20 mM. Most of the EphrinB2 binding activity eluted in the 10OmM and 12OmM fractions.
  • Fractions, active in EphrinB2 binding assay See SP chromatography, fractions # 100-120 mM) were used in second step of purification on Q-column. Pulled fractions were dialyzed against starting buffer#2 (SB2): 20 mM Tris-HCl, 20 mM NaCl, pH 8 for O/N and loaded onto 2 ml of Q-Sepharose. After washing with 20 ml of SB2, absorbed protein was eluted by NaCl: 3 ml/fraction with concentrational increment of 25 mM. Obtained fractions were analyzed by PAGE and in Ephrin-B2 binding assay. The 200 mM and 225 mM fractions were found to contain the most protein and the most B2 binding activity.
  • Soluble EphB4 ectodomain protein was purified as follows: 300 ml of conditional medium (see: Cell culture and transfections) were concentrated up to final volume of 100 ml, using ultrafiltration membrane with 30 kDa C/O. After concentration, pH of the sample was adjusted by adding 5 ml of 1 M Na-Acetate, pH 5.5. Then sample was dialyzed against starting buffer (StB): 20 mM Na-Acetate, 20 mM NaCl, pH 5.5 for O/N. 5 ml of SP- Sepharose was equilibrated with StB and sample was loaded. After washing the column with 20 ml of StB, absorbed proteins were eluted by linear gradient of concentration of

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Analytical Chemistry (AREA)
  • Pathology (AREA)
  • General Health & Medical Sciences (AREA)
  • Physics & Mathematics (AREA)
  • Hematology (AREA)
  • Urology & Nephrology (AREA)
  • Biomedical Technology (AREA)
  • Biochemistry (AREA)
  • Zoology (AREA)
  • Genetics & Genomics (AREA)
  • Wood Science & Technology (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • Medicinal Chemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • General Physics & Mathematics (AREA)
  • Food Science & Technology (AREA)
  • Biophysics (AREA)
  • Hospice & Palliative Care (AREA)
  • Cell Biology (AREA)
  • Oncology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
PCT/US2005/034179 2004-09-23 2005-09-23 Compositions and methods for detecting and treating tumors Ceased WO2006034456A2 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
EP05816052A EP1799867A2 (en) 2004-09-23 2005-09-23 Compositions and methods for detecting and treating tumors
AU2005286663A AU2005286663A1 (en) 2004-09-23 2005-09-23 Compositions and methods for detecting and treating tumors
CA002581430A CA2581430A1 (en) 2004-09-23 2005-09-23 Compositions and methods for detecting and treating tumors
JP2007533654A JP2008514925A (ja) 2004-09-23 2005-09-23 腫瘍を検出し且つ治療するための組成物及び方法

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US61286104P 2004-09-23 2004-09-23
US60/612,861 2004-09-23

Publications (2)

Publication Number Publication Date
WO2006034456A2 true WO2006034456A2 (en) 2006-03-30
WO2006034456A3 WO2006034456A3 (en) 2006-08-10

Family

ID=36090700

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2005/034179 Ceased WO2006034456A2 (en) 2004-09-23 2005-09-23 Compositions and methods for detecting and treating tumors

Country Status (6)

Country Link
US (1) US20060194220A1 (https=)
EP (1) EP1799867A2 (https=)
JP (1) JP2008514925A (https=)
AU (1) AU2005286663A1 (https=)
CA (1) CA2581430A1 (https=)
WO (1) WO2006034456A2 (https=)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2008289456A (ja) * 2006-06-16 2008-12-04 Sysmex Corp がん細胞の検出方法及び装置
EP2109690B1 (en) * 2007-11-29 2012-04-18 MOLECULAR HEALTH GmbH Eph-b4 specific sirna for reducing epo-induced tumor cell growth during anemia treatment in cancer patients, tissue protective erythropoietin receptor (nepor) and methods of use.
US8357501B2 (en) 2007-11-29 2013-01-22 Molecular Health Gmbh Tissue protective erythropoietin receptor (NEPOR) and methods of use
EP4105328A1 (en) * 2021-06-15 2022-12-21 Max-Planck-Gesellschaft zur Förderung der Wissenschaften e.V. Antisense-oligonucleotides for prevention of kidney dysfunction promoted by endothelial dysfunction by ephrin-b2 suppression

