WO2001049851A1 - Progenitor cell preservation factors and related methods and products - Google Patents
Progenitor cell preservation factors and related methods and products Download PDFInfo
- Publication number
- WO2001049851A1 WO2001049851A1 PCT/US1999/031307 US9931307W WO0149851A1 WO 2001049851 A1 WO2001049851 A1 WO 2001049851A1 US 9931307 W US9931307 W US 9931307W WO 0149851 A1 WO0149851 A1 WO 0149851A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cells
- fril
- cell
- family member
- progenitor
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/415—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
- C07K14/42—Lectins, e.g. concanavalin, phytohaemagglutinin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P39/00—General protective or antinoxious agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- the invention relates to the preservation of progenitor cells. More specifically, the invention relates to the in vivo or ex vivo preservation of progenitor cells, such as hematopoietic progenitor cells.
- hematopoiesis involves the process of producing a balanced supply of different blood cells from such progenitor cells found in the adult bone marrow.
- the development of other cell types also depends upon production of the differentiated cells from such progenitor cells.
- Progenitor cells are activated by signals, such as cell-cell contact or soluble regulators, to generate daughter cells that are identical to the parent (i.e., self- renewal of the parent) and /or to generate daughter cells that are more differentiated than the parent, thus beginning an irreversible process that ends with the production of differentiated, functional cells.
- signals such as cell-cell contact or soluble regulators
- proliferation is coupled to proliferation as a progenitor cell gives rise to more differentiated daughter cells that progressively become committed to producing only one blood cell type.
- hematopoietic progenitor cells The enormous activation of hematopoietic progenitor cells needed to meet the body's daily requirement for hundreds of billions of new mature blood cells is directed by potent soluble regulators (e.g., colony stimulating factors and cytokines) acting upon the hematopoietic progenitor cells themselves, and their more differentiated daughter cells.
- potent soluble regulators e.g., colony stimulating factors and cytokines
- progenitor cells eventually produce so many of the mature cells of the body, they occur only rarely.
- typically the more primitive (i.e., undifferentiated) the progenitor cell typically the more rare the progenitor cell.
- the currently believed most primitive of the hematopoietic progenitor cells which are called hematopoietic stem cells, occur at a frequency of only from about 1 in 10,000 to about 1 in 100,000 of the cells in the bone marrow.
- Hematopoietic stem cells have the capacity to generate more than 10 13 mature blood cells of all lineages, including other progenitor cells which, although more differentiated than hematopoietic stem cells, are themselves capable of giving rise to several different types of mature blood cells. Hematopoietic stem cells are responsible for sustaining blood cell production over the life of an animal. The small population of hematopoietic stem cells is sufficient to produce all the mature blood cells in a healthy individuals; however, some unhealthy individuals suffer from a lack of a sufficient number of progenitor cells and/or mature blood cells.
- cancer patients receiving chemotherapeutic or radiotherapy treatments designed to kill the rapidly dividing cancer cells also suffer from the depletion of white blood cells and platelets, thus exposing these patients to life threatening opportunistic infections and bleeding episodes. Indeed, this hematopoietic progenitor cell-depleting activity is the dose- limiting factor for most of these chemotherapeutic and radiotherapeutic agents.
- Many cancer patients are routinely treated with cytokines, including G-CSF,
- GM-CSF GM-CSF
- SCF Erythropoietin
- IL-11 IL-11
- these cytokines lead to the irreversible differentiation of hematopoietic progenitor cells, including hematopoietic stem cells, into more differentiated daughter cells.
- cytokines Workers in the field have attempted to use cytokines in mice to protect progenitors from the toxicity of chemotherapy (Neta et al., /. Immunol. 136: 2483- 2485, 1986; Neta et al, /. Immunol.
- the invention provides a family of factors that preserve progenitor cells.
- Members of this family, the FRIL family are non-toxic, inexpensively produced reagents that preserve progenitor cells.
- the invention provides compositions comprising at least one member of the FRIL family, as well as methods for using members of the FRIL family to preserve progenitor cells both in vivo and ex vivo.
- the invention provides an essentially pure composition of one or more members of the FRIL family of progenitor cell preservation factors.
- the FRIL family member is from a legume.
- the legume is Dolichos lab lab.
- the legume is Phaseolus vulgaris.
- the legume is Sphenostylis stenocarpa.
- the FRIL family member is a mutant derived from a second member of the FRIL family, wherein the mutant is selected from the group consisting of a substitution mutant, a deletion mutant, an addition mutant, or a combination thereof.
- the FRIL family member is a fusion protein comprising a first portion and a second portion, wherein the first portion is derived from a second member of the FRIL family.
- the invention provides a recombinant nucleic acid molecule encoding a composition of a member of the FRIL family of progenitor cell preservation factors.
- the invention provides a pharmaceutical formulation comprising an essentially pure composition of one or more members of the FRIL family of progenitor cell preservation factors and a pharmaceutically acceptable carrier.
- administration of a therapeutically effective amount of the formulation to a patient prior to treatment of the patient with a therapeutic treatment having a hematopoietic progenitor cell- depleting activity alleviates and /or reduces the hematopoietic progenitor cell- depleting activity of the therapeutic treatment in the patient.
- the patient is a human or is a domesticated mammal. In some embodiments, the patient has cancer.
- the therapeutic treatment is a radiotherapeutic or a chemotherapeutic treatment, including, without limitation, cytarabine (Ara-C), doxorubicin (Dox), or 5-fluorouracil (5-FU), or a combination of a radiotherapeutic and a chemotherapeutic.
- a radiotherapeutic or a chemotherapeutic treatment including, without limitation, cytarabine (Ara-C), doxorubicin (Dox), or 5-fluorouracil (5-FU), or a combination of a radiotherapeutic and a chemotherapeutic.
- the invention provides a method for alleviating or reducing the hematopoietic progenitor cell-depleting activity of a therapeutic treatment in a patient, comprising administering to the animal a therapeutically effective amount of a composition of a FRIL family member prior to administration of the therapeutic treatment to the patient.
- the patient is a human or is a domesticated mammal.
- the patient has cancer.
- the therapeutic treatment is a radiotherapeutic or a chemotherapeutic treatment, including, without limitation, cytarabine (Ara-C), doxorubicin (Dox), or 5-fluorouracil (5-FU), or a combination of a radiotherapeutic and a chemotherapeutic.
- the invention provides a method for isolating a population of progenitor cells, comprising contacting a population of cells with a plurality of FRIL family member molecules, and separating the unbound cells, wherein the cells bound to the FRIL family member molecules are an isolated population of progenitor cells.
- the isolated population of progenitor cells is from a human.
- the FRIL family member molecules are detectably labeled.
- the detectably labeled FRIL family member molecules are labeled with a chromophore.
- the unbound cells are separated by using a flow cytometry cell sorter to sort the population of cells contacted with the FRIL family member molecules detectably labeled with a chromophore.
- the FRIL family member molecules is immobilized on a solid support.
- the solid support is a bead, such as a magnetic bead.
- the unbound cells are separated by applying a magnet to the population of cells contacted with the FRIL family member molecules immobilized on the magnetic bead.
- the population of cells bound to the FRIL family member molecules immobilized on a magnetic bead is rinsed with a physiologically acceptable solution while the magnet is applied.
- the solid support is the bottom of a tissue culture plate.
- the unbound cells are separated by rinsing the population of cells contacted with the FRIL family member immobilized on the bottom of a tissue culture plate with a physiologically acceptable solution.
- the isolated population of progenitor cells is a population of hematopoietic progenitor cell.
- the population of cells is whole blood, umbilical cord blood, bone marrow cells, or fetal liver cells.
- the population of cells is a sorted population of cells, wherein a cell of the sorted population does not express a cell surface molecule selected from the group consisting of CDllb, CDllc, and CD38.
- the sorted population of cells is sorted by flow cytometry or by magnetic bead selection.
- invention provides an isolated population of progenitor cells isolated by a method comprising contacting a population of cells with a plurality of FRIL family member molecules, and separating the unbound cells, wherein the cells bound to the FRIL family member molecules are an isolated population of progenitor cell.
- the progenitor cell is from a human.
- the cells of the isolated population do not express CD34.
- the cells of the isolated population express a receptor tyrosine kinase selected from the group consisting of from FLK1, FLT1, FLT3, FLT4, and Kit.
- the cells of the isolated population express a cell surface molecule selected from the group consisting of CDllb and CDllc.
- the cells of the isolated population express FLT3.
- the cells of the isolated population are hemangioblasts, messengerchymal stem cells, bone progenitor cells, hepatic progenitor cells, endothelial progenitor cells, hematopoietic progenitor cells, embryonal stem cells, brain progenitor cells, or dendritic progenitor cells.
- the cells of the isolated population are hematopoietic progenitor cells.
- the cells of the isolated population are hematopoietic progenitor cells
- transplantation of the isolated population into an animal lacking a population of hematopoietic progenitor cells sufficient to enable survival of the animal reconstitutes the animal, wherein the transplanted animal survives.
- the hematopoietic progenitor cells are from a human or a mouse and wherein the animal is a mouse.
- the mouse is a SCID mouse or the mouse is sublethally irradiated or the mouse is treated with a sublethal dose of a chemotherapeutic.
- the hematopoietic progenitor cells are from a human and the animal is a human.
- the human is a cancer patient receiving a treatment that depletes the patient's hematopoietic progenitor cells.
- the treatment is a radiotherapeutic or a chemotherapeutic treatment, including, without limitation, cytarabine (Ara-C), doxorubicin (Dox), or 5- fluorouracil (5-FU), or a combination of a radiotherapeutic and a chemotherapeutic.
- the invention provides a method for preserving progenitor cells ex vivo comprising contacting a population of cells comprising at least one progenitor cell with an effective amount of a composition of a FRIL family member for an effective period of time, wherein the progenitor cells in the population are rendered quiescent.
- the progenitor cells are from a human.
- the population of cells is bone marrow cells.
- the non-progenitor cells in the population of cells differentiate or die.
- the population of cells is removed from a cancer patient prior to treatment of the cancer patient with a therapeutic treatment having a hematopoietic progenitor cell-depleting activity.
- the therapeutic treatment is a radiotherapeutic or a chemotherapeutic treatment, including, without limitation, cytarabine (Ara-C), doxorubicin (Dox), or 5-fluorouracil (5-FU), or a combination of a radiotherapeutic and a chemotherapeutic.
- the invention provides a method for preserving progenitor cells in vivo, comprising administering to a patient an effective amount of a composition of a FRIL family member for an effective period of time, wherein the progenitor cells in the patient are rendered quiescent.
- the patient is a human or a domesticated animal.
- the patient is a cancer patient.
- the effective amount of the composition of a FRIL family member is administered prior to the treatment of the patient with a therapeutic treatment having a hematopoietic progenitor cell-depleting activity.
