WO2003072715A2 - Gasp1: a follistatin domain containing protein - Google Patents

Gasp1: a follistatin domain containing protein Download PDF

Info

Publication number
WO2003072715A2
WO2003072715A2 PCT/US2003/005151 US0305151W WO03072715A2 WO 2003072715 A2 WO2003072715 A2 WO 2003072715A2 US 0305151 W US0305151 W US 0305151W WO 03072715 A2 WO03072715 A2 WO 03072715A2
Authority
WO
WIPO (PCT)
Prior art keywords
gasp1
gdf
protein
proteins
disorder
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2003/005151
Other languages
English (en)
French (fr)
Other versions
WO2003072715A8 (en
WO2003072715A3 (en
Inventor
Jennifer J. Hill
Neil M. Wolfman
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Wyeth LLC
Original Assignee
Wyeth LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to KR10-2004-7012977A priority Critical patent/KR20040094709A/ko
Priority to IL16352503A priority patent/IL163525A0/xx
Priority to BRPI0307907-4A priority patent/BR0307907A2/pt
Priority to MXPA04008150A priority patent/MXPA04008150A/es
Priority to EP03713568A priority patent/EP1572909A4/en
Priority to JP2003571403A priority patent/JP4429729B2/ja
Priority to CA002476887A priority patent/CA2476887A1/en
Priority to AU2003217612A priority patent/AU2003217612A1/en
Application filed by Wyeth LLC filed Critical Wyeth LLC
Publication of WO2003072715A2 publication Critical patent/WO2003072715A2/en
Anticipated expiration legal-status Critical
Priority to NO20043886A priority patent/NO20043886L/no
Publication of WO2003072715A8 publication Critical patent/WO2003072715A8/en
Publication of WO2003072715A3 publication Critical patent/WO2003072715A3/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/18Growth factors; Growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/02Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/08Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/08Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • A61P19/10Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease for osteoporosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • A61P21/02Muscle relaxants, e.g. for tetanus or cramps
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • A61P21/04Drugs for disorders of the muscular or neuromuscular system for myasthenia gravis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • A61P21/06Anabolic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/04Anorexiants; Antiobesity agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00Drugs for disorders of the endocrine system
    • A61P5/24Drugs for disorders of the endocrine system of the sex hormones
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00Drugs for disorders of the endocrine system
    • A61P5/38Drugs for disorders of the endocrine system of the suprarenal hormones
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/08Vasodilators for multiple indications
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/475Growth factors; Growth regulators
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y10TECHNICAL SUBJECTS COVERED BY FORMER USPC
    • Y10STECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y10S435/00Chemistry: molecular biology and microbiology
    • Y10S435/81Packaged device or kit

