WO2002050107A2 - Streptococcus pyogenes antigens and corresponding dna fragments - Google Patents
Streptococcus pyogenes antigens and corresponding dna fragments Download PDFInfo
- Publication number
- WO2002050107A2 WO2002050107A2 PCT/CA2001/001853 CA0101853W WO0250107A2 WO 2002050107 A2 WO2002050107 A2 WO 2002050107A2 CA 0101853 W CA0101853 W CA 0101853W WO 0250107 A2 WO0250107 A2 WO 0250107A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- polypeptide
- seq
- polynucleotide
- nos
- sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/315—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Streptococcus (G), e.g. Enterococci
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/0208—Specific bacteria not otherwise provided for
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/09—Lactobacillales, e.g. aerococcus, enterococcus, lactobacillus, lactococcus, streptococcus
- A61K39/092—Streptococcus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/04—Drugs for disorders of the respiratory system for throat disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P39/00—General protective or antinoxious agents
- A61P39/02—Antidotes
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56911—Bacteria
- G01N33/56944—Streptococcus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
- A61K2039/575—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 humoral response
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/195—Assays involving biological materials from specific organisms or of a specific nature from bacteria
- G01N2333/315—Assays involving biological materials from specific organisms or of a specific nature from bacteria from Streptococcus (G), e.g. Enterococci
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2469/00—Immunoassays for the detection of microorganisms
- G01N2469/20—Detection of antibodies in sample from host which are directed against antigens from microorganisms
Definitions
- the present invention is related to antigens, more particularly BVH-P2, BVH-P3, BVH-P4, BVH-P5, and BVH-P6 antigens of Group A Streptococcus (S . pyogenes) bacterial pathogen which may be used to prevent, diagnose and/or treat streptococcal infections.
- antigens more particularly BVH-P2, BVH-P3, BVH-P4, BVH-P5, and BVH-P6 antigens of Group A Streptococcus (S . pyogenes) bacterial pathogen which may be used to prevent, diagnose and/or treat streptococcal infections.
- Streptococci are gram (+) bacteria which are differentiated by group specific carbohydrate antigens A through 0 which are found at the cell surface. S ⁇ pyogenes isolates are further distinguished by type-specific M protein antigens. M proteins are important virulence factors which are highly variable both in molecular weights and in sequences. Indeed, more than 80 -M protein types have been identified on the basis of antigenic differences .
- pyogenes is responsible for many diverse infection types, including pharyngitis, erysipelas and impetigo, scarlet fever, and invasive diseases such as bacteremia and necrotizing fasciitis.
- pharyngitis erysipelas and impetigo
- scarlet fever erysipelas and impetigo
- invasive diseases such as bacteremia and necrotizing fasciitis.
- a resurgence of invasive disease in recent years has been documented in many countries, including those in North America and Europe. Although the organism is sensitive to antibiotics, the high attack rate and rapid onset of sepsis results in high morbidity and mortality.
- S_ ⁇ _ pyogenes proteins In addition to the serotype-specific antigens, other S_ ⁇ _ pyogenes proteins have generated interest as potential vaccine candidates.
- the C5a peptidase which is expressed by at least S . pyogenes 40 serotypes, was shown to be immunogenic in mice, but its capacity to reduce the level of nasopharyngeal colonization was limited.
- Other investigators have also focused on the streptococcal pyrogenic exotoxins which appear to play an important role in pathogenesis of infection. Immunization with these proteins prevented the deadly symptoms of toxic shock, but did not prevent colonization.
- the University of Oklahoma has set up a genome sequencing project for S. pyogenes strain Ml GAS (http : //dnal . chem. ou . edu/strep . html ) .
- the present invention provides an isolated polynucleotide encoding a polypeptide having at least 70% identity to a second polypeptide comprising a sequence chosen from SEQ ID Nos : 2,4,6,8,10,12,14 and 16 or fragments or analogs thereof .
- the present invention relates to polypeptides which comprise an amino acid sequence chosen from SEQ ID Nos : 2,4,6,8,10,12,14 and 16 or fragments or analogs thereof .
- polypeptides encoded by polynucleotides of the invention pharmaceutical compositions, vectors comprising polynucleotides of the invention operably linked to an expression control region, as well as host cells transfected with said vectors and methods of producing polypeptides comprising culturing said host cells under conditions suitable for expression.
- Figure 1 represents the DNA sequence of BVH-P2 gene from serotype M3 S ⁇ pyogenes strain ATCC12384; SEQ ID NO: 1.
- Figure 2 represents the amino acid sequence BVH-P2 polypeptide from serotype 3 S ⁇ pyogenes strain ATCC12384; SEQ ID NO: 2.
- Figure 3 represents the DNA sequence of BVH-P3 gene from serotype Ml S_ ⁇ pyogenes strain ATCC700294; SEQ ID NO: 3.
- Figure 4 represents the amino acid sequence BVH-P3 polypeptide from serotype Ml S ⁇ pyogenes strain ATCC700294; SEQ ID NO: 4.
- Figure 5 represents the DNA sequence of BVH-P4 gene from serotype Ml S ⁇ _ pyogenes strain ATCC700294; SEQ ID NO: 5.
- Figure 6 represents the amino acid sequence BVH-P4 polypeptide from serotype Ml S_ ⁇ pyogenes strain ATCC700294; SEQ ID NO: 6.
- Figure 7 represents the DNA sequence of BVH-5 gene from serotype Ml S ⁇ pyogenes strain ATCC700294; SEQ ID NO: 7.
- Figure 8 represents the amino acid sequence BVH-P5 polypeptide from serotype Ml S_ ⁇ pyogenes strain ATCC700294; SEQ ID NO: 8.
- Figure 9 represents the DNA sequence of BVH-P6 gene from serotype Ml S ⁇ pyogenes strain ATCC700294; SEQ ID NO: 9.
- Figure 10 represents the amino acid sequence BVH-P6 polypeptide from serotype Ml S ⁇ pyogenes strain ATCC700294; SEQ ID NO: 10.
- Figure 11 represents the DNA sequence of BVH-P4 gene from serotype M3 S_ ⁇ pyogenes strain ATCC123834; SEQ ID NO: 11.
- Figure 12 represents the amino acid sequence BVH-P4 polypeptide from serotype M3 S ⁇ _ pyogenes strain ATCC12384; SEQ ID NO: 12.
- Figure 13 represents the DNA sequence of BVH-P4 gene from serotype M6 S_ ⁇ pyogenes strain SPY67; SEQ ID NO: 13.
- Figure 14 represents the amino acid sequence BVH-P4 polypeptide from serotype M3 S ⁇ pyogenes strain SPY67; SEQ ID NO: 14.
- Figure 16 represents the amino acid sequence BVH-P4 polypeptide from serotype S ⁇ pyogenes strain B514; SEQ ID NO: 16.
- Figure 17 depicts the comparison of the nucleotide sequences of the BVH-P4 genes from the S_ ⁇ pyogenes serotype Ml ATCC700294, serotype M3 ATCC12384, serotype M6 SPY77 strains and the mouse isolate B514 by using the program Clustal W from MacVector sequence analysis software (version 6.5) . Identical nucleotides are presented as * and differences are indicated by blank spaces .
- Figure 18 depicts the comparison of the predicted amino acid sequences of the BVH-P4 partial open reading frames from the S . pyogenes serotype Ml ATCC700294, serotype M3 ATCC12384, serotype M6 SPY77 strains and the mouse isolate B514 by using the program Clustal W from MacVector sequence analysis software (version 6.5). Underneath the alignment, there is a consensus line. Identical amino acid are illustrated with a * while differences are indicated by periods.
- the present invention provides purified and isolated DNA molecules, which encode Streptococcal polypeptides that can be used to prevent, treat, and/or diagnose Streptococcal infection.
- the invention includes DNA molecules that encode analogs such as mutants, variants, homologues and derivatives of such polypeptides, as described herein in the present patent application.
- the invention also includes RNA molecules corresponding to the DNA molecules of the invention.
- the invention includes the corresponding polypeptides and monospecific antibodies that specifically bind to such polypeptides .