- the therapeutic treatment is a radiotherapeutic or a chemotherapeutic treatment, including, without limitation, cytarabine (Ara-C), doxorubicin (Dox), or 5-fluorouracil (5-FU), or a combination of a radiotherapeutic and a chemotherapeutic.
- a radiotherapeutic or a chemotherapeutic treatment including, without limitation, cytarabine (Ara-C), doxorubicin (Dox), or 5-fluorouracil (5-FU), or a combination of a radiotherapeutic and a chemotherapeutic.
- the invention provides a method for identifying a progenitor cell, comprising contacting a candidate cell with a FRIL family member molecule, wherein binding of the candidate cell to the FRIL family member molecule identifies the candidate cell as a progenitor cell.
- the candidate cell is in a population of cells. In certain embodiments, the candidate cell is from a human.
- the invention provides a progenitor cell identified by a method comprising contacting a candidate cell with a FRIL family member molecule, wherein binding of the candidate cell to the FRIL family member identifies the candidate cell as a progenitor cell.
- the invention provides a method for identif ing a composition of a member of the FRIL family of progenitor cell preservation factors, comprising contacting a candidate compound with a glycosylated extracellular domain of an FLT3 receptor, wherein the glycosylation pattern of the extracellular domain of the FLT3 receptor is the same as the glycosylation pattern of an extracellular domain of a normally glycosylated FLT3 receptor, wherein a candidate compound that binds the glycosylated extracellular domain of the FLT3 receptor is identified as a composition of a FRIL family member.
- the candidate compound is a lectin.
- the lectin is synthetic.
- the lectin is from a legume.
- the invention provides an essentially pure composition of a FRIL family member identified by the method comprising contacting a candidate compound with a glycosylated extracellular domain of an FLT3 receptor, wherein the glycosylation pattern of the extracellular domain of the FLT3 receptor is the same as the glycosylation pattern of an extracellular domain of a normally glycosylated FLT3 receptor, wherein a candidate compound that binds the glycosylated extracellular domain of the FLT3 receptor is identified as a member of the FRIL family.
- compositions of a FRIL family member may be used as therapeutic agents to preserve progenitor cells in patients, such as cancer patients receiving chemotherapy, who have suffer from a condition that diminishes their progenitor cells.
- compositions of a FRIL family member may be administered with a pharmaceutically-acceptable carrier (e.g., physiological sterile saline solution) via any route of administration to a cancer patient receiving chemotherapy in an attempt to reduce the progenitor cell-depleting effects of the chemotherapeutic so that the patient can receive a higher dose of the chemotherapeutic and, preferably, recover from cancer.
- a pharmaceutically-acceptable carrier e.g., physiological sterile saline solution
- Pharmaceutically- acceptable carriers and their formulations are well-known and generally described in, for example, Remington's Pharmaceutical Sciences (18th Edition, ed. A. Gennaro, Mack Publishing Co., Easton, PA, 1990).
- Figure 1 is a map of a cloning vector pCR2.1-DLA manufactured by ligating a cDNA according to the invention in the EcoRI site of the cloning vector pCR2.1.
- Figure 2 shows a direct amino acid sequence comparison of the mannose lectin described by Gowda et al. (J Biol Chem 269:18789-18793, 1994) and the derived amino acid sequence of Dl-FRIL, a representative, non-limiting FRIL family member of the invention, encoded by a representative, non-limiting nucleic acid of the invention.
- Figure 3 is a map of a cloning vector pCR2.1-DLA(D) manufactured by ligating a mutated cDNA in the EcoRI site of the cloning vector pCR2.1.
- Figure 4 is a map of a cloning vector pBS-SpDLA manufactured by ligating a recombinant fragment in the EcoRI site of the cloning vector pBluescript SK+.
- Figure 5 is a map of a cloning vector pCR2.1-SpMl(D) manufactured by ligating a mutated recombinant clone in the EcoRI site of the cloning vector pCR2.1.
- Figure 6 is a map of a recombinant expression vector pBIN-VicPro manufactured by subclqrang the vicilin promoter obtained from the pCW66 vector in the EcoBI/Clal site of the plant binary vector pBIN19 for Agrobacterium-mediated transformation.
- Figure 7 is a map of a recombinant expression vector pBINVicPro-SpDLA manufactured by ligating a recombinant fragment in the EcoBI/Sacl site of the pBINVicPro vector.
- Figure 8 is a map of a recombinant expression vector pBINVicPro-SpDLA(D) manufactured by ligating a mutated recombinant clone in the EcoRI site of the pBINVicPro vector.
- Figure 9 is a map of a recombinant expression vector pGEX4T-l-DLA manufactured by ligating a wild-type cDNA clone in the EcoRI/S ⁇ /I site of the E. coli expression vector pGEX4T-l.
- Figure 10 is a map of a recombinant expression vector pGEX4T-l-DLA(D) manufactured by ligating a mutant cDNA clone in the EcoRI/X/zoI site of the E. coli expression vector pGEX4T-l.
- Figure 11 is a representation of an electrophoretogram of a Southern blot of total protein extracts of E. coli cells transformed with the recombinant expression vectors pGEX4T-l-DLA and pGEX4T-l-DLA(D).
- Figure 12 is a representation of an electrophoretogram of a Western blot of purified GST-fusion proteins with and without cleavage by thrombin.
- Figure 13A is a representation of a graph showing that a crude extract of an E. coli culture containing expressed Dl-FRIL, a representative, non-limiting FRIL family member of the invention, specifically stimulates hFLT33T3 cells;
- Figure 13B is a graph showing that the same extract does not stimulate untransfected 3T3 cells.
- Figure 14A is a representation of a histogram showing that purified Dl-FRIL, a representative, non-limiting FRIL family member of the invention, preserves cord blood mononuclear cells in a dose-responsive manner.
- Figure 14B is a representation of a histogram showing that purified Dl-FRIL, a representative, non-limiting FRIL family member of the invention, preserves hematopoietic progenitors in a dose-responsive manner.
- Figure 15 A is a representation of a photograph of colonies derived from human cord blood mononuclear cells cultured in 40 ng/mL Dl-FRIL, a representative, non-limiting FRIL family member of the invention, for 3 weeks, and then replated in methylcellulose colony assay medium.
- Figure 15B is a representation of a photograph of colonies derived from human cord blood mononuclear cells cultured in 40 ng/mL Dl-FRIL, a representative, non-limiting FRIL family member of the invention, for 4 weeks, and then replated into methylcellulose colony assay medium.
- Figure 16 is a schematic diagram showing the serial replating of progenitor cells cultured in Dl-FRIL, a representative, non-limiting FRIL family member of the invention, or Dl-FRIL+recFL (i.e., recombinant FLT3-Ligand).
- Dl-FRIL a representative, non-limiting FRIL family member of the invention
- Dl-FRIL+recFL i.e., recombinant FLT3-Ligand.
- the human cord mononuclear cells were first cultured in supensiion in 40 ng/mL Dl-FRtL of 40 ng/mL Dl-FRIL + 40 ng/mL recFL (solid black box). The cells were then harvested and assessed for progenitor activity by being replated into methylcellulose colony assay medium for 6 weeks (middle striped box).
- Figure 17 is a representation of a photograph of colonies derived from human cord blood mononuclear cells initially cultured in 40 ng/mL Dl-FRIL, a representative, non-limiting FRIL family member of the invention, for 3 weeks, then replated into methylcellulose colony assay medium for 6 weeks, and then replated again into methylcellulose colony assay medium for an additional 4 weeks.
- Figure 18 is a representation of a bar graph showing that a representative, non-limiting FRIL family member of the invention, Dl-FRIL, encoded by a representative, non-limiting nucleic acid of the invention is sufficient to preserve progenitor cells ex vivo, whereas a cytokine cocktail fails to preserve such cells.
- Figures 19A and 19B are representations of line graphs showing the biological specificity of receptor-transfected 3T3 cells.
- Figure 19A shows that rhM- CSF specifically stimulated Fms 3T3 (solid circles) but not either mFlt3/Fms 3T3 (open circles) or parent 3T3 cells (solid squares) in biological screening assay in a dose-dependent manner.
- Figure 19B shows that PHA-LCM (reciprocal dilution) stimulated mFlt3/Fms 3T3 (solid circles) and Stk 3T3 (open circles) but not parent untransfected 3T3 cells (solid squares).
- Figures 20A-20D are representations of the detected biological activities of PHA-LCM fractionated by anion exchange chromatography.
- Figure 20A shows the number of viable cells cord blood cells observed microscopically.
- Figure 20B shows the stimulation of mFlt3/Fms 3T3 cells by anion exchange column fractions.
- Figure 20C shows the stimulation of Stk 3T3 cells by anion exchange column fractions.
- Figure 20D shows the stimulation of Fms 3T3 cells by anion exchange column fractions.
- Figures 21A and 21B are representations of line graphs showing the co-factors required in the Flt33T3 assay during purification of Pv-FRIL, a representative, non- limiting FRIL family member of the invention.
- Figure 21A shows that the plateau stimulation of Flt33T3 cells decreased during purification from crude, 10-fold concentrated PHA-LCM (solid circles) to partially purified (open circles), and highly purified (solid squares). Medium control is shown is open squares.
- Figure 21B shows that the decreased plateau stimulation of Flt3 3T3 cells (solid circles) was restored by addition of sub-optimal concentrations (1:200) of crude PHA-LCM (solid squares). Corresponding medium controls are shown in open symbols.
- Figures 22A-22D are representations of a series of flow cytometry histograms showing the re-analysis of CD34 expression of cord blood CD34 + cells after two weeks in suspension culture with pooled AQS affinity column fractions.
- CD34 expression was re-analyzed by flow cytometry on pooled AQS affinity column fractions 1-5 ( Figure 22A), fractions 6-10 ( Figure 22B), fractions 11-15 ( Figure 22C), and fractions 16-20 ( Figure 22D). Fluorescence intensity on the abcissa and frequency of events on the ordinate in Figures 22A-22D.
- Figure 23 is a representation of a line graph showing the ILl-dependent response of mFlt3/Fms 3T3 cells to FRIL isolated from commercial red kidney bean extract.
- mFlt3/Fms 3T3 cells respond to FRIL in the presence of rhILl (solid circles) but not the absence of ILl (solid squares).
- Corresponding medium only controls are shown with open symbols.
- Figure 24A is a map of a cloning vector pCR2.1-Pv-FRIL manufactured by ligating a cDNA according to the invention in the EcoRI site of the cloning vector pCR2.1.
- Figure 24B shows a direct amino acid sequence comparison of Pv-FRIL, a representative, non-limiting FRIL family member of the invention, with Dl-FRIL, another representative, non-limiting FRIL family member of the invention, and the
- FIG. 25 is a map of a cloning vector pCR2.1-SpPv-FRIL manufactured by ligating a cDNA according to the invention in the Xhol site of the cloning vector pCR2.1.
- Figure 26 is a map of a cloning vector pM-SpPv-FRIL manufactured by ligating a cDNA according to the invention in the BglH/Xhol sites of the cloning vector SpPv-FRIL.
