WO2005026733A1 - Method and device for detecting feline immunodeficiency virus - Google Patents
Method and device for detecting feline immunodeficiency virus Download PDFInfo
- Publication number
- WO2005026733A1 WO2005026733A1 PCT/US2004/029570 US2004029570W WO2005026733A1 WO 2005026733 A1 WO2005026733 A1 WO 2005026733A1 US 2004029570 W US2004029570 W US 2004029570W WO 2005026733 A1 WO2005026733 A1 WO 2005026733A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- fiv
- seq
- polypeptide
- vaccinated
- infected
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56983—Viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56983—Viruses
- G01N33/56988—HIV or HTLV
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/15011—Lentivirus, not HIV, e.g. FIV, SIV
- C12N2740/15022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/005—Assays involving biological materials from specific organisms or of a specific nature from viruses
- G01N2333/08—RNA viruses
- G01N2333/15—Retroviridae, e.g. bovine leukaemia virus, feline leukaemia virus, feline leukaemia virus, human T-cell leukaemia-lymphoma virus
- G01N2333/155—Lentiviridae, e.g. visna-maedi virus, equine infectious virus, FIV, SIV
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2469/00—Immunoassays for the detection of microorganisms
- G01N2469/20—Detection of antibodies in sample from host which are directed against antigens from microorganisms
Definitions
- the invention is related to the detection of antibodies directed to Feline Immunodeficiency Virus.
- Feline immunodeficiency virus formerly called feline T- lymphotrophic lentivirus
- FIV infects cats to produce an AIDS-like syndrome.
- FIV is morphologically and pathologically similar to the human immunodeficiency virus (HIV), it has been shown to be antigenically distinct from HIV.
- a cat Like HIV, once a cat becomes infected with FIV, the disease progresses from a primary infection (viraemia, fever, general lymphadenitis) to a lengthy asymptomatic phase, followed by severe impairment in immune function caused by a reduction in CD4 lymphocytes, and resulting in heightened susceptibility to secondary infections and ultimately death.
- a primary infection viralemia, fever, general lymphadenitis
- a lengthy asymptomatic phase followed by severe impairment in immune function caused by a reduction in CD4 lymphocytes, and resulting in heightened susceptibility to secondary infections and ultimately death.
- FIV has been classified as a member of the subfamily Lentiviridae in the family Retroviridae, the family that includes human and simian immunodeficiency viruses, equine infectious anaemia, maedi visna of sheep and caprinearthritis encephalitis viruses (CAEV).
- the genome of FIV is organized like other lentiviruses with three long open reading frames corresponding to gag,pol and env (Talbott et al., Proc. Nati Acad. Sci. (1989) 86:5743; Olmsted et al, Proc. Nail. Acad. Sci. (1989) 86:2448).
- the gag gene codes for the major structural components ofthe virus
- the env gene codes for the envelope glycoprotein
- the pol gene codes for the polymerase protein.
- the gag gene is expressed as a 55 kD polyprotein that is processed into three subunits: a pi 5 matrix protein, a p24 capsid protein, and a plO nucleocapsid protein.
- the pol gene encodes three proteins: the protease, reverse transcriptase and a pl4.6 protein of unknown function. Autoprocessing by the protease portion of the gene gives rise to all three proteins of the pol region. Additionally, the protease is responsible for the processing ofthe gag precursor.
- the pol gene is expressed as a gag-pol fusion protein.
- the envelope gene is expressed as a 160 kD glycoprotein, gpl60. The antigenicity ofthe FIV core proteins is similar to other lentiviruses.
- the virus replicates optima-lly in blood mononuclear cells and has a tropism for T-lymphocytes, peritoneal macrophage, brain macrophage and astrocytes.
- the genetic material of FIV is composed of RNA and the production of a DNA copy ofthe viral RNA is an essential step in the replication of FIV in the host. This step requires the enzyme reverse transcriptase that is carried into the host by the invading virus.
- the DNA version ofthe viral genome is inserted into the genetic material of infected host cells in which it continues to reside as a provirus. This provirus is replicated every time the cell divides and can code for the production of new virus particles. Cells infected with FIV remain infected for the duration of their lifespan.
- the present invention provides a method for determining whether a felid has been vaccinated against FIV or is naturally infected with FIV by determining the felid's immune response to an FIV polypeptide, such as an FIV env polypeptide.
- the invention is directed to a method of distinguishing among animals that have been naturally infected with FIV versus animals that have not been infected or have been vaccinated against an FIV infection.
- the method includes contacting a biological sample from an animal with a polypeptide that does not substantially bind to an FIV antibody that is a significant component ofthe animal' s immune response to an FTV vaccine.
- FIV antibodies in the sample that substantially bind to the polypeptide are detected. It is determined that the animal is naturally infected by correlating a positive result in the detecting step to a natural infection and it is determined that the animal has been vaccinated or not infected by correlating a negative result to a vaccination or no infection.
- the polypeptide may be derived from FIV env.
- the invention is directed to a method of determining whether a cat has been vaccinated against FIV or is naturally infected with FIV.
- the method includes (a) detecting, before a period a time following vaccination sufficient for certain FIV antigen-specific antibodies raised in response to the vaccine to be not detected, whether the cat has antibodies against an FTV peptide; (b) detecting, after a period of time following vaccination sufficient for certain FIV antigen-specific antibodies raised in response to the vaccine to be not detected, whether the cat has antibodies against an FIV polypeptide; (c) determining that the animal has been vaccinated by detecting antibodies in step a but not in step b, and (d) determining that the animal is naturally infected by detecting antibodies in steps a and b.
- the invention also provides for a method of determining whether a cat has not been infected by FIV or has been vaccinated against FIV.
- the method includes analyzing a biological sample from the cat to detect antibodies against a polypeptide derived from FIV, and determining that the animal has not been infected or has been or vaccinated by not detecting such antibodies.
- the invention provides a method of determining whether or not a cat has been vaccinated for FIV or naturally infected with FIV.
- the method includes providing a test device comprising a polypeptide, obtaining a blood sample from a cat, running the blood sample on the test device, and reading the test device.
- a positive result indicates the cat has been naturally infected with FIV or vaccinated against FIV and a negative result indicates the cat has not been naturally infected with FIV and not vaccinated against FIV.
- the invention is directed to a diagnostic device having a dry porous carrier, a first detection reagent immobilized on the porous carrier where the first detection reagent includes a protein that captures FIV antibodies generated by a host in response to either a natural FIV infection or an FIV vaccination, and a second detection reagent immobilized on the porous carrier wherein the second detection reagent includes a protein that captures FTV antibodies generated by a host in response to a natural FIV infection but does not substantially capture antibodies generated by the host in response to an FIV vaccination.