- the present invention provides an isolated polynucleotide encoding a polypeptide having at least 70% identity to a second polypeptide comprising a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16 or fragments or analogs or thereof .
- the present invention provides an isolated polynucleotide encoding a polypeptide having at least 80% identity to a second polypeptide comprising a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16 or fragments or analogs or thereof .
- the present invention provides an isolated polynucleotide encoding a polypeptide having at least 90% identity to a second polypeptide comprising a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16 or fragments or analogs or thereof .
- the present invention provides an isolated polynucleotide encoding a polypeptide having at least 95% identity to a second polypeptide comprising a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16 or fragments 5 or analogs or thereof.
- the present invention provides a polynucleotide encoding a polypeptide comprising a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14 or 16 or 10 fragments or analogs or thereof .
- the present invention provides a polynucleotide encoding a polypeptide capable of generating antibodies having binding specificity for a polypeptide having a 15 sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14 or 16 or fragments or analogs or thereof .
- the present invention provides a polynucleotide encoding an epitope bearing portion of a
- polypeptide having a sequence chosen from: SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14 or 16 or fragments or analogs or thereof.
- the present invention relates to epitope bearing portions of a polypeptide having a sequence 25 chosen from SEQ ID NOS: 2, 4, 6, 8, 10, 12, 14 or 16 or fragments or analogs or thereof .
- the present invention provides an isolated polynucleotide encoding a polypeptide having at least 3070% identity to a second polypeptide comprising a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14 or 16.
- the present invention provides an isolated polynucleotide encoding a polypeptide having at least 35 80% identity to a second polypeptide comprising a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14 or 16. According to one aspect, the present invention provides an isolated polynucleotide encoding a polypeptide having at least 90% identity to a second polypeptide comprising a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14 or 16.
- the present invention provides an isolated polynucleotide encoding a polypeptide having at least 95% identity to a second polypeptide comprising a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14 or 16.
- the present invention provides a polynucleotide encoding a polypeptide comprising a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14 or 16 or fragments or analogs or thereof.
- the present invention provides a polynucleotide encoding a polypeptide capable of generating antibodies having binding specificity for a polypeptide having a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14 or 16.
- the present invention provides a polynucleotide encoding an epitope bearing portion of a polypeptide having a sequence chosen from: SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14 or 16.
- the present invention relates to epitope bearing portions of a polypeptide having a sequence chosen from SEQ ID NOS: 2, 4, 6, 8, 10, 12, 14 or 16.
- the present invention relates to polypeptides having at least 70% identity to a second polypeptide having an amino acid sequence chosen from: SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16 or fragments or analogs thereof. According to one aspect, the present invention relates to polypeptides having at least 95% identity to a second polypeptide having an amino acid sequence chosen from: SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16 or fragments or analogs thereof.
- the present invention relates to polypeptides characterized by the amino acid sequence comprising sequences from SEQ ID Nos : 2,4,6,8,10,12,14,16 or fragments or analogs thereof.
- the present invention relates to polypeptides capable of generating antibodies having binding specificity for a polypeptide having a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16 or fragments or analogs thereof .
- the present invention relates to epitope bearing portions of a polypeptide having a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16 or fragments or analogs thereof .
- the present invention relates to polypeptides having at least 70% identity to a second polypeptide having an amino acid sequence chosen from: SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16,.
- the present invention relates to polypeptides having at least 95% identity to a second polypeptide having an amino acid sequence chosen from: SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16,.
- the present invention relates to polypeptides characterized by the amino acid sequence comprising sequences from SEQ ID Nos : 2,4,6,8,10,12,14,16.
- the present invention relates to polypeptides capable of generating antibodies having binding specificity for a polypeptide having a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16.
- the present invention relates to epitope bearing portions of a polypeptide having a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16.
- polypeptides in accordance with the present invention are antigenic.
- polypeptides in accordance with the present invention are immunogenic .
- polypeptides in accordance with the present invention can elicit an immune response in a host.
- the present invention also relates to polypeptides which are able to raise antibodies having binding specificity to the polypeptides of the present invention as defined above.
- An antibody that "has binding specificity” is an antibody that recognizes and binds the selected polypeptide but which does not substantially recognize and bind other molecules in a sample, e.g., a biological sample, which naturally includes the selected peptide. Specific binding can be measured using an E ISA assay in which the selected polypeptide is used as an antigen.
- antigenic/immunogenic fragments of the polypeptides of the invention or of analogs thereof.
- the fragments of the present invention should include one or more such epitopic regions or be sufficiently similar to such regions to retain their antigenic/immunogenic properties.
- the degree of identity is perhaps irrelevant, since they may be 100% identical to a particular part of a polypeptide or analog thereof as described herein.
- the present invention further provides fragments having at least 10 contiguous amino acid residues from the polypeptide sequences of the present invention. In one embodiment, at least 15 contiguous amino acid residues. In one embodiment, at least 20 contiguous amino acid residues.
- substitutions are those having a minimal influence on the secondary structure and hydropathic nature of the polypeptide.
- Preferred substitutions are those known in the art as conserved, i.e. the substituted residues share physical or chemical properties such as hydrophobicity, size, charge or functional groups. These include substitutions such as those described by Dayhoff, M. in Atlas of Protein Sequence and Structure 5, 1978 and by Argos, P. in EMBO J. 8, 779-785, 1989.
- amino acids either natural or unnatural, belonging to one of the following groups represent conservative changes: ala, pro, gly, gin, asn, ser, thr, val; cys, ser, tyr, thr; val, ile, leu, met, ala, phe; lys, arg, orn, his; and phe, tyr, trp, his.
- the preferred substitutions also include substitutions of D- enantiomers for the corresponding L-amino acids.
- the percentage of homology is defined as the sum of the percentage of identity plus the percentage of similarity or conservation of amino acid type.
- the analogs could be fusion proteins, incorporating moieties which render purification easier, for example by effectively tagging the desired polypeptide. It may be necessary to remove the "tag” or it may be the case that the fusion polypeptide itself retains sufficient antigenicity to be useful.
- fragments include those polypeptides in which one or more of the amino acid residues are substituted with a conserved or non-conserved amino acid residue (preferably conserved) and which may be natural or unnatural .
- analogs of polypeptides of the invention will have about 70% identity with those sequences illustrated in the figures or fragments thereof. That is, 70% of the residues are the same.
- polypeptides will have greater than 75% homology.
- polypeptides will have greater than 80% homology.
- polypeptides will have greater than 85% homology.
- polypeptides will have greater than 90% homology.
- polypeptides will have greater than 95% homology.
- polypeptides will have greater than 99% homology.
- analogs of polypeptides of the invention will have fewer than about 20 amino acid residue substitutions, modifications or deletions and more preferably less than 10.
- polypeptides will have greater than 70% homology.
- polypeptides will have greater than 75% homology.
- polypeptides will have greater than 80% homology.
- polypeptides will have greater than 85% homology.
- polypeptides will have greater than 90% homology.
- polypeptides will have greater than 95% homology.
- polypeptides will have greater than 99% homology.
- derivatives and analogs of polypeptides of the invention will have less than about 20 amino acid residue substitutions, modifications or deletions and more preferably less than 10.
- Preferred substitutions are those known in the art as conserved i.e. the substituted residues share physical or chemical properties such as hydrophobicity, size, charge or functional groups.
- This program compares amino acid sequences and finds the optimal alignment by inserting spaces in either sequence as appropriate. It is possible to calculate amino acid identity or similarity (identity plus conservation of amino acid type) for an optimal alignment.
- a program like BLASTx will align the longest stretch of similar sequences and assign a value to the fit. It is thus possible to obtain a comparison where several regions of similarity are found, each having a different score. Both types of identity analysis are contemplated in the present invention.
- antigenic/immunogenic fragments of the polypeptides of the invention or of analogs thereof.