- Figures 27A-27B are representations of line graphs showing the total cell numbers and progenitor levels in the presence of Dl-FRIL,a representative, non- limiting FRIL family member of the invention, or cytokines.
- Enriched CB CD34 + cells were cultured for 3,6,10, or 13 days in the presence of Dl-FRIL (solid symbols) or cytokines (open symbols). Colonies were scored on day 14 and progenitor levels were calculated based on total cell numbers. Values shown represent the mean ⁇ SEM of data from up to 10 experiments.
- Figure 27A shows the total cell numbers over time.
- Figure 27B shows the progenitor levels in cultures over time.
- Figures 28A-28D are representations of line and bar graphs showing the total cell numbers and progenitor levels first in the presence of Dl-FRIL, a representative, non-limiting FRIL family member of the invention, and second in presence of cytokines.
- Figure 28A shows the total numbers of cells cultured with Dl-FRIL for entire 10 days (solid symbols) or for 6 days followed by 4 days of cytokine stimulation (open symbols).
- Figure 28B shows the progenitor levels in cells cultured with Dl-FRIL for entire 10 days (solid symbols) or for 6 days followed by 4 days of cytokine stimulation (open symbols).
- Figure 28C shows the total numbers of cells cultured with Dl-FRIL for 13 days (solid symbols) or for 10 days followed by 3 days of cytokine stimulation (open symbols).
- Figure 28D shows the progenitor levels in cells cultured with Dl-FRIL for 13 days (solid symbols) or for 10 days followed by 3 days of cytokine stimulation (open symbols).
- Figures 29 A-29D are representations of representative Southern blot analyses showing the quantitative analysis of SRC after ex vivo cultures with Dl-FRIL,a representative, non-limiting FRIL family member of the invention, or cytokines and after transplantation into mice.
- Figure 29A is a representation of a representative Southern blot showing human DNA in the marrow of mice transplanted with cells that were cultured with Dl-FRIL for 6 days (lane 1), Dl-FRIL for 10 days (lane 2), or with Dl-FRIL for 6 days followed by 4 days with cytokine stimulation (lane 3).
- Figure 29B is a representation of a representative Southern blot showing human DNA in the marrow of mice transplanted with cells cultured with Dl-FRIL for 10 days (lanes 1-2), or with Dl-FRIL for 6 days followed by 4 days with cytokine stimulation (lanes 3-4).
- Figure 29C is a representation of a representative Southern blot showing human DNA in the marrow of mice transplanted with the original cells prior to seeding (lane 1), or with cells cultured with Dl-FRIL for 13 days (lane 2).
- Figure 29D is a representation of a representative Southern blot showing human DNA in the marrow of mice transplanted with cells cultured with FRIL for 10 days (lane 1), Dl-FRIL for 6 days followed by 4 days of cytokine stimulation (lane 2), Dl-
- FRIL for 13 days (lane 3), or with Dl-FRIL for 10 days followed by 3 days of cytokine stimulation (lane 4).
- Figure 29E is a representation of a Southern blot analysis showing the detection of a 0%, 0.1%, 1%, and 10% human DNA per murine DNA.
- Figure 30 is a representation of a survival chart summarizing the levels of human cell engraftment in the marrow of mice transplanted with CD34 + cells cultured in either Dl-FRIL, a representative, non-limiting FRIL family member of the invention, for ten days (left panel), or in the presence of Dl-FRIL for 6 days followed by culture in the presence of cytokines for four days.
- Figure 31 is a representation of a representative Southern blotting analysis showing the levels of levels of human cell engraftment in the BM of NOD/SCID B2M""" transplanted with CD34 + CD38 "/low cells cultured in the presence of Dl-FRIL, a representative, non-limiting FRIL family member of the invention.
- Sorted cells (2xl0 5 initial cells /treatment) were cultured in the presence of Dl-FRIL for 6 days followed by additional 4 days exposure to cytokines, or with Dl-FRIL alone for 10 days.
- 3.6xl0 5 cells harvested from cytokine culture were divided and transplanted into 3 mice (lanes 1-3), while 3.5xl0 4 cells harvested from Dl-FRIL alone culture were transplanted to one mouse (lane 4).
- DNA was harvested from the bone marrow of transplanted mice and subjected to Southern blotting analysis with radiolabeled human chromosome 17-specific cc-satellite probe (pl7H8). A representative experiment out of 4 is shown.
- Figure 32 is a representation of a bar graph showing the average fold increase of engraftment levels obtained with CD34 + CD38 "/low cells that were cultured with Dl-FRIL, a representative, non-limiting FRIL family member of the invention, for 6 days and with cytokines for 4 days (right bar), as compared to 10 days with Dl-FRIL alone (left bar). Data represent mean ⁇ SE from 4 experiments.
- Figures 33A-33F are representations of a bar graph ( Figure 33 A) and representative flow cytometry histograms ( Figure 33B-33F) showing the multilineage differentiation of SRC cultured with Dl-FRIL, a representative, non- limiting FRIL family member of the invention, in the BM of transplanted mice.
- Figure 33A shows the number of colonies per 2 x 10 cells, where the cells treated as indicated prior to transplantation into mice were recovered from the murine BM, and seeded into semisolid media selective for human colonies. Progenitor levels were calculated based on the total human cell numbers (2 x 10 cells) in the marrow of transplanted mice. Values shown represent the mean ⁇ SEM of data from 3 experiments, 9 mice/treatment.
- Figure 33B shows a representative flow cytometry analysis showing nonspecific labeling where mouse IgG was used as isotype control.
- Figures 33C and 33D show representative flow cytometry analyses of BM cells from mice that were transplanted with CD34 + cells (Figure 33C) or CD34 + CD38 " lo cells (Figure 33D) precultured with Dl-FRIL for 10 days, where the harvested BM cells were stained with anti human CD45 and anti-human CD19.
- Figures 33E and 33F show representative flow cytometry analyses of BM cells from mice that were engrafted by CD34 + cells ( Figure 33E) or CD34 + CD38 ' low cells ( Figure 33F) precultured with Dl-FRIL for 10 days, where the harvested BM cells were subsequently cultured with SCF + IL-15 for 10 days, and then stained with human specific monoclonal anti-CD45 and anti-CD56.
- Figures 34A-34B are representations of bar graphs showing the growth effect of Dl-FRIL, a representative, non-limiting FRIL family member of the invention, on CD34 + cells and progenitors compared to Flt3 ligand and cytokine combinations. (+) indicates co-culture of factors for the entire 10 days while (->) indicates substitution of the first factor after 6 days with cytokines, as indicated under the x axis.
- (+) indicates co-culture of factors for the entire 10 days while (->) indicates substitution of the first factor after 6 days with cytokines, as indicated under the x axis.
- FIG. 34A shows the total cell numbers.
- Figure 34B shows the percentage of CFU-GEMM out of total colonies. Values shown are per 2x10 s seeded cells, and represent the mean ⁇ SEM of data from 5 experiments.
- Figures 35A-35G are representatives of flow cytometry histograms showing the cell cycle analyses of CD34 + cells cultured with Dl-FRIL, a representative, non- limiting FRIL family member of the invention, or various cytokines, or with combinations thereof. DNA content was determined by flow cytometry with propidium iodide staining. Enriched CD34 + cells were cultured for 3 days with no treatment (Fig. 35A), Dl-FRIL (Fig. 35B), FU3-L (Fig. 35C), Dl-FRIL+Flt3-L (Fig. 35D), SCF+G-CSF+IL-3+IL-6 (SG36) (Fig. 35E), SG36+D1-FRIL (Fig. 35F), and SG36+Flt3-L (Fig. 35G).
- Figures 36A-36C are representations of line graphs showing the dose response of CB mnc chemotherapeutic agents in the presence and absence of Dl- FRIL, a representative, non-limiting FRIL family member of the invention.
- Chemotherapy agents were assayed over a 5-log dose range on CB MNC (2 x 10 5 cells /0.1 mL) in AIMV (Life Technologies) containing Agar-SCM (StemCell
- Viable cells were determined after 5 days of culture by XTT. Solid squares indicate chemotherapy drug with no Dl-FRIL; solid triangles indicate cultures containing Dl-FRIL at 10 ng/ml in all wells; and open circles indicate Dl- FRIL in all wells at 100 ng/ml.
- Figure 36A shows the dose response to Ara-C; Figure 36B shows the dose response to doxorubicin, and Figure 36C shows the dose response to 5-FU.
- Figure 37 is a representation of a photograph of purified Dl-FRIL, a representative, non-limiting FRIL family member of the invention, resolved by SDS- PAGE analysis. Five discrete bands appeared which corresponded to the and ⁇ subunits, each of which was subjected to amino-terminal sequencing. The amino acid sequences of the five bands are as indicated.
- the invention relates the preservation of progenitor cells by members of the FRIL family of progenitor cell preservation factors. More specifically, the invention relates to the in vivo or ex vivo preservation of progenitor cells, such as hematopoietic progenitor cells, using members of the FRIL family of progenitor cell preservation factors.
- the invention provides a family of factors that preserve progenitor cells.
- Members of this family, the FRIL family are non-toxic, inexpensively produced reagents that preserve progenitor cells.
- the invention provides compositions comprising at least one member of the FRIL family, as well as methods for using members of the FRIL family to preserve progenitor cells both in vivo and ex vivo.
- the invention provides an essentially pure composition of a member of the FRIL family of progenitor cell preservation factors.
- FRIL family of progenitor cell preservation factors is used to mean a family of lectins, wherein each FRIL family member molecule binds to a normally glycosylated FLT3 receptor, wherein each FRIL family member molecule preserves progenitor cells, and wherein one FRIL family member molecule that is isolated from a hyacinth bean (i.e., Dolichos lab lab) has an amino acid sequence which comprises the following eight amino acid sequence: TNNVLQXT (SEQ ID NO: 24).
- a composition of a FRIL family member which includes a mutant of another FRIL family member molecule or a fusion protein comprising a portion derived from a FRIL family member molecule or mutant thereof, wherein each FRIL family member molecule binds to a normally glycosylated FLT3 receptor has at least about 45% amino acid sequence identity with the amino acid sequence of another member of the FRIL family, preferably at least about 50% identity, even more preferably at least about 55% identity, still more preferably at least about 60% identity, and still more preferably at least about 65% identity with the sequence of the second protein.
- the amino acid sequence of the first protein shares at least about 75% sequence identity, preferably at least about 85% identity, and more preferably at least about 95% identity, with the amino acid sequence of another member of the FRIL family.
- Both amino acid sequence identity and nucleic acid sequence identity between two proteins or two nucleic acid molecules can be measured according to standard methods. For example, in order to compare a first amino acid sequence to a second amino acid sequence or a first nucleic acid sequence to a second nucleic acid sequence for the purpose of determining percentage identity between the two sequences, the sequences are aligned so as to maximize the number of identical amino acid or nucleic acid residues.