Definitions

  • GASP1 A FOLLISTATIN DOMAIN CONTAINING PROTEIN
  • the present invention relates to the use of proteins comprising at least one follistatin domain to modulate the level or activity of growth and differentiation factor-8 (GDF-8). More particularly, the invention relates to the use of proteins comprising at least one follistatin domain, excluding follistatin itself, for treating disorders that are related to modulation of the level or activity of GDF-8.
  • the invention is useful for treating muscular diseases and disorders, particularly those in which an increase in muscle tissue would be therapeutically beneficial.
  • the invention is also useful for treating diseases and disorders related to metabolism, adipose tissue, and bone degeneration. Background of the invention
  • GDF-8 Growth and differentiation factor-8
  • TGF- ⁇ transforming growth factor-beta
  • GDF-8 is a negative regulator of skeletal muscle mass, and there is considerable interest in identifying factors which regulate its biological activity. For example, GDF-8 is highly expressed in the developing and adult skeletal muscle.
  • the GDF-8 null mutation in transgenic mice is characterized by a marked hypertrophy and hyperplasia of the skeletal muscle (McPherron et al. (1997) Nature, 387: 83-90). Similar increases in skeletal muscle mass are evident in naturally occurring mutations of GDF-8 in cattle (Ashmore et al. (1974) Growth, 38: 501-507; Swatland and Kieffer (1994) J. Anim. Sci., 38: 752-757; McPherron and Lee (1997) Proc. Nat. Acad. Sci. U.S.A., 94: 12457-12461 ; and Kambadur et al. (1997) Genome Res., 7: 910-915).
  • GDF-8 can modulate the production of muscle-specific enzymes (e.g., creatine kinase) and modulate myoblast cell proliferation (WO 00/43781 ).
  • a number of human and animal disorders are associated with loss of or functionally impaired muscle tissue.
  • very few reliable or effective therapies exist for these disorders.
  • the serious symptoms associated with these disorders may be substantially reduced by employing therapies that increase the amount of muscle tissue in patients suffering from the disorders. While not curing the conditions, such therapies would significantly improve the quality of life for these patients and could ameliorate some of the effects of these diseases.
  • therapies that may contribute to an overall increase in muscle tissue in patients suffering from these disorders.
  • GDF-8 may also be involved in a number of other physiological processes (e.g., glucose homeostasis), as well as abnormal conditions, such as in the development of type 2 diabetes and adipose tissue disorders, such as obesity.
  • GDF-8 modulates preadipocyte differentiation to adipocytes (Kim et al. (2001) B.B.R.C. 281 : 902-906).
  • modulation of GDF-8 may be useful for treating these diseases, as well.
  • the GDF-8 protein is synthesized as a precursor protein consisting of an amino-terminal propeptide and a carboxy-terminal mature domain (McPherron and Lee, (1997) Proc. Nat. Acad. Sci. U.S.A., 94: 12457- 12461). Before cleavage, the precursor GDF-8 protein forms a homodimer. The amino-terminal propeptide is then cleaved from the mature domain. The cleaved propeptide may remain noncovalently bound to the mature domain dimer, inactivating its biological activity (Miyazono et al. (1988) J. Biol. Chem., 263: 6407-6415; Wakefield et al.
  • GDF-8 GDF-8 or structurally related proteins and inhibit their biological activity.
  • inhibitory proteins include follistatin (Gamer et al. (1999) Dev. Biol., 208: 222-232).
  • the mature domain of GDF-8 is believed to be active as a homodimer when the propeptide is removed.
  • GDF-8 is involved in the regulation of many critical biological processes. Due to its key function in these processes, GDF-8 may be a desirable target for therapeutic intervention. In particular, therapeutic agents that inhibit the activity of GDF-8 may be used to treat human or animal disorders in which an increase in muscle tissue would be therapeutically beneficial.
  • follistatin domain plays roles in many biological processes, particularly in the regulation of TGF- ⁇ superfamily signaling and the regulation of extracellular matrix-mediated processes such as cell adhesion.
  • Follistatin, follistatin related gene (FLRG, FSRP), and follistatin-related protein (FRP) have all been linked to TGF- ⁇ signaling, either through transcriptional regulation by TGF- ⁇ (Bartholin et al. (2001 ) Oncogene, 20: 5409-5419; Shibanuma et al. (1993) Eur. J. Biochem. 217: 13-19) or by their ability to antagonize TGF- ⁇ signaling pathways (Phillips and de Kretser (1998) Front.
  • IGFBP7 Insulin growth factor binding protein 7
  • Agrins and agrin related proteins contain upwards of nine follistatin domains and are secreted from nerve cells to promote the aggregation of acetylcholine receptors and other molecules involved in the formation of synapses. It has been suggested that the follistatin domains may serve to localize growth factors to the synapse (Patthy et al. (1993) Trends Neurosci., 16: 76-81 ).
  • Osteonectin SPARC, BM40
  • SC1 , mast9, QR1 hevin
  • SC1 , mast9, QR1 hevin
  • These proteins comprise at least one follistatin domain.
  • follistatin domain proteins have been described or uncovered from the NCBI database (National Center for Biotechnology Information, Bethesda, Maryland, USA), however their functions are presently unknown. These proteins include U 19878 (G01639, very similar to tomoregulin-1 ), T46914, human GASP1 (GDF-associated serum p_rotein 1 ; described herein; Figure 7), human GASP2 (WFIKKN; Trexler e al. (2001 ) Proc. Natl. Acad. Sci. U.S.A., 98: 3705-3709; Figure 9), and the proteoglycan family of testican (SPOCK) proteins (Alliel et a/.(1993) Eur. J.
  • the invention relates to proteins, other than follistatin, comprising a unique structural feature, namely, the presence of at least one follistatin domain.
  • Follistatin itself is not encompassed by the invention.
  • the proteins comprising at least one follistatin domain are specifically reactive with a mature GDF-8 protein or a fragment thereof, whether the GDF-8 protein is in monomeric form, a dimeric active form, or complexed in the GDF-8 latent complex. Proteins comprising at least one follistatin domain may bind to an epitope on the mature GDF-8 protein that results in a reduction in one or more of the biological activities associated with GDF-8, relative to a mature GDF-8 protein that is not bound by the same protein.
  • the present invention provides methods for modulating the effects of GDF-8 on cells. Such methods comprise administering an effective amount of a protein comprising at least one follistatin domain.
  • the present invention also encompasses methods for expressing a protein in a cell by administering a DNA molecule encoding a protein comprising at least one follistatin domain.
  • proteins comprising at least one follistatin domain may be administered to a patient, in a therapeutically effective dose, to treat or prevent medical conditions in which an increase in muscle tissue would be therapeutically beneficial.
  • embodiments include treatment of diseases, disorders, and injuries involving cells and tissue that are associated with the production, metabolism, or activity of GDF-8.
  • Proteins comprising at least one follistatin domain may be prepared in a pharmaceutical preparation.
  • the pharmaceutical preparation may contain other components that aid in the binding of the mature GDF-8 protein or fragments thereof, whether it is in monomeric form, dimeric active form, or complexed in the GDF-8 latent complex.
  • proteins comprising at least one follistatin domain may be used as a diagnostic tool to quantitatively or qualitatively detect mature GDF-8 protein or fragments thereof, whether it is in monomeric form, dimeric active form, or complexed in the GDF-8 latent complex.
  • proteins comprising at least one follistatin domain may be used to detect the presence, absence, or amount of GDF-8 protein in a cell, bodily fluid, tissue, or organism. The presence or amount of mature GDF-8 protein detected may be correlated with one or more of the medical conditions listed herein.
  • Proteins comprising at least one follistatin domain may be provided in a diagnostic kit to detect mature GDF-8 protein or fragments thereof, whether it is in monomeric form, dimeric active form, or complexed in the GDF-8 latent complex, and help correlate the results with one or more of the medical conditions described herein.
  • a kit may comprise at least one protein comprising at least one follistatin domain, whether it is labeled or unlabeled, and at least one agent that bind to this proteins, such as a labeled antibody.
  • the kit may also include the appropriate biological standards and control samples to which one could compare the results of the experimental detection. It may also include buffers or washing solutions and instructions for using the kit.
  • Structural components may be included on which one may carry out the experiment, such as sticks, beads, papers, columns, vials, or gels. Brief Description of the Figures
  • Figure 1 shows antibody purification of the GDF-8 complex from wild-type mouse serum.
  • a silver stained reducing gel shows proteins purified from wild type mouse serum using the JA16 monoclonal antibody covalently coupled to agarose beads.
  • a control purification (0) with mock-coupled beads was performed in parallel. Subsequent elutions with buffer (mock elute), a competing peptide, and SDS sample buffer revealed two visible protein bands which were specifically eluted with peptide from the JA16-conjugated beads (indicated by arrows).
  • Figure 2 shows the identification of mature and unprocessed GDF-8 in affinity purified samples from normal mouse serum.
  • Figure 2A shows a representative MS/MS spectrum of a GDF-8 derived peptide (SEQ ID NO: 19) identified from the 12 kDa band visible in the affinity purified sample. Both N-terminal fragment ions (b ions) and C-terminal fragment ions (y ions) are visible. Notably, the most intense y fragment ions result from fragmentation before the proline residue, a common characteristic of proline containing peptides.
  • Figure 2B shows a western blot probed with a polyclonal antibody that recognizes the mature region of GDF-8, confirming the presence of GDF-8 in the affinity purified samples. Both the mature and unprocessed forms of GDF-8 are visible.
  • Figure 3 shows the GDF-8 propeptide and follistatin-like related gene (FLRG) bind to circulating GDF-8 isolated from normal mouse serum.
  • Representative MS/MS spectra from GDF-8 propeptide (SEQ ID NO:23) ( Figure 3A) and FLRG (SEQ ID NO:30) ( Figure 3C) derived peptides identified in the 36 kDa band are shown.
  • Figure 3B shows a western blot of affinity purified GDF-8 complex probed with a polyclonal antibody that specifically recognizes the propeptide region of GDF-8, confirming the mass spectrometric identification of this protein in the GDF-8 complex.
  • FIG. 3D shows a western blot of affinity purified GDF-8 complex probed with a monoclonal antibody to FLRG.
  • FIG. 4 shows results from a thorough analysis of a large scale GDF-8 purification that identified GDF-8 propeptide, FLRG, and a novel protein as the major GDF-8 binding proteins in serum.
  • a silver stained gel was dissected into 13 slices from the peptide eluted sample of both negative control and JA16 immunoprecipitates. The proteins in each slice were digested with trypsin and identified using nanoflow-LC-MS/MS and database searching. Proteins unique to the JA16 sample included only unprocessed and mature GDF-8, GDF-8 propeptide, FLRG, and a novel multidomain protease inhibitor (GDF-associated serum protein 1 , GASP1 ). These proteins were identified from the noted regions of the gel.
  • GDF-associated serum protein 1 GASP1
  • Figure 5 shows that a novel multidomain protease inhibitor, GASP1 , is bound to GDF-8 in serum.
  • Figures 5A (peptide assigned SEQ ID NO:31 ) and 5B (peptide assigned SEQ ID NO:33) show representative MS/MS spectra from two GASP1 peptides, identified in band 3 of the silver stained gel of Figure 4.
  • Figure 6A shows the predicted nucleotide sequence to mouse GASP1.
  • Figure 6B shows a predicted alternative nucleotide sequence to mouse GASP1.
  • Figure 6C shows the predicted amino acid sequence encoded by the nucleotide sequences shown in Figures 6A and 6B.
  • the protein sequences encoded by the two nucleotide sequences are identical because the nucleotide differences are all in wobble codon positions.
  • the follistatin domain is shown in bold and underlined.
  • Figure 7A shows the predicted nucleotide sequence of human GASP1.
  • Figure 7B shows the corresponding predicted amino acid sequence.
  • the follistatin domain is shown in bold and underlined.
  • Figure 7C shows the predicted nucleotide sequence of human GASP1 using an alternative start site.
  • Figure 7D shows the corresponding predicted amino acid sequence.
  • the follistatin domain is shown in bold and underlined. The end of the sequence is denoted by the asterisk.
  • Figure 8A shows the predicted nucleotide sequence to mouse GASP2, while Figure 8B shows the corresponding predicted amino acid sequence.
  • the follistatin domain is shown in bold and underlined.
  • Figure 9A shows the predicted nucleotide sequence to human GASP2, while Figure 9B shows the corresponding predicted amino acid sequence.
  • the follistatin domain is shown in bold and underlined.
  • FIG. 10 shows that mouse GASP1 is expressed in many adult tissues and during development.
  • the figure shows tissue expression profiles of mouse GASP1.
  • a 551 bp fragment of GASP1 was amplified from normalized first-strand cDNA panels from Clontech (Palo Alto, CA).
  • a portion of glyceraldehyde-3-phosphate dehydrogenase (G3PDH) was amplified as a control.
  • G3PDH expression is known to be high in skeletal muscle and low in testis.
  • the cDNA panels were normalized against ⁇ -actin, phospholipase A2, and ribosomal protein S29, in addition to G3PDH.
  • Figure 11 shows proteins isolated from human serum.
  • Proteins from a JA16 immunoprecipitate or a control sample (0) were eluted in a mock PBS elution, a competing peptide elution, or a SDS elution.
  • the proteins in the indicated regions of the gel were digested with trypsin and analyzed by LS-MS/MS and database searching.
  • the proteins present in the JA16 sample but not in the control sample were mature GDF-8 (band 16), GDF-8 propeptide and FLRG (band 11), and human GASP1 (band 4).
  • Figure 11B shows a western blot of an identical JA16 immunoprecipitate probed with an antibody that recognizes mature GDF-8. Bands corresponding to mature and unprocessed GDF-8 isolated from human serum are visible.
  • Figure 12 shows representative mass spectra of a peptide derived from GDF-8 and associated proteins isolated from bands 4, 11 , and 16 ( Figure 11 ). The peptide sequence and N-terminal (b ions) and C-terminal (y ions) are shown. A complete listing of identified peptides is provided in Table 1. Spectra are shown from a GASP1 peptide (SEQ ID NO:44) ( Figure 12A), a FLRG peptide (SEQ ID NO:41) ( Figure 12B), a GDF-8 propeptide peptide (SEQ ID NO:24) ( Figure 12C), and a mature GDF-8 peptide (SEQ ID NO:13) ( Figure l 2D).
  • Figure 13 shows the nucleotide (SEQ ID NO:48) and amino acid (SEQ ID NO:49) sequences of cloned mouse GASPL The peptides identified by mass spectrometry in JA16 affinity-purified samples are underlined. The end of the sequence is denoted by the asterisk.
  • Figure 14A shows the domain structure of GASP1.
  • GASP1 has a signal sequence/cleavage site after amino acid 29.
  • GASP1 contains two Kunitz/BPTI serine protease inhibitor domains, a follistatin domain (including a Kazal serine protease inhibitor motif) and a netrin domain, which may inhibit metalloproteases.
  • Figure 14B shows the phylogenetic tree of GASP1 and GASP2 predicted from the mouse and human genomic sequences. Mouse and human GASP1 are 90% identical. GASP1 and GASP2 are 54% identical.
  • Figure 15 shows that recombinantly-produced GASP1 binds separately to both GDF-8 and GDF-8 propeptide.
  • FIG. 16 shows that GASP1 inhibits the biological activity of GDF-8 and the highly related BMP-11 , but not activin or TGF- ⁇ .
  • Various dilutions of conditioned media from mock (open circles) or GASP1-V5-His (filled squares) transfectants were incubated with (A) 10 ng/ml GDF-8, (B) 10 ng/ml BMP-11 , (C) 10 ng/ml activin, or (D) 0.5 ng/ml TGF- ⁇ . These samples were then subjected to a luciferase reporter activity assay in A204 (A-C) or RD (D) cells to determine the activity of the added growth factors.
  • Luciferase activity is shown in relative luciferase units. The activity resulting from each of the growth factors alone is shown by the filled diamonds and short dashed line. Without addition of any growth factor, the background activity in the assay is low, as shown by the long dashed line with no symbols.
  • FIG 17 shows the potency of GASP1 inhibition of GDF-8.
  • Purified GASP1 was tested for its ability to inhibit 20 ng/ml of myostatin in the (CAGA) ⁇ 2 (SEQ ID NO:53) luciferase reporter assay in RD cells (filled squares).
  • the activity resulting from GDF-8 alone is shown by the filled diamonds and short dashed line.
  • the activity present when no growth factors are added is shown by the long dashed line.
  • follistatin domain refers to an amino acid domain or a nucleotide domain encoding for an amino acid domain, characterized by cysteine rich repeats.
  • a follistatin domain typically encompasses a 65-90 amino acid span and contains 10 conserved cysteine residues and a region similar to Kazal serine protease inhibitor domains.
  • the loop regions between the cysteine residues exhibit sequence variability in follistatin domains, but some conservation is evident.
  • the loop between the fourth and fifth cysteines is usually small, containing only 1 or 2 amino acids.
  • the amino acids in the loop between the seventh and eighth cysteines are generally the most highly conserved containing a consensus sequence of (G,A)-(S,N)- (S,N,T)-(D,N)-(G,N) followed by a (T,S)-Y motif.
  • the region between the ninth and tenth cysteines generally contains a motif containing two hydrophobic residues (specifically V, I, or L) separated by another amino acid.
  • protein comprising at least one follistatin domain refers to proteins comprising at least one, but possibly more than one follistatin domain.
  • the term also refers to any variants of such proteins (including fragments; proteins with substitution, addition or deletion mutations; and fusion proteins) that maintain the known biological activities associated with the native proteins, especially those pertaining to GDF-8 binding activity, including sequences that have been modified with conservative or non- conservative changes to the amino acid sequence.