- the first detection reagent may be FIV pi 5 or p24 antigen
- the second detection reagent may be an FIV env protein.
- the invention is directed to novel FTV polypeptides.
- polypeptide refers to a compound of a single chain or a complex of two or more chains of amino acid residues linked by peptide bonds.
- the chain(s) may be of any length.
- a protein is a polypeptide and the terms are used synonymously. Also included within the scope ofthe invention are functionally equivalent variants and fragments of FIV polypeptides.
- the polypeptide is capable of binding one or more antibodies specific for the polypeptide.
- Polypeptides derived from FIV include any region ofthe ofthe FIV proteome including for example, portions ofthe gag and env regions and mimitopes thereof.
- Examples of a suitable env polypeptides include the following: ELGSNONOFFSKVPPELWKRYNKSKSKSKSKKTRWEWRPDFESEKC [SEQ ID NO:l]
- SEQ ID NO: 1 is a trimeric sequence; the first monomer is the native FIV env sequence, amino acids 696 - 717 with C to S, I to V, L to P, and T to K substitutions; the second monomer (underline) is a KLS linker; the third monomer is the native FIV surface env protein, amino acids 396 — 408 with a C-terminal C addition.
- the length ofthe KS linker is varied from 2- 20 amino acids.
- SEQ ID NO:2 is a trimeric sequence; first monomer is the native FIV env protein, amino acids 396 - 408 with an N-terminal C addition; the second monomer (underline) is a KS linker; the third monomer is native FIV env protein, amino acids 694 - 717, with C to S, I to V, L to P, and T to K su stitutions.
- the length ofthe KS linker is varied from 2-20 amino acids.
- Binding specificity refers to the substantial recognition of a first molecule for a second molecule, for example a polypeptide and a polyclonal or monoclonal antibody, or an antibody fragment (e.g. a Fv, single chain Fv, Fab', or F(ab')2 fragment) specific for the polypeptide.
- a second molecule for example a polypeptide and a polyclonal or monoclonal antibody, or an antibody fragment (e.g. a Fv, single chain Fv, Fab', or F(ab')2 fragment) specific for the polypeptide.
- substantially bind refers to an amount of specific binding or recognizing between molecules in an assay mixture under particular assay conditions.
- substantial binding relates to the difference between a first molecule's incapability of binding or recognizing a second molecule, and the first molecules capability of binding or recognizing a third molecule, such that the difference is sufficient to allow a meaningful assay to be conducted distinguishing specific binding under a particular set of assay conditions, which includes the relative concentrations ofthe molecules, and the time and temperature of an incubation.
- one molecule is substantially incapable of binding or recognizing another molecule in a cross-reactivity sense where the first molecule exhibits a reactivity for a second molecule that is less than 25%, preferably less than 10%, more preferably less than 5% ofthe reactivity exhibited toward a third molecule under a particular set of assay conditions, which includes the relative concentration and incubation ofthe molecules.
- Specific binding can be tested using a number of widely known methods, e.g, an immunohistochemical assay, an enzyme-linked immunosorbent assay (ELISA), a radioimmunoassay (RIA), or a western blot assay.
- felids Animals infected with FIV are felids, which is to be understood to include all members ofthe order Felidae, including domestic cats, lions, tigers, jaguars, leopards, puma, ocelots, etc.
- felid cat or "animal” is a reference to all felids.
- a “biological sample” refers to a sample from an animal subject including saliva, whole blood, serum, plasma or other sample known to contain FIV antibodies
- an "antibody that is a significant component of an animal's immune response to a FIV vaccine” refers to an antibody that is elicited as the result of a vaccination with a FIV vaccine. These antibodies may be identical to or similar to antibodies elicited as the result of a natural FIV infection. A successful vaccination produces a measurable level ofthe antibody that is a significant component ofthe FIV vaccine.
- Vaccines for FIV are described, for example, in U.S. Patents 6,667,295, 5,833,993, 6,447,993, 6,254,872 and 6,544,528, and published U.S. Patent Application 20040096460, each of which is incorporated herein by reference in their entirety.
- U.S. patents 6,447,993 and 6,254,872 describe vaccines that are prepared from cell free-viral isolates of different FIV subtypes or a combination of cell lines each infected with different prototype FIV virus from a different subtype.
- U.S. Patent 5,833,933 describes vaccines containing DNA sequences encoding FIV gag protein and FTV env protein. These vaccines include an expression system for expressing the sequences.
- One available vaccine is FEL-O-VAX® FIV (Fort Dodge Animal Health, Overland Park, Kansas).
- the invention provides for a method of distinguishing between animals that have been naturally infected with FIV and animals that have not been infected or have been vaccinated against an FIV infection.
- the method includes contacting a biological sample from the animal with a polypeptide derived from an FIV that does not substantially bind to an antibody that is a significant component of the animal' s antibody response to an FIV vaccine.
- the invention includes a method of determining whether a cat has not been infected by FIV and has not been vaccinated against FIV.
- a biological sample from a cat is analyzed to detect antibodies against a polypeptide, derived from FIV env and/or gag. It is then determined that the animal has not been infected and has not been or vaccinated by determining the absence of such antibodies.
- an animal may temporarily (transiently) produce lower levels of certain antibodies to specific FIV polypeptides that are elements of a vaccine, as compared to those produced in response to a natural infection.
- FIV antibodies in an animal against a vaccine is dependent upon the vaccine. For example, it has been found that animals test seropositive for FPV antibodies against p24 (gag) about two to four weeks after vaccination with the FEL-O-VAX® vaccine. However, animals so vaccinated do not generate persistent levels of antibodies against one or more regions ofthe env protein, even though this protein was included as an element ofthe vaccine. In contrast, naturally infected animals typically generate persistent levels of antibodies to both FIV gag and env proteins.
- the differences in the immune response between animals that are vaccinated and animals that are naturally infected provide a means for determining whether an animal has been vaccinated or is naturally infected. " Using the method of the invention, animals that have been naturally infected with FIV can be distinguished from animals that have not been infected or have been vaccinated against an FIV infection. Accordingly, the detection ofthe substantial binding between a polypeptide derived from FIV and an antibody that is not a significant component of an animal's immune response to a vaccine can indicate a natural infection. The relative absence of such binding can indicate vaccination or no infection.
- a second, separate antibody capture reagent can be included in the test that substantially binds to antibodies produced in response to vaccination and/or natural infection, such as pi 5 or p24 proteins.
- various combinations of separate capture reagents can lead to a determination of the vaccination and/or infection status ofthe test subject.
- FIV gag proteins pi 5 and p24 may be irnmunogenic components of a killed whole virus FIV vaccine. It is expected that these components elicit a persistent antibody response when administered to an animal.