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20070218061A1 (en) * 2005-09-23 2007-09-20 Vasgene Therapeutics, Inc. Use of ephrinb2 directed agents for the treatment or prevention of viral infections
US20070292882A1 (en) * 2006-06-16 2007-12-20 Sysmex Corporation Method and apparatus for detecting cancer cell
US7662566B2 (en) * 2006-11-22 2010-02-16 Myriad Genetics, Inc. Gene copy number profiling
JP5610125B2 (ja) * 2010-02-22 2014-10-22 国立大学法人 長崎大学 癌転移の検出方法および検出用キット
GB201616640D0 (en) * 2016-09-30 2016-11-16 Sarphie David And Mian Rubina Monitoring cancer recurrence and progression
ES2832880T3 (es) * 2017-06-08 2021-06-11 Lumito Ab Un método de análisis de una muestra para al menos un analito
US12020493B2 (en) 2018-07-27 2024-06-25 Ventana Medical Systems, Inc. Systems for automated in situ hybridization analysis
JP7464977B2 (ja) * 2020-06-10 2024-04-10 国立大学法人東京農工大学 イヌ中皮腫細胞株

Family Cites Families (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5530101A (en) * 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US6331302B1 (en) * 1992-01-22 2001-12-18 Genentech, Inc. Protein tyrosine kinase agonist antibodies
US5635177A (en) * 1992-01-22 1997-06-03 Genentech, Inc. Protein tyrosine kinase agonist antibodies
US6303769B1 (en) * 1994-07-08 2001-10-16 Immunex Corporation Lerk-5 dna
US5864020A (en) * 1994-07-20 1999-01-26 Genentech, Inc. HTK ligand
US6346398B1 (en) * 1995-10-26 2002-02-12 Ribozyme Pharmaceuticals, Inc. Method and reagent for the treatment of diseases or conditions related to levels of vascular endothelial growth factor receptor
CA2259157A1 (en) * 1996-07-05 1998-01-15 Mount Sinai Hospital Corporation Oligomerized receptors which affect pathways regulated by transmembrane ligands for elk-related receptor tyrosine kinases
ATE293989T1 (de) * 1998-11-20 2005-05-15 Genentech Inc Verwendung von eph-rezeptor-antagonisten und agonisten zur behandlung von vaskulären krankheiten
US6150162A (en) * 1998-12-17 2000-11-21 Isis Pharmaceuticals Inc. Antisense modulation of CD44 expression
US6770633B1 (en) * 1999-10-26 2004-08-03 Immusol, Inc. Ribozyme therapy for the treatment of proliferative skin and eye diseases
US6271030B1 (en) * 2000-06-14 2001-08-07 Isis Pharmaceuticals, Inc. Antisense inhibition of C/EBP beta expression
US6277640B1 (en) * 2000-07-31 2001-08-21 Isis Pharmaceuticals, Inc. Antisense modulation of Her-3 expression
US6812339B1 (en) * 2000-09-08 2004-11-02 Applera Corporation Polymorphisms in known genes associated with human disease, methods of detection and uses thereof
WO2003004057A1 (en) * 2001-07-03 2003-01-16 The Hospital For Sick Children Ephrin and eph receptor mediated immune modulation
US20040110150A1 (en) * 2002-12-10 2004-06-10 Isis Pharmaceuticals Inc. Modulation of Ephrin-B2 expression
AU2002951409A0 (en) * 2002-09-16 2002-09-26 North Western Adelaide Health Services Methods for regulating cancer
AU2003295600A1 (en) * 2002-11-14 2004-06-15 Dharmacon, Inc. Functional and hyperfunctional sirna
EP1606305A4 (en) * 2003-03-12 2009-06-24 Vasgene Therapeutics Inc NUCLEIC ACID COMPOUNDS FOR THE INHIBITION OF ANGIOGENESIS AND TUMOR GROWTH