- the sequences of proteins sharing at least 50% amino acid sequence identity or the sequences of nucleic acids sharing at least 45% nucleic acid sequence identity can usually be aligned by visual inspection. If visual inspection is insufficient, the proteins or nucleic acids may be aligned in accordance with the FASTA method in accordance with Pearson and Lipman (Proc. Natl. Acad. Sci. USA 85:2444-2448, 1988), or, preferably, any of the methods described by
- sequence analysis software Another method for determining amino acid or nucleic acid sequence identity between two proteins or nucleic acids is by using sequence analysis software with the default parameters specified therein.
- sequence analysis software Various software packages exist including Sequence Analysis Software Package of the Genetics Computer Group (University of Wisconsin Biotechnology Center, Madison, WI), and the various BLAST programs of the National Center for Biotechnology (National Library of Medicine, Bethesda, MD). Unless otherwise specified, percentage of amino acid sequence identity or percentage of nucleic acid sequence identity is determined using the basic BLAST program of the National Center for Biotechnology (National Library of Medicine, Bethesda, MD), using the default settings defined therein.
- Another test for percentage identity of two nucleic acid sequences is whether they hybridize under normal hybridization conditions, preferably under stringent hybridization conditions.
- proteins that are encoded by nucleic acid molecules that hybridize under high stringent conditions to a sequence complementary to SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, and/or SEQ ID NO: 7.
- stringent conditions is equivalent to "high stringent conditions” and "high stringency.” These terms are used interchangeably in the art.
- Stringent conditions are defined in a number of ways.
- stringent conditions are selected to be about 50°C lower than the thermal melting point (T m ) for a specific sequence at a defined ionic strength and pH.
- the T m is the temperature (under defined ionic strength and pH) at which 50% of the target sequence hybridizes to a perfectly matched sequence.
- Typical stringent conditions are those in which the salt concentration is at least about 0.02 M at pH 7 and the temperature is at least about 60°C "Stringent conditions,” in referring to percentage identity (e.g., homology) or substantial similarity in the hybridization context, can be combined conditions of salt, temperature, organic solvents or other parameters that are typically known to control hybridization reactions.
- stringent conditions can be provided in a variety of ways such as overnight incubation at 42°C in a solution comprising: 20% formamide, 5 x SSC (150 mM NaCl, 15 mM trisodium citrate), 50 mM sodium phosphate (pH 7.6), 5 x Denhardt's solution, 10% dextran sulfate, and 20 / /g/ml denatured, sheared salmon sperm DNA.
- the stringent conditions are characterized by a hybridization buffer comprising 30% formamide in 5 x SSPE (0.18 M NaCl, 0.01 M NaP0 4 , pH 7.7, 0.0001 M EDTA) buffer at a temperature of 42°C, and subsequent washing at 42°C with 0.2 x SSPE.
- stringent conditions involve the use of a hybridization buffer comprising 50% formamide in 5 x SSPE at a temperature of 42°C and washing at the same temperature with 0.2 x SSPE.
- progenitor cells an ability of a FRIL family member molecule (or mutant thereof or fusion protein comprising a FRIL family member molecule or mutant thereof) to retain (i.e., preserve) progenitor cells in an undifferentiated state, which can be determined using the assays described below (e.g., the SCID mouse reconstituting cell assay and the methylcellulose or other semi-solid medium based hematopoietic progenitor cell assay).
- progenitor cell refers to any normal somatic cell that has the capacity to generate fully differentiated, functional progeny by differentiation and proliferation.
- Progenitor cells include progenitors from any tissue or organ system, including, but not limited to, blood, mesenchymal, embryonic, nerve, muscle, skin, gut, bone, kidney, liver, pancreas, thymus, brain and the like.
- Progenitor cells are distinguished from "differentiated cells," the latter being defined as those cells that may or may not have the capacity to proliferate, i.e., self-replicate, but that are unable to undergo further differentiation to a different cell type under normal physiological conditions.
- progenitor cells are further distinguished from abnormal cells such as neoplastic cells, as defined herein. For example, leukemia cells proliferate (self -replicate), but generally do not further differentiate, despite appearing to be immature or undifferentiated.
- Progenitor cells include all the cells in a lineage of differentiation and proliferation prior to the most differentiated or the fully mature cell.
- progenitors include the skin progenitor in the mature individual.
- the skin progenitor is capable of differentiation to only one type of cell, but is itself not fully mature or fully differentiated.
- hematopoiesis is meant the development of mature, functional blood cells.
- the progenitor cells that give rise to mature, functional blood cells are called hematopoietic progenitor cells.
- the most primitive, undifferentiated hematopoietic progenitor cell is called a hematopoietic stem cell.
- Hematopoietic stem cells typically reside in the bone marrow primarily in a quiescent state, and may form identical daughter cells through a process called "self -renewal.”
- hematopoietic progenitor For red blood cell (erythrocyte) production, a unipotential progenitor called a "CFU-E" (colony forming unit-erythroid) has the capacity to generate two to 32 mature progeny cells.
- CFU-E colony forming unit-erythroid
- hematopoietic progenitor cells include those cells that are capable of successive cycles of differentiating and proliferating to yield up to eight different mature hematopoietic cell lineages.
- Uncommitted progenitor cells such as hematopoietic stem cells
- Progenitor cells that retain a capacity to generate all cell lineages, but that can not self -renew, are termed “pluripotent.” Cells that can produce some but not all blood lineages and can not self -renew are termed
- Progenitor cells can be defined by mRNA levels of genes that either specifically regulate progenitors or serve as markers of lineage commitment.
- genes induced in primitive human hematopoietic progenitor cells include those encoding the shared beta subunits of the IL3, IL5, and/or granulocyte- macrophage colony-stimulating factor (GM-CSF) receptors, termed the beta common chain (McClanahan et al., Blood 81:3903-2915, 1993); CD34 genes; and/or the receptors for Kit (Turner et al., Blood 88:3383-3390, 1996), FLTl, FLT4 (Galland et al., Oncogene 8:3233-1240, 1993), FLK1 (Broxmeyer et al., Int. J. Hematol. 62:303-215,
- genes for intermediate progenitors include the c-Fms, G-CSF receptor, and/or CD34 genes; and the IL-7 receptor gene, a gene induced for B lymphopoiesis.
- Murine primitive progenitor populations include receptors for interleukin-1 alpha (IL-l ), IL-3, IL-6, granulocyte colony-stimulating factor (G- CSF), and/or FLK1-1 (the murine homologue of human KDR which binds VEGF) (Broxmeyer, supra), but lack receptors for macrophage colony-stimulating factor (M-CSF), granulocyte-macrophage colony stimulating factor (GM-CSF), and leukemia inhibitory factor (LIF).
- Cells within the intermediate progenitor cell population include receptors for GM-CSF, G-CSF, IL-6, and/or IL-l ⁇ .
- bind binds to a normally glycosylated FLT3 receptor with an affinity higher than the affinity with which the FLT3-Ligand binds the FLT3 receptor.
- a FRIL family member molecule binds to a normally glycosylated FLT3 receptor with an affinity that is at least as high as the affinity with which an antibody binds its specific ligand.
- a FRIL family member molecule of the invention binds to a normally glycosylated FLT3 receptor with an affinity that is higher than the affinity with which an antibody binds its specific ligand. Still more preferably, a FRIL family member molecule of the invention binds to a normally glycosylated FLT3 receptor with a dissociation
- FRIL family member molecule of the invention binds to a normally glycosylated FLT3 receptor with a dissociation constant (K D ) of at least 10 "11 M.
- K D dissociation constant
- Standard methods for determining binding and binding affinity are known.
- normally glycosylated FLT3 receptor is meant an FLT3 receptor that has a glycosylation pattern of an FLT3 cell glycosylated by a normal cell.
- normal cell a cell that is not neoplastic.
- neoplastic cell a cell that shows aberrant proliferation, particularly increased proliferation, that is not regulated by such factors as cell-cell contact inhibition and soluble regulators (e.g., cytokines or hormones), and that abnormally glycosylates the FLT3 receptor such that the glycosylation pattern on the FLT3 receptor on the neoplastic cells is abnormal and such that the FLT3 receptor on the neoplastic cell is not bound by a FRIL family member molecule.
- soluble regulators e.g., cytokines or hormones
- essentially pure means a molecule, such as a nucleic acid or protein (e.g., a FRIL family member molecule), or composition of a molecule that is more free from other organic molecules (e.g., carbohydrates, nucleic acids, proteins, and lipids) that naturally occur with an impure molecule, and is substantially free as well of materials used during the purification process.
- a nucleic acid or protein e.g., a FRIL family member molecule
- composition of a molecule that is more free from other organic molecules (e.g., carbohydrates, nucleic acids, proteins, and lipids) that naturally occur with an impure molecule, and is substantially free as well of materials used during the purification process e.g., a FRIL family member molecule
- a protein or nucleic acid molecule is considered to be essentially pure if it is at least approximately 60%, preferably at least approximately 75%, more preferably approximately at least 85%, most preferably approximately at least 90%, and optimally approximately at least 95% pure, i.e., free from other organic molecules with which it naturally occurs and free from materials used during the purification process.
- Methods for purifying proteins include, without limitation, HPLC, SDS-PAGE, immunoprecipitation, recombinant protein production, affinity chromatography using specific antibodies, ion-exchange, size-exclusion, and hydrophobic interaction chromatography, or a combination of any of these methods.
- a FRIL family member can also be purified by binding to a mannose, which may be coupled on a sold support (e.g., a sepharose bead).
- FRIL family member molecule may be purified from a natural source by methods well known in the art. For example, the purification of Dl-FRIL from Dolichos lab lab is described below in Example 1.
- a suitable natural source from which to purify a FRIL family member molecule includes plants, especially legume plants.
- Legumes such as the garden pea or the common bean, are plants (“leguminous plants”) from a family (Leguminosae) of dicotyledonous herbs, shrubs, and trees bearing (nitrogen-fixing bacteria) nodules on their roots. These plants are commonly associated with their seeds (e.g., the garden pea or the common bean)
- a FRIL family member molecule according to the first aspect of the invention can be purified from members of the tribe Phaseoleae.
- a FRIL family member molecule can be purified from Dolichos lab lab (e.g., hyacinth beans, which is also known by other common names throughout the world).
- a FRIL family member molecule can be purified from varieties of the common bean (Phaseolus vulgaris) (e.g., red kidney beans and white kidney beans), from yam bean (Sphenostylis stenocarpa) or from Vigna sinensis, commonly known as the black-eyed pea.
- the common bean Phaseeolus vulgaris
- yam bean Sphenostylis stenocarpa
- Vigna sinensis commonly known as the black-eyed pea.
- a native FRIL family member molecule can be easily purified from legumes, such as hyacinth beans (pesticide-free), by mannose- affinity chromatography or ovalbumin affinity chromatography, and is more than
- FRIL family member molecules is a mannose/glucose-specific legume lectin.