- some vaccines may not include immunologically significant quantities of FIV env protein or, this protein has been altered in the process of virus inactivation, or presentation of this protein by vaccination differs from that for natural infection to a point where antibodies produced thereto, if any, are detected for a period of time less than antibodies to pi 5 and p24.
- an animal may transiently produce low levels of such antibodies that bind to env proteins, any such antibody production declines over a period of time and is not detected after about 12 weeks.
- the transiently produced antibodies are not a significant component of he animal's immune response to the vaccine after a period of time.
- the biological sample is obtained from the animal that has not received an FIV vaccine within about the prior 12 weeks. If the vaccination status is unknown and the test indicates infection Chased on a reaction with the antibody capture protein), a retest after an additional 12 weeks can be recommended.
- Differences in the immune response between vaccinated animals and naturally infected animals should be considered in the design of an assay for distinguishing between vaccinated and infected animals. Differences in immune response can be significant such that even after the initial phase following a vaccination, an animal may persistently produce lower levels of antibodies to specific FIV polypeptides, and/or antibodies with different binding properties as compared to those antibodies produced in response to a natural infection.
- the method ofthe invention can be optimized in many ways and one of skill in the art could simultaneously adjust the sample dilutions, reagent concentrations, incubation temperatures and times used in the method to accomplish a differential detection of serum having antibodies to an FIV infection or vaccination. For instance, at optimized sample dilution and other conditions for an immunoassay for antibodies to specific polypeptides, samples from vaccinated animals may, for one specific FIV polypeptide, give a negative assay result and samples from infected animals will give a positive assay result. For a second FIV polypeptide, both samples may give a positive result.
- the proteins are immobilized on a suitable solid support.
- the biological sample is brought into contact with the protein, to which the anti-FIV antibodies bind, if such antibodies are present in the sample.
- the binding may be detected by any suitable means, e.g., enzymes, radionuclides, particulates or fluorescent labels.
- the detection reagent can be associated with a protein that is the same or similar to that which is used to capture anti-FIV antibodies (if present).
- the method is directed to a test device to determine whether a cat has been vaccinated for FIV or naturally infected with FIV.
- a method of using the test device includes providing a test device having an FIV env protein and a separate FIV gag protein. The device can be used to test a biological sample from a cat by contacting the device with the biological sample. Upon reading the device, the detection ofthe binding of an antibody to the gag protein (a positive result on the gag protein) indicates the cat has been naturally infected with FIV or vaccinated against FIV. A concurrent positive result on the env protein indicates natural infection (or, perhaps a transient post vaccination response), while a concurrent negative result on the env protein indicates vaccination.
- gag protein env protein indicates natural infection (or, perhaps a transient post vaccination response), while a concurrent negative result on the env protein indicates vaccination.
- the polypeptides used in the invention contain at least six amino acids, usually at least nine amino acids, and more usually twelve or more amino acids found within one ofthe natural FIV proteins and mimitopes and functionally equivalent variants thereof.
- “Functional equivalent” or “Functionally equivalent” refers to polypeptides related to or derived from the native FIV envelope (env) and viral core (gag) polypeptide sequences where the amino acid sequence has been modified by a single or multiple amino acid substitution, insertion, deletion, and also sequences where the amino acids have been chemically modified, such as amino acid analogs, but which nonetheless retain substantially equivalent function.
- Functionally- equivalent variants may occur as natural biological variations or may be prepared using known techniques such as chemical synthesis, site-directed mutagenesis, random mutagenesis, or enzymatic cleavage and/or ligation of amino acids. Thus, modification ofthe amino-acid sequence to obtain variant sequences may occur so long as the function ofthe polypeptide is not affected.
- FIV functionally-equivalent variants within the scope ofthe invention may comprise conservatively substituted sequences, meaning that one or more amino acid residues ofthe FIV polypeptide are replaced by different residues that do not alter the secondary and/or tertiary structure ofthe FIV polypeptide.
- Such substitutions may include the replacement of an amino acid by a residue having similar physicochemical properties, such as charge density, size, configuration, or hypdrophilicity/hydrophobicity.
- substitutions could include substituting one aliphatic residue (He, Val, Leu, or Ala) for another, or substitution of basic residues Lys and Arg, acidic residues Glu and Asp, amide residues Gin and Asn, hydroxyl residues Ser and Tyr, or aromatic residues Phe and Tyr.
- Conservative variants can generally be identified by modifying a polypeptide sequence ofthe invention and evaluating the antigenic activity ofthe modified polypeptide using, for example, an immunohistochemical assay, an enzyme-linked immunosorbent assay (ELISA), a radioimmunoassay (RIA), or a western blot assay. urther information regarding the making of phenotypically silent amino acid cchanges may be found in Bowie et al, Science 247:1306-1310 (1990).
- Additional variants are also contemplated within the scope ofthe tivention, and such variants include amino and or carboxyl terminal fusions, for xample achieved by addition of amino acid sequences of any number of residues, as veil as intrasequence insertion of one or more amino acids.
- amino acid equences added may be those derived from the whole or parts of other polypeptides >r proteins, or may be those provided in the corresponding positions in the FIV ;nvelope or viral protein. Longer peptides may comprise multiple copies of one or nore ofthe polypeptide sequences.
- nultiple antigen peptides MAPs
- Deletional amino acid sequence variants are those in which one or more amino acid residues are removed from the sequence. Insertional variants exist when one or more amino acids are integrated into a predetermined site in the protein, although random insertion is an option with suitable screening ofthe resulting product. In all cases, these and other FIV variants used retain substantially the same antigenicity ofthe FIV polypeptides. Other variants are also contemplated, including those where the amino acid substitutions are made in the area outside the antibody recognition regions ofthe protein.
- Fusion proteins comprising two or more polypeptide sequences of FIV are also within the scope ofthe invention provided the sequences provide the appropriate antigenicity.
- Such polypeptides will generally correspond to at least one epitope or mimitope that is characteristic of FIV.
- characteristic it is meant that the epitope or mimitope will allow immunologic detection of antibody directed to FIV in a physiological sample with reasonable assurance.
- the epitope or mimitope, variant or fusion protein be immunologically distinct from (i.e., not cross-reactive with antibodies which recognize) viruses other than FIV.
- An antigenically active variant differs by about, for example, 1 , 2, 3, 5, 6, 10, 15 or 20 amino acid residues from SEQ ID NOS: 1 and 2, such as those shown in SEQ ID NOS: 3 - 10, or a fragment thereof. Where this comparison requires alignment the sequences are aligned for maximum homology. Deletions, insertions, substitutions, repeats, inversions or mismatches are considered differences. The differences are, preferably, differences or changes at a non-essential residue or a conservative substitution.