- fragments of the polypeptides described herein, or of analogs thereof the situation is slightly different from native protein. It is well known that it is possible to screen an antigenic polypeptide to identify epitopic regions, i.e. those regions which are responsible for the polypeptide' s antigenicity or immunogenicity . Methods for carrying out such screening are well known in the art. Thus, the fragments of the present invention should include one or more such epitopic regions or be sufficiently similar to such regions to retain their antigenic/immunogenic properties. Thus, for fragments according to the present invention the degree of identity is perhaps irrelevant, since they may be 100% identical to a particular part of a polypeptide, analog as described herein.
- polypeptides which have fused thereto other compounds which alter the polypeptides biological or pharmacological properties i.e. polyethylene glycol (PEG) to increase half-life; leader or secretory amino acid sequences for ease of purification; prepro- and pro- sequences; and
- PEG polyethylene glycol
- amino acid regions are found to be polymorphic, it may be desirable to vary one or more particular amino acids to more effectively mimic the different epitopes of the different streptococcus strains.
- polypeptides of the present invention can be modified by terminal -NH 2 acylation (eg. by acetylation, or thioglycolic acid amidation, terminal carboxy amidation, e.g. with ammonia or methylamine) to provide stability, increased hydrophobicity for linking or binding to a support or other molecule .
- terminal -NH 2 acylation eg. by acetylation, or thioglycolic acid amidation, terminal carboxy amidation, e.g. with ammonia or methylamine
- hetero and homo polypeptide multimers of the polypeptide fragments and analogues include, for example, one or more polypeptides that have been cross-linked with cross-linkers such as avidin/biotin, gluteraldehyde or dimethylsuperimidate .
- polymeric forms also include polypeptides containing two or more tandem or inverted contiguous sequences, produced from multicistronic mRNAs generated by recombinant DNA technology.
- the present invention also relates to chimeric polypeptides which comprise one or more polypeptides or fragments or analogs thereof as defined in the figures of the present application.
- the present invention also relates to chimeric polypeptides comprising two or more polypeptides having a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16 or fragments or analogs thereof; provided that the polypeptides are linked as to formed a chimeric polypeptide.
- the present invention also relates to chimeric polypeptides comprising two or more polypeptides having a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14 or 16 provided that the polypeptides are linked as to formed a chimeric polypeptide.
- polypeptides may be utilized having bishaloacetyl groups, nitroarylhalides, or the like, where the reagents being specific for thio groups. Therefore, the link between two mercapto groups of the different polypeptides may be a single bond or may be composed of a linking group of at least two, typically at least four, and not more than 16, but usually not more than about 14 carbon atoms.
- polypeptide fragments and analogs of the invention do not contain a starting residue, such as methionine (Met) or valine (Val) .
- polypeptides will not incorporate a leader or secretory sequence (signal sequence) .
- the signal portion of a polypeptide of the invention may be determined according to established molecular biological techniques.
- the polypeptide of interest may be isolated from a streptococcal culture and subsequently sequenced to determine the initial residue of the mature protein and therefore the sequence of the mature polypeptide . It is understood that polypeptides can be produced and/or used without their start codon (methionine or valine) and/or without their leader peptide to favor production and purification of recombinant polypeptides. It is known that cloning genes without sequences encoding leader peptides will restrict the polypeptides to the cytoplasm of E.
- the polypeptides may be expressed with or without a leader or secretion sequence.
- the leader may be removed using post-translational processing (see US 4 431 739, US 4 425 437 and US 4 338 397 incorporated herein by reference) or be chemically removed subsequent to purifying the expressed polypeptide .
- composition of matter containing a polypeptide of the invention, together with a carrier, diluent or adjuvant;
- a pharmaceutical composition comprising a polypeptide of the invention and a carrier, diluent or adjuvant;
- a vaccine comprising a polypeptide of the invention and a carrier, diluent or adjuvant;
- a method for inducing an immune response against Streptococcus, in a host by administering to the host, an immunogenically effective amount of a polypeptide of the invention to elicit an immune response, e.g., a protective immune response to Streptococcus; and particularly, (v) a method for preventing and/or treating a Streptococcus infection, by administering a prophylactic or therapeutic amount of a polypeptide of the invention to a host in need.
- the polypeptides of the invention can also be coupled or conjugated to carrier proteins such as tetanus toxin, diphtheria toxin, hepatitis B virus surface antigen, poliomyelitis virus VP1 antigen or any other viral or bacterial toxin or antigen or any suitable proteins to stimulate the development of a stronger immune response.
- carrier proteins such as tetanus toxin, diphtheria toxin, hepatitis B virus surface antigen, poliomyelitis virus VP1 antigen or any other viral or bacterial toxin or antigen or any suitable proteins to stimulate the development of a stronger immune response.
- This coupling or conjugation can be done chemically or genetically.
- compositions comprising one or more Streptococcal polypeptides of the invention in a mixture with a pharmaceutically acceptable adjuvant.
- Suitable adjuvants include (1) oil-in-water emulsion formulations such as MF59TM, SAFTM, RibiTM ; (2) Freund' s complete or incomplete adjuvant; (3) salts i.e.
- adjuvants include QuilATM, QS21TM, AlhydrogelTM and AdjuphosTM.
- a method of manufacturing a pharmaceutical composition comprising admixing a polypeptide of the invention with a pharmaceutically acceptable diluent, excipient or adjuvant.
- the invention provides a method for prophylactic or therapeutic treatment of Streptopcoccal bacterial infection in a host susceptible to Streptococcal infection comprising administering to a host a therapeutic or prophylactic amount of a composition of the invention.
- compositions of the invention may be administered parenterally by injection, rapid infusion, nasopharyngeal absorption, dermoabsorption, or bucal or oral .
- Pharmaceutically acceptable carriers also include tetanus toxoid.
- compositions of the invention are used for the treatment or prophylaxis of streptococcal infection and/or diseases and symptoms mediated by streptococcal infection as described in P.R. Murray (Ed, in chief), E.J. Baron, M.A. Pfaller, F.C. Tenover and R.H. Yolken. Manual of Clinical Microbiology, ASM Press, Washington, D.C. sixth edition, 1995, 1482p which are herein incorporated by reference.
- pharmaceutical compositions of the present invention are used for the treatment or prophylaxis of pharyngitis, erysipelas and impetigo, scarlet fever, and invasive diseases such as bacteremia and necrotizing fasciitis and also toxic shock.
- compositions of the invention are used for the treatment or prophylaxis of streptococcus infection and/or diseases and symptoms mediated by streptococcus infection, in particular group A streptococcus (S. pyogenes) , group B streptococcus (GBS or S .agalactiae) , S .pneumoniae, S . dysgalactiae, S .uberis, S .nocardia as well as Staphylococcus aureus .
- the streptococcus infection is Streptococcus pyogenes .
- compositions are administered to those host at risk of streptococcus infection such as infants, elderly and immunocompromised hosts.
- the streptococcal polypeptides of the invention may be used in a kit comprising the polypeptides of the invention for detection or diagnosis of streptococcal infection.
- the term "host" include mammals.
- the mammal is human.
- compositions are preferably in unit dosage form of about 0.001 to 100 ⁇ g/kg (antigen/body weight) and more preferably 0.01 to 10 ⁇ g/kg and most preferably 0.1 to 1 ⁇ g/kg 1 to 3 times with an interval of about 1 to 6 week intervals between immunizations.
- compositions are preferably in unit dosage form of about 0.1 ⁇ g to 10 mg and more preferably l ⁇ g to 1 mg and most preferably 10 to 100 ⁇ g 1 to 3 times with an interval of about 1 to 6 week intervals between immunizations.
- polynucleotides are those illustrated in SEQ ID Nos: 1, 3, 5, 7, 9, 11, 13, 15 which may include the open reading frames (ORF) , encoding the polypeptides of the invention.
- polynucleotide sequences illustrated in the figures may be altered with degenerate codons yet still encode the polypeptides of the invention. Accordingly the present invention further provides polynucleotides which hybridize to the polynucleotide sequences herein above described (or the complement sequences thereof) having 50% identity between sequences. In one embodiment, at least 70% identity between sequences. In one embodiment, at least 75% identity between sequences. In one embodiment, at least 80% identity between sequences. In one embodiment, at least 85% identity between sequences. In one embodiment, at least 90% identity between sequences. In a further embodiment, polynucleotides are hybridizable under stringent conditions i.e. having at least 95% identity. In a further embodiment, more than 97% identity.