  • proteins may be derived from any source, natural or synthetic.
  • the protein may be human or derived from animal sources, including bovine, chicken, murine, rat, porcine, ovine, turkey, baboon, and fish. Follistatin itself is not encompassed by the invention.
  • GDF-8 or "GDF-8 protein” refer to a specific growth and differentiation factor. The terms include the full length unprocessed precursor form of the protein, as well as the mature and propeptide forms resulting from post-translational cleavage. The terms also refer to any fragments of GDF-8 that maintain the known biological activities associated with the protein, including sequences that have been modified with conservative or non-conservative changes to the amino acid sequence.
  • GDF-8 molecules may be derived from any source, natural or synthetic.
  • the protein may be human or derived from animal sources, including bovine, chicken, murine, rat, porcine, ovine, turkey, baboon, and fish.
  • Various GDF-8 molecules have been described in McPherron et al. (1997) Proc. Natl. Acad. Sci. USA, 94: 12457-12461.
  • GDF-8 refers to the protein that is cleaved from the carboxy-terminal domain of the GDF-8 precursor protein.
  • the mature GDF-8 may be present as a monomer, homodimer, or in a GDF-8 latent complex. Depending on the in vivo or in vitro conditions, mature GDF-8 may establish an equilibrium between any or all of these different forms. It is believed to be biologically active as homodimer. In its biologically active form, the mature GDF-8 is also referred to as "active GDF-8.”
  • GDF-8 propeptide refers to the polypeptide that is cleaved from the amino-terminal domain of the GDF-8 precursor protein.
  • the GDF-8 propeptide is capable of binding to the propeptide binding domain on the mature GDF-8.
  • GDF-8 latent complex refers to the complex of proteins formed between the mature GDF-8 homodimer and the GDF-8 propeptide. It is believed that two GDF-8 propeptides associate with the two molecules of mature GDF-8 in the homodimer to form an inactive tetrameric complex.
  • the latent complex may include other GDF inhibitors in place of or in addition to one or more of the GDF-8 propeptides.
  • GDF-8 activity refers to one or more of physiologically growth-regulatory or morphogenetic activities associated with active GDF-8 protein.
  • active GDF-8 is a negative regulator of skeletal muscle.
  • Active GDF-8 can also modulate the production of muscle-specific enzymes (e.g., creatine kinase), stimulate myoblast cell proliferation, and modulate preadipocyte differentiation to adipocytes.
  • GDF-8 is also believed to increase sensitivity to insulin and glucose uptake in peripheral tissues, particularly in skeletal muscle or adipocytes.
  • GDF-8 biological activities include but are not limited to inhibition of muscle formation, inhibition of muscle cell growth, inhibition of muscle development, decrease in muscle mass, regulation of muscle-specific enzymes, inhibition of myoblast cell proliferation, modulation of preadipocyte differentiation to adipocytes, increasing sensitivity to insulin, regulations of glucose uptake, glucose hemostasis, and modulate neuronal cell development and maintenance.
  • isolated refers to a molecule that is substantially free of its natural environment.
  • an isolated protein is substantially free of cellular material or other contaminating proteins from the cell or tissue source from which it is derived.
  • substantially free of cellular material refers to preparations where the isolated protein is at least 70% to 80% (w/w) pure, at least 80%-89% (w/w) pure, at least 90- 95% pure, or at least 96%, 97%, 98%, 99% or 100% (w/w) pure.
  • LC-MS/MS refers to liquid chromatography in line with a mass spectrometer programmed to isolate a molecular ion of particular mass/charge ratio, fragment this ion, and record the mass/charge ratio of the fragment ions.
  • mass spectrometer programmed to isolate a molecular ion of particular mass/charge ratio, fragment this ion, and record the mass/charge ratio of the fragment ions.
  • MS/MS refers to the process of using a mass spectrometer to isolate a molecular ion of a particular mass/charge ratio, fragment this ion, and record the mass/charge ratio of the resulting fragment ions.
  • the fragment ions provide information about the sequence of a peptide.
  • treating refers to both therapeutic treatment and prophylactic or preventative measures. Those in need of treatment may include individuals already having a particular medical disorder as well as those who may ultimately acquire the disorder (i.e., those needing preventative measures).
  • treatment includes both measures that address the underlying cause of a disorder and measures that reduce symptoms of a medical disorder without necessarily affecting its cause. Thus, improvement of quality of life and amelioration of symptoms are considered treatment, as are measures that counteract the cause of a disorder.
  • medical disorder refers to disorders of muscle, bone, or glucose homeostasis, and include disorders associated with GDF-8 and/or other members of the TGF- ⁇ superfamily (e.g., BMP-11 ).
  • disorders include, but are not limited to, metabolic diseases and disorders such as insulin-dependent (type 1 ) diabetes mellitus, noninsulin- dependent (type 2) diabetes mellitus, hyperglycemia, impaired glucose tolerance, metabolic syndrome (e.g., syndrome X), and insulin resistance induced by trauma (e.g., burns or nitrogen imbalance), and adipose tissue disorders (e.g., obesity); muscle and neuromuscular disorders such as muscular dystrophy (including but not limited to severe or benign X-linked muscular dystrophy, limb-girdle dystrophy, facioscapulohumeral dystrophy, myotinic dystrophy, distal muscular dystrophy, progressive dystrophic ophthalmoplegia, oculopharyngeal dystrophy, Duchenne's muscular dystrophy, and Fakuyama-type congenital muscular dystophy); amyotrophic lateral sclerosis (ALS); muscle atrophy; organ atrophy; frailty; carpal tunnel syndrome; congestive disorders
  • osteoporosis especially in the elderly and/or postmenopausal women; glucocorticoid- induced osteoporosis; osteopenia; osteoarthritis; osteoporosis-related fractures; and traumatic or chronic injury to muscle tissue.
  • glucocorticoid- induced osteoporosis especially in the elderly and/or postmenopausal women
  • osteopenia especially in the elderly and/or postmenopausal women
  • osteoarthritis osteoporosis-related fractures
  • osteoporosis-related fractures and traumatic or chronic injury to muscle tissue.
  • traumatic or chronic injury to muscle tissue include low bone mass due to chronic glucocorticoid therapy, premature gonadal failure, androgen suppression, vitamin D deficiency, secondary hyperparathyroidism, nutritional deficiencies, and anorexia nervosa.
  • the term "increase in mass” refers to the presence of a greater amount of muscle after treatment with proteins comprising at least one follistatin domain relative to the amount of muscle mass present before the treatment.
  • therapeutic benefit refers to an improvement of symptoms of a disorder, a slowing of the progression of a disorder, or a cessation in the progression of a disorder. The therapeutic benefit is determined by comparing an aspect of a disorder, such as the amount of muscle mass, before and after at least one protein comprising at last one follistatin domain is administered.
  • modulating refers to varying a property of a protein by increasing, decreasing, or inhibiting the activity, behavior, or amount of the protein.
  • proteins comprising at least one follistatin domain may modulate GDF-8 by inhibiting its activity.
  • stabilizing modification is any modification known in the art or set forth herein capable of stabilizing a protein, enhancing the in vitro half life of a protein, enhancing circulatory half life of a protein and/or reducing proteolytic degradation of a protein.
  • stabilizing modifications include but are not limited to fusion proteins (including, for example, fusion proteins comprising a protein comprising at least one follistatin domain and a second protein), modification of a glycosylation site (including, for example, addition of a glycosylation site to a protein comprising at least one follistatin domain), and modification of carbohydrate moiety (including, for example, removal of carbohydrate moieties from a protein comprising at least one follistatin domain).
  • a stabilizing modification which comprises a fusion protein (e.g., such that a second protein is fused to a protein comprising at least one follistatin domain)
  • the second protein may be referred to as a "stabilizer portion” or “stabilizer protein.”
  • a protein a human protein comprising at least one follistatin domain may be fused with an IgG molecule, wherein IgG acts as the stabilizer protein or stabilizer portion.
  • a "stabilizer portion” also includes nonproteinaceous modifications such as a carbohydrate moiety, or nonproteinaceous polymer.
  • Fc region of an IgG molecule refers to the Fc domain of an immunoglobulin of the isotype IgG, as is well known to those skilled in the art.
  • the Fc region of an IgG molecule is that portion of IgG molecule (lgG1 , lgG2, lgG3, and lgG4) that is responsible for increasing the in vivo serum half-life of the IgG molecule.
  • In vitro half life refers to the stability of a protein measured outside the context of a living organism.
  • Assays to measure in vitro half life are well known in the art and include but are not limited to SDS-PAGE, ELISA, cell-based assays, pulse-chase, western blotting, northern blotting, etc. These and other useful assays are well known in the art.
  • In vivo half life refers to the stability of a protein in an organism. In vivo half life may be measured by a number of methods known in the art including but not limited to in vivo serum half life, circulatory half life, and assays set forth in the examples herein.
  • In vivo serum half life refers to the half-life of a protein circulating in the blood of an organism. Methods known in the art may be used to measure in vivo serum half life. For example, radioactive protein can be administered to an animal and the amount of labeled protein in the serum can be monitored over time.
  • the present invention relates to proteins, other than follistatin, having a unique structural feature, namely, that they comprise at least one follistatin domain. Follistatin itself is not encompassed by the invention. It is believed that proteins containing at least one follistatin domain will bind and inhibit GDF-8. Examples of proteins having at least one follistatin domain include, but are not limited to follistatin-like related gene (FLRG), FRP (flik, tsc 36), agrins, osteonectin (SPARC, BM40), hevin (SC1 , mast9, QR1), IGFBP7 (mac25), and U19878.
  • FLRG follistatin-like related gene
  • FRP flik, tsc 36
  • SPARC osteonectin
  • BM40 hevin
  • SC1 , mast9, QR1 IGFBP7
  • U19878 U19878.
  • GASP1 comprising the nucleotide and amino acid sequences provided in Figures 6 and 7, and GASP2, comprising the nucleotide and amino acid sequences provided in Figures 8 and 9, are other examples of proteins comprising at least one follistatin domain.
  • a follistatin domain is defined as an amino acid domain or a nucleotide domain encoding for an amino acid domain, characterized by cysteine rich repeats.
  • a follistatin domain typically encompasses a 65-90 amino acid span and contains 10 conserved cysteine residues and a region similar to Kazal serine protease inhibitor domains. In general, the loop regions between the cysteine residues exhibit sequence variability in follistatin domains, but some conservation is evident. The loop between the fourth and fifth cysteines is usually small, containing only 1 or 2 amino acids.
  • the amino acids in the loop between the seventh and eighth cysteines are generally the most highly conserved containing a consensus sequence of (G,A)-(S,N)-(S,N,T)-(D,N)-(G,N) followed by a (T,S)-Y motif.
  • the region between the ninth and tenth cysteines generally contains a motif containing two hydrophobic residues (specifically V, I, or L) separated by another amino acid.
  • Proteins comprising at least one follistatin domain may be isolated using a variety of methods. For example, one may use affinity purification using GDF-8, as exemplified in the present invention. In addition, one may use a low stringency screening of a cDNA library, or use degenerate PCR techniques using a probe directed toward a follistatin domain. As more genomic data becomes available, similarity searching using a number of sequence profiling and analysis programs, such as MotifSearch (Genetics Computer Group, Madison, WI), ProfileSearch (GCG), and BLAST (NCBI) could be used to find novel proteins containing significant homology with known follistatin domains.
  • MotifSearch Genetics Computer Group, Madison, WI
  • GCG ProfileSearch
  • NCBI BLAST
  • both GDF-8 or proteins comprising at least one follistatin domain may contain any number of conservative changes to their respective amino acid sequences without altering their biological properties.
  • conservative amino acid modifications are based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like.
  • Exemplary conservative substitutions which take various of the foregoing characteristics into consideration are well known to those of skill in the art and include: arginine and lysine; glutamate and aspartate; serine and threonine; glutamine and asparagine; and valine, leucine, and isoleucine.
  • proteins comprising at least one follistatin domain may be used to generate functional fragments comprising at least one follistatin domain. It is expected that such fragments would bind and inhibit GDF-8.
  • proteins comprising at least one follistatin domain specifically bind to mature GDF-8 or a fragment thereof, whether it is in monomeric form, active dimer form, or complexed in a GDF-8 latent complex, with an affinity of between 0.001 and 100 nM, or between 0.01 and 10 nM, or between 0.1 and 1 nM.
  • the present invention provides the amino acid and nucleotide sequences for GASP1 and GASP2, as shown in Figures 6-9.
  • the present invention also include variants, homologues, and fragments of such nucleic and amino acid sequences.
  • the nucleic or amino acid sequence may comprise a sequence at least 70% to 79% identical to the nucleic or amino acid sequence of the native protein, or at least 80% to 89% identical, or at least 90% to 95% identical, or at least 96% to 100% identical.
  • the region that binds GDF-8 can tolerate less sequence variation than the other portions of the protein not involved in binding.
  • these non-binding regions of the protein may contain substantial variations without significantly altering the binding properties of the protein.
  • many changes can be made to specifically increase the affinity of the protein for its target.
  • affinity-increasing changes are typically determined empirically by altering the protein, which may be in the binding region, and testing the ability to bind GDF-8 or the strength of the binding. All such alterations, whether within or outside the binding region, are included in the scope of the present invention.
  • Relative sequence similarity or identity may be determined using the "Best Fit” or "Gap” programs of the Sequence Analysis Software PackageTM (Version 10; Genetics Computer Group, Inc., University of Wisconsin Biotechnology Center, Madison, WI). "Gap” utilizes the algorithm of Needleman and Wunsch (Needleman and Wunsch, 1970) to find the alignment of two sequences that maximizes the number of matches and minimizes the number of gaps. "BestFit” performs an optimal alignment of the best segment of similarity between two sequences. Optimal alignments are found by inserting gaps to maximize the number of matches using the local homology algorithm of Smith and Waterman (Smith and Waterman, 1981 ; Smith, et al., 1983).
  • the Sequence Analysis Software Package described above contains a number of other useful sequence analysis tools for identifying homologues of the presently disclosed nucleotide and amino acid sequences.
  • the "BLAST" program Altschul, et al., 1990 searches for sequences similar to a query sequence (either peptide or nucleic acid) in a specified database (e.g., sequence databases maintained at the NCBI; "FastA” (Lipman and Pearson, 1985; see also Pearson and Lipman, 1988; Pearson, et al., 1990) performs a Pearson and Lipman search for similarity between a query sequence and a group of sequences of the same type (nucleic acid or protein); "TfastA” performs a Pearson and Lipman search for similarity between a protein query sequence and any group of nucleotide sequences (it translates the nucleotide sequences in all six reading frames before performing the comparison); "FastX” performs a Pearson and Lipman search for similar
  • the invention encompasses fragments of proteins comprising at least one follistatin domain. Such fragments will likely include all or a part of the follistatin domain. Fragments may include all, a part, or none of the sequences between the follistatin domain and the N-terminus and/or between the follistatin domain and the C-terminus.
  • amino acids may be substituted for other amino acids in a protein structure without adversely affecting the activity of the protein, e.g., binding characteristics of a protein comprising at least one follistatin domain. It is thus contemplated by the inventors that various changes may be made in the amino acid sequences of proteins comprising at least one follistatin domain, or DNA sequences encoding the proteins, without appreciable loss of their biological utility or activity. Such changes may include deletions, insertions, truncations, substitutions, fusions, shuffling of motif sequences, and the like.
  • the hydropathic index of amino acids may be considered.
  • the importance of the hydropathic amino acid index in conferring interactive biological function on a protein is generally understood in the art (Kyte and Doolittle (1982) J. Mol. Biol., 157: 105-132). It is accepted that the relative hydropathic character of the amino acid contributes to the secondary structure of the resultant protein, which in turn defines the interaction of the protein with other molecules, for example, enzymes, substrates, receptors, DNA, antibodies, antigens, and the like.