- FRIL family member molecules, and compositions of FRIL family member molecules have many attributes as reagents to either alleviate the progenitor cell-depleting activity of a therapeutic (e.g., a chemotherapeutic) or to alleviate the symptoms of a condition where the patient's progenitor cells are depleted.
- FRIL family members have unique properties and are the first soluble regulators reported to preserve hematopoietic stem cells and progenitors in a dormant state for extended periods, even in the presence of potent stimulators of proliferation and differentiation. Moreover, because mice tolerate very high levels of compositions of FRIL family members, this may permit more effective protection of stem cells and progenitors by preventing their recruitment during aggressive dose intensification regimens aimed at increasing frequency and dosage levels of chemotherapy. While the biological activity of Dl-FRIL is similar to cytokines (ng/ml range), as demonstrated in the examples below, mice tolerated up to a 1,000-fold more Dl-FRIL than cytokines.
- one or more members of the FRIL family allows for the administration of a broad range of cell cycle active chemotherapy drugs with greater frequency and higher dose.
- administration of a composition of one or more FRIL family members may permit more aggressive dose-intensification chemotherapy regimens for a broad range of chemotherapy drugs.
- Administration of a composition of a FRIL family member also provides for a larger reservoir of progenitor cells which could rapidly respond to stimulatory signals after completing chemotherapy.
- the FRIL family member of the invention is from a legume (e.g., a bean plant).
- the FRIL family member molecule of the invention is from a hyacinth bean (i.e., Dolichos lab lab), and has an amino acid sequence comprising the sequence of SEQ ID NO: 24.
- the FRIL family member molecule of the invention isolated from a hyacinth bean has the amino acid sequence of SEQ ID NO: 2 or comprises a signal sequence having the amino acid sequence of SEQ ID NO: 4, and, even more preferably, is encoded by a nucleic acid having the nucleic acid sequence of SEQ ID NO: 1 or the nucleic acid sequence of SEQ ID NO: 3.
- the FRIL family member molecule of the invention is from a red kidney bean (i.e., Phaseolus vulgaris).
- the FRIL family member of the invention isolated from a red kidney bean has the amino acid sequence of
- SEQ ID NO: 6 is encoded by a nucleic acid having the nucleic acid sequence of SEQ ID NO: 5.
- the FRIL family member of the invention is from a yam bean (i.e., Sphenostylis stenocarpa).
- the FRIL family member of the invention isolated from a yam bean has the amino acid sequence comprising the amino acid sequence of SEQ ID NO: 8, more preferably has a ⁇ subunit having an amino acid sequence which comprises the amino acid sequence of SEQ ID NO: 9, even more preferably has an ⁇ subunit having an amino acid sequence which comprises the amino acid sequence of SEQ ID NO: 10, and, even more preferably, is encoded by a nucleic acid having a nucleic acid sequence which comprises the nucleic acid sequence of SEQ ID NO: 7.
- the FRIL family member molecule is a mutant derived from a second member of the FRIL family, wherein the mutant is selected from the group consisting of a substitution mutant, a deletion mutant, an addition mutant, or a combination thereof (e.g., a mutant of Dl-
- FRIL or Pv-FRIL described below For example, it is preferred to substitute amino acids in a sequence with equivalent amino acids.
- Groups of amino acids known normally to be equivalent are: (1) Ala(A), Ser(S), Thr(T), Pro(P), and Gly(G); (2) Asn(N), Asp(D), Glu(E), Gln(Q); (3) His(H), Arg(R), Lys(K); (4) Met(M), Leu(L), Ile(I), Val(V); and (5) Phe(F), Tyr(Y), Trp(W).
- Substitutions, additions, and/or deletions in an amino acid sequence can be made as long as the mutant FRIL family member molecule continues to satisfy the functional criteria described herein.
- amino acid sequence that is substantially the same as another sequence, but that differs from the other sequence by means of one or more substitutions, additions, and/or deletions, is considered to be an equivalent sequence.
- less than 50%, more preferably less than 25%, and still more preferably less than 10%, of the number of amino acid residues in a sequence are substituted for, added to, or deleted from the FRIL family member molecule upon which the mutant FRIL family member was derived.
- the FRIL family member molecule is a fusion protein comprising a first portion and a second portion, wherein the first portion is derived from a second member of the FRIL family.
- fusion protein is meant a molecule comprising at least two proteins or polypeptide fragments thereof joined together, wherein the proteins or polypeptide fragments thereof are not joined together in the naturally-occurring organism from which the proteins or polypeptide fragments thereof were derived.
- the two proteins or polypeptide fragments thereof of a fusion protein may be joined by any means, including, without limitation, a chemical linker, a peptide bond, or a non- covalent bond, such as an ionic bond.
- protein or “polypeptide” is meant a chain of two or more amino acid residues joined with a peptide bond regardless of length or post-translational modification such as acetylation, glycosylation, lipidation, acetylation, or phosphorylation.
- a FRIL family member molecule that is a fusion protein may comprise a first portion derived from a FRIL family member and a second portion derived from a protein or other molecule not related to the FRIL family (e.g., the heavy chain of an antibody).
- An additional FRIL family member molecule that is a fusion protein is FRIL family member comprising the subunit from a first FRIL family member and a ⁇ subunit from a second FRIL family member.
- Such a fusion protein may be generated, for example, by joining a nucleic acid sequence encoding the subunit of the first FRIL family member in frame with a nucleic acid sequence encoding the ⁇ subunit of the second FRIL family member.
- the nucleic acid encoding such a fusion protein can be engineered to encode an enzyme-specific cleavage site between the portion encoding the ⁇ subunit of the first FRIL family member and the portion encoding the ⁇ subunit of the second FRIL family member.
- identity of the fusion protein as a FRIL family member is determined by the sequence identity between the FRIL family member-derived portion of the fusion protein and a second FRIL family member, where the FRIL family member-derived portion of the fusion protein and the second FRIL family member share at least about 45% amino acid sequence identity, even more preferably at least about 50% identity, even more preferably at least about 55% identity, still more preferably at least about 60% identity, still more preferably at least about 65% identity yet more preferably at least about 75% sequence identity, still more preferably at least about 85% identity, and most preferably at least about 95% identity, with the amino acid sequence of a second member of the FRIL family.
- a FRIL family member in accordance with the first aspect of the invention can also be a recombinant protein made by expressing a recombinant nucleic acid that encodes FRIL in a suitable host.
- the invention features an essentially pure nucleic acid molecule encoding a member of the FRIL family of progenitor cell preservation factors. Exemplary purifications of the nucleic acid molecules of the invention from Dolichos lab lab and Phaseolus vulgaris are described below.
- nucleic acid in accordance to this aspect of the invention need not have a naturally occurring sequence, but need only encode a FRIL family member according to the first aspect of the invention.
- a "member of the FRIL family of progenitor cell preservation factors" is a described above the first aspect of the invention. "Essentially pure” is used as described for the first aspect of the invention.
- a “recombinant nucleic acid” is meant a nucleic acid which encodes a FRIL family member molecule, or a portion encoding at least 15 contiguous amino acids thereof, or a mutant thereof, or a fusion protein comprising the molecule, portion thereof or mutant thereof or is capable of expressing an antisense molecule specifically complementary thereto, or a sense molecule that shares nucleic acid sequence identity thereto wherein the recombinant nucleic acid may be in the form of linear DNA or RNA, covalently closed circular DNA or RNA, or as part of a chromosome, provided however that it cannot be the native chromosomal locus for a FRIL family member molecule.
- Preferred recombinant nucleic acids of the invention are vectors, which may include an origin of replication and are thus replicatable in one or more cell type. Certain preferred recombinant nucleic acids are expression vectors, and further comprise at least a promoter and passive terminator, thereby allowing transcription of the recombinant nucleic acid in a bacterial, fungal, plant, insect or mammalian cell.
- nucleic acid or “nucleic acid molecule” as used herein, means any deoxyribonucleic acid (DNA) or ribonucleic acid (RNA), including, without limitation, complementary DNA (cDNA), genomic DNA, RNA, hnRNA, messenger RNA (mRNA), DNA/RNA hybrids, or synthetic nucleic acids (e.g., an oligonucleoti.de) comprising ribonucleic and/or deoxyribonucleic acids or synthetic variants thereof.
- the nucleic acid of the invention includes, without limitation, an oligonucleoti.de or a polynucleoti.de.
- a nucleic acid encoding a FRIL family member has at least about 50% nucleic acid sequence identity with a nucleic acid encoding another member of the FRIL family, preferably at least about 555% nucleic acid sequence identity, more preferably at least about 60% nucleic acid sequence identity, more preferably at least about 65% nucleic acid sequence identity, still more preferably at least about 75% nucleic acid sequence identity, still more preferably at least about 85% nucleic acid sequence identity, and most preferably at least about 95% nucleic acid sequence identity with a nucleic acid encoding another member of the FRIL family. Percentage nucleic acid sequence identity can be determined as described for the first aspect of the invention.
- a recombinant nucleic acid according to the second aspect of the invention can also be chemically synthesized by methods known in the art.
- recombinant DNA can be synthesized chemically from the four nucleotides in whole or in part by methods known in the art. Such methods include those described in Caruthers, M.H., Science 230(4723):281-285, 1985).
- DNA can also be synthesized by preparing overlapping double-stranded oligonucleotides, filling in the gaps, and ligating the ends together. See, generally, Sambrook et al., supra, and Glover and Hames, eds., DNA Cloning, 2d ed., Vols. 1-4, IRL Press, Oxford, 1995.
- a recombinant nucleic acid molecule of the invention encoding a mutant FRIL family member can be prepared from wild-type DNA by site-directed mutagenesis (see, for example, Zoller and Smith, Nucleic. Acids. Res. 10:6487-6500, 1982; Zoller, M.J., Methods Enzymol. 100:468-500, 1983; Zoller, M.J., DNA 3(6):479- 488, 1984.; and McPherson, M.J., ed., Directed Mutagenesis: A Practical Approach, IRL Press, Oxford, 1991.
- a recombinant nucleic acid of the second aspect of the invention can be amplified by methods known in the art.
- PCR polymerase chain reaction
- vectors e.g., recombinant expression vectors
- vectors which permit the incorporation of recombinant nucleic acids of interest for cloning and transformation of other cells.
- the invention further includes vectors (e.g., plasmids, phages, and cosmids) which incorporate a nucleotide sequence of the invention, especially vectors which include the recombinant nucleic acid molecule of the invention for expression of a FRIL family member.
- a recombinant nucleic acid of the invention can be replicated and used to express a FRIL family member following insertion into a wide variety of host cells in a wide variety of cloning and expression vectors.
- the host can be prokaryotic or eukaryotic.
- the nucleic acid can be obtained from natural sources and, optionally, modified.
- the genes can also be synthesized in whole or in part.
- Cloning vectors can comprise segments of chromosomal, non-chromosomal and synthetic DNA sequences.