- Suitable stringent conditions for hybridation can be readily determined by one of skilled in the art (see for example
- the present invention provides polynucleotides that hybridize under stringent conditions to either
- polypeptide (b) the complement of a DNA sequence encoding a polypeptide; wherein said polypeptide comprises SEQ ID NO: 2, 4, 6, 8, 10, 12, 14 or 16 or fragments or analogs thereof.
- the present invention provides polynucleotides that hybridize under stringent conditions to either
- polypeptide (b) the complement of a DNA sequence encoding a polypeptide; wherein said polypeptide comprises SEQ ID NO: 2, 4, 6, 8, 10, 12, 14 or 16.
- the present invention provides polynucleotides that hybridize under stringent conditions to either (a) a DNA sequence encoding a polypeptide or (b) the complement of a DNA sequence encoding a polypeptide; wherein said polypeptide comprises at least 10 contiguous amino acid residues from a polypeptide comprising SEQ ID NO: 2, 4, 6, 8, 10, 12, 14 or 16 or fragments or analogs thereof.
- the present invention provides polynucleotides that hybridize under stringent conditions to either
- polypeptide comprises at least 10 contiguous amino acid residues from a polypeptide comprising SEQ ID NO: 2, 4, 6, 8, 10, 12, 14 or 16.
- polynucleotides are those illustrated in SEQ ID NOs : 1, 3, 5, 7, 9, 11, 13, 15 encoding polypeptides of the invention.
- polynucleotides include both DNA and RNA.
- the present invention also includes polynucleotides complementary to the polynucleotides described in the present application.
- polynucleotides encoding polypeptides of the invention, or fragments, analogs or derivatives thereof, may be used in a DNA immunization method. That is, they can be incorporated into a vector which is replicable and expressible upon injection thereby producing the antigenic polypeptide in vivo.
- polynucleotides may be incorporated into a plasmid vector under the control of the CMV promoter which is functional in eukaryotic cells.
- the vector is injected intramuscularly.
- polypeptides of the invention by recombinant techniques by expressing a polynucleotide encoding said polypeptide in a host cell and recovering the expressed polypeptide product.
- the polypeptides can be produced according to established synthetic chemical techniques i.e. solution phase or solid phase synthesis of oligopeptides which are ligated to produce the full polypeptide (block ligation) .
- host cells are transfected with vectors which encode the polypeptide, and then cultured in a nutrient media modified as appropriate for activating promoters, selecting transformants or amplifying the genes.
- Suitable vectors are those that are viable and replicable in the chosen host and include chromosomal, non-chromosomal and synthetic DNA sequences e.g. bacterial plasmids, phage DNA, baculovirus, yeast plasmids, vectors derived from combinations of plasmids and phage DNA.
- the polypeptide sequence may be incorporated in the vector at the appropriate site using restriction enzymes such that it is operably linked to an expression control region comprising a promoter, ribosome binding site (consensus region or Shine-Dalgarno sequence) , and optionally an operator (control element) .
- an expression control region comprising a promoter, ribosome binding site (consensus region or Shine-Dalgarno sequence) , and optionally an operator (control element) .
- Suitable promoters include but are not limited to LTR or SV40 promoter, E.coli lac, tac or trp promoters and the phage lambda P L promoter.
- Vectors will preferably incorporate an origin of replication as well as selection markers i.e. ampicilin resistance gene.
- Suitable bacterial vectors include pET, pQE70, pQE60, pQE-9, pDIO phagescript, psiX174, pbluescript SK, pbsks, pNH8A, pNH16a, pNH18A, pNH46A, ptrc99a, pKK223-3, pKK233-3, pDR540, pRIT5 and eukaryotic vectors pBlueBacIII, pWLNEO, pSV2CAT, pOG44, pXTl, pSG, pSVK3 , pBPV, pMSG and pSVL.
- Host cells may be bacterial i.e.
- E.coli Bacillus subtilis, Streptomyces ; fungal i.e. Aspergillus niger, Aspergillus nidulins; yeast i.e. Saccharomyces or eukaryotic i.e. CHO, COS.
- polypeptide Upon expression of the polypeptide in culture, cells are typically harvested by centrifugation then disrupted by physical or chemical means (if the expressed polypeptide is not secreted into the media) and the resulting crude extract retained to isolate the polypeptide of interest. Purification of the polypeptide from culture media or lysate may be achieved by established techniques depending on the properties of the polypeptide i.e. using ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, hydroxylapatite chromatography and lectin chromatography. Final purification may be achieved using HPLC.
- the streptococcal polypeptides of the invention may be used in a diagnostic test for streptococcus infection, in particular Streptococcus pyogenes infection.
- a diagnostic test for streptococcus infection in particular Streptococcus pyogenes infection.
- Several diagnostic methods are possible, for example detecting streptococcus organism in a biological sample, the following procedure may be followed: a) obtaining a biological sample from a host; b) incubating an antibody or fragment thereof reactive with a streptococcus polypeptide of the invention with the biological sample to form a mixture; and c) detecting specifically bound antibody or bound fragment in the mixture which indicates the presence of streptococcus .
- a method for the detection of antibody specific to a streptococcus antigen in a biological sample containing or suspected of containing said antibody may be performed as follows : a) obtaining a biological sample from a host; b) incubating one or more streptococcus polypeptides of the invention or fragments thereof with the biological sample to form a mixture ; and c) detecting specifically bound antigen or bound fragment in the mixture which indicates the presence of antibody specific to streptococcus .
- this diagnostic test may take several forms, including an immunological test such as an enzyme-linked immunosorbent assay (ELISA) , a radioimmunoassay or a latex agglutination assay, essentially to determine whether antibodies specific for the protein are present in an organism.
- an immunological test such as an enzyme-linked immunosorbent assay (ELISA)
- ELISA enzyme-linked immunosorbent assay
- radioimmunoassay or a latex agglutination assay
- the DNA sequences encoding polypeptides of the invention may also be used to design DNA probes for use in detecting the presence of streptococcus in a biological sample suspected of containing such bacteria.
- the detection method of this invention comprises: a) obtaining the biological sample from a host; b) incubating one or more DNA probes having a DNA sequence encoding a polypeptide of the invention or fragments thereof with the biological sample to form a mixture; and c) detecting specifically bound DNA probe in the mixture which indicates the presence of streptococcus bacteria.
- the DNA probes of this invention may also be used for detecting circulating streptococcus i.e. Streptococcus pyogenes nucleic acids in a sample, for example using a polymerase chain reaction, as a method of diagnosing streptococcus infections.
- the probe may be synthesized using conventional techniques and may be immobilized on a solid phase, or may be labelled with a detectable label.
- a preferred DNA probe for this application is an oligomer having a sequence complementary to at least about 6 contiguous nucleotides of the Streptococcus pyogenes polypeptides of the invention.
- Another diagnostic method for the detection of streptococcus in a host comprises: a) labelling an antibody reactive with a polypeptide of the invention or fragment thereof with a detectable label; b) administering the labelled antibody or labelled fragment to the host ; and c) detecting specifically bound labelled antibody or labelled fragment in the host which indicates the presence of streptococcus.
- a further aspect of the invention is the use of the streptococcus polypeptides of the invention as immunogens for the production of specific antibodies for the diagnosis and in particular the treatment of streptococcus infection.
- Suitable antibodies may be determined using appropriate screening methods, for example by measuring the ability of a particular antibody to passively protect against streptococcus infection in a test model.
- an animal model is the mouse model described in the examples herein.
- the antibody may be a whole antibody or an antigen-binding fragment thereof and may belong to any immunoglobulin class.
- the antibody or fragment may be of animal origin, specifically of mammalian origin and more specifically of murine, rat or human origin.
- the term recombinant antibody or antibody fragment means antibody or antibody fragment which was produced using molecular biology techniques.
- the antibody or antibody fragments may be polyclonal, or preferably monoclonal. It may be specific for a number of epitopes associated with the Streptococcus pyogenes polypeptides but is preferably specific for one.