  • Each amino acid has been assigned a hydropathic index on the basis of its hydrophobicity and charge characteristics (Kyte and Doolittle, 1982); these are isoleucine (+4.5), valine (+4.2), leucine (+3.8), phenylalanine (+2.8), cysteine/cystine (+2.5), methionine (+1.9), alanine (+1.8), glycine (- 0.4), threonine (-0.7), serine (-0.8), tryptophan (-0.9), tyrosine (-1.3), proline (- 1.6), histidine (-3.2), glutamate (-3.5), glutamine (-3.5), aspartate (-3.5), asparagine (-3.5), lysine (-3.9), and arginine (-4.5).
  • the substitution of amino acids whose hydropathic indices may be within ⁇ 2, within ⁇ 1 , and within ⁇ 0.5.
  • the modifications may be conservative such that the structure or biological function of the protein is not affected by the change.
  • conservative amino acid modifications are based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like.
  • Exemplary conservative substitutions which take various of the foregoing characteristics into consideration are well known to those of skill in the art and include: arginine and lysine; glutamate and aspartate; serine and threonine; glutamine and asparagine; and valine, leucine, and isoleucine.
  • the amino acid sequence of proteins comprising at least one follistatin domain may be modified to have any number of conservative changes, so long as the binding of the protein to its target antigen is not adversely affected. Such changes may be introduced inside or outside of the binding portion of the protein comprising at least one follistatin domain. For example, changes introduced inside of the antigen binding portion of the protein may be designed to increase the affinity of the protein for its target.
  • Stabilizing modifications are capable of stabilizing a protein, enhancing the in vitro and/or in vivo half life of a protein, enhancing circulatory half life of a protein and/or reducing proteolytic degradation of a protein.
  • Such stabilizing modifications include but are not limited to fusion proteins, modification of a glycosylation site, and modification of carbohydrate moiety.
  • a stabilizer protein may be any protein which enhances the overall stability of the modified GDF propeptide. As will be recognized by one of ordinary skill in the art, such fusion protein may optionally comprise a linker peptide between the propeptide portion and the stabilizing portion.
  • fusion proteins are prepared such that the second protein is fused in frame with the first protein such that the resulting translated protein comprises both the first and second proteins.
  • a fusion protein may be prepared such that a protein comprising at least one follistatin domain is fused to a second protein (e.g. a stabilizer protein portion.)
  • a second protein e.g. a stabilizer protein portion.
  • Such fusion protein is prepared such that the resulting translated protein contains both the propeptide portion and the stabilizer portion.
  • Proteins comprising at least one follistatin domain can be glycosylated or linked to albumin or a nonproteineous polymer.
  • proteins comprising at least one follistatin domain may be linked to one of a variety of nonproteinaceous polymers, e.g., polyethylene glycol, polypropylene glycol, or polyoxyalkylenes, in the manner set forth in U.S. Patent Numbers 4,640,835; 4,496,689; 4,301 ,144; 4,670,417; 4,791 ,192 or 4,179,337.
  • Proteins are chemically modified by covalent conjugation to a polymer to increase their circulating half-life, for example. Polymers, and methods to attach them to peptides, are also shown in U.S. Pat. Nos. 4,766,106; 4,179,337; 4,495,285; and 4,609,546.
  • Proteins comprising at least one follistatin domain may be pegylated.
  • Pegylation is a process whereby polyethylene glycol (PEG) is attached to a protein in order to extend the half-life of the protein in the body.
  • Pegylation of proteins comprising at least one follistatin domain may decrease the dose or frequency of administration of the proteins needed for an optimal inhibition of GDF-8. Reviews of the technique are provided in Bhadra et al. (2002) Pharmazie, 57: 5-29, and in Harris et al. (2001 ) Clin. Pharmacokinet, 40: 539-551.
  • Proteins comprising at least one follistatin domain can be linked to an Fc region of an IgG molecule. Proteins comprising at least one follistatin domain may be fused adjacent to the Fc region of the IgG molecule, or attached to the Fc region of the IgG molecule via a linker peptide. Use of such linker peptides is well known in the protein biochemistry art.
  • the Fc region may me derived from lgG1 or lgG4, for example.
  • Proteins comprising at least one follistatin domain may be modified to have an altered glycosylation pattern (i.e., altered from the original or native glycosylation pattern).
  • altered means having one or more carbohydrate moieties deleted, and/or having one or more glycosylation sites added to the original protein.
  • N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue.
  • the tripeptide sequences asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain.
  • X is any amino acid except proline
  • O-linked glycosylation refers to the attachment of one of the sugars N-aceylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
  • Addition of glycosylation sites to proteins comprising at least one follistatin domain is conveniently accomplished by altering the amino acid sequence such that it contains one or more of the above-described tripeptide sequences (for N-linked glycosylation sites).
  • the alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the original protein (for O-linked glycosylation sites).
  • the protein amino acid sequence may be altered through changes at the DNA level.
  • Another means of increasing the number of carbohydrate moieties on proteins is by chemical or enzymatic coupling of glycosides to the amino acid residues of the protein. These procedures are advantageous in that they do not require production of the GDF peptide inhibitor in a host cell that has glycosylation capabilities for N- or O-linked glycosylation.
  • the sugars may be attached to (a) arginine and histidine, (b) free carboxyl groups, (c) free sulfhydryl groups such as those of cysteine, (d) free hydroxyl groups such as those of serine, threonine, or hydroxyproline, (e) aromatic residues such as those of phenylalanine, tyrosine, or tryptophan, or (f) the amide group of glutamine.
  • Removal of any carbohydrate moieties present on proteins comprising at least one follistatin domain may be accomplished chemically or enzymatically. Chemical deglycosylation requires exposure of the protein to trifluoromethanesulfonic acid, or an equivalent compound. This treatment results in the cleavage of most or all sugars except the linking sugar (N- acetylglucosamine or N-acetylgalactosamine), while leaving the amino acid sequence intact.
  • Proteins comprising at least one follistatin domain may be linked to the protein albumin or a derivative of albumin.
  • Methods for linking proteins and polypeptides to albumin or albumin derivatives are well known in the art. See, for example, U.S. Patent No. 5,116,944.
  • compositions containing proteins comprising at least one follistatin domain Such compositions may be suitable for pharmaceutical use and administration to patients.
  • the compositions typically contain one or more proteins comprising at least one follistatin domain and a pharmaceutically acceptable excipient.
  • pharmaceutically acceptable excipient includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, that are compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is well known in the art.
  • the compositions may also contain other active compounds providing supplemental, additional, or enhanced therapeutic functions.
  • the pharmaceutical compositions may also be included in a container, pack, or dispenser together with instructions for administration.
  • a pharmaceutical composition of the invention is formulated to be compatible with its intended route of administration. Methods to accomplish the administration are known to those of ordinary skill in the art.
  • the administration may, for example, be intravenous, intramuscular, or subcutaneous.
  • Solutions or suspensions used for subcutaneous application typically include one or more of the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetra acetic acid; buffers such as acetates, citrates or phosphates; and agents for the adjustment of tonicity such as sodium chloride or dextrose.
  • the pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide.
  • Such preparations may be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
  • compositions suitable for injection include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
  • suitable carriers include physiological saline, bacteriostatic water, Cremophor ELTM (BASF, Parsippany, NJ) or phosphate buffered saline (PBS).
  • the composition must be sterile and should be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi.
  • the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyetheylene glycol, and the like), and suitable mixtures thereof.
  • the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
  • Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like.
  • Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate and gelatin.
  • proteins comprising at least one follistatin domain are prepared with carriers that will protect the compound against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems.
  • a controlled release formulation including implants and microencapsulated delivery systems.
  • Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Methods for preparation of such formulations will be apparent to those skilled in the art. The materials can also be obtained commercially from Alza Corporation and Nova Pharmaceuticals, Ind.
  • Liposomal suspensions containing proteins comprising at least one follistatin domain can also be used as pharmaceutically acceptable carriers. These can be prepared according to methods known to those skilled in the art, for example, as described in U.S. Patent No. 4,522,811.
  • Therapeutically useful agents such as growth factors (e.g., BMPs, TGF- ⁇ , FGF, IGF), cytokines (e.g., interleukins and CDFs), antibiotics, and any other therapeutic agent beneficial for the condition being treated may optionally be included in or administered simultaneously or sequentially with, proteins comprising at least one follistatin domain.
  • growth factors e.g., BMPs, TGF- ⁇ , FGF, IGF
  • cytokines e.g., interleukins and CDFs
  • Proteins comprising at least one follistatin domain are useful to prevent, diagnose, or treat various medical disorders in humans or animals. Accordingly, the present invention provides a method for treating diseases and disorders related to muscle cells and tissue, by administering to a subject a composition comprising at least one protein comprising at least one follistatin domain in an amount sufficient to ameliorate the symptoms of the disease.
  • Such disorders include muscular dystrophies, including, but not limited to severe or benign X-linked muscular dystrophy, limb-girdle dystrophy, facioscapulohumeral dystrophy, myotinic dystrophy, distal muscular dystrophy, progressive dystrophic ophthalmoplegia, oculopharyngeal dystrophy, Duchenne's muscular dystrophy, and Fakuyama- type congenital muscular dystophy); amyotrophic lateral sclerosis (ALS); muscle atrophy; organ atrophy; frailty; carpal tunnel syndrome; congestive obstructive pulmonary disease; congenital myopathy; myotonia congenital; familial periodic paralysis; paroxysmal myoglobinuria; myasthenia gravis; Eaton-Lambert syndrome; secondary myasthenia; denervation atrophy; paroxymal muscle atrophy; and sarcopenia, cachexia and other muscle wasting syndromes.
  • the invention also relates to traumatic or
  • the present invention also provides for methods for preventing or treating metabolic diseases or disorders resulting from abnormal glucose homeostasis.
  • diseases or disorders include metabolic diseases and disorders (such as insulin-dependent (type 1) diabetes mellitus, noninsulin- dependent (type 2) diabetes mellitus), hyperglycemia, impaired glucose tolerance, metabolic syndrome (e.g., syndrome X), obesity and insulin resistance induced by trauma (e.g., burns or nitrogen imbalance), adipose tissue disorders (such as obesity), or bone degenerative diseases (such as osteoporosis, especially in the elderly and/or postmenopausal women; glucocorticoid-induced osteoporosis; osteopenia; osteoarthritis; and osteoporosis-related fractures).
  • Yet further examples include low bone mass due to chronic glucocorticoid therapy, premature gonadal failure, androgen suppression, vitamin D deficiency, secondary hyperparathyroidism, nutritional deficiencies, and anorexia
  • the present invention provides a method for treating diabetes mellitus and related disorders, such as obesity or hyperglycemia, by administering to a subject a composition comprising at least one protein comprising at least one follistatin domain in an amount sufficient to ameliorate the symptoms of the disease.
  • Type 2 or noninsulin-dependent diabetes mellitus NIDDM
  • NIDDM noninsulin-dependent diabetes mellitus
  • subjects suffering from type 2 diabetes can be treated according to the present invention by administration of protein comprising at least one follistatin domain, which increases sensitivity to insulin and glucose uptake by cells.
  • Proteins comprising at least one follistatin domain may be used to inhibit or reduce one or more activities associated with the GDF-8 protein (whether in monomeric form, dimeric active form, or complexed in a GDF-8 latent complex), relative to a GDF-8 protein not bound by the same protein.
  • the activity of the mature GDF-8 protein, when bound by a protein comprising at least one follistatin domain, is inhibited at least 50%, or at least 60, 62, 64, 66, 68, 70, 72, 72, 76, 78, 80, 82, 84, 86, or 88%, or at least 90, 91 , 92, 93, or 94%, or at least 95% to 100% relative to a mature GDF-8 protein that is not bound by a protein having a follistatin domain.
  • an "effective amount" of the protein is a dosage which is sufficient to reduce the activity of GDF-8 to achieve a desired biological outcome.
  • the desired biological outcome may be any therapeutic benefit including an increase in muscle mass, an increase in muscle strength, improved metabolism, decreased adiposity, or improved glucose homeostasis.
  • Such improvements may be measured by a variety of methods including those that measure lean and fat body mass (such as duel x-ray scanning analysis), muscle strength, serum lipids, serum leptin, serum glucose, glycated hemoglobin, glucose tolerance, and improvement in the secondary complication of diabetes.
  • a therapeutically effective amount may vary with the subject's age, condition, and sex, as well as the severity of the medical condition in the subject.
  • the dosage may be determined by an physician and adjusted, as necessary, to suit observed effects of the treatment.
  • Appropriate dosages for administering at least one protein comprising at least one follistatin domain may range from 5 mg to 100 mg, from 15 mg to 85 mg, from 30 mg to 70 mg, or from 40 mg to 60 mg. Proteins can be administered in one dose, or at intervals such as once daily, once weekly, and once monthly. Dosage schedules can be adjusted depending on the affinity of the protein for GDF-8, the half life of the protein, or the severity of the patient's condition.
  • the compositions are administered as a bolus dose, to maximize the circulating levels of proteins comprising at least one follistatin domain for the greatest length of time after the dose. Continuous infusion may also be used after the bolus dose.
  • Toxicity and therapeutic efficacy of such compounds can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD 50 (the dose lethal to 50% of the population) and the ED 0 (the dose therapeutically effective in 50% of the population).
  • the dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio LD 5 o/ED 50 .
  • Proteins comprising at least one follistatin domain which exhibit large therapeutic indices may be used.
  • the dosage of such compounds may lie within a range of circulating concentrations that include the ED 50 with little or no toxicity.
  • the dosage may vary within this range depending upon the dosage form employed and the route of administration utilized.
  • the therapeutically effective dose can be estimated initially from cell culture assays.
  • a dose may be formulated in animal models to achieve a circulating plasma concentration range that includes the IC 50 (i.e., the concentration of the test protein which achieves a half-maximal inhibition of symptoms) as determined in cell culture.
  • Levels in plasma may be measured, for example, by high performance liquid chromatography.
  • bioassays include GDF-8 protein/receptor binding assays, creatine kinase assays, assays based on glucose uptake in adipocytes, and immunological assays.
  • the present invention also provides gene therapy for the in vivo production of proteins comprising at least one follistatin domain. Such therapy would achieve its therapeutic effect by introduction of the polynucleotide sequences into cells or tissues having the disorders as listed herein.
  • Delivery of polynucleotide sequences of proteins comprising at least one follistatin domain can be achieved using a recombinant expression vector such as a chimeric virus or a colloidal dispersion system.
  • Target liposomes may be used for therapeutic delivery of the polynucleotide sequences.
  • Various viral vectors which can be utilized for gene therapy include adenovirus, herpes virus, vaccinia, or an RNA virus such as a retrovirus.
  • the retroviral vector may be a derivative of a murine or avian retrovirus.
  • retroviral vectors in which a single foreign gene can be inserted include, but are not limited to: Moloney murine leukemia virus (MoMuLV), Harvey murine sarcoma virus (HaMuSV), murine mammary tumor virus (MuMTV), and Rous sarcoma virus (RSV).
  • MoMuLV Moloney murine leukemia virus
  • HaMuSV Harvey murine sarcoma virus
  • MuMTV murine mammary tumor virus
  • RSV Rous sarcoma virus
  • retroviral vectors can incorporate multiple genes. All of these vectors can transfer or incorporate a gene for a selectable marker so that transduced cells can be identified and generated.
  • Retroviral vectors can be made target specific by attaching, for example, a sugar, a glycolipid, or a protein. Targeting may be accomplished by using an antibody. Those of skill in the art will recognize that specific polynucleotide sequences can be inserted into the retroviral genome or attached to a viral envelope to allow target specific delivery of the retroviral vector containing the polynucleotide of proteins comprising at least one follistatin domain. In one embodiment, the vector is targeted to muscle cells or muscle tissue.