- the site of variation can occur anywhere in the polypeptide, as long as the resulting variant polypeptide is antigenically substantially similar to SEQ ID NOS: 1 and 2, such as, for example, the variations shown in SEQ ID NOS: 3 - 10 (see Tables 3 and 4).
- Exemplary functionally-equivalent variants include those displaying 50% or more amino acid homology. Preferably, such homology is 60%, 70%, or greater than 80%. However, such variants may display a smaller percentage of homology overall and still fall within the scope ofthe invention where they have conserved regions of homology.
- one or more cysteine residues may be added to the termini ofthe polypeptides in order to facilitate specific carrier linkage or to permit disulphide bonding to mimic antigenic loops and thus increase the antigenicity.
- a fatty acid or hydrophobic tail may be added to the peptides to facilitate incorporation into delivery vehicles and to increase antigenicity.
- the invention provides novel polypeptides. These polypeptides may be used, for example, as detection reagents in kits or in vaccines.
- One such polypeptide has the following formula wherein P 1 is a polypeptide that is the native, or an antigenic fragment and functionally-equivalent variant of native FIV env peptides 696-717, and P 2 is a polypeptide that is the native, or an antigenic fragment and functionally-equivalent variant of native FIV env 1 7 1 protein, amino acids 396 ⁇ 408.
- P or P can be inverted.
- P can be, for example, any of SEQ ID NOs.
- P 2 can be, for example, one of NRWEWRPDFESEKC [SEQ ID NO: 16], CNRWEWRPDFESEK [SEQ ID NO:NO: 17], CWEWRPDFESER [SEQ ID NO: 18], and CNRWDWRPDFESKK [SEQ ID NO: 19], where either P 1 and/or P 2 is inverted.
- L 1 is a linker polypeptide consisting of 2-20 alternatively repeating S and K peptides, beginning and ending with either S or K, and where a, c and n may independently be an integer from 1 to 3, and b may be an integer from 0 to 1.
- the FIV polypeptides used as detection reagents may be natural, i.e., including the entire FIV protein or fragments thereof isolated from a natural source, or may be synthetic.
- the natural proteins may be isolated from the whole FIV virus by conventional techniques, such as affinity chromatography.
- Polyclonal or monoclonal antibodies may be used to prepare a suitable affinity column by well-known techniques.
- Proteins that are immunologically cross-reactive with a natural FIV protein can be chemically synthesized. For example, polypeptides having fewer than about 100 amino acids, more usually fewer than about 80 amino acids, and typically fewer than about 50 amino acids, may be synthesized by the well-known Merrif ⁇ eld solid- phase synthesis method where amino acids are sequentially added to a growing chain. Merrifield, 1963, J. Am. Chem. Soc, 85:2149-2156). Recombinant proteins can also be used. These proteins may be produced by expression in cultured cells of recombinant DNA molecules encoding a desired portion ofthe FIV genome. Tbe portion ofthe FIV genome may itself be natural or synthetic, with natural genes obtainable from the isolated virus by conventional techniques.
- RNA the genome of FIV is RNA, and it will be necessary to transcribe the natural RNA into DNA. by conventional techniques employing reverse transcriptase.
- Polynucleotides may also be synthesized by well-known techniques. For example, short single-stranded DNA fragments may be prepared by the phosphoramidite method described by Beaucage and Carruthers, 1981, Tett. Letters 22:1859-1862. Double-stranded fragments may then be obtained either by synthesizing the complementary strand and then annealing the strands together under appropriate conditions, or by adding the complementary strand using DNA polymerase with an appropriate primer sequence.
- the natural or synthetic DNA fragments coding for the desired FIV protein or fragment may be incorporated in a DNA construct capable of introduction to and expression in in vitro cell culture.
- the DNA constructs will be suitable for replication in a unicellular host, such as yeast or bacteria. They may also be intended for introduction and integration within the genome of cultured mammalian or other eukaryotic cells.
- DNA constructs prepared for introduction into bacteria or yeast will include a replication system recognized by the host, the FIV DNA fragment encoding the desired polypeptide product, transcriptional and translational initiation regulatory sequences joined to the 5'-end ofthe FIV DNA termination regulatory sequences joined to the 3 '-end ofthe fragment.
- the transcriptional regulatory sequences will include a heterologous promoter that is recognized by the host.
- a variety of suitable expression vectors are commercially available for a number of hosts.
- the polypeptides are obtained in a substantially pure form, that is, typically from about 50% w/w or more purity, substantially free of interfering proteins and contaminants.
- the FIV polypeptides are isolated or synthesized in a purity of at least 80% w/w, and more preferably, in at least about 95% w/w purity.
- homogeneous polypeptide compositions of at least about 99% w/w purity can be obtained.
- the proteins may be purified by use ofthe antibodies described hereinafter using the immunoabsorbant affinity columns described hereinabove.
- the method of the invention may be accomplished using immunoassay techniques well known to those of skill in the art, including, but not limited to, using microplates and lateral flow devices.
- an FIV protein is immobilized on a solid support at a distinct location. Detection of protein-antibody complexes on the solid support can be by any means known in the art.
- U.S. Patent No. 5,726,010 which is incorporated herein by reference in its entirety, describes an example of a lateral flow device, the SNAP® immunoassay device (IDEXX Laboratories), useful in the present invention.
- Colloidal particle based tests can also be used, such as the commercially available WITNESS® FIV diagnostic test (Synbiotics Corporation, Lyon, France).
- Immobilization of one or more analyte capture reagents, e.g., FIV proteins, onto a device or solid support is performed so that an analyte capture reagent will not be washed away by the sample, diluent and/or wash procedures.
- One or more analyte capture reagents can be attached to a surface by physical adsorption (i.e., without the use of chemical linkers) or by chemical binding (i.e., with the use of chemical linkers). Chemical binding can generate stronger attachment of specific binding substances on a surface and provide defined orientation and conformation ofthe surface-bound molecules.
- Another embodiment ofthe invention provides a device that is suitable for a lateral flow assay.
- a test sample is added to a flow matrix at a first region (a sample application zone).
- the test sample is carried in a fluid flow path by capillary action to a second region ofthe flow matrix where a label capable of binding and forming a first complex with an analyte in the test sample.
- the first complex is carried to a third region ofthe flow matrix where an FIV protein is immobilized at a distinct location.
- a second complex is formed between an immobilized protein and the first complex including the antibody from the sample.
- a first complex comprising a gold sol particle and an FIV protein bound to an FIV antibody will specifically bind and form a second complex with a second immobilized FIV protein or with a second antibody directed to feline antibodies.
- the label that is part ofthe second complex can be directly visualized.