- Some suitable prokaryotic cloning vectors include plasmids from E. coli, such as colEl, pCRl, pBR322, pMB9, pUC, pKSM, and RP4.
- Prokaryotic vectors also include derivatives of phage DNA such as M13fd, and other filamentous single-stranded DNA phages.
- Vectors for expressing proteins in bacteria are also known.
- Such vectors include the pK233 (or any of the t ⁇ c family of plasmids), T7, and lambda P L .
- Examples of vectors that express fusion proteins are PATH vectors described in Dieckmann and Tzagoloff (J. Biol. Chem. 260(3):1513-1520, 1985). These vectors contain DNA sequences that encode anthranilate synthetase (TrpE) followed by a polylinker at the carboxy terminus.
- TrpE anthranilate synthetase
- beta-galactosidase pEX
- pMAL maltose binding protein
- pGST glutathione S- transferase
- Vectors useful for cloning and expression in yeast are also available.
- a suitable example is the 2 ⁇ circle plasmid.
- Suitable cloning/expression vectors for use in mammalian cells are also known.
- Such vectors include well-known derivatives of SV-40, adenovirus, cytomegalovirus (CMV) retrovirus-derived DNA sequences.
- CMV cytomegalovirus
- the expression vectors useful in the present invention contain at least one expression control sequence that is operatively linked to the recombinant nucleic acid molecule or fragment thereof to be expressed.
- the control sequence is inserted in the vector in order to control and to regulate the expression of the recombinant nucleic acid of the invention.
- Examples of useful expression control sequences are the lac system, the trp system, the tac system, the trc system, major operator and promoter regions of phage lambda, the control region of fd coat protein, the glycolytic promoters of yeast, e.g., the promoter for 3-phosphogly cerate kinase, the promoters of yeast acid phosphatase, e.g., Pho5, the promoters of the yeast alpha- mating factors, and promoters derived from polyoma, adenovirus, retrovirus, and simian virus, e.g., the early and late promoters or SV40, and other sequences known to control the expression of genes of prokaryotic or eukaryotic cells and their viruses or combinations thereof.
- Useful expression hosts for expressing the recombinant nucleic acids of the invention include well-known prokaryotic and eukaryotic cells.
- suitable prokaryotic hosts include, for example, E. coli, such as E. coli SG-936, E. coli HB101, E. coli W3110, E. coli X1776, E. coli X2282, E. coli DHI, and E. coli MRC1, Pseudomonas, Bacillus, such as B. subtilis, and Streptomyces.
- Suitable eukaryotic cells include yeasts and other fungi, insect, animal cells, such as COS cells and CHO cells, human cells and plant cells in tissue culture.
- oligonucleotides or polynucleotides for use as primers in nucleic acid amplification procedures, such as the polymerase chain reaction (PCR), ligase chain reaction (LCR), Repair Chain Reaction (RCR), PCR oligonucleotide ligation assay (PCR-OLA), and the like.
- Oligonucleotides useful as probes in hybridization studies, such as in situ hybridization can be constructed. Numerous methods for labeling such probes with radioisotopes, fluorescent tags, enzymes, binding moieties (e.g., biotin), and the like are known, so that the probes of the invention can be adapted for easy detectability.
- Oligonucleotides can also be designed and manufactured for other purposes.
- the invention enables the artisan to design antisense oligonucleotides, and triplex-forming oligonucleotides, and the like, for use in the study of structure /function relationships.
- Homologous recombination can be implemented by adaptation of the nucleic acid of the invention for use as targeting means.
- Recombinant nucleic acids of the invention produced as described above can further be modified to alter biophysical or biological properties by means of techniques known in the art.
- the recombinant nucleic acid can be modified to increase its stability against nucleases (e.g., "end-capping"), or to modify its lipophilicity, solubility, or binding affinity to complementary sequences. Methods for modifying nucleic acids to achieve specific purposes are disclosed in the art, for example, in Sambrook et al., supra.
- the recombinant nucleic acid of the invention can include one or more portions of nucleotide sequence that are non-coding for a FRIL family member.
- the invention provides a pharmaceutical formulation comprising an essentially pure composition of one or more members of the FRIL family of progenitor cell preservation factors and a pharmaceutically acceptable carrier.
- pharmaceutically acceptable carrier is meant any inert carrier that is non-toxic to the animal to which it is administered and that retains the therapeutic properties of the compound with which it is administered (i.e., the FRIL family member).
- Pharmaceutically acceptable carriers and their formulations are well- known and generally described in, for example, Remington's Pharmaceutical Sciences (18th Edition, ed. A. Gennaro, Mack Publishing Co., Easton, PA, 1990).
- One exemplary pharmaceutically acceptable carrier is physiological saline.
- compositions of the invention may employ any pharmaceutically acceptable carrier, depending upon the route of administration of the composition.
- Compositions of FRIL family members may be used safely and efficaciously as a therapeutics.
- the gastrointestinal tracts of animals come in constant contact with lectins, such as FRIL family members, in raw and/or cooked vegetables and fruits. Many lectins pass through the gastrointestinal tract biologically intact (Pusztai, A., Eur. J. Clin. Nutr. 47: 691-699, 1993). Some lectins interact with the gut and are transported into the peripheral blood circulation.
- PNA peanut agglutinin
- Antibodies to dietary lectins are commonly found in people at levels of -l ⁇ g/ml (Tchernychev and Wilchek, FEBS Lett. 397: 139-142, 1996). These circulating antibodies do not block carbohydrate binding of the lectins.
- administering comprises administering a therapeutically effective amount of the pharmaceutical formulation to a patient suffering from a condition whereby the patient's hematopoietic progenitor cells are depleted alleviates and/or reduces the condition in the patient.
- a therapeutically effective amount is meant a dosage of a composition of a FRIL family member or pharmaceutical formulation comprising a composition of a FRIL family member that is effective to alleviate and/or reduce either a condition whereby the patient's hematopoietic progenitor cells are depleted or a hematopoietic progenitor cell- depleting activity of a therapeutic (e.g., a chemotherapeutic).
- a therapeutically effective amount is an amount of between about 500 ng of the FRIL family member/kg total body weight and about 5 mg/kg total body weight per day.
- a therapeutically effective amount is between about 500 ng/kg and 500 ⁇ g/kg total body weight of the FRIL family member per day. Still more preferably, a therapeutically effective amount is between about 5 ⁇ g/kg and 50 ⁇ g/kg total body weight of the FRIL family member per day. Most preferably, a therapeutically effective amount is an amount that delivers about 50 ⁇ g/kg total body weight of the FRIL family member per day.
- a composition of a FRIL family member of the invention and pharmaceutical formulation comprising a composition of a FRIL family member of the invention may be administered patients having, or predisposed to developing, a condition whereby the patient's hematopoietic progenitor cells are depleted.
- a condition may be congenital.
- the patient may have severe combined immunodeficiency or aplastic anemia.
- the condition may also be induced by a drug.
- administration of a therapeutically effective amount of the pharmaceutical formulation to a patient prior to treatment of the patient with a therapeutic treatment having a hematopoietic progenitor cell- depleting activity alleviates the hematopoietic progenitor cell-depleting activity of the therapeutic in the patient.
- cancer patients are often treated with radiotherapeutics or chemotherapeutics that have hematopoietic progenitor cell- depleting activity.
- hematopoietic progenitor cell-depleting activity an activity of a therapeutic treatment whereby the hematopoietic progenitor cells in the patient being treated with the therapeutic treatment are depleted, either by killing the progenitor cells or by inducing the progenitor cells to undergo irreversible differentiation.
- therapeutic treatments having hematopoietic progenitor cell-depleting activity are the chemotherapeutic agents cytarabine (Ara-C), doxorubicin (Dox), daunorubicin, and 5-fluorouracil (5-FU).
- administration of the pharmaceutical formulation of the invention to a patient prior to the treatment of the patient with a therapeutic treatment having a hematopoietic progenitor cell-depleting activity enables treatment of the patient with a higher dosage of the therapeutic treatment.
- the higher dosage of the therapeutic treatment may be accomplished by either an increased dose of the therapeutic treatment and/or an increased duration of treatment with the therapeutic treatment.
- AML Acute Myelogenous Leukemia
- a child diagnosed with childhood Acute Myelogenous Leukemia (AML) is typically initially treated for the first seven days with daunorubicin at 45 mg/m on Days 1-3 plus Ara-C at 100 mg/m for 7 days plus GTG at 100 mg/m for 7 days.
- the same child pretreated with a composition in accordance with this aspect of the invention may be able to tolerate a higher dosage (i.e., higher dose and/or prolonged treatment period) of any or all of these chemotherapeuti.es.
- a higher dosage i.e., higher dose and/or prolonged treatment period
- Such an increase in dosage tolerance of a therapeutic treatment(c.g., a chemotherapeutic) having a hematopoietic progenitor cell-depleting activity in a cancer patient is desirable since a higher dosage may result in the destruction of more cancerous cells.
- the pharmaceutical formulations and/or compositions of the invention may be administered by any appropriate means.
- the pharmaceutical formulations and/ or compositions of the invention may be administered to an mammal within a pharmaceutically-acceptable diluent, carrier, or excipient, in unit dosage form according to conventional pharmaceutical practice. Administration may begin before the mammal is symptomatic for a condition whereby the patient's hematopoietic progenitor cells are depleted.
- administration of the pharmaceutical formulations of the third aspect of the invention to a cancer patient may begin before the patient receives radiotherapy and/ or chemotherapy treatment.
- any appropriate route of administration of a pharmaceutical formulation and /or composition of the invention may be employed, including, without limitation, parenteral intravenous, intra-arterial, subcutaneous, sublingual, transdermal, topical, intrapulmonary, intramuscular, intraperitoneal, by inhalation, intranasal, aerosol, intrarectal, intravaginal, or by oral administration.
- Pharmaceutical formulations and /or compositions of the invention may be in the form of liquid solutions or suspensions; for oral administration, formulations may be in the form of tablets or capsules; and for intranasal formulations, in the form of powders, nasal drops, or aerosols.
- the pharmaceutical formulations and/or compositions may be administered locally to the area affected by a condition whereby the patient's hematopoietic progenitor cells are depleted.
- the pharmaceutical formulations and/or compositions of the invention may be administered directly into the patient's bone marrow.
- the pharmaceutical formulations and/or compositions of the invention may be administered systemically.
- the patient is human or a domesticated animal.
- domesticated animal is meant an animal domesticated by humans, including, without limitation, a cat, dog, elephants, horse, sheep, cow, pig, and goat.
- the patient has cancer.
- the reatment is a radiotherapeutic or a chemotherapeutic treatment, including, without limitation, cytarabine (Ara-C), doxorubicin (Dox), or 5-fluorouracil (5-FU), or a combination of a radiotherapeutic and a chemotherapeutic.
- a radiotherapeutic or a chemotherapeutic treatment including, without limitation, cytarabine (Ara-C), doxorubicin (Dox), or 5-fluorouracil (5-FU), or a combination of a radiotherapeutic and a chemotherapeutic.