  • helper cell lines that contain plasmids encoding all of the structural genes of the retrovirus under the control of regulatory sequences within the LTR. These plasmids are missing a nucleotide sequence which enables the packaging mechanism to recognize an RNA transcript for encapsidation.
  • Helper cell lines which have deletions of the packaging signal include, but are not limited to PSI.2, PA317 and PA12, for example. These cell lines produce empty virions, since no genome is packaged. If a retroviral vector is introduced into such cells in which the packaging signal is intact, but the structural genes are replaced by other genes of interest, the vector can be packaged and vector virion produced.
  • tissue culture cells can be directly transfected with plasmids encoding the retroviral structural genes gag, pol and env, by conventional calcium phosphate transfection. These cells are then transfected with the vector plasmid containing the genes of interest. The resulting cells release the retroviral vector into the culture medium.
  • Another targeted delivery system for a polynucleotide of a protein comprising at least one follistatin domain is a colloidal dispersion system.
  • Colloidal dispersion systems include macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in- water emulsions, micelles, mixed micelles, and liposomes.
  • Liposomes are artificial membrane vesicles which are useful as delivery vehicles in vitro and in vivo.
  • RNA, DNA and intact virions can be encapsulated within the aqueous interior and be delivered to cells in a biologically active form (see, for example, Fraley, et al. (1981 ) Trends Biochem. Sci., 6: 77).
  • compositions of the liposome is usually a combination of phospholipids, usually in combination with steroids, especially cholesterol. Other phospholipids or other lipids may also be used.
  • the physical characteristics of liposomes depend on pH, ionic strength, and the presence of divalent cations.
  • lipids useful in liposome production include phosphatidyl compounds, such as phosphatidylglycerol, phosphatidylcholine, phosphatidylserine, phosphatidylethanolamine, sphingolipids, cerebrosides, and gangliosides.
  • Illustrative phospholipids include egg phosphatidylcholine, dipalmitoylphosphatidylcholine and distearoylphosphatidylcholine.
  • the targeting of liposomes is also possible based on, for example, organ- specificity, cell-specificity, and organelle-specificity and is known in the art.
  • the cells expressing proteins comprising at least one follistatin domain can be delivered by direct application, for example, direct injection of a sample of such cells into the site of tissue damage. These cells can be purified.
  • the such cells can be delivered in a medium or matrix which partially impedes their mobility so as to localize the cells to a site of injury.
  • a medium or matrix could be semi- solid, such as a paste or gel, including a gel-like polymer.
  • the medium or matrix could be in the form of a solid, a porous solid which will allow the migration of cells into the solid matrix, and hold them there while allowing proliferation of the cells.
  • Proteins comprising at least one follistatin domain may be used to detect the presence or level of GDF-8, in vivo or in vitro. By correlating the presence or level of these proteins with a medical condition, one of skill in the art can diagnose the associated medical condition.
  • the medical conditions that may be diagnosed by the proteins comprising at least one follistatin domain are set forth herein.
  • Such detection methods are well known in the art and include ELISA, radioimmunoassay, immunoblot, western blot, immunofluorescence, immuno-precipitation, and other comparable techniques.
  • Proteins comprising at least one follistatin domain may further be provided in a diagnostic kit that incorporates one or more of these techniques to detect GDF-8.
  • a diagnostic kit may contain other components, packaging, instructions, or other material to aid the detection of the protein and use of the kit.
  • proteins comprising at least one follistatin domain are intended for diagnostic purposes, it may be desirable to modify them, for example with a ligand group (such as biotin) or a detectable marker group (such as a fluorescent group, a radioisotope or an enzyme).
  • a ligand group such as biotin
  • a detectable marker group such as a fluorescent group, a radioisotope or an enzyme
  • the proteins may be labeled using conventional techniques. Suitable labels include fluorophores, chromophores, radioactive atoms, electron-dense reagents, enzymes, and ligands having specific binding partners. Enzymes are typically detected by their activity.
  • horseradish peroxidase is usually detected by its ability to convert 3,3',5,5'-tetramethylbenzidine (TMB) to a blue pigment, quantifiable with a spectrophotometer.
  • TMB 3,3',5,5'-tetramethylbenzidine
  • Other suitable binding partners include biotin and avidin or streptavidin, IgG and protein A, and the numerous receptor-ligand couples known in the art.
  • Other permutations and possibilities will be readily apparent to those of ordinary skill in the art, and are considered as equivalents within the scope of the instant invention.
  • Proteins comprising at least one follistatin domain or fragments thereof may also be useful for isolating GDF-8 in a purification process.
  • proteins may be immobilized, for example, through incorporation into a column or resin. The proteins are used to bind GDF-8, and then subject to conditions which result in the release of the bound GDF-8. Such processes may be used for the commercial production of GDF-8.
  • N-hydroxysuccinimidyl-activated beads (4% beaded agarose, Sigma H-8635, St Louis MO) were washed in MilliQ-H 2 0 and incubated for 4 hours at 4°C with the anti-GDF-8 JA16 monoclonal antibody (3-4 ⁇ g/ ⁇ l in 100 mM MOPS, pH 7.5) at a ratio to allow a final concentration of 10 mg JA16/ml resin.
  • Beads were washed extensively with 100 mM MOPS pH 7.5 and phosphate-buffered saline (PBS) (Ausubel et al, (1999) Current Protocols in Molecular Biology, John Wiley & Sons) and stored at 4°C in PBS until use. Control beads were prepared identically without JA16 antibody.
  • a total of 40 ⁇ l of packed JA16-conjugated or control beads were incubated with 15 ml normal Balb/C mouse serum (Golden West Biologicals, Temecula CA) or 30 ml pooled normal human serum (ICN Biomedical, Aurora OH) for 3 hours at 4°C. Beads were washed twice in -10 ml of cold 1 % Triton X-100/PBS, twice in -10 ml of cold 0.1% Triton X- 100/PBS, and twice in -1 ml of cold PBS. Proteins were eluted from the beads in three subsequent steps.
  • the beads were treated to a 'mock elution', where 100 ⁇ l of PBS was added to the beads and incubated at 4°C for 30 minutes. The supernatant was collected and combined with 30 ⁇ l 4x LDS sample buffer (Invitrogen, Carlsbad CA).
  • the beads were subject to a 'peptide elution', 100 ⁇ l of 1 ⁇ g/ ⁇ l competing peptide (sequence: DFGLDSDEHSTESRSSRYPLTVDFEAFGWD-COOH (SEQ ID NO:12)) in PBS was added to the beads and again incubated at 4°C for 30 minutes. The supernatant was collected as before.
  • the beads were treated with an 'SDS elution' technique, where 30 ⁇ l of 4x LDS buffer (Invitrogen) and 100 ⁇ l of PBS was added to the beads and heated to 80°C for 10 minutes before transferring the supernatant to a fresh tube.
  • 4x LDS buffer Invitrogen
  • FIG. 1 A silver stained gel of the proteins released in each of the elution steps is shown in Figure 1.
  • Two protein bands in the silver-stained gel shown in Figure 1 of approximately 12 and 36 kDa were specifically eluted from JA16-conjugated beads, but not from unconjugated control beads.
  • MS/MS data was collected using an LCQ Deca or LCQ Deca XP (Finnigan, San Jose CA) mass spectrometer and searched against the NCBI non-redundant database using the Sequest program (Finnigan). Unless otherwise noted, all peptide sequences listed in this paper corresponded to MS/MS spectra that were deemed high quality by manual inspection and produced X ⁇ ,- scores > 2.5 in the Sequest scoring system.
  • Proteins were transferred to a 0.45 ⁇ m nitrocellulose membrane (Invitrogen) and blocked with blocking buffer (5% non-fat dry milk in Tris- buffered saline (TBS: 10 mM Tris-CI, pH 7.5, 150 mM NaCl)) at 4°C overnight. Blots were then probed with primary antibody diluted 1 :1000 in blocking buffer for 1-3 hours at room temperature, washed 5x with TBS, probed with horseradish peroxidase-conjugated secondary antibody in blocking buffer for 1-3 hours at room temperature, and washed as before. Signals were detected by autoradiography using the West Pico Substrate (Pierce).
  • Table 1 lists peptides derived from GDF-8 (SEQ ID NO:13-20), GDF-8 propeptide (SEQ ID NO:21-27), FLRG (SEQ ID NO:28-30), and GASP1 (SEQ ID NO:31-35) that were found in JA16 immunoprecipitates from mouse and human serum.
  • the immediately preceding amino acid in the protein sequence is shown in parentheses for each peptide and the charge state of the peptide (z) and the Sequest program correlation coefficient (X co rr, a measure of confidence) are listed.
  • the sequence listing numbers in the table refer only to the isolated peptides and their sequences.
  • the preceding amino acids in parentheses are not included in the peptides, but are provided only for reference. All spectra were confirmed by manual inspection.
  • GASP1 The sequences of the GASP1 transcript and protein were predicted prior to the actual cloning of GASP1 ( Figure 6).
  • GASP1 was predicted to be a 571 amino acid protein with a predicted molecular mass of 63 kDa. It has a putative signal sequence/cleavage site at its N-terminus and two possible sites for N-glycosylation at amino acids 314 and 514.
  • Analysis of the GASP1 protein sequence by Pfam and BLAST (according to the techniques in Altschul et a/.(1990) J. Mol. Biol., 215: 403-410; Bateman et al.
  • GASP1 contains many conserved domains, including a WAP domain, a follistatin/Kazal domain, an immunoglobulin domain, two tandem Kunitz domains, and a netrin domain ( Figure 14A).
  • WAP domains originally identified in whey acidic protein, contain 8 cysteines that form a four-disulfide core and are often found in proteins with anti-protease activity (Hennighausen and Sippel (1982) Nucleic Acids Res., 10: 2677-2684; Seemuller et al. (1986) FEBS Lett., 199: 43-48).
  • follistatin domain mediates the interaction between GDF- 8 and GASPL
  • the C-terminal region of follistatin domains contains a similarity to Kazal serine protease inhibitor domains.
  • this region is even more closely related to Kazal domains than in follistatin or FLRG, suggesting the possibility that this region may have an additional protease inhibitor function.
  • Kunitz domains originally identified in bovine pancreatic trypsin inhibitor, also inhibit serine proteases, thus establishing a likely role for GASP1 in the regulation of this class of proteins.
  • GASP1 is likely to inhibit the activity of proteases, perhaps regulating GDF-8 processing or activation of the latent GDF-8 complex.
  • GASP2 contains the same domain structure as GASP1 , suggesting that these proteins define a two member family of multivalent protease inhibitors ( Figure 14B). Interestingly, only peptides corresponding to GASP1 , not GASP2, were found in our JA16 purified samples. This result suggests that GASP1 and GASP2 likely have different biological specificity. Both GASP1 and GASP2 are conserved in humans (>90% identity with mouse). The sequence for human GASP1 is now available in the NCBI nr database under the accession number gi
  • GDF-8 is produced nearly exclusively in skeletal muscle.
  • a 551 bp fragment of GASP1 was amplified from first-strand cDNA produced from a variety of mouse tissues and staged embryos ( Figure 10).
  • a mouse GASP1 fragment was amplified from normalized mouse first-strand cDNA panels (Clontech, Palo Alto CA) using the Advantage cDNA PCR kit (Clontech) according to the manufacturer's recommendations (forward primer: 5'
  • GASP1 appears to be fairly widely-expressed, with particularly high expression in skeletal muscle and heart. Significant expression is also seen in brain, lung, and testis. In contrast, liver and kidney express relatively low levels of GASP1 mRNA. Developmentally, the level of GASP1 mRNA remains fairly constant, perhaps increasing slightly between day 7 and day 11 of mouse embryogenesis.
  • the GASP1 coding sequence was amplified from mouse heart QUICKCLONE cDNA (Clontech) by PCR with PfuTurbo polymerase (Stratagene) using the following primers (fp: 5'
  • the nucleotide sequence of the mouse GASP1 clone is shown in Figure 13.
  • This clone matched the predicted Celera sequence, with the exception of some base substitutions in wobble codons that did not change the predicted amino acid sequence (i.e., 288C:G; 294G:A; 615G:A; 738A:G; 768C:T; 1407A:G; 1419A:G; and 1584C:G, where the first base at the indicated position is that reported by Celera and the second base is that obtained from sequencing of the clone; see Figure 6A and B).
  • GASP1-V5-His a mammalian expression vector encoding mouse GASP1 cloned with a C-terminal V5-His tag.
  • Serum- free conditioned media was harvested 48 hours later and analyzed by western blot analysis with an anti-V5 polyclonal antibody (Sigma). More specifically, conditioned media was collected 48 hours after transfection of COS1 cells with GASP1-V5-His/pcDNA3.1 D-V5-His-TOPO or empty vector using the FuGENE 6 reagent (Roche) in serum-free Dulbecco's modified Eagle's medium.
  • GASP1 had the same binding pattern to GDF-8 as GASP1 isolated from mouse serum.
  • 400 ⁇ l conditioned media from vector- or GASP1 -transfected cells was combined with 1.2 ⁇ g of recombinant purified GDF-8 and/or GDF-8 propeptide protein (Thies et al., 2001).
  • JA16 (10 ⁇ l packed volume) or anti-V5 (30 ⁇ l) conjugated agarose beads were incubated with the supplemented conditioned media for two hours at 4°C and washed twice in cold 1% Triton in phosphate-buffered saline (PBS) and twice in PBS. Beads were resuspended in 50 ⁇ l 1x LDS buffer with DTT. Western blots were performed as previously described (Hill ef a/., 2002).
  • GDF-8 propeptide also co-purified with GASP1 , even in the absence of GDF-8 (lane 4), suggesting that GDF-8 propeptide can bind directly to GASP1.
  • GASP1 binds to both GDF-8 and GDF-8 propeptide independently. This is in contrast to FLRG, another follistatin- domain protein, that binds exclusively to mature GDF-8 (Hill et al. (2002) J. Biol. Chem., 277: 40735-40741 ).
  • Addition of both GDF-8 and propeptide consistently showed less propeptide binding to GASP1 than when propeptide was added alone. This observation suggests that GASP1 may not bind to the GDF-8 small latent complex.
  • Example 11 GASP1 -Mediated Inhibition of GDF-8 and BMP-11 , But Not Activin or TGF- ⁇ 1, Activity
  • a luciferase reporter construct pGL3-(CAGA) 12 (SEQ ID NO:53) (Dennler et al. (1998) EMBO J., 17: 3091-3100) was transiently transfected into A204 or RD rhabdomyosarcoma cells. Dilutions of conditioned media from vector or GASP1 transfected cells were incubated for 30 minutes at 37 °C with 10 ng/ml GDF-8, 10 ng/ml BMP-11 , 10 ng/ml rh activin A (R&D Systems), or 0.5 ng/ml rh TGF- ⁇ 1 (R&D Systems). Luciferase activity was measured according to Thies et al.
  • follistatin-domain proteins Two follistatin-domain proteins, follistatin and FLRG inhibit GDF- 8 activity in a (CAGA) ⁇ 2 (SEQ ID NO:53) luciferase transcriptional reporter assay, but also inhibit the biological activity of the related proteins, activin and BMP-11.
  • the ability of GASP1 to inhibit GDF-8, BMP-11 , activin, and TGF- ⁇ 1 activity in the (CAGA) ⁇ 2 (SEQ ID NO:53) reporter assay was also tested.
  • GASP1 similarly inhibited the activity of BMP-11 in this assay ( Figure 16B), as might be expected since mature GDF-8 and BMP-11 are highly conserved and differ by only 11 amino acids. Surprisingly, GASP1 did not inhibit the activity of activin or TGF- ⁇ 1 ( Figure 16C and D), suggesting a very high level of specificity, which is not demonstrated by follistatin itself. Thus, GASP1 exhibits specificity in its inhibition of GDF-8 and BMP-11.
  • GASP1-V5-His protein was purified from conditioned media on a cobalt affinity column and eluted as described above. Fractions containing GASP1 were further purified by size exclusion chromatography in PBS using a BioSepS3000 column (Phenomenex). As shown in Figure 17, GASP1 inhibited GDF-8 with an IC50 of approximately 3 nM.
  • GASP1 may be administered to patients suffering from a disease or disorder related to the functioning of GDF-8 according to Table 2. Patients take the composition one time or at intervals, such as once daily, and the symptoms of their disease or disorder improve. For example, symptoms related to a muscle disorder are improved, as measured by muscle mass, muscle activity, and or muscle tone. This shows that the composition of the invention is useful for the treatment of diseases or disorders related to the functioning of GDF-8, such as muscle disorders.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Diabetes (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Zoology (AREA)
  • Endocrinology (AREA)
  • Genetics & Genomics (AREA)
  • Obesity (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Neurology (AREA)
  • Rheumatology (AREA)
  • Hematology (AREA)
  • Immunology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Molecular Biology (AREA)
  • Epidemiology (AREA)
  • Biomedical Technology (AREA)
  • Emergency Medicine (AREA)
  • Wood Science & Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Marine Sciences & Fisheries (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Physics & Mathematics (AREA)
  • Microbiology (AREA)
PCT/US2003/005151 2002-02-21 2003-02-21 Gasp1: a follistatin domain containing protein Ceased WO2003072715A2 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
CA002476887A CA2476887A1 (en) 2002-02-21 2003-02-21 Gasp1:a follistatin domain containing protein
BRPI0307907-4A BR0307907A2 (pt) 2002-02-21 2003-02-21 gasp1: proteìna contendo domìnio de folistatina
MXPA04008150A MXPA04008150A (es) 2002-02-21 2003-02-21 Gasp1: una proteina que contiene dominio de folistatina.
EP03713568A EP1572909A4 (en) 2002-02-21 2003-02-21 PROTEIN CONTAINING A DOMAINE OF FOLLISTATIN
JP2003571403A JP4429729B2 (ja) 2002-02-21 2003-02-21 Gasp1;フォリスタチンドメイン含有タンパク質
KR10-2004-7012977A KR20040094709A (ko) 2002-02-21 2003-02-21 폴리스타틴 도메인을 포함하는 단백질
IL16352503A IL163525A0 (en) 2002-02-21 2003-02-21 A follistatin domain containing protein
AU2003217612A AU2003217612A1 (en) 2002-02-21 2003-02-21 GASP1: a follistatin domain containing protein
NO20043886A NO20043886L (no) 2002-02-21 2004-09-16 Et follistatindomene som inneholder proteiner