- the invention includes one or more labeled specific binding reagents that can be mixed with a test sample prior to application to a device for ofthe invention. In this case it is not necessary to have labeled specific binding reagents deposited and dried on a specific binding reagent pad in the device.
- a labeled specific binding reagent, whether added to a test sample or pre-deposited on the device, can be for example, a labeled FIV protein that specifically binds an antibody for FIV.
- kits Any or all ofthe above embodiments can be provided as a kit.
- a kit would include a device complete with specific binding reagents (e.g., a non-immobilized labeled specific binding reagent and an immobilized analyte capture reagent) and wash reagent, as well as detector reagent and positive and negative control reagents, if desired or appropriate.
- other additives can be included, such as stabilizers, buffers, and the like.
- the relative amounts ofthe various reagents can be varied, to provide for concentrations in solution ofthe reagents that substantially optimize the sensitivity ofthe assay.
- the reagents can be provided as dry powders, usually lyophilized, which on dissolution will provide for a reagent solution having the appropriate concentrations for combining with a sample.
- An FIV protein can be an immobilized analyte capture reagent in a reaction zone (solid phase).
- a second analyte capture reagent i.e. a second FIV protein, that has been conjugated to a label, can either be added to the sample before the sample is added to the device, or the second analyte capture reagent can be incorporated into the device.
- the labeled specific binding reagent can be deposited and dried on a fluid flow path that provides fluid communication between the sample application zone and the solid phase. Contact ofthe labeled specific binding reagent with the fluid sample results in dissolution ofthe labeled specific binging reagent.
- the device may also include a liquid reagent that transports unbound material (e.g., unreacted fluid sample and unbound specific binding reagents) away from the reaction zone (solid phase).
- a liquid reagent can be a wash reagent and serve only to remove unbound material from the reaction zone, or it can include a detector reagent and serve to both remove unbound material and facilitate analyte detection.
- the detector reagent includes a substrate that produces a detectable signal upon reaction with the enzyme-antibody conjugate at the reactive zone.
- the detector reagent acts merely as a wash solution facilitating detection of complex formation at the reactive zone by washing away unbound labeled reagent.
- Two or more liquid reagents can be present in a device, for example, a device can comprise a liquid reagent that acts as a wash reagent and a liquid reagent that acts as a detector reagent and facilitates analyte detection.
- a liquid reagent can further include a limited quantity of an "inhibitor", t.e., a substance that blocks the development ofthe detectable end product.
- a limited quantity is an amount of inhibitor sufficient to block end product development until most or all excess, unbound material is transported away from the second region, at which time detectable end product is produced.
- Sample testing was accomplished using a SNAP ® ELISA format.
- SNAP ® device technology was used to provide a solid phase with reversible, chromatographic flow of sample, and automatic, sequential flow of wash and enzyme substrate solutions as described in U.S. Patent 5,726,010.
- FIV gag p24 (recombinant) and an FIV env 696- 707 with additional N-terminal cysteine ⁇ CELGCNQNQFFCK [SEQ ID NO:20] - proteins were deposited to form a single antibody capture spot on the solid phase.
- a negative control reagent was deposited to form a negative control spot and a positive control reagent was deposited to form a positive control spot on the solid phase ofthe SNAP ® device.
- the gag or env proteins were chemically conjugated to the enzyme horseradish peroxidase and provided in a solution consisting of a buffer, detergent, and animal serum components.
- Serum samples were combined with either gag or env protein-enzyme conjugate solution, and applied to the SNAP device. Following a short incubation period, the device was activated. Color development on the positive control spot indicated the test was valid. Color development on the sample spot greater than color development on the negative control spot indicated the presence of antigen in the sample and was scored as a positive test result. Test results were determined visually and are shown in Table 1.
- Microplate ELISA analysis was performed on serum samples collected from confirmed FIV negative and infected cats, and cats vaccinated with the FEL-O- VAX® FIV vaccine in an indirect assay format with individual FIV polypeptides on the solid phase and anti-(feline IgG) peroxidase conjugate. Antibodies to FIV env were detected using these peptides as antigen reagents:
- polypeptides were synthesized using a commercial instrument and following the manufacturer's instructions. Polypeptide stocks were prepared at 5 mg/ml in DMSO. The polypeptides were then coated on microplate wells (peptide @ 10 ug/ml in 50 niM Tris-HCl pH 7.4, 100 ul/well). The plates were then blocked/overcoated with 2% Tween-20 / 2.5% sucrose, allowed to dry in mylar bags with desiccant.
- feline serum samples (100 ul/well, diluted 1/1000 in 50% fetal bovine serum) were added to the wells and the plates were incubated for ten minutes at room temperature. Following incubation, the microplates were washed with PBS/Tween. Goat Anti-(cat IgG): ⁇ eroxidase conjugate was added to the wells (100 ul/well anti-catIgG:peroxidase diluted in 50% fetal bovine serum). The plates were incubated for another fifteen minutes at room temperature and washed a second time with PBS/Tween.
- Peroxidase substrate was added (100 ul/well, tetramethyl benzidine peroxidase substrate) and the plates were incubated a third time for ten minutes at room temperature. A hydrofluoric acid stop solution (50 ul/well) was added to the plates. Sample antibody binding was measured by determining peroxidase activity (colored product) with a spectrophotometer (A650 nm). Significant, substantial antibody binding for a sample is considered to be A650nm greater than 0.200. The IDEXX PetChek® Anti-FIV antibody test kit was also run on these samples as a reference test. The results are shown in Table 2.