- a further aspect of the invention is the use of the antibodies directed to the polypeptides of the invention for passive immunization.
- One example of an animal model is the mouse model described in the examples herein.
- the antibody may be a whole antibody or an antigen- binding fragment thereof and mav belong to any immunoglobulin class.
- the antibody or fragment may be of animal origin, specifically of mammalian origin and more specifically of murine, rat or human origin. It may be a natural antibody or a fragment thereof, or if desired, a recombinant antibody or antibody fragment.
- the term recombinant antibody or antibody fragment means antibody or antibody fragment which was produced using molecular biology techniques.
- the antibody or antibody fragments may be polyclonal, or preferably monoclonal. It may be specific for a number of epitopes associated with the streptococcal polypeptides but is preferably specific for one.
- the present invention provides the use of an antibody for treatment and/or prophylaxis of streptococcal infections .
- S_ ⁇ pyogenes BVH-P2 gene (SEQ ID NO: 1) was amplified by PCR (Robocycler Gradient 96 Temperature cycler, Stratagene, LaJolla, Ca) from genomic DNA of serotype M3 S .
- pyogenes strain ATCC12384 using the following oligonuceotide primers that contained base extensions for the addition of restriction sites Ndel (CATATG) and Xhol (CTCGAG) : DMAR124 and DMAR125, which are presented in Table 1.
- PCR products were purified from agarose gel using a QIAquick gel extraction kit from QIAgen following the manufacturer's instructions
- the pET-21b(+) vector (Novagen, Madison, WI) was digested with W el and Xhol and purified from agarose gel using a QIAquick gel extraction kit from QIAgen (Chatsworth, CA) .
- the N el-Xhol PCR products were ligated to the Ndel -Xhol pET-21b(+) expression vector.
- the ligated products were transformed into E ⁇ coli strain DH5
- Recombinant pET-21b(+) plasmid (rpET21b(+)) containing BVH-P2 gene was purified using a QIAgen plasmid kit (Chatsworth, CA) and DNA insert was sequenced (Taq Dye Deoxy Terminator Cycle Sequencing kit, ABI , Foster City, CA) .
- ORF open reading frame
- the following 4 serologically distinct S ⁇ pyogenes strains were used: the serotype Ml S ⁇ pyogenes strain ATCC 700294 and the serotype M3 S ⁇ pyogenes strain ATCC12384 were obtained from the American Type Culture Collection (Rockville, MD, USA) ; the serotype M6 S_ ⁇ _ pyogenes SPY67 clinical isolate was provided by the Centre detician en infectiologie du Centre hospitalier de l'universite Laval, Sainte-Foy; and S ⁇ pyogenes strain B514 which was initially isolated from a mouse was provided by Susan Hollingshead, from University of Alabama, Birmingham.
- the E ⁇ coli strain XLl-Blue MRF ' was used in these experiments as negative control .
- Chromosomal DNA was isolated from each S_ ⁇ pyogenes strain as previously described (Jayarao BM et al. 1991. J. Clin. Microbiol . 29:2774-2778).
- BVH-P2 (SEQ ID NO: 1) gene was amplified by PCR (Robocycler Gradient 96 Temperature cycler, Stratagene, LaJolla, Ca) from the genomic DNA purified from the 4 S ⁇ pyogenes strains, and the control E . coli strain using the oligonucleotides primers DMAR124 and DMAR125 (Table 1) .
- PCR was performed with 30 cycles of 45 sec at 95°C, 45 sec at 50°C and 1 min at 72°C and a final elongation period of 7 min at 72 °C.
- the PCR products were size fractionated in 1% agarose gels and were visualized by ethidium bromide staining.
- the results of these PCR amplifications are presented in Table 2.
- the analysis of the amplification products revealed that BVH-P2 (SEQ ID NO: 1) gene was present in the genome of all of the 4 S ⁇ pyogenes strains tested. No such product was detected when the control E ⁇ coli DNA was submitted to identical PCR amplifications with these oligonucleotide primers .
- S ⁇ pyogenes BVH-P3 gene (SEQ ID NO: 3) was amplified by PCR (Robocycler Gradient 96 Temperature cycler, Stratagene, LaJolla, Ca) from genomic DNA of serotype Ml S .
- pyogenes strain ATCC700294 using the following oligos that contained base extensions for the addition of restriction sites ⁇ Vdel (CATATG) and Xhol (CTCGAG) : DMAR188 and DMAR189, which are presented in Table 1.
- the methods used for cloning BVH-P3 into an expression vector and sequencing are similar to the methods described in Example 1.
- the BVH-P3 gene was shown to be present after PCR amplification using the oligonucleotide primers DMAR188 and DMAR189 in the 4 serologically S ⁇ pyogenes strains tested (Table 2) .
- the methods used for PCR amplification of the BVH-P3 gene were similar to the methods presented in Example 1. No such product was detected when the control E. coli DNA was submitted to identical PCR amplifications with these oligonucleotide primers .
- S_ ⁇ pyogenes BVH-P4 gene SEQ ID NO: 5
- the coding region of S_ ⁇ pyogenes BVH-P4 gene was amplified by PCR (Robocycler Gradient 96 Temperature cycler, Stratagene, LaJolla, Ca) from genomic DNA of serotype Ml S .
- pyogenes strain ATCC700294 using the following oligos that contained base extensions for the addition of restriction sites Ndel (CATATG) and Xhol (CTCGAG) : DMAR192 and DMAR193, which are presented in Table 1.
- the methods used for cloning BVH-P4 into an expression vector and sequencing are similar to the methods described in Example 1.
- ORF open reading frame
- the BVH-P4 gene was shown to be present after PCR amplification using the oligonucleotide primers DMAR192 and DMAR193 in the 4 serologically S _ pyogenes strains tested (Table 2) .
- the methods used for PCR amplification of the BVH-P4 gene were similar to the methods presented in Example 1. No such product was detected when the control E ⁇ coli DNA was submitted to identical PCR amplifications with these oligonucleotide primers.
- EXAMPLE 4 This example illustrates the cloning and molecular characteristics of BVH-P5 gene and corresponding polypeptide
- the coding region of _ ; _ pyogenes BVH-P5 gene was amplified by PCR (Robocycler Gradient 96 Temperature cycler, Stratagene, LaJolla, Ca) from genomic DNA of serotype Ml S .
- pyogenes strain ATCC700294 using the following oligos that contained base extensions for the addition of restriction sites Ndel (CATATG) and Xhol (CTCGAG) : DMAR200 and DMAR201, which are presented in Table 1.
- the methods used for cloning BVH-P5 into an expression vector and sequencing are similar to the methods described in Example 1.
- ORF open reading frame
- BVH-P5 (Wisconsin Sequence Analysis Package; Genetics Computer Group) suggested the existence of a 17 amino acid residues signal peptide (MNKKVMSLGLVSTALFT) , which ends with a cleavage site situated between a threonine and a leucine residues.
- MNKKVMSLGLVSTALFT 17 amino acid residues signal peptide
- the BVH-P5 gene was shown to be present after PCR amplification using the oligonucleotide primers DMAR200 and DMAR201 in the 4 serologically S ⁇ pyogenes strains tested, (Table 2) .
- the methods used for PCR amplification of the BVH-P5 gene were similar to the methods presented in example 1. No such product was detected when the control E ⁇ coli DNA was submitted to identical PCR amplifications with these oligonucleotide primers.
- EXAMPLE 5 This example illustrates the cloning and molecular characteristics of BVH-P6 gene and corresponding polypeptide.
- S ⁇ pyogenes BVH-P6 gene (SEQ ID NO: 9) was amplified by PCR (Robocycler Gradient 96 Temperature cycler, Stratagene, LaJolla, Ca) from genomic DNA of serotype Ml S .
- pyogenes strain ATCC700294 using the following oligonucleotide primers that contained base extensions for the addition of restriction sites Ndel (CATATG) and Xhol (CTCGAG) : DMAR235 and DMAR236, which are presented in Table 1.
- the methods used for cloning BVH-P6 into an expression vector and sequencing are similar to the methods described in Example 1.