- the invention provides a method for a method for alleviating and/or reducing the hematopoietic progenitor cell-depleting activity of a therapeutic treatment in a patient, comprising administering to the animal a therapeutically effective amount of a composition of a FRIL family member prior to administration of the therapeutic treatment to the patient.
- a composition of a FRIL family member prior to administration of the therapeutic treatment to the patient.
- Routes of administration of a composition of a FRIL family member of this aspect of the invention are as described for the administration of the pharmaceutical formulation of the third aspect of the invention.
- “Therapeutically effective amount” is as described for the third aspect of the invention.
- the patient is a human or a domesticated animal. "Domesticated animal" is as described for the third aspect of the invention.
- the patient has cancer.
- the therapeutic treatment is a radiotherapeutic or a chemotherapeutic treatment, including, without limitation, cytarabine (Ara-C), doxorubicin (Dox), or
- 5-fluorouracil (5-FU), or a combination of a radiotherapeutic and a chemotherapeutic.
- the invention provides a method for isolating a population of progenitor cells, comprising contacting a population of cells with a plurality of FRIL family member molecules, and separating the unbound cells, wherein the cells bound to the FRIL family member molecules are an isolated population of progenitor cells.
- FRIL family member molecule and "progenitor cell” are as described for the first aspect of the invention.
- unbound cell is meant a cell that does not bind to a FRIL family member.
- Bod is a described for the first aspect of the invention.
- isolated is meant a population of progenitor cells that is separated from a larger population of cells, wherein the percentage of progenitor cells in the isolated population is at least two fold greater than the percentage of progenitor cells in the larger population. Preferably, the percentage of progenitor cells in the isolated population is at least four fold greater than the percentage of progenitor cells in the larger population.
- a non-limiting example of the increased percentage of progenitor cells in an isolated population of progenitor cells of the invention is shown below in Table 11.
- the isolated population of progenitor cells of the invention is at most 2% of the total population of umbilical cord blood mononuclear cells (CB mnc).
- the population of progenitor cells of the invention is at most 1% of the total population of umbilical cord blood mononuclear cells (CB mnc).
- an isolated population of progenitor cells binds to a normally glycosylated FLT3 receptor. "Normally glycosylated FLT3 receptor" is as defined above.
- the isolated population of progenitor cells is from a human or is from a domesticated animal.
- the FRIL family member molecules are detectably. labeled.
- detectably labeled is meant that the FRIL family member is attached to a label that is detectable visually or instrumentally.
- Detectable labels such as enzymes and chromophoric molecules can be conjugated to the FRIL family member molecules by means of coupling agents, such as dialdehydes, carbodiimides, and dimaleimides. Numerous methods of labeling proteins are known in the art.
- the label can also be directly attached through a functional group on the FRIL family member.
- Such a functional group may be present on the FRIL family member molecule to be detectably labeled; alternatively, the FRIL family member molecules can be modified using standard techniques to contain a functional group.
- suitable functional groups include, without limitation, amino, carboxyl, sulfhydryl, maleimide, isocyanate, isothiocyanate.
- the detectable label is radioactive or non-radioactive.
- useful radioactive labels include 32 P, 125 1, 131 I, and 3 H. Use of radioactive labels have been described in U.K. patent document 2,034,323, and U.S.
- Non-radioactive labels include enzymes, chromophores, atoms and molecules detectable by electron microscopy, and metal ions detectable by their magnetic properties.
- the detectable label is an enzymatic label.
- Some useful enzymatic labels include enzymes that cause a detectable change in a substrate.
- Some useful enzymes and their substrates include, for example, horseradish peroxidase (pyrogallol and o-phenylenediamine), beta-galactosidase (fluorescein beta-D-galactopyranoside), and alkaline phosphatase (5-bromo-4-chloro-3-indolyl phosphate /nitro blue tetrazolium).
- horseradish peroxidase pyrogallol and o-phenylenediamine
- beta-galactosidase fluorescein beta-D-galactopyranoside
- alkaline phosphatase 5-bromo-4-chloro-3-indolyl phosphate /nitro blue tetrazolium.
- the detectably labeled FRIL family member molecules are labeled by being specifically bound by an antibody that is detectably labeled.
- the FRIL family member molecules are conjugated to a receptor (or ligand) and is detectably labeled by binding the receptor (or ligand) with the ligand (or receptor), wherein the ligand (or receptor) is detectably labeled.
- a receptor or ligand
- Any of the known ligand-receptor combinations is suitable.
- Some suitable ligand-receptor pairs include, for example, biotin-avidin or -streptavidin, and antibody-antigen. In certain embodiments, biotin-avidin combination is preferred.
- the detectable label is a chromophore.
- useful chromophores include, for example, fluorescent, chemiluminescent, and bioluminescent molecules, as well as dyes.
- Some specific chromophores useful in the present invention include, for example, fluorescein, rhodamine, Texas red, phycoerythrin, umbelliferone, luminol.
- the unbound cells are separated by using a flow cytometry cell sorter to sort the population of cells contacted with the FRIL family member molecules detectably labeled with a fluorescent marker.
- the FRIL family member molecules are immobilized on a solid support.
- Solid support includes any surface, including, without limitation, the surface of a sepharose bead, a gel, a matrix, a magnetic bead, and a plastic surface (e.g., the bottom of a tissue culture dish or flask).
- the solid support is a bead, for example, a magnetic bead.
- the unbound cells are separated by applying a magnet to the population of cells contacted with the FRIL family member molecules immobilized on the magnetic bead.
- the population of cells bound to the FRIL family member molecules immobilized on a magnetic bead is rinsed with a physiologically acceptable solution while the magnet is applied.
- physiologically acceptable solution is meant an inert solution, such as sterile saline solution or tissue culture medium, which is non-toxic to the cells.
- Magnetic beads are commerically available (e.g., from Dynabeads Tosylactivated, Lake Success, NY; or from Miltenyi Biotec, Auburn, CA). Since the FRIL family member is protein, it can be conjugated to a magnetic bead via amino- or sulfhydryl-groups of the protein.
- FRIL family member molecule can also immobilized on magnetic beads by a biotin- strepavidin interaction.
- Preferred magnetic beads are the MACS super-paramagnetic MicroBeads (from Miltenyi Biotec) which are extremely small, approximately 50 ran in diameter
- MACS beads are about one million times smaller in volume than eukaryotic cells. Because MACS beads react like magnetic antibodies, magnetic labeling is achieved within minutes. MACS MicroBeads form a stable colloidal suspension and do not precipitate or aggregate in magnetic fields. Because of their size and composition (iron oxide and polysaccharide) make the MACS biodegradable, so labeled cells retain their physiological function. This property of MACS beads is particularly useful for bead-sorted FRIL family member-binding cells, which bind the FRIL family member with such high affinity that it is difficult to remove the beads.
- the solid support is the bottom of a tissue culture plate.
- the unbound cells are separated by rinsing the population of cells contacted with the FRIL family member molecules immobilized on the bottom of a tissue culture plate with a physiologically acceptable solution.
- FRIL family member molecules may be directly or indirectly attached to the bottom of a tissue culture plate.
- a standard "panning" protocol see, e.g., Stengelin et al., EMBO J. 7(4):1053-1059, 1988; Aruffo and Seed, Proc. Natl. Acad. Sci. USA 84(23): 8573-8577, 1987
- a population of cells suspected of containing FRIL family member-binding progenitor cells is incubated on the plate.
- the plate is then gently rinsed with a physiologically acceptable solution, thereby removing the unbound cells while leaving the FRIL family member-binding population of cells attached to the FRIL family member-coated plate.
- the isolated population of progenitor cell is a population of hematopoietic progenitor cells.
- the population of cells is whole blood, umbilical cord blood, bone marrow cells, or fetal liver cells.
- the population of cells is a sorted population of cells, wherein a cell of the sorted population does not express CDllb, CDllc, or CD38.
- the population of cells is preferably sorted to first remove cells that express one or more of the following cell surface molecules: CDllb, CDllc, and CD38. Following this negative sort (i.e., a sort, wherein the cells retained do not express CDllb, CDllc, and/or CD38), the sorted population is positively sorted for an ability to bind a FRIL family member.
- the sorted population of cells is sorted by flow cytometry or by magnetic bead selection.
- a population of cells e.g., human umbilical cord blood cells
- chromophore-labeled antibodies or other molecule such as a ligand which specifically bind CDllb, CDllc, and/or CD38.
- the population of cells is then negatively sorted by flow cytometry, where the cells which are not bound by the antibodies (and so do not express CDllb, CDllc, and/or CD38) are retained and further sorted for an ability to bind a FRIL family member, wherein the population of cells that binds a FRIL family member is an isolated population of progenitor cells according to the invention.
- a population of cells may also be contacted with a molecule, such as an antibody, which specifically binds CDllb, CDllc, and/or CD38, wherein the molecule is attached to a solid support, such as a magnetic bead.
- the population is then negatively sorted by applying a magnet to the beads, and retaining the cells that do not bind the beads and so are not attracted to the magnet.
- These sorted cells are then further sorted for an ability to bind a FRIL family member, wherein the population of cells that binds a FRIL family member is an isolated population of progenitor cells according to the invention.
- invention provides an isolated population of progenitor cells isolated by a method comprising contacting a population of cells with a plurality of FRIL family member molecules, and separating the unbound cells, wherein the cells bound to the FRIL family member are an isolated population of progenitor cells.
- FRIL family member molecule "progenitor cell,” “unbound cell,” and “bind” are as described above.
- the isolated population of progenitor cells is from a human or a domesticated animal.
- the cells of the isolated population do not express CD34 on their cell surface.
- the cells of the isolated population express the FLK1, FLTl, FLT3, FLT4, or Kit receptor tyrosine kinases.
- the cells of the isolated population express the CDllb or CDllc cell surface molecules.
- the cells of the isolated population express FLT3.
- the cells of the isolated population are hemangioblasts, messengerchymal stem cells, bone progenitor cells, hepatic progenitor cells, endothelial progenitor cells, hematopoietic progenitor cells, embryonal stem cells, brain progenitor cells, or dendritic progenitor cells.
- hemangioblast is meant a cell that is a progenitor cell for both hemaopoietic and endothelial lineages.
- the cells of the isolated population are hematopoietic progenitor cells.
- a “messenchymal stem cells” is meant the population of cells that is the progenitor for bone marrow stromal cells, including, without limitation, adipose tissue cells, cartilage-producing cells, muscle cells, and bone cells. Such cells of this aspect of the invention can be used, for example, for tissue repair. Determination of what type of cells a progenitor cell of the invention will give rise to is made by the various progenitor cell assays described below. For example, if a progenitor cell is suspected of being an endothelial progenitor cell, the cell may be cultured in a methylcellulose progenitor cell assay in the presence of vascular endothelial growth factor. Should cells arising from such a culture have endothelial cell markers, the progenitor cell of the invention is a endothelial progenitor cell or perhaps a hemangioblast.