- Vx SK4 D84 0.031 0.047 0.033 0.048 0.042 0.046 positive
- Vx G1 wk5 0.032 0.111 0.100 0.101 0.114 0.116 positive
- Example 3 Microplate ELISA analysis was performed as in Example 2 on serum samples collected from confirmed FIV negative and infected cats, and cats vaccinated with the FEL-O-VAX® FIV vaccine. Antibodies to FIV env were detected using these peptides as antigen reagents:
- Vx C3520 D35 0.211 0.058 0.142 0.065 0.116 positive
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- Virology (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Biomedical Technology (AREA)
- Biochemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Cell Biology (AREA)
- Pathology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Organic Chemistry (AREA)
- Biotechnology (AREA)
- General Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Microbiology (AREA)
- Physics & Mathematics (AREA)
- Food Science & Technology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- AIDS & HIV (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP04783703A EP1673633B9 (en) | 2003-09-11 | 2004-09-10 | Method for detecting feline immunodeficiency virus |
| DE602004021829T DE602004021829D1 (de) | 2003-09-11 | 2004-09-10 | Verfahren zum nachweis des felinen immunschwächevirus |
| AU2004273076A AU2004273076B2 (en) | 2003-09-11 | 2004-09-10 | Method and device for detecting feline immunodeficiency virus |
| AT04783703T ATE435425T1 (de) | 2003-09-11 | 2004-09-10 | Verfahren zum nachweis des felinen immunschwächevirus |
| JP2006526311A JP2007505320A (ja) | 2003-09-11 | 2004-09-10 | ネコ免疫不全ウイルスの検出のための方法と装置 |
| CA002537429A CA2537429A1 (en) | 2003-09-11 | 2004-09-10 | Method and device for detecting feline immunodeficiency virus |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US50198203P | 2003-09-11 | 2003-09-11 | |
| US60/501,982 | 2003-09-11 | ||
| US58410604P | 2004-06-30 | 2004-06-30 | |
| US60/584,106 | 2004-06-30 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2005026733A1 true WO2005026733A1 (en) | 2005-03-24 |
Family
ID=34316504
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2004/029570 Ceased WO2005026733A1 (en) | 2003-09-11 | 2004-09-10 | Method and device for detecting feline immunodeficiency virus |
Country Status (9)
| Country | Link |
|---|---|
| US (3) | US7776546B2 (enExample) |
| EP (2) | EP1673633B9 (enExample) |
| JP (1) | JP2007505320A (enExample) |
| AT (1) | ATE435425T1 (enExample) |
| AU (1) | AU2004273076B2 (enExample) |
| CA (1) | CA2537429A1 (enExample) |
| DE (1) | DE602004021829D1 (enExample) |
| ES (1) | ES2327340T3 (enExample) |
| WO (1) | WO2005026733A1 (enExample) |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2005062053A3 (en) * | 2003-12-18 | 2005-09-29 | Idexx Lab Inc | Method and device for detecting feline immunodeficiency virus |
| WO2005080939A3 (en) * | 2004-02-19 | 2005-10-06 | Idexx Lab Inc | Method and device for detecting feline immunodeficiency virus |
| WO2006011919A1 (en) * | 2004-06-30 | 2006-02-02 | Idexx Laboratories, Inc. | Method and device for detecting feline immunodeficiency virus |
| WO2006011920A1 (en) * | 2004-06-30 | 2006-02-02 | Idexx Laboratories, Inc. | Method and device for detecting feline immunodeficiency virus (fiv) comprising the use of peptides derived from the v3 region of the fiv env protein |
| WO2006098849A3 (en) * | 2005-03-09 | 2007-04-19 | Idexx Lab Inc | Method and device for detecting feline immunodeficiency virus |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2005335203A1 (en) * | 2004-09-08 | 2007-02-15 | The United States Of America As Represented By The Secretary Of Health And Human Services, Nih | Compositions and methods for the detection of HIV-1/HIV-2 infection |
| EP2553452B1 (en) * | 2010-04-02 | 2015-03-04 | IDEXX Laboratories, Inc. | Detection of feline immunodeficiency virus |
| CN109734783A (zh) * | 2018-12-26 | 2019-05-10 | 杭州爱谨生物科技有限公司 | 一种猫艾滋病毒重组蛋白及其制备方法和应用 |
| JP6976621B1 (ja) * | 2021-02-04 | 2021-12-08 | 株式会社Icst | 検査器具、検査キットおよび検査方法 |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6458528B1 (en) * | 1998-05-15 | 2002-10-01 | Idexx Laboratories, Inc. | Diagnosis of feline immunodeficiency virus infection using ENV/GAG polypeptide markers |
Family Cites Families (47)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4629783A (en) * | 1985-04-29 | 1986-12-16 | Genetic Systems Corporation | Synthetic antigen for the detection of AIDS-related disease |
| US4879212A (en) | 1986-04-02 | 1989-11-07 | United Biomedical Inc. | Peptide composition and method for the detection of antibodies to HTLV-III |
| US5118602A (en) * | 1987-08-26 | 1992-06-02 | The Regents Of The University Of California | Feline T-lymphotropic lentivirus assay |
| CA1341439C (en) | 1987-08-26 | 2003-09-23 | Niels C. Pedersen | Feline t-lymphotropic lentivirus |
| US4900548A (en) * | 1987-11-13 | 1990-02-13 | Harvard University | Use of diethylcarbamazine to enhance antigen-antibody and antigen-host immune cell interactions |
| JPH0211524A (ja) * | 1988-06-29 | 1990-01-16 | Gen Corp:Kk | オーエスキー病ワクチンの製造方法及び該ワクチン接種豚と自然感染豚との識別方法 |
| CA1335880C (en) * | 1988-07-14 | 1995-06-13 | Thomas P. O'connor | Detection of an antibody and antigen in an immunoassay |
| US5219725A (en) | 1988-12-05 | 1993-06-15 | Idexx Laboratories Incorporated | Monoclonal antibodies to feline-t-lymphotropic lentivirus |
| US5177014A (en) | 1988-12-05 | 1993-01-05 | Idexx Laboratories, Inc. | Monoclonal antibodies to feline-T-lymphotropic lentivirus |
| WO1990013573A1 (en) | 1989-05-08 | 1990-11-15 | Idexx Corporation | Polypeptides of feline t-cell lymphotropic lentivirus |
| FR2669338A1 (fr) | 1990-11-21 | 1992-05-22 | Centre Nat Rech Scient | Fragments peptidiques issus de la proteine externe du vif, anticorps antifragments, application de ceux-ci au diagnostic et/ou au traitement de l'immunodeficience feline. |
| US6228608B1 (en) | 1991-02-28 | 2001-05-08 | Aquila Biopharmaceuticals, Inc. | Recombinant FIV glycoprotein 160 and P24 gag protein |