- ORF open reading frame
- BVH-P6 (Wisconsin Sequence Analysis Package; Genetics Computer Group) suggested the existence of a 33 amino acid residues signal peptide (MRKRCYSTSAAVLAAVTLFVLSVDRGVIADSFS) , which ends with a cleavage site situated between a serine and an alanine residues.
- the BVH-P6 gene was shown to be present after PCR amplification using the oligonucleotide primers DMAR235 and DMAR236 in the 4 serologically S ⁇ pyogenes strains tested, (Table 2) .
- the methods used for PCR amplification of the BVH-P6 gene were similar to the methods presented in example 1. No such product was detected when the control E ⁇ coli DNA was submitted to identical PCR amplifications with these oligonucleotide primers.
- EXAMPLE 6 This example illustrates the cloning of S ⁇ pyogenes genes in CMV plasmid pCMV-GH.
- the DNA coding regions of S ⁇ pyogenes proteins were inserted in phase downstream of a human growth hormone (hGH) gene which was under the transcriptional control of the cytomegalovirus (CMV) promotor in the plasmid vector pCMV-GH (Tang et al . , Nature, 1992, 356 :152).
- the CMV promotor is a non functional plasmid in E ⁇ coli cells but active upon administration of the plasmid in eukaryotic cells.
- the vector also incorporated the ampicillin resistance gene.
- BVH-P2 SEQ ID NO: 1
- BVH-P4 SEQ ID NO: 5
- BVH-P5 SEQ ID NO: 7
- BVH-P6 SEQ ID NO: 9
- the PCR products were purified from agarose gel using a QIAquick gel extraction kit from QIAgen (Chatsworth, CA) , digested with restriction enzymes (Pharmacia Canada Inc, Baie d'Urfe, Canada).
- the pCMV-GH vector (Laboratory of Dr. Stephen A. Johnston, Department of Biochemistry, The University of Texas, Dallas, Texas) was digested with BamHI and Sail and purified from agarose gel using the QIAquick gel extraction kit from QIAgen (Chatsworth, CA) .
- the BamHI -SalI DNA fragments were ligated to the BamHI - Sail pCMV-GH vector to create the hGH-BVH-P2, hGH-BVH- P4, hGH-BVH-P5, and hGH-BVH-P6 fusion proteins under the control of the CMV promoter.
- the ligated products were transformed into E.
- This example illustrates the use of DNA to elicit an immune response to S ⁇ pyogenes protein antigens.
- mice Groups of 8 female BALB/c mice (Charles River, St-Constant, Quebec, Canada) were immunized by intramuscular injection of 100 ⁇ l three times at two- or three-week intervals with 50 ⁇ g of recombinant pCMV-GH encoding BVH-P2 (SEQ ID NO: 1) , BVH-P4 (SEQ ID NO: 5) , BVH-P5 (SEQ ID NO: 7) , and BVH-P6 (SEQ ID NO: 9) genes in presence of 50 ⁇ g of granulocyte-macrophage colony- stimulating factor (GM-CSF) - expressing plasmid pCMV-GH-GM-CSF (Laboratory of Dr. Stephen A.
- GM-CSF granulocyte-macrophage colony- stimulating factor
- mice were injected with 50 ⁇ g of pCMV-GH in presence of 50 ⁇ g of pCMV-GH-GM-CSF.
- Blood samples were collected from the orbital sinus prior to each immunization and seven days following the third injection and serum antibody responses were determined by ELISA using the corresponding His- tagged labeled S ⁇ pyogenes recombinant proteins as coating antigens. The production and purification of these His-tagged labeled S ⁇ pyogenes recombinant proteins are presented in Example 8.
- This example illustrates the production and purification of S . pyogenes recombinant proteins.
- BVH-P2 SEQ ID NO: 1
- BVH-P3 SEQ ID NO: 3
- BVH-P4 SEQ ID NO: 5
- BVH-P5 SEQ ID NO: 7
- BVH-P6 SEQ ID NO: 9
- His «Tag sequence (6 consecutive histidine residues) to bind to divalent cations (Ni 2+ ) immobilized on the His «Bind metal chelation resin.
- the pelleted cells obtained from a 500 mL culture induced with IPTG was resuspended in lysis buffer
- This example illustrates the reactivity of the His-tagged S . pyogenes recombinant proteins with human sera and sera collected from mice after immunization with S ⁇ pyogenes antigenic preparations
- ⁇ His-tagged recombinant proteins produced and purified as described in Example 7 were used to perform the immunoblots. Molecular weight of the His-tagged recombinant protein were estimated after SDS-PAGE. 3 Two sera collected from healthy human volunteers were pooled together and diluted 1/500 to perform the immunoblots. 4 Mouse sera collected after immunization with S ⁇ pyogenes antigenic preparations enriched membrane proteins were pooled and diluted 1/500 to perform the immunoblots. These mice were protected against a lethal S ⁇ pyogenes challenge.
- This example illustrates the accessibility to antibodies of the S ⁇ pyogenes BVH-P4 polypeptide at the surface of intact streptococcal cells.
- BVH-P4 -specific antibodies efficiently recognized their corresponding surface exposed epitopes on the heterologous (ATCC12384; serotype M3) S _ pyogenes strain tested. It was determined that more than 90 % of the 10,000 S ⁇ pyogenes cells analyzed were labeled with the antibodies present in the BVH-P4 specific anti-sera. It appears that the BVH-P4 polypeptide is accessible at the surface where it can be recognized by antibodies.
- This example illustrates the protection against fatal S ⁇ pyogenes infection induced by passive immunization of mice with rabbit hyper -immune sera.
- New Zealand rabbits (Charles River laboratories, St-Constant, Canada) are injected subcutaneously at multiple sites with 50 ⁇ g and 100 ⁇ g of the different His-tagged S _ pyogenes recombinant proteins that were produced and purified as described in Example 8 and adsorbed to Alhydrogel adjuvant (Superfos Biosector a/s) . Rabbits are immunized three times at three-week intervals with the different His-tagged S ⁇ pyogenes recombinant proteins. Blood samples are collected three weeks after the third injection. The antibodies present in the serum are purified by precipitation using 40% saturated ammonium sulfate.
- mice Groups of 10 female CD-I mice (Charles River) are injected intravenously with 500 ⁇ l of purified serum collected from rabbits immunized with the different His-tagged S ⁇ pyogenes recombinant proteins, or rabbits immunized with an unrelated control recombinant protein. Eighteen hours later the mice are challenged with approximately 2xl0 7 CFU of the type 3 S_ ; _ pyogenes strain ATCC12384. Samples of the S ⁇ pyogenes challenge inoculum are plated on blood agar plates to determine the CFU and to verify the challenge dose. Deaths are recorded for a period of 5 days .
- EXAMPLE 12 This example illustrates the protection of mice against fatal S. pyogenes infection induced by immunization.
- Groups of 8 female CD-I mice (Charles River) are immunized subcutaneously three times at three-week intervals with 20 ⁇ g of affinity purified His-tagged S ⁇ pyogenes recombinant proteins in presence of 10 ⁇ g of QuilA adjuvant (Cedarlane Laboratories Ltd, Hornby, Canada) or, as control, with QuilA adjuvant alone in PBS. Blood samples are collected from the orbital sinus on day 1, 22 and 43 prior to each immunization and seven days (day 50) following the third injection.
- mice Two weeks later the mice are challenged with approximately 2xl0 7 CFU of the type 3 S ⁇ pyogenes strain ATCC12384. Samples of the S ⁇ pyogenes challenge inoculum are plated on blood agar plates to determine the CFU and to verify the challenge dose. Deaths are recorded for a period of 14 days .