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US35784502P 2002-02-21 2002-02-21
US60/357,845 2002-02-21
US43464402P 2002-12-20 2002-12-20
US60/434,644 2002-12-20

Publications (3)

Publication Number Publication Date
WO2003072715A2 true WO2003072715A2 (en) 2003-09-04
WO2003072715A8 WO2003072715A8 (en) 2005-01-13
WO2003072715A3 WO2003072715A3 (en) 2006-11-02

Family

ID=27767536

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2003/005151 Ceased WO2003072715A2 (en) 2002-02-21 2003-02-21 Gasp1: a follistatin domain containing protein

Country Status (12)

Country Link
US (4) US7192717B2 (enExample)
EP (1) EP1572909A4 (enExample)
JP (2) JP4429729B2 (enExample)
KR (1) KR20040094709A (enExample)
AU (1) AU2003217612A1 (enExample)
BR (1) BR0307907A2 (enExample)
CA (1) CA2476887A1 (enExample)
IL (1) IL163525A0 (enExample)
MX (1) MXPA04008150A (enExample)
NO (1) NO20043886L (enExample)
PL (1) PL375045A1 (enExample)
WO (1) WO2003072715A2 (enExample)

Cited By (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1438068A4 (en) * 2001-09-26 2005-11-16 Wyeth Corp GDF-8 INHIBITOR ANTIBODIES AND USES THEREOF
JP2005323584A (ja) * 2004-04-15 2005-11-24 Techno Network Shikoku Co Ltd フォリスタチン変異体ポリペプチド
WO2006020884A3 (en) * 2004-08-12 2006-04-27 Wyeth Corp Combination therapy for diabetes, obesity, and cardiovascular diseases using gdf-8 inhibitors
WO2006107611A3 (en) * 2005-03-23 2007-04-26 Wyeth Corp Detection of an immune response to gdf-8 modulating agents
WO2006102574A3 (en) * 2005-03-23 2007-05-24 Wyeth Corp Detection of gdf-8 modulating agents
US7560441B2 (en) 2001-02-08 2009-07-14 Wyeth Modified and stabilized GDF propeptides and uses thereof
US7655763B2 (en) 2002-10-22 2010-02-02 Wyeth Neutralizing antibodies against GDF-8 and uses therefor
US7785587B2 (en) 2003-06-02 2010-08-31 Wyeth Therapeutic methods for muscular or neuromuscular disorders
US7888486B2 (en) 2005-08-19 2011-02-15 Wyeth Llc Antagonist antibodies against GDF-8
AU2005256519B2 (en) * 2004-06-28 2011-10-13 Merck Patent Gmbh Fc-interferon-beta fusion proteins
US8992913B2 (en) 2012-06-15 2015-03-31 Pfizer Inc. Antagonist antibodies against GDF-8 and uses therefor
WO2016120647A2 (en) 2015-01-30 2016-08-04 Debreceni Egyetem Muscle regeneration
WO2016181177A2 (en) 2015-05-14 2016-11-17 Alu-Öntö Kft. Casting process and sand mould provided with an inlet system for producing at least partly thin walled aluminium casts with sand moulding technology by means of gravity casting