| ATE160358T1 (de) | 1991-06-14 | 1997-12-15 | St Vincents Inst Med Res | Detektion des immunschwäche-virus aus felis |
| WO1993001304A1 (en) | 1991-07-10 | 1993-01-21 | Synbiotics Corporation | Synthetic peptides related to fiv-env proteins |
| US5726010A (en) * | 1991-07-31 | 1998-03-10 | Idexx Laboratories, Inc. | Reversible flow chromatographic binding assay |
| US5736378A (en) | 1991-09-12 | 1998-04-07 | The Scripps Research Institute | Molecular cloning and characterization of the feline immunodeficiency virus isolate PPR |
| EP0577458B1 (fr) | 1992-06-16 | 2004-09-29 | Centre National De La Recherche Scientifique | Séquences nucléotidiques et peptidiques issues de la souche Wo du VIF et applications desdites séquences au diagnostic et à la prévention de l'immunodéficience féline |
| GB9215232D0 (en) | 1992-07-17 | 1992-09-02 | Pitman Moore Inc | Vaccines |
| GB9219936D0 (en) | 1992-09-21 | 1992-11-04 | Pitman Moore Inc | Vaccines |
| US5462852A (en) * | 1992-10-28 | 1995-10-31 | The Government Of The United States Of America, As Represented By The Secretary, Dhhs | HIV Nucleocapsid protein capture assay and method of use |
| DE4242475A1 (de) | 1992-12-16 | 1994-06-23 | Suspa Compart Ag | Führungsbuchse, insbesondere für längenverstellbare Stuhl-Säule und Stuhl-Säule mit derartiger Führungsbuchse |
| JPH07159408A (ja) * | 1993-12-09 | 1995-06-23 | Biseibutsu Kagaku Kenkyusho:Kk | オーエスキー病ウイルス感染抗体識別用抗原 |
| US5576177A (en) | 1994-03-09 | 1996-11-19 | St. Jude Children's Research Hospital | Bioassay for reverse transcriptase inhibitors |
| EP0758396B1 (en) | 1994-04-29 | 2006-07-26 | Pharmacia & Upjohn Company LLC | Feline immunodeficiency virus vaccine |
| FR2721031B1 (fr) | 1994-06-09 | 1996-07-26 | Centre Nat Rech Scient | Fragment peptidique spécifique du virus de l'immunodéficience féline (VIF) et son utilisation comme réactif de diagnostic. |
| ATE331952T1 (de) * | 1994-07-25 | 2006-07-15 | Roche Diagnostics Gmbh | Bestimmung von spezifischem immunglobulin unter verwendung multipler antigene |
| US5675056A (en) | 1995-03-09 | 1997-10-07 | Vance; Murray A. | Incandescent waste disposal system and method |
| FR2732346B1 (fr) | 1995-03-27 | 1997-05-30 | Centre Nat Rech Scient | Proteines mutees, codees par un gene env mute de lentivirus, fragments peptidiques inclus dans lesdites proteines, vecteurs d'expression exprimant lesdites proteines mutees et leurs applications |
| US5849303A (en) | 1995-06-07 | 1998-12-15 | American Home Products Corporation | Recombinant feline Immunodeficiency virus subunit vaccines employing baculoviral-expressed envelope glycoproteins derived from isolate NCSU-1 and their use against feline immunodeficiency virus infection |
| US6300118B1 (en) * | 1995-06-07 | 2001-10-09 | American Home Products Corporation | Plasmids comprising a genetically altered feline immunodeficiency virus genome |
| US5820869A (en) | 1995-06-07 | 1998-10-13 | American Home Products Corporation | Recombinant raccoon pox viruses and their use as an effective vaccine against feline immunodeficiency virus infection |
| BR9610343A (pt) | 1995-08-25 | 1999-12-21 | Univ Florida | Vacinas de subtipos múltiplos para fiv |
| US6254872B1 (en) * | 1995-08-25 | 2001-07-03 | University Of Florida | Multi-subtype FIV vaccines |
| US6077662A (en) | 1996-11-27 | 2000-06-20 | Emory University | Virus-like particles, methods and immunogenic compositions |
| US6331616B1 (en) | 1997-03-05 | 2001-12-18 | North Carolina State University | Nucleic acids obtained from the envelope coding region of feline immunodeficiency virus molecular clone designated JSY3 |
| EP0887412B1 (en) * | 1997-05-26 | 2003-10-15 | Akzo Nobel N.V. | Recombinant birnavirus vaccine |
| FR2769916B1 (fr) | 1997-10-17 | 2000-12-01 | Centre Nat Rech Scient | Peptides issus du gene env du virus de l'immunodeficience feline et leurs applications immunoprotectrices et vaccinales |
| FR2771011B1 (fr) | 1997-11-17 | 2000-01-28 | Hippocampe | Obtention de vaccins destines a prevenir les effets pathogenes associes a une infection retrovirale |
| DE1035780T1 (de) | 1997-12-05 | 2001-02-08 | University Of New Mexico, Albuquerque | Verfahren zur reinigung von hitze-schock peptidkomplexen |
| US6284253B1 (en) | 1998-01-29 | 2001-09-04 | Cornell Research Foundation, Inc. | Feline immunodeficiency virus (FIV) nucleotide sequence |
| US6764676B1 (en) | 1998-08-24 | 2004-07-20 | Pfizer Inc. | Compositions and methods for protecting animals from lentivirus-associated disease such as feline immunodeficiency virus |
| EP1074625A3 (en) * | 1999-06-14 | 2002-01-02 | Pfizer Products Inc. | DNA vaccine against feline immunodeficiency virus |
| EP1203078B1 (de) | 1999-07-08 | 2005-05-04 | Mologen Forschungs-, Entwicklungs- und Vertriebs GmbH | Impfstoff gegen infektionen mit lentiviren, wie dem felinen immunschwäche-virus der katze |
| CA2386239A1 (en) | 1999-10-04 | 2001-04-12 | University Of Medicine And Dentistry Of New Jersey | Methods for identifying rna binding compounds |
| US20040115621A1 (en) * | 2000-02-18 | 2004-06-17 | Allen Rodrigo | Ancestral viruses and vaccines |
| FR2828687B1 (fr) | 2001-08-17 | 2003-12-12 | Hippocampe | Nouveaux peptides et leur utilisation comme medicaments contre l'infection par le fiv chez le chat |
| US20050031639A1 (en) | 2003-05-12 | 2005-02-10 | Yamamoto Janet K. | Materials and methods for immunizing against FIV infection |
-
2004
- 2004-09-10 AU AU2004273076A patent/AU2004273076B2/en not_active Ceased
- 2004-09-10 US US10/938,097 patent/US7776546B2/en not_active Expired - Lifetime
- 2004-09-10 ES ES04783703T patent/ES2327340T3/es not_active Expired - Lifetime
- 2004-09-10 CA CA002537429A patent/CA2537429A1/en not_active Abandoned
- 2004-09-10 US US10/938,056 patent/US7201903B2/en not_active Expired - Fee Related
- 2004-09-10 AT AT04783703T patent/ATE435425T1/de not_active IP Right Cessation
- 2004-09-10 EP EP04783703A patent/EP1673633B9/en not_active Expired - Lifetime
- 2004-09-10 DE DE602004021829T patent/DE602004021829D1/de not_active Expired - Lifetime
- 2004-09-10 JP JP2006526311A patent/JP2007505320A/ja active Pending