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Gastroenterology & Hepatology (AREA)
- Hematology (AREA)
- Urology & Nephrology (AREA)
- Biomedical Technology (AREA)
- Pulmonology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Food Science & Technology (AREA)
- Cell Biology (AREA)
- Biotechnology (AREA)
- Virology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Toxicology (AREA)
- Communicable Diseases (AREA)
Priority Applications (15)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US10/451,337 US7595057B2 (en) | 2000-12-21 | 2001-12-21 | Streptococcus pyogenes antigens and corresponding DNA fragments |
| EP01271387A EP1343895B1 (en) | 2000-12-21 | 2001-12-21 | Streptococcus pyogenes antigens and corresponding dna fragments |
| DE60134494T DE60134494D1 (de) | 2000-12-21 | 2001-12-21 | Antigene aus streptococcus pyogenes und zugehörige dna-fragmente |
| BR0116704-9A BR0116704A (pt) | 2000-12-21 | 2001-12-21 | Antìgenos de streptococcus pyogenes e fragmentos de dna correspondentes |
| AU1686302A AU1686302A (en) | 2000-12-21 | 2001-12-21 | Streptococcus pyogenes antigens and corresponding dna fragments |
| AU2002216863A AU2002216863B8 (en) | 2000-12-21 | 2001-12-21 | Streptococcus pyogenes antigens and corresponding DNA fragments |
| JP2002552000A JP4080876B2 (ja) | 2000-12-21 | 2001-12-21 | ストレプトコッカス・ピオゲネス抗原及び対応するdnaフラグメント |
| CA2432525A CA2432525C (en) | 2000-12-21 | 2001-12-21 | Streptococcus pyogenes antigens and corresponding dna fragments |
| ES01271387T ES2307564T3 (es) | 2000-12-21 | 2001-12-21 | Antigenos de streptococcus pyrogenes y fragmentos de adn correspondientes. |
| US12/568,457 US8298551B2 (en) | 2000-12-21 | 2009-09-28 | Streptococcus pyogenes antigens and corresponding DNA fragments |
| US13/659,233 US8821895B2 (en) | 2000-12-21 | 2012-10-24 | Streptococcus pyogenes antigens and corresponding DNA fragments |
| US14/448,719 US9340586B2 (en) | 2000-12-21 | 2014-07-31 | Streptococcus pyogenes antigens and corresponding DNA fragments |
| US15/099,268 US20160326221A1 (en) | 2000-12-21 | 2016-04-14 | Streptococcus pyogenes antigens and corresponding dna fragments |
| FR21C1005C FR21C1005I2 (fr) | 2000-12-21 | 2021-02-04 | Antigenes de streptococcus pyogenes et fragments d'adn correspondants |
| BE2021C506C BE2021C506I2 (https=) | 2000-12-21 | 2021-02-09 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US25694000P | 2000-12-21 | 2000-12-21 | |
| US60/256,940 | 2000-12-21 |
Related Child Applications (4)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US10451337 A-371-Of-International | 2001-12-21 | ||
| US10/451,337 A-371-Of-International US7595057B2 (en) | 2000-12-21 | 2001-12-21 | Streptococcus pyogenes antigens and corresponding DNA fragments |
| US12/568,457 Division US8298551B2 (en) | 2000-12-21 | 2009-09-28 | Streptococcus pyogenes antigens and corresponding DNA fragments |
| US12/568,457 Continuation US8298551B2 (en) | 2000-12-21 | 2009-09-28 | Streptococcus pyogenes antigens and corresponding DNA fragments |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2002050107A2 true WO2002050107A2 (en) | 2002-06-27 |
| WO2002050107A3 WO2002050107A3 (en) | 2003-04-10 |
Family
ID=22974225
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/CA2001/001853 Ceased WO2002050107A2 (en) | 2000-12-21 | 2001-12-21 | Streptococcus pyogenes antigens and corresponding dna fragments |
Country Status (12)
| Country | Link |
|---|---|
| US (5) | US7595057B2 (https=) |
| EP (1) | EP1343895B1 (https=) |
| JP (1) | JP4080876B2 (https=) |
| AT (1) | ATE398677T1 (https=) |
| AU (2) | AU1686302A (https=) |
| BE (1) | BE2021C506I2 (https=) |
| BR (1) | BR0116704A (https=) |
| CA (2) | CA2789252C (https=) |
| DE (1) | DE60134494D1 (https=) |
| ES (1) | ES2307564T3 (https=) |
| FR (1) | FR21C1005I2 (https=) |
| WO (1) | WO2002050107A2 (https=) |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2003051914A3 (en) * | 2001-12-18 | 2004-03-04 | Hansa Medical Res Aktiebolag | Ides, an igg-degrading enzyme of streptococcus pyogenes |
| US20160326221A1 (en) * | 2000-12-21 | 2016-11-10 | Id Biomedical Corporation Of Quebec | Streptococcus pyogenes antigens and corresponding dna fragments |
| US10696959B2 (en) | 2015-02-12 | 2020-06-30 | Hansa Biopharma AB | Cysteine protease |
| US10758597B2 (en) | 2015-02-12 | 2020-09-01 | Hansa Biopharma AB | Cysteine proteases |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2005017093A2 (en) * | 2003-08-15 | 2005-02-24 | Id Biomedical Corporation | Polypeptides of streptococcus pyogenes |
| EP4687953A2 (en) * | 2023-03-29 | 2026-02-11 | Cyrus Biotechnology, Inc. | Ides variant proteins and methods of using the same |
Family Cites Families (28)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5854416A (en) * | 1991-11-14 | 1998-12-29 | The United States Of America As Represented By The Department Of Health And Human Services | Streptococcus pneumoniae 37-KDA surface adhesin a protein and nucleic acids coding therefor |
| US6287574B1 (en) | 1995-03-17 | 2001-09-11 | Biochem Pharma Inc. | Proteinase K resistant surface protein of neisseria meningitidis |
| ES2540281T3 (es) * | 1998-02-20 | 2015-07-09 | Id Biomedical Corporation Of Quebec | Antígenos de estreptococos del grupo B |
| GB9807890D0 (en) * | 1998-04-09 | 1998-06-10 | Actinova Ltd | Peptides |
| DE69935986D1 (de) | 1998-07-27 | 2007-06-14 | Sanofi Pasteur Ltd | Streptococcus pneumoniae proteine und nukleinsäuren |
| WO2000006736A2 (en) | 1998-07-27 | 2000-02-10 | Microbial Technics Limited | Nucleic acids and proteins from group b streptococcus |
| US7128918B1 (en) * | 1998-12-23 | 2006-10-31 | Id Biomedical Corporation | Streptococcus antigens |
| GB9828880D0 (en) * | 1998-12-31 | 1999-02-17 | Actinova Ltd | Protein |
| US7074415B2 (en) * | 2000-06-20 | 2006-07-11 | Id Biomedical Corporation | Streptococcus antigens |
| JP4718099B2 (ja) * | 2000-07-06 | 2011-07-06 | アイディー バイオメディカル コーポレイション | ストレプトコッカス・パイオジェンス抗原 |
| EP1325133B1 (en) * | 2000-10-13 | 2012-02-29 | ID Biomedical Corporation | Bvh-a2 and bvh-a3 antigens of group b streptococcus |
| DK1328543T3 (da) * | 2000-10-27 | 2009-11-23 | Novartis Vaccines & Diagnostic | Nukleinsyrer og proteiner fra streptococcus-gruppe A & B |
| EP1343895B1 (en) * | 2000-12-21 | 2008-06-18 | ID Biomedical Corporation | Streptococcus pyogenes antigens and corresponding dna fragments |
| ES2338637T3 (es) * | 2001-02-21 | 2010-05-11 | Id Biomedical Corporation | Polipeptidos de streptococcus pyogenes y fragmentos de adn correspondiente. |
| BR0208874A (pt) * | 2001-04-13 | 2004-06-22 | Wyeth Corp | Proteìnas superficiais de streptococcus pyogenes |
| WO2003004650A2 (en) * | 2001-07-06 | 2003-01-16 | Shire Biochem Inc. | Group b streptococcus antigens and corresponding dna fragments |