Families Citing this family (124)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
MXPA04008149A (es) 2002-02-21 2005-06-17 Wyeth Corp Proteinas que contienen dominios de folistatina.
MXPA04008150A (es) * 2002-02-21 2005-06-17 Wyeth Corp Gasp1: una proteina que contiene dominio de folistatina.
BR0314270A (pt) * 2002-09-16 2005-08-02 Univ Johns Hopkins Ativação de miostatina com metaloprotease e processos de modulação da atividade da miostatina
US20040223966A1 (en) * 2002-10-25 2004-11-11 Wolfman Neil M. ActRIIB fusion polypeptides and uses therefor
ES2564694T3 (es) 2003-09-12 2016-03-28 Vessix Vascular, Inc. Sistema de remodelación y / o ablación excéntrica seleccionable de material ateroesclerótico
ES2551852T3 (es) * 2004-07-23 2015-11-24 Acceleron Pharma Inc. Polipéptidos del receptor ActRII
US7300773B2 (en) 2004-08-27 2007-11-27 Wyeth Research Ireland Limited Production of TNFR-Ig
US7294484B2 (en) 2004-08-27 2007-11-13 Wyeth Research Ireland Limited Production of polypeptides
TWI374935B (en) 2004-08-27 2012-10-21 Pfizer Ireland Pharmaceuticals Production of α-abeta
US8396548B2 (en) 2008-11-14 2013-03-12 Vessix Vascular, Inc. Selective drug delivery in a lumen
US9713730B2 (en) 2004-09-10 2017-07-25 Boston Scientific Scimed, Inc. Apparatus and method for treatment of in-stent restenosis
US8128933B2 (en) 2005-11-23 2012-03-06 Acceleron Pharma, Inc. Method of promoting bone growth by an anti-activin B antibody
EA201692543A1 (ru) 2005-11-23 2017-08-31 Акселерон Фарма Инк. Антагонисты активина-actriia и их применение для стимулирования роста кости
US7790161B2 (en) * 2006-03-28 2010-09-07 Wyeth Llc GDF-9/BMP-15 modulators for the treatment of bone disorders
US8019435B2 (en) 2006-05-02 2011-09-13 Boston Scientific Scimed, Inc. Control of arterial smooth muscle tone
EP2076193A4 (en) 2006-10-18 2010-02-03 Minnow Medical Inc MATCHED RF-ENERGY AND ELECTRO-TISSUE CHARACTERIZATION FOR THE SELECTIVE TREATMENT OF TARGET TISSUE
ES2560006T3 (es) 2006-10-18 2016-02-17 Vessix Vascular, Inc. Inducción de efectos de temperatura deseables sobre tejido corporal
WO2008049087A2 (en) 2006-10-18 2008-04-24 Minnow Medical, Inc. System for inducing desirable temperature effects on body tissue
US20100028332A1 (en) * 2006-12-18 2010-02-04 Acceleron Pharma Inc. Antagonists of actriib and uses for increasing red blood cell levels
EP2468291B1 (en) 2006-12-18 2017-11-22 Acceleron Pharma, Inc. Activin-actrii antagonists and uses for increasing red blood cell levels
US8895016B2 (en) * 2006-12-18 2014-11-25 Acceleron Pharma, Inc. Antagonists of activin-actriia and uses for increasing red blood cell levels
CA2677007A1 (en) * 2007-02-01 2008-08-07 Acceleron Pharma Inc. Activin-actriia antagonists and uses for treating or preventing breast cancer
TWI782836B (zh) 2007-02-02 2022-11-01 美商艾瑟勒朗法瑪公司 衍生自ActRIIB的變體與其用途
CA3039330C (en) * 2007-02-09 2021-11-09 Acceleron Pharma Inc. Activin-actriia antagonists and uses for promoting bone growth in cancer patients
US8236751B2 (en) 2007-03-07 2012-08-07 The Johns Hopkins University Methods of increasing muscle mass using follistatin-like related gene (FLRG)
CN103877564A (zh) 2007-09-18 2014-06-25 阿塞勒隆制药公司 活化素-actriia拮抗剂和减少或抑制fsh分泌的用途
WO2009054967A2 (en) * 2007-10-22 2009-04-30 Synthes (U.S.A.) Compositions for delivery of glycopeptide antibiotics
US8637455B2 (en) * 2007-10-22 2014-01-28 Affinergy, Llc Compositions and methods for delivery of glycopeptide antibiotics to medical device surfaces
PE20091163A1 (es) 2007-11-01 2009-08-09 Wyeth Corp Anticuerpos para gdf8
US20100008918A1 (en) * 2008-06-26 2010-01-14 Acceleron Pharma Inc. Methods for dosing an actriib antagonist and monitoring of treated patients
JP5922928B2 (ja) 2008-08-14 2016-05-24 アクセルロン ファーマ, インコーポレイテッド 赤血球レベルを高めるためのgdfトラップの使用
US8216997B2 (en) 2008-08-14 2012-07-10 Acceleron Pharma, Inc. Methods for increasing red blood cell levels and treating anemia using a combination of GDF traps and erythropoietin receptor activators
KR20110104504A (ko) 2008-11-17 2011-09-22 미노우 메디컬, 인코포레이티드 조직 토폴로지의 지식 여하에 따른 에너지의 선택적 축적
EP2387412A4 (en) * 2009-01-13 2013-04-03 Acceleron Pharma Inc PROCESS FOR INCREASING THE ADIPONECTIN MIRROR
CN102482339B (zh) 2009-06-08 2015-06-17 阿塞勒隆制药公司 用于增加产热脂肪细胞的方法
EP2440577A4 (en) 2009-06-12 2013-01-23 Acceleron Pharma Inc SHORTEN ACTRIIB FC FUSION PROTEINS
CA2773494A1 (en) * 2009-09-09 2011-03-17 Acceleron Pharma Inc. Actriib antagonists and dosing and uses thereof
CA2779472C (en) * 2009-11-03 2021-03-16 Acceleron Pharma Inc. The use of a composition comprising an activin type iib receptor polypeptide in the treatment of fatty liver disease
ES2658292T3 (es) 2009-11-17 2018-03-09 Acceleron Pharma, Inc. Proteínas ActRIIB y variantes y usos de las mismas con respecto a la inducción de la utrofina para el tratamiento de la distrofia muscular
CN103068330B (zh) 2010-04-09 2016-06-29 Vessix血管股份有限公司 用于治疗组织的功率发生和控制装置
US9192790B2 (en) 2010-04-14 2015-11-24 Boston Scientific Scimed, Inc. Focused ultrasonic renal denervation
WO2011149096A1 (ja) * 2010-05-27 2011-12-01 国立大学法人 東京大学 インスリン抵抗性改善薬
US8473067B2 (en) 2010-06-11 2013-06-25 Boston Scientific Scimed, Inc. Renal denervation and stimulation employing wireless vascular energy transfer arrangement
US9358365B2 (en) 2010-07-30 2016-06-07 Boston Scientific Scimed, Inc. Precision electrode movement control for renal nerve ablation
US9408661B2 (en) 2010-07-30 2016-08-09 Patrick A. Haverkost RF electrodes on multiple flexible wires for renal nerve ablation
US9463062B2 (en) 2010-07-30 2016-10-11 Boston Scientific Scimed, Inc. Cooled conductive balloon RF catheter for renal nerve ablation
US9084609B2 (en) 2010-07-30 2015-07-21 Boston Scientific Scime, Inc. Spiral balloon catheter for renal nerve ablation
US9155589B2 (en) 2010-07-30 2015-10-13 Boston Scientific Scimed, Inc. Sequential activation RF electrode set for renal nerve ablation
JP2013535981A (ja) 2010-08-20 2013-09-19 ワイス・エルエルシー 成長因子不含適合細胞の細胞培養
US8974451B2 (en) 2010-10-25 2015-03-10 Boston Scientific Scimed, Inc. Renal nerve ablation using conductive fluid jet and RF energy
US9220558B2 (en) 2010-10-27 2015-12-29 Boston Scientific Scimed, Inc. RF renal denervation catheter with multiple independent electrodes
CN103298832A (zh) 2010-11-08 2013-09-11 阿塞勒隆制药公司 Actriia结合剂及其用途
US9028485B2 (en) 2010-11-15 2015-05-12 Boston Scientific Scimed, Inc. Self-expanding cooling electrode for renal nerve ablation
US9089350B2 (en) 2010-11-16 2015-07-28 Boston Scientific Scimed, Inc. Renal denervation catheter with RF electrode and integral contrast dye injection arrangement
US9668811B2 (en) 2010-11-16 2017-06-06 Boston Scientific Scimed, Inc. Minimally invasive access for renal nerve ablation
US9326751B2 (en) 2010-11-17 2016-05-03 Boston Scientific Scimed, Inc. Catheter guidance of external energy for renal denervation
US9060761B2 (en) 2010-11-18 2015-06-23 Boston Scientific Scime, Inc. Catheter-focused magnetic field induced renal nerve ablation
US9192435B2 (en) 2010-11-22 2015-11-24 Boston Scientific Scimed, Inc. Renal denervation catheter with cooled RF electrode
US9023034B2 (en) 2010-11-22 2015-05-05 Boston Scientific Scimed, Inc. Renal ablation electrode with force-activatable conduction apparatus
US20120157993A1 (en) 2010-12-15 2012-06-21 Jenson Mark L Bipolar Off-Wall Electrode Device for Renal Nerve Ablation
WO2012100095A1 (en) 2011-01-19 2012-07-26 Boston Scientific Scimed, Inc. Guide-compatible large-electrode catheter for renal nerve ablation with reduced arterial injury
WO2013013156A2 (en) 2011-07-20 2013-01-24 Boston Scientific Scimed, Inc. Percutaneous devices and methods to visualize, target and ablate nerves
EP2734264B1 (en) 2011-07-22 2018-11-21 Boston Scientific Scimed, Inc. Nerve modulation system with a nerve modulation element positionable in a helical guide
WO2013055826A1 (en) 2011-10-10 2013-04-18 Boston Scientific Scimed, Inc. Medical devices including ablation electrodes
EP2765940B1 (en) 2011-10-11 2015-08-26 Boston Scientific Scimed, Inc. Off-wall electrode device for nerve modulation
US9420955B2 (en) 2011-10-11 2016-08-23 Boston Scientific Scimed, Inc. Intravascular temperature monitoring system and method
US9364284B2 (en) 2011-10-12 2016-06-14 Boston Scientific Scimed, Inc. Method of making an off-wall spacer cage
EP2768568B1 (en) 2011-10-18 2020-05-06 Boston Scientific Scimed, Inc. Integrated crossing balloon catheter
EP2768563B1 (en) 2011-10-18 2016-11-09 Boston Scientific Scimed, Inc. Deflectable medical devices
KR20170021919A (ko) 2011-10-21 2017-02-28 화이자 인코포레이티드 철을 첨가하여 세포 배양을 개선하는 방법
US8951251B2 (en) 2011-11-08 2015-02-10 Boston Scientific Scimed, Inc. Ostial renal nerve ablation
US9119600B2 (en) 2011-11-15 2015-09-01 Boston Scientific Scimed, Inc. Device and methods for renal nerve modulation monitoring
US9119632B2 (en) 2011-11-21 2015-09-01 Boston Scientific Scimed, Inc. Deflectable renal nerve ablation catheter
US9265969B2 (en) 2011-12-21 2016-02-23 Cardiac Pacemakers, Inc. Methods for modulating cell function
AU2012358143B2 (en) 2011-12-23 2015-06-11 Boston Scientific Scimed, Inc. Expandable balloon or an electrode pad with a heat sensing device
EP2797534A1 (en) 2011-12-28 2014-11-05 Boston Scientific Scimed, Inc. Device and methods for nerve modulation using a novel ablation catheter with polymeric ablative elements
US9050106B2 (en) 2011-12-29 2015-06-09 Boston Scientific Scimed, Inc. Off-wall electrode device and methods for nerve modulation
WO2013169927A1 (en) 2012-05-08 2013-11-14 Boston Scientific Scimed, Inc. Renal nerve modulation devices
ES2791778T3 (es) 2012-08-01 2020-11-05 Ikaika Therapeutics Llc Mitigación del daño tisular y la fibrosis a través de anticuerpos anti-LTBP4
CN104540465A (zh) 2012-08-24 2015-04-22 波士顿科学西美德公司 带有含单独微孔隙区域的球囊的血管内导管
US9173696B2 (en) 2012-09-17 2015-11-03 Boston Scientific Scimed, Inc. Self-positioning electrode system and method for renal nerve modulation
US10549127B2 (en) 2012-09-21 2020-02-04 Boston Scientific Scimed, Inc. Self-cooling ultrasound ablation catheter
WO2014047411A1 (en) 2012-09-21 2014-03-27 Boston Scientific Scimed, Inc. System for nerve modulation and innocuous thermal gradient nerve block
EP2906135A2 (en) 2012-10-10 2015-08-19 Boston Scientific Scimed, Inc. Renal nerve modulation devices and methods
MX366336B (es) 2012-11-02 2019-07-05 Celgene Corp Antagonistas de activina - actrii y usos para el tratar trastornos oseos y otros.
WO2014143571A1 (en) 2013-03-11 2014-09-18 Boston Scientific Scimed, Inc. Medical devices for modulating nerves
US9956033B2 (en) 2013-03-11 2018-05-01 Boston Scientific Scimed, Inc. Medical devices for modulating nerves
US9808311B2 (en) 2013-03-13 2017-11-07 Boston Scientific Scimed, Inc. Deflectable medical devices
WO2014149690A2 (en) 2013-03-15 2014-09-25 Boston Scientific Scimed, Inc. Medical devices and methods for treatment of hypertension that utilize impedance compensation
US9827039B2 (en) 2013-03-15 2017-11-28 Boston Scientific Scimed, Inc. Methods and apparatuses for remodeling tissue of or adjacent to a body passage
US10265122B2 (en) 2013-03-15 2019-04-23 Boston Scientific Scimed, Inc. Nerve ablation devices and related methods of use
US9943365B2 (en) 2013-06-21 2018-04-17 Boston Scientific Scimed, Inc. Renal denervation balloon catheter with ride along electrode support
WO2014205399A1 (en) 2013-06-21 2014-12-24 Boston Scientific Scimed, Inc. Medical devices for renal nerve ablation having rotatable shafts
US9707036B2 (en) 2013-06-25 2017-07-18 Boston Scientific Scimed, Inc. Devices and methods for nerve modulation using localized indifferent electrodes
AU2014284558B2 (en) 2013-07-01 2017-08-17 Boston Scientific Scimed, Inc. Medical devices for renal nerve ablation
US10413357B2 (en) 2013-07-11 2019-09-17 Boston Scientific Scimed, Inc. Medical device with stretchable electrode assemblies
US10660698B2 (en) 2013-07-11 2020-05-26 Boston Scientific Scimed, Inc. Devices and methods for nerve modulation
WO2015010074A1 (en) 2013-07-19 2015-01-22 Boston Scientific Scimed, Inc. Spiral bipolar electrode renal denervation balloon
EP3024405A1 (en) 2013-07-22 2016-06-01 Boston Scientific Scimed, Inc. Renal nerve ablation catheter having twist balloon
EP3024406B1 (en) 2013-07-22 2019-06-19 Boston Scientific Scimed, Inc. Medical devices for renal nerve ablation
JP6159888B2 (ja) 2013-08-22 2017-07-05 ボストン サイエンティフィック サイムド,インコーポレイテッドBoston Scientific Scimed,Inc. 腎神経変調バルーンへの接着性を向上させたフレキシブル回路
US9895194B2 (en) 2013-09-04 2018-02-20 Boston Scientific Scimed, Inc. Radio frequency (RF) balloon catheter having flushing and cooling capability
EP3043733A1 (en) 2013-09-13 2016-07-20 Boston Scientific Scimed, Inc. Ablation balloon with vapor deposited cover layer
US9687166B2 (en) 2013-10-14 2017-06-27 Boston Scientific Scimed, Inc. High resolution cardiac mapping electrode array catheter
US11246654B2 (en) 2013-10-14 2022-02-15 Boston Scientific Scimed, Inc. Flexible renal nerve ablation devices and related methods of use and manufacture
WO2015057584A1 (en) 2013-10-15 2015-04-23 Boston Scientific Scimed, Inc. Medical device balloon
US9770606B2 (en) 2013-10-15 2017-09-26 Boston Scientific Scimed, Inc. Ultrasound ablation catheter with cooling infusion and centering basket
EP3057521B1 (en) 2013-10-18 2020-03-25 Boston Scientific Scimed, Inc. Balloon catheters with flexible conducting wires
JP2016534842A (ja) 2013-10-25 2016-11-10 ボストン サイエンティフィック サイムド,インコーポレイテッドBoston Scientific Scimed,Inc. 除神経フレックス回路における埋め込み熱電対
CN105899157B (zh) 2014-01-06 2019-08-09 波士顿科学国际有限公司 抗撕裂柔性电路组件
US9907609B2 (en) 2014-02-04 2018-03-06 Boston Scientific Scimed, Inc. Alternative placement of thermal sensors on bipolar electrode
US11000679B2 (en) 2014-02-04 2021-05-11 Boston Scientific Scimed, Inc. Balloon protection and rewrapping devices and related methods of use
US10010498B2 (en) 2014-06-04 2018-07-03 Acceleron Pharma Inc. Methods for treatment of amyotrophic lateral sclerosis with follistatin fusion proteins
WO2015187977A1 (en) 2014-06-04 2015-12-10 Acceleron Pharma, Inc. Methods and compositions for treatment of disorders with follistatin polypeptides
AU2015274277B2 (en) 2014-06-13 2021-03-18 Acceleron Pharma, Inc. Methods and compositions for treating ulcers
MA41052A (fr) 2014-10-09 2017-08-15 Celgene Corp Traitement d'une maladie cardiovasculaire à l'aide de pièges de ligands d'actrii
SMT202300166T1 (it) 2014-12-03 2023-07-20 Celgene Corp Antagonisti di attivina- actrii e usi per il trattamento di sindrome mielodisplastica
WO2016154601A1 (en) * 2015-03-26 2016-09-29 Acceleron Pharma Inc. Follistatin-related fusion proteins and uses thereof
KR20180137487A (ko) * 2016-03-04 2018-12-27 샤이어 휴먼 지네틱 테라피즈 인크. 재조합 폴리스타틴-fc 융합 단백질 및 듀시엔형 근이영양증 치료에서의 용도
US12253490B2 (en) 2018-03-19 2025-03-18 Regeneron Pharmaceuticals, Inc. Microchip capillary electrophoresis assays and reagents
US12259355B2 (en) 2018-03-19 2025-03-25 Regeneron Pharmaceuticals, Inc. Microchip capillary electrophoresis assays and reagents
DK3768709T3 (da) * 2018-03-19 2024-01-29 Regeneron Pharma Mikrochip-kapillærelektroforese-assays og reagenser
KR20210117271A (ko) 2018-12-21 2021-09-28 노쓰웨스턴유니버시티 근막 손상 예방 및 치료를 위한 아넥신의 사용근각 손상 예방 및 치료를 위한 아넥신의 사용
WO2020139977A1 (en) 2018-12-26 2020-07-02 Northwestern University Use of glucocorticoid steroids in preventing and treating conditions of muscle wasting, aging and metabolic disorder