- 2004-09-10 EP EP09003215A patent/EP2107374A1/en not_active Withdrawn
- 2004-09-10 WO PCT/US2004/029570 patent/WO2005026733A1/en not_active Ceased
-
2010
- 2010-04-15 US US12/761,239 patent/US20110189651A1/en not_active Abandoned
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6458528B1 (en) * | 1998-05-15 | 2002-10-01 | Idexx Laboratories, Inc. | Diagnosis of feline immunodeficiency virus infection using ENV/GAG polypeptide markers |
Non-Patent Citations (7)
| Title |
|---|
| CALANDRELLA M ET AL: "Densitometric analysis of Western blot assays for feline immunodeficiency virus antibodies", VETERINARY IMMUNOLOGY AND IMMUNOPATHOLOGY, vol. 79, no. 3-4, 30 May 2001 (2001-05-30), pages 261 - 271, XP002312661, ISSN: 0165-2427 * |
| HARTMANN K ET AL: "Comparison of six in-house tests for the rapid diagnosis of feline immunodeficiency and feline leukaemia virus infections.", THE VETERINARY RECORD. 15 SEP 2001, vol. 149, no. 11, 15 September 2001 (2001-09-15), pages 317 - 320, XP008040870, ISSN: 0042-4900 * |
| HOHDATSU TSUTOMU ET AL: "Effect of dual-subtype vaccine against feline immunodeficiency virus infection", VETERINARY MICROBIOLOGY, vol. 58, no. 2-4, November 1997 (1997-11-01), pages 155 - 165, XP002312712, ISSN: 0378-1135 * |
| MOON DEBRA: "Another solution to identify FIV-vaccinated cats.", JOURNAL OF THE AMERICAN VETERINARY MEDICAL ASSOCIATION. 1 MAY 2003, vol. 222, no. 9, 1 May 2003 (2003-05-01), pages 1207; author reply 1207, XP008040879, ISSN: 0003-1488 * |
| MURRAY DOROTHY M: "Identifying FIV vaccinates.", JOURNAL OF THE AMERICAN VETERINARY MEDICAL ASSOCIATION, vol. 222, no. 6, 15 March 2003 (2003-03-15), pages 710, XP008040878, ISSN: 0003-1488 * |
| UHL E W ET AL: "FIV vaccine development and its importance to veterinary and human medicine: A review FIV vaccine 2002 update and review.", VETERINARY IMMUNOLOGY AND IMMUNOPATHOLOGY, vol. 90, no. 3-4, December 2002 (2002-12-01), pages 113 - 132, XP002312660, ISSN: 0165-2427 * |
| YAMAMOTO J K ET AL: "EXPERIMENTAL VACCINE PROTECTION AGAINST HOMOLOGOUS AND HETEROLOGOUSSTRAINS OF FELINE IMMUNODEFICIENCY VIRUS", JOURNAL OF VIROLOGY, NEW YORK, US, US, vol. 67, no. 1, 1993, pages 601 - 605, XP000609625, ISSN: 0022-538X * |
Cited By (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2005267607B2 (en) * | 2003-09-11 | 2009-06-11 | Idexx Laboratories, Inc. | Method and device for detecting feline immunodeficiency virus |
| AU2005267607B8 (en) * | 2003-09-11 | 2009-07-16 | Idexx Laboratories, Inc. | Method and device for detecting feline immunodeficiency virus |
| WO2005062053A3 (en) * | 2003-12-18 | 2005-09-29 | Idexx Lab Inc | Method and device for detecting feline immunodeficiency virus |
| WO2005080939A3 (en) * | 2004-02-19 | 2005-10-06 | Idexx Lab Inc | Method and device for detecting feline immunodeficiency virus |
| WO2006011919A1 (en) * | 2004-06-30 | 2006-02-02 | Idexx Laboratories, Inc. | Method and device for detecting feline immunodeficiency virus |
| WO2006011920A1 (en) * | 2004-06-30 | 2006-02-02 | Idexx Laboratories, Inc. | Method and device for detecting feline immunodeficiency virus (fiv) comprising the use of peptides derived from the v3 region of the fiv env protein |
| WO2006098849A3 (en) * | 2005-03-09 | 2007-04-19 | Idexx Lab Inc | Method and device for detecting feline immunodeficiency virus |
| AU2006223631B2 (en) * | 2005-03-09 | 2009-12-17 | Idexx Laboratories Inc. | Method and device for detecting feline immunodeficiency virus |
Also Published As
| Publication number | Publication date |
|---|---|
| EP2107374A1 (en) | 2009-10-07 |
| US7776546B2 (en) | 2010-08-17 |
| US20050058992A1 (en) | 2005-03-17 |
| ATE435425T1 (de) | 2009-07-15 |
| JP2007505320A (ja) | 2007-03-08 |
| US20050058993A1 (en) | 2005-03-17 |
| US7201903B2 (en) | 2007-04-10 |
| CA2537429A1 (en) | 2005-03-24 |
| EP1673633B9 (en) | 2011-03-02 |
| DE602004021829D1 (de) | 2009-08-13 |
| EP1673633A1 (en) | 2006-06-28 |
| EP1673633B1 (en) | 2009-07-01 |
| ES2327340T3 (es) | 2009-10-28 |
| AU2004273076A1 (en) | 2005-03-24 |
| AU2004273076B2 (en) | 2008-02-14 |
| US20110189651A1 (en) | 2011-08-04 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20110189651A1 (en) | Method and Device for Detecting Feline Immunodeficiency Virus | |
| US20100092940A1 (en) | Method and Device for Detecting Feline Immunodeficiency Virus | |
| US7285272B2 (en) | Method and device for detecting feline immunodeficiency virus | |
| AU2005267605B2 (en) | Method and device for detecting feline immunodeficiency virus | |
| US7348136B2 (en) | Method and device for detecting feline immunodeficiency virus | |
| US7335360B2 (en) | Method and device for detecting feline immunodeficiency virus |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AK | Designated states |
Kind code of ref document: A1 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BW BY BZ CA CH CN CO CR CU CZ DK DM DZ EC EE EG ES FI GB GD GE GM HR HU ID IL IN IS JP KE KG KP KZ LC LK LR LS LT LU LV MA MD MK MN MW MX MZ NA NI NO NZ PG PH PL PT RO RU SC SD SE SG SK SY TJ TM TN TR TT TZ UA UG US UZ VN YU ZA ZM |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A1 Designated state(s): BW GH GM KE LS MW MZ NA SD SZ TZ UG ZM ZW AM AZ BY KG MD RU TJ TM AT BE BG CH CY DE DK EE ES FI FR GB GR HU IE IT MC NL PL PT RO SE SI SK TR BF CF CG CI CM GA GN GQ GW ML MR SN TD TG |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 2004273076 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2006526311 Country of ref document: JP |
|
| ENP | Entry into the national phase |
Ref document number: 2537429 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2004273076 Country of ref document: AU Date of ref document: 20040910 Kind code of ref document: A |
|
| WWP | Wipo information: published in national office |
Ref document number: 2004273076 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2004783703 Country of ref document: EP |
|
| WWP | Wipo information: published in national office |
Ref document number: 2004783703 Country of ref document: EP |