| GB0130228D0 (en) * | 2001-12-18 | 2002-02-06 | Hansa Medica Ab | Protein |
| EP1456231A2 (en) * | 2001-12-20 | 2004-09-15 | Shire Biochem Inc. | Streptococcus antigens |
| AU2003246495A1 (en) * | 2002-07-15 | 2004-02-02 | Id Biomedical Corporation | Polypeptide of streptococcus pyogenes |
| WO2005017093A2 (en) * | 2003-08-15 | 2005-02-24 | Id Biomedical Corporation | Polypeptides of streptococcus pyogenes |
| WO2006042027A2 (en) * | 2004-10-08 | 2006-04-20 | Novartis Vaccines And Diagnostics Inc. | Immunogenic and therapeutic compositions for streptococcus pyogenes |
| JP5427409B2 (ja) * | 2005-06-09 | 2014-02-26 | ハンサ メディカル アクチボラゲット | 自己免疫疾患及び移植片拒絶反応を治療するためのIdeSプロテイナーゼ(化膿連鎖球菌由来)の使用 |
| US8309096B2 (en) * | 2007-01-15 | 2012-11-13 | Glaxosmithkline Biologicals S.A. | Fusion protein |
| CN102584989B (zh) * | 2007-09-14 | 2015-05-13 | 季诺维斯公司 | 用于解离Fcgamma-受体-IgG复合物及纯化与检测IgG的方法和试剂盒 |
| GB201003920D0 (en) * | 2010-03-09 | 2010-04-21 | Glaxosmithkline Biolog Sa | Method of treatment |
| GB201115841D0 (en) * | 2011-09-13 | 2011-10-26 | Genovis Ab | Protein and method |
| GB201316744D0 (en) * | 2013-09-20 | 2013-11-06 | Genovis Ab | Method |
| GB201416849D0 (en) * | 2014-09-24 | 2014-11-05 | Genovis Ab | Method |
-
2001
- 2001-12-21 EP EP01271387A patent/EP1343895B1/en not_active Expired - Lifetime
- 2001-12-21 US US10/451,337 patent/US7595057B2/en not_active Expired - Lifetime
- 2001-12-21 CA CA2789252A patent/CA2789252C/en not_active Expired - Fee Related
- 2001-12-21 DE DE60134494T patent/DE60134494D1/de not_active Expired - Lifetime
- 2001-12-21 JP JP2002552000A patent/JP4080876B2/ja not_active Expired - Fee Related
- 2001-12-21 AT AT01271387T patent/ATE398677T1/de not_active IP Right Cessation
- 2001-12-21 AU AU1686302A patent/AU1686302A/xx active Pending
- 2001-12-21 ES ES01271387T patent/ES2307564T3/es not_active Expired - Lifetime
- 2001-12-21 WO PCT/CA2001/001853 patent/WO2002050107A2/en not_active Ceased
- 2001-12-21 CA CA2432525A patent/CA2432525C/en not_active Expired - Fee Related
- 2001-12-21 BR BR0116704-9A patent/BR0116704A/pt not_active Application Discontinuation
- 2001-12-21 AU AU2002216863A patent/AU2002216863B8/en not_active Ceased
-
2009
- 2009-09-28 US US12/568,457 patent/US8298551B2/en not_active Expired - Fee Related
-
2012
- 2012-10-24 US US13/659,233 patent/US8821895B2/en not_active Expired - Lifetime
-
2014
- 2014-07-31 US US14/448,719 patent/US9340586B2/en not_active Expired - Fee Related
-
2016
- 2016-04-14 US US15/099,268 patent/US20160326221A1/en not_active Abandoned
-
2021
- 2021-02-04 FR FR21C1005C patent/FR21C1005I2/fr active Active
- 2021-02-09 BE BE2021C506C patent/BE2021C506I2/fr unknown
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20160326221A1 (en) * | 2000-12-21 | 2016-11-10 | Id Biomedical Corporation Of Quebec | Streptococcus pyogenes antigens and corresponding dna fragments |
| WO2003051914A3 (en) * | 2001-12-18 | 2004-03-04 | Hansa Medical Res Aktiebolag | Ides, an igg-degrading enzyme of streptococcus pyogenes |
| US7666582B2 (en) | 2001-12-18 | 2010-02-23 | Hansa Medical Research Ab | IdeS, an IgG-degrading enzyme of Streptococcus pyogenes |
| US10696959B2 (en) | 2015-02-12 | 2020-06-30 | Hansa Biopharma AB | Cysteine protease |
| US10758597B2 (en) | 2015-02-12 | 2020-09-01 | Hansa Biopharma AB | Cysteine proteases |
| US11214784B2 (en) | 2015-02-12 | 2022-01-04 | Hansa Biopharma AB | Cysteine protease |
| US11524057B2 (en) | 2015-02-12 | 2022-12-13 | Hansa Biopharma AB | Cysteine protease |
| US11667905B2 (en) | 2015-02-12 | 2023-06-06 | Hansa Biopharma AB | Cysteine protease |
| US12359183B2 (en) | 2015-02-12 | 2025-07-15 | Hansa Biopharma AB | Cysteine protease |
Also Published As
| Publication number | Publication date |
|---|---|
| FR21C1005I2 (fr) | 2022-01-14 |
| US7595057B2 (en) | 2009-09-29 |
| US20130136760A1 (en) | 2013-05-30 |
| EP1343895B1 (en) | 2008-06-18 |
| CA2432525A1 (en) | 2002-06-27 |
| AU2002216863B8 (en) | 2008-03-20 |
| CA2789252A1 (en) | 2002-06-27 |
| BR0116704A (pt) | 2003-12-23 |
| US9340586B2 (en) | 2016-05-17 |
| US8821895B2 (en) | 2014-09-02 |
| ES2307564T3 (es) | 2008-12-01 |
| US20160326221A1 (en) | 2016-11-10 |
| CA2789252C (en) | 2016-11-15 |
| JP4080876B2 (ja) | 2008-04-23 |
| US8298551B2 (en) | 2012-10-30 |
| DE60134494D1 (de) | 2008-07-31 |
| AU2002216863B2 (en) | 2008-02-28 |
| ATE398677T1 (de) | 2008-07-15 |
| JP2004524014A (ja) | 2004-08-12 |
| BE2021C506I2 (https=) | 2021-05-31 |
| US20040097706A1 (en) | 2004-05-20 |
| US20100119507A1 (en) | 2010-05-13 |
| EP1343895A2 (en) | 2003-09-17 |
| WO2002050107A3 (en) | 2003-04-10 |
| AU1686302A (en) | 2002-07-01 |
| ES2307564T9 (es) | 2021-04-26 |
| CA2432525C (en) | 2012-11-27 |
| FR21C1005I1 (https=) | 2021-03-26 |
| US20150017684A1 (en) | 2015-01-15 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US7811585B2 (en) | Streptococcus pyogenes antigens | |
| US7883706B2 (en) | Methods for using Streptococcus pyogenes polypeptides | |
| US20160326221A1 (en) | Streptococcus pyogenes antigens and corresponding dna fragments | |
| AU2002234455A1 (en) | Streptococcus pyogenes polypeptides and corresponding DNA fragments | |
| AU2002317107A1 (en) | Group B streptococcus antigens and corresponding DNA fragments | |
| WO2003004650A2 (en) | Group b streptococcus antigens and corresponding dna fragments | |
| AU2001272270B2 (en) | Streptococcus pyogenes antigen | |
| WO2004007725A1 (en) | Polypeptide of streptococcus pyogenes | |
| US20070110763A1 (en) | Polypeptides of streptococcus pyogenes | |
| WO2002079475A2 (en) | Streptococcus pyogenes antigens and corresponding dna fragments | |
| AU2002325109A1 (en) | Moraxella (branhamella) catarrhalis polypeptides and corresponding DNA fragments | |
| EP1420817A1 (en) | Moraxella (branhamella) catarrhalis polypeptides and corresponding dna fragments | |
| AU2001272270A1 (en) | Streptococcus pyogenes antigen |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ OM PH PL PT RO RU SD SE SG SI SK SL TJ TM TN TR TT TZ UA UG US UZ VN YU ZA ZM ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 2001271387 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2432525 Country of ref document: CA Ref document number: 2002552000 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2002216863 Country of ref document: AU |
|
| WWP | Wipo information: published in national office |
Ref document number: 2001271387 Country of ref document: EP |
|
| REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 10451337 Country of ref document: US |
|
| WWG | Wipo information: grant in national office |
Ref document number: 2001271387 Country of ref document: EP |