Family Cites Families (38)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US77053A (en) * 1868-04-21 Improvement in mitre-gauges
US223966A (en) * 1880-01-27 Vapor-burner
US162714A (en) * 1875-04-27 Improvement in balanced and cut-off valves
US150577A (en) * 1874-05-05 Improvement in grain-separators
US43232A (en) * 1864-06-21 Improvement in preserving fruits
US181033A (en) * 1876-08-15 Improvement in fire-kindlers
US4179337A (en) 1973-07-20 1979-12-18 Davis Frank F Non-immunogenic polypeptides
US6162896A (en) 1991-05-10 2000-12-19 The Salk Institute For Biological Studies Recombinant vertebrate activin receptors
CA2157577C (en) 1993-03-19 2009-11-17 Se-Jin Lee Growth differentiation factor-8
US5994618A (en) 1997-02-05 1999-11-30 Johns Hopkins University School Of Medicine Growth differentiation factor-8 transgenic mice
US7393682B1 (en) 1993-03-19 2008-07-01 The Johns Hopkins University School Of Medicine Polynucleotides encoding promyostatin polypeptides
PT698094E (pt) 1993-05-12 2004-05-31 Inst Genetics Llc Composicoes de bmp-11
DK0716610T3 (da) 1993-08-26 2006-09-04 Genetics Inst Llc Humane knogle-morfogenetiske proteiner til anvendelse ved neural regenerering
US6008434A (en) 1994-07-08 1999-12-28 Johns Hopkins University School Of Medicine Growth differentiation factor-11 transgenic mice
CA2194660C (en) 1994-07-08 2009-09-29 Se-Jin Lee Growth differentiation factor-11
US5723125A (en) 1995-12-28 1998-03-03 Tanox Biosystems, Inc. Hybrid with interferon-alpha and an immunoglobulin Fc linked through a non-immunogenic peptide
WO1998033887A1 (en) 1997-02-05 1998-08-06 The Johns Hopkins University School Of Medicine Growth differentiation factor-8
US6696260B1 (en) 1997-08-01 2004-02-24 The Johns Hopkins University School Of Medicine Methods to identify growth differentiation factor (GDF) binding proteins
US6656475B1 (en) 1997-08-01 2003-12-02 The Johns Hopkins University School Of Medicine Growth differentiation factor receptors, agonists and antagonists thereof, and methods of using same
EP1015468A4 (en) * 1997-08-29 2000-09-06 Human Genome Sciences Inc FOLLISTATINE-3
AU1276399A (en) 1997-11-07 1999-05-31 Genetics Institute Inc. Neuronal uses of bmp-11
US5942420A (en) 1997-11-17 1999-08-24 Millennium Biotherapeutics, Inc. Molecules of the follistatin-related protein family and uses therefor
US6369201B1 (en) 1998-02-19 2002-04-09 Metamorphix International, Inc. Myostatin multimers
US6004937A (en) 1998-03-09 1999-12-21 Genetics Institute, Inc. Use of follistatin to modulate growth and differentiation factor 8 [GDF-8] and bone morphogenic protein 11 [BMP-11]
DE69941116D1 (de) 1998-05-06 2009-08-27 Metamorphix Inc G von gdf-8
WO2000011163A1 (en) 1998-08-20 2000-03-02 Regeneron Pharmaceuticals, Inc. Dcr5, a bmp-binding protein, and applications thereof
BR0008188A (pt) 1999-01-21 2002-02-13 Metamorphix Inc Inibidores de fator de diferenciação de crescimento e usos para os mesmos
US20020004224A1 (en) * 2000-02-29 2002-01-10 Sheppard Paul O. Kunitz domain polypeptide zkun8
WO2001064888A2 (en) * 2000-02-29 2001-09-07 Zymogenetics, Inc. Kunitz domain polypeptide zkun8
US7037501B2 (en) * 2001-01-04 2006-05-02 Regents Of The University Of Minnesota Myostatin immnoconjugate
TW200526779A (en) 2001-02-08 2005-08-16 Wyeth Corp Modified and stabilized GDF propeptides and uses thereof
US7320789B2 (en) 2001-09-26 2008-01-22 Wyeth Antibody inhibitors of GDF-8 and uses thereof
MXPA04008149A (es) * 2002-02-21 2005-06-17 Wyeth Corp Proteinas que contienen dominios de folistatina.
MXPA04008150A (es) 2002-02-21 2005-06-17 Wyeth Corp Gasp1: una proteina que contiene dominio de folistatina.
BR0314270A (pt) 2002-09-16 2005-08-02 Univ Johns Hopkins Ativação de miostatina com metaloprotease e processos de modulação da atividade da miostatina
US7261893B2 (en) 2002-10-22 2007-08-28 Wyeth Neutralizing antibodies against GDF-8 and uses therefor
US20040223966A1 (en) 2002-10-25 2004-11-11 Wolfman Neil M. ActRIIB fusion polypeptides and uses therefor
EP2272864A3 (en) 2002-12-20 2011-02-16 Amgen Inc. Binding agents which inhibit myostatin

Cited By (31)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7560441B2 (en) 2001-02-08 2009-07-14 Wyeth Modified and stabilized GDF propeptides and uses thereof
US7731961B1 (en) 2001-09-26 2010-06-08 Wyeth Methods of increasing muscle mass or muscle strength using antibody inhibitors of GDF-8
US9505831B2 (en) 2001-09-26 2016-11-29 Wyeth Llc Isolated cell comprising a nucleic acid encoding antibody inhibitors of gdf-8 and uses thereof
US8710202B2 (en) 2001-09-26 2014-04-29 Wyeth Llc Isolated nucleic acid molecule encoding an antibody that reduces GDF-8 activity
EP1438068A4 (en) * 2001-09-26 2005-11-16 Wyeth Corp GDF-8 INHIBITOR ANTIBODIES AND USES THEREOF
US8092798B2 (en) 2001-09-26 2012-01-10 Wyeth Llc Method of increasing trabecular bone density in a patient in need thereof by an antibody against GDF-8
US7320789B2 (en) 2001-09-26 2008-01-22 Wyeth Antibody inhibitors of GDF-8 and uses thereof
EP2316851A1 (en) * 2001-09-26 2011-05-04 Wyeth LLC Antibody inhibitors of GDF-8 and uses thereof
US8420082B2 (en) 2002-10-22 2013-04-16 Wyeth Llc Neutralizing antibodies against GDF-8 and uses therefor
US8940874B2 (en) 2002-10-22 2015-01-27 Wyeth Llc Neutralizing antibodies against GDF-8 and uses therefor
US7655763B2 (en) 2002-10-22 2010-02-02 Wyeth Neutralizing antibodies against GDF-8 and uses therefor
US7785587B2 (en) 2003-06-02 2010-08-31 Wyeth Therapeutic methods for muscular or neuromuscular disorders
AU2005233474B2 (en) * 2004-04-15 2010-12-09 Techno Network Shikoku Co., Ltd. Follistatin variant polypeptide
US7867973B2 (en) 2004-04-15 2011-01-11 Techno Networks Shikoku Co., Ltd. Follistatin variant polypeptide
JP2005323584A (ja) * 2004-04-15 2005-11-24 Techno Network Shikoku Co Ltd フォリスタチン変異体ポリペプチド
EP1748069A4 (en) * 2004-04-15 2008-04-30 Techno Network Shikoku Co Ltd MUTANT FOLLISTATIN POLYPEPTIDE
AU2005256519B2 (en) * 2004-06-28 2011-10-13 Merck Patent Gmbh Fc-interferon-beta fusion proteins
JP4808709B2 (ja) * 2004-06-28 2011-11-02 メルク パテント ゲゼルシャフト ミット ベシュレンクテル ハフツング Fc−インターフェロン−β融合タンパク質
WO2006020884A3 (en) * 2004-08-12 2006-04-27 Wyeth Corp Combination therapy for diabetes, obesity, and cardiovascular diseases using gdf-8 inhibitors
WO2006107611A3 (en) * 2005-03-23 2007-04-26 Wyeth Corp Detection of an immune response to gdf-8 modulating agents
WO2006102574A3 (en) * 2005-03-23 2007-05-24 Wyeth Corp Detection of gdf-8 modulating agents
US8349327B2 (en) 2005-08-19 2013-01-08 Wyeth Llc Method for treating muscular dystrophy using antagonist antibodies against GDF-8
US8372625B2 (en) 2005-08-19 2013-02-12 Wyeth Llc Polynucleotides encoding antagonist antibodies against GDF-8
US7910107B2 (en) 2005-08-19 2011-03-22 Wyeth Llc Antagonist antibodies against GDF-8 and uses in treatment of ALS and other GDF-8 associated disorders
US8956608B2 (en) 2005-08-19 2015-02-17 Wyeth Llc Method for treating sarcopenia using antagonist antibodies against GDF-8
US7888486B2 (en) 2005-08-19 2011-02-15 Wyeth Llc Antagonist antibodies against GDF-8
US9926368B2 (en) 2005-08-19 2018-03-27 Wyeth Llc Method for treating muscle wasting syndrome using antagonist antibodies against GDF-8
US8992913B2 (en) 2012-06-15 2015-03-31 Pfizer Inc. Antagonist antibodies against GDF-8 and uses therefor
US9751937B2 (en) 2012-06-15 2017-09-05 Pfizer Inc. Antagonist antibodies against GDF-8 and uses therefor
WO2016120647A2 (en) 2015-01-30 2016-08-04 Debreceni Egyetem Muscle regeneration
WO2016181177A2 (en) 2015-05-14 2016-11-17 Alu-Öntö Kft. Casting process and sand mould provided with an inlet system for producing at least partly thin walled aluminium casts with sand moulding technology by means of gravity casting

Also Published As

Publication number Publication date
US20050106154A1 (en) 2005-05-19
IL163525A0 (en) 2005-12-18
WO2003072715A8 (en) 2005-01-13
CA2476887A1 (en) 2003-09-04
JP2005534616A (ja) 2005-11-17
PL375045A1 (en) 2005-11-14
US7541154B2 (en) 2009-06-02
AU2003217612A1 (en) 2003-09-09
US20030162714A1 (en) 2003-08-28
NO20043886L (no) 2004-09-16
KR20040094709A (ko) 2004-11-10
US7192717B2 (en) 2007-03-20
WO2003072715A3 (en) 2006-11-02
US7956038B2 (en) 2011-06-07
BR0307907A2 (pt) 2011-07-05
JP2010031018A (ja) 2010-02-12
US7585835B2 (en) 2009-09-08
EP1572909A4 (en) 2007-06-06
EP1572909A2 (en) 2005-09-14
US20070134258A1 (en) 2007-06-14
MXPA04008150A (es) 2005-06-17
JP4429729B2 (ja) 2010-03-10
US20100021462A1 (en) 2010-01-28

Similar Documents

Publication Publication Date Title
US7541154B2 (en) GASP1: a follistatin domain containing protein
US7572763B2 (en) Follistatin domain containing proteins
US8710025B2 (en) Modified and stabilized GDF propeptides and uses thereof
AU2002243852A1 (en) Modified and stabilized GDF propeptides and uses thereof
ZA200406542B (en) Gasp 1 : A follistatin domain containing protein
EP1790726B1 (en) Modified and stabilized GDF propeptides and uses thereof
HK1062457B (en) Modified and stabilized gdf propeptides and uses thereof
HK1104578A (en) Modified and stabilized gdf propeptides and uses thereof

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A2

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ OM PH PL PT RO RU SC SD SE SG SK SL TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW

AL Designated countries for regional patents

Kind code of ref document: A2

Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LU MC NL PT SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
WWE Wipo information: entry into national phase

Ref document number: 163525

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 2004/06542

Country of ref document: ZA

Ref document number: 200406542

Country of ref document: ZA

WWE Wipo information: entry into national phase

Ref document number: 2003713568

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2476887

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: PA/a/2004/008150

Country of ref document: MX

Ref document number: 375045

Country of ref document: PL

Ref document number: 2003571403

Country of ref document: JP

Ref document number: 1020047012977

Country of ref document: KR

Ref document number: 2003217612

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 535432

Country of ref document: NZ

WWE Wipo information: entry into national phase

Ref document number: 20038089890

Country of ref document: CN

WWP Wipo information: published in national office

Ref document number: 1020047012977

Country of ref document: KR

CFP Corrected version of a pamphlet front page

Free format text: UNDER (54) PUBLISHED TITLE REPLACED BY CORRECT TITLE

WWP Wipo information: published in national office

Ref document number: 2003713568

Country of ref document: EP

DFPE Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101)
DPE2 Request for preliminary examination filed before expiration of 19th month from priority date (pct application filed from 20040101)
ENP Entry into the national phase

Ref document number: PI0307907

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20040823