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2008289456A (ja) * 2006-06-16 2008-12-04 Sysmex Corp がん細胞の検出方法及び装置
EP2109690B1 (en) * 2007-11-29 2012-04-18 MOLECULAR HEALTH GmbH Eph-b4 specific sirna for reducing epo-induced tumor cell growth during anemia treatment in cancer patients, tissue protective erythropoietin receptor (nepor) and methods of use.
EP2492355A1 (en) * 2007-11-29 2012-08-29 Life Biosystems GmbH Tissue protective erythropoietin receptor (nepor) and methods of use
US8357501B2 (en) 2007-11-29 2013-01-22 Molecular Health Gmbh Tissue protective erythropoietin receptor (NEPOR) and methods of use
EP2960341A1 (en) * 2007-11-29 2015-12-30 Molecular Health GmbH Novel tissue protective erythropoietin receptor (nepor) and methods of use
EP4105328A1 (en) * 2021-06-15 2022-12-21 Max-Planck-Gesellschaft zur Förderung der Wissenschaften e.V. Antisense-oligonucleotides for prevention of kidney dysfunction promoted by endothelial dysfunction by ephrin-b2 suppression
WO2022263569A1 (en) * 2021-06-15 2022-12-22 MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. Antisense-oligonucleotides for prevention of kidney dysfunction promoted by endothelial dysfunction by ephrin-b2 suppression

Also Published As

Publication number Publication date
EP1799867A2 (en) 2007-06-27
WO2006034456A3 (en) 2006-08-10
US20060194220A1 (en) 2006-08-31
AU2005286663A1 (en) 2006-03-30
JP2008514925A (ja) 2008-05-08
CA2581430A1 (en) 2006-03-30

Similar Documents

Publication Publication Date Title
EP0821733B1 (en) Genetic markers for breast and ovarian cancer
US9458508B2 (en) Methods and compositions for the diagnosis and treatment of cancer resistant to anaplastic lymphoma kinase (ALK) kinase inhibitors
US7507532B2 (en) Cancer specific gene MH15
KR102240323B1 (ko) 유방암 전이의 진단, 예후 및 치료 방법
US8273858B2 (en) Polypeptide compounds for inhibiting angiogenesis and tumor growth
JPWO2015012397A1 (ja) Ntrk3融合体の検出法
US20060194220A1 (en) Compositions and methods for detecting and treating tumors
EP0889959B1 (en) Partial intron sequence of von hippel-lindau (vhl) disease gene and its use in diagnosis of disease
JP2010526029A (ja) がんを処置し、診断し、そして検出するためのfxyd5調節剤
Dmitrenko et al. Reduction of the transcription level of the mitochondrial genome in human glioblastoma
CA2506737C (en) Methods and kits for diagnosing and treating b-cell chronic lymphocytic leukemia (b-cll)
EP2148932B1 (en) Sox11 expression in malignant lymphomas
Kavsan et al. Characterization of genes with increased expression in human glioblastomas.
MX2012012735A (es) Deteccion y modulacion de formacion de vasos linfaticos mediados por la proteina slit y roundabount (robo), y usos de los mismos.
Armstrong et al. FLT4 receptor tyrosine kinase gene mapping to chromosome band 5q35 in relation to the t (2; 5), t (5; 6), and t (3; 5) translocations
WO2007098093A2 (en) Compositions and methods of use for modulators of polypeptides and polynucleotides in treating breast cancer and melanoma
US20070128595A1 (en) Novel polynucleotide and polypeptide sequences and uses thereof
JP6806440B2 (ja) 新規融合体及びその検出法
AU2007216790A1 (en) Methods and kits for diagnosing and treating B-cell chronic lymphocytic leukemia (B-CLL)

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A2

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KM KP KR KZ LC LK LR LS LT LU LV LY MA MD MG MK MN MW MX MZ NA NG NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SM SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW

AL Designated countries for regional patents

Kind code of ref document: A2

Designated state(s): BW GH GM KE LS MW MZ NA SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LT LU LV MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG

WWE Wipo information: entry into national phase

Ref document number: 2581430

Country of ref document: CA

Ref document number: 2007533654

Country of ref document: JP

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2005286663

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2005816052

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2005286663

Country of ref document: AU

Date of ref document: 20050923

Kind code of ref document: A

121 Ep: the epo has been informed by wipo that ep was designated in this application
WWP Wipo information: published in national office

Ref document number: 2005816052

Country of ref document: EP