- the cells of the isolated population are hematopoietic progenitor cells
- transplantation of the cell into an animal lacking a population of hematopoietic progenitor cells sufficient to enable survival of the animal reconstitutes the animal, wherein the transplanted animal survives.
- Determination of the ability of a hematopoietic progenitor cell to reconstitute a animal lacking a population of hematopoietic progenitor cells sufficient to enable survival of the animal may be made using the methods described below for the NOD-SCID mouse.
- the hematopoietic progenitor cells are from a mouse or a human and the animal is a mouse.
- the mouse is a severe combined immunodeficient (SCID) mouse (e.g., the NOD-SCID mouse described below) or a mouse that has been exposed to a sublethal dose of radiation and /or chemotherapy
- the hematopoietic progenitor cells are from a human and the animal is a human.
- the human is a cancer patient receiving a treatment that depletes the patient's hematopoietic progenitor cells.
- the treatment is a radiotherapeutic or a chemotherapeutic treatment, including, without limitation, cytarabine (Ara-C), doxorubicin (Dox), or 5-fluorouracil (5-FU), or a combination of a radiotherapeutic and a chemotherapeutic.
- the invention provides a method for preserving progenitor cells ex vivo, comprising contacting a population of cells comprising at least one progenitor cell with an effective amount of a composition of a FRIL family member for an effective period of time, wherein the progenitor cell in the population are rendered quiescent.
- FRIL family member and "progenitor cell” are as described above for the first aspect of the invention.
- the terms "effective amount” and "effective period of time” are used to denote known treatments at dosages and for periods of time effective to preserve progenitor cells. Where administered to a patient, preferably, such administration is systemic (e.g., by intravenous injection). Effective amounts and effective periods of time can be determined using the models and assays described herein. For example, the Examples below describe the preservation of progenitor cells that have SCID-reconstituting ability.
- an effective amount may range from about 0.1 ng/mL to about 1 ⁇ g/mL of a FRIL family member, preferably about 1.0 ng/mL to to about 1.0 ⁇ g/mL, more preferably about 1.0 ng/mL to about 100 ng/mL, even more preferably about 10 ng/mL to about 50 ng/mL, and most preferably about 50 ng/mL of a FRIL family member in culture.
- an effective period of time includes culturing the cells in the presence of a FRIL family member for between would include from about 2 hours to 5 days, more preferably from about 12 hours to about 3 days, and most preferably for about 24 hours..
- the progenitor cells are from a human or from a domesticated animal.
- the population of cells is bone marrow cells.
- the non-progenitor cells in the population of cells differentiate or die.
- the progenitor cells in the culture do not actually expand in number, they are enriched relative to the number of cells in the culture.
- the population of cells is removed from a cancer patient prior to treatment of the cancer patient with a therapeutic treatment having a hematopoietic progenitor cell-depleting activity.
- the therapeutic treatment is a radiotherapeutic or a chemotherapeutic treatment, including, without limitation, cytarabine (Ara-C), doxorubicin (Dox), or 5-fluorouracil (5-FU), or a combination of a radiotherapeutic and a chemotherapeutic.
- the invention provides a method for preserving progenitor cells in vivo, comprising administering to a patient a therapeutically effective amount of a composition of a FRIL family member for a therapeutically effective period of time, wherein the progenitor cells in the patient are rendered quiescent.
- FRIL family member and “progenitor cell” are as described above for the first aspect of the invention.
- “Therapeutically effective amount” is as described for the third aspect of the invention.
- terapéuticaally effective period of time treatment for a period of time effective to preserve progenitor cells.
- administration is systemic (e.g., by intravenous injection).
- Effective amounts and effective periods of time can be determined using the models and assays described herein. For example, the examples below describe the preservation of progenitor cells that have SCID-reconstituting ability.
- a therapeutically effective period of time is injecting a therapeutically effective amount of a composition and/or pharmaceutical formulation of a FRIL family member between about 5 days before the patient receives treatment with a therapeutic treatment (e.g., a chemotherapeutic) having a progenitor cell-depleting activity to about 2 hours prior to treatment with the therapeutic treatment, wherein the therapeutically effective amount of a composition and /or pharmaceutical formulation of the FRIL family member is administered daily.
- a therapeutic treatment e.g., a chemotherapeutic
- a preferred therapeutically effective period of time is injecting a patient (e.g., a cancer patient) with a therapeutically effective amount of a composition and/or pharmaceutical formulation of a FRIL family member between about 2 days before the patient receives treatment with a therapeutic treatment (e.g., a chemotherapeutic) having a progenitor cell-depleting activity to about 1 day prior to treatment with the therapeutic treatment, wherein the therapeutically effective amount of a composition and/or pharmaceutical formulation of a FRIL is administered daily.
- a therapeutic treatment e.g., a chemotherapeutic
- the therapeutically effective amount of a composition and/or pharmaceutical formulation of a FRIL family member may be different from the therapeutically effective amount of the a composition and/or pharmaceutical formulation of a FRIL family member that the patient received prior to receiving treatment with the therapeutic treatment.
- the patient is a human or a domesticated animal. "Domesticated animal" is as described for the third aspect of the invention.
- the patient is a cancer patient.
- the effective amount of the composition of the FRIL family member is administered prior to the treatment of the patient with a therapeutic treatment having a hematopoietic progenitor cell-depleting activity.
- the therapeutic treatment is a radiotherapeutic or a chemotherapeutic treatment, including, without limitation, cytarabine (Ara-C), doxorubicin (Dox), or 5-fluorouracil (5-FU), or a combination of a radiotherapeutic and a chemotherapeutic.
- the invention provides a method for identifying a progenitor cell, comprising contacting a candidate cell with a FRIL family member molecule, wherein binding of the candidate cell to the FRIL family member molecule identifies the candidate cell as a progenitor cell.
- FRIL family member molecule and "progenitor cell” are as described above for the first aspect of the invention.
- the candidate cell is in a population of cells. In certain embodiments, the candidate cell is from a human.
- the invention provides a progenitor cell identified by a method comprising contacting a candidate cell with a FRIL family member molecule, wherein binding of the candidate cell to the FRIL family member molecule identifies the candidate cell as a progenitor cell.
- FRIL family member and "progenitor cell” are as described above for the first aspect of the invention.
- the invention provides a method for identifying a composition of a member of the FRIL family of progenitor cell preservation factors, comprising contacting a candidate compound with a glycosylated extracellular domain of an FLT3 receptor, wherein the glycosylation pattern of the extracellular domain of the FLT3 receptor is the same as the glycosylation pattern of an extracellular domain of a normally glycosylated FLT3 receptor, wherein a candidate compound that binds the glycosylated extracellular domain of the FLT3 receptor is identified as a composition of a FRIL family member.
- "FRIL family member,” "progenitor cell,” and "normally glycosylated FLT3 receptor” are as described above for the first aspect of the invention.
- the normally glycosylated extracellular domain of the FLT3 receptor may expressed on a cell surface (e.g., on the surface of an NIH 3T3 cell, as described in the examples below).
- a cell surface e.g., on the surface of an NIH 3T3 cell, as described in the examples below.
- Any normal cell may be transfected with a nucleic acid sequence encoding the extracellular domain of the FLT3 receptor (from, e.g., a human or a mouse) provided that the cell normally glycosylates the FLT3 receptor it expresses on its cell surface.
- the cell need not be transfected with a nucleic acid sequence encoding the entire FLT3 receptor.
- the cell may be transfected with a nucleic acid molecule encoding a fusion protein comprising the intracellular domain of a non-FLT3 receptor (e.g., the Fms receptor) and the extracellular domain of the FLT3 receptor.
- a candidate compound according to this aspect of the invention is then incubated with the cell expressing the normally glycosylated extracellular domain of the FLT3 receptor, and binding of the candidate compound to the cell (as can be measured, as described below, by survival of the cell) identifies the candidate compound as a FRIL family member.
- the normally glycosylated extracellular domain of the FLT3 receptor need not be expressed by a cell.
- the normally glycosylated extracellular domain of the FLT3 receptor may be detectably labeled or immobilized on a solid support (e.g., a magnetic bead).
- the normally glycosylated extracellular domain of the FLT3 receptor can be bound to the surface of a 96 well microtiter plate.
- Compositions comprising different candidate compounds (or pools of such compounds) can be detectably labeled (e.g., with biotin), and added to the wells.
- a positive control e.g., a composition of a known FRIL family member
- the plate is washed and detectably labeled avidin is added to each well.
- the plate can then be read on a standard microtiter plate reader to determine binding of a composition of a candidate compound to the plate-bound normally glycosylated extracellular domain of the FLT3 receptor, wherein binding (as measured by detection of the bound detectably labeled avidin) identifies the candidate compound in the composition as a FRIL family member.
- the candidate compound is a lectin.
- the lectin is synthetic.
- the lectin is from a legume.
- the invention provides an essentially pure composition of a FRIL family member identified by the method comprising contacting a candidate compound with a glycosylated extracellular domain of an FLT3 receptor, wherein the glycosylation pattern of the extracellular domain of the FLT3 receptor is the same as the glycosylation pattern of an extracellular domain of a normally glycosylated FLT3 receptor, wherein a candidate compound that binds the glycosylated extracellular domain of the FLT3 receptor is identified as an essentially pure composition of a member of the FRIL family.
- "FRIL family member,” "progenitor cell,” and "normally glycosylated FLT3 receptor,” and "essentially pure” are as described above for the first aspect of the invention.
- Seeds from the hyacinth beans were purchased from Stokes Seeds (Buffalo, NY) and grown in a greenhouse. Dry seeds were ground in a coffee mill and the power was extracted in 5 volumes of 50 mM Tris/HCl containing 1 nM each of MgCl 2 and CaCl 2 for 4 hours at 4°C. Bean solids were pelleted by centrifugation at 10,000 x g for 20 min. The pH of the supernatant was acidified to pH 4.0 with acetic acid, followed by a second centrifugation to clarify the supernatant, and finally the pH was readjusted to 8.0 with sodium hydroxide. This crude extract was stored at -20°C.
- FRIL family member Single-step purification of the FRIL family member was achieved by binding to a mannose-Sepharose matrix (Sigma).
- the gel i.e., matrix
- the gel was tumbled with the thawed crude extract for 4-12 hours at 4°C, carefully washed several times with 50 mM Tris/HCl containing 1 nM each of MgCl 2 and CaCl 2 , and then eluted with 20 mM ⁇ -methyl ⁇ -D-mannoside. Because this FRIL family member was isolated from Dolichos lab lab, it is referred to herein as Dl-FRIL.
- RNA was prepared from mid-maturation Dolichos lab lab seeds stored at -70°C following the procedure of Pawloski et al.Mol. Plant Biol. Manual 5: 1 - 13, 1994.
- Poly (A + ) RNA was obtained from this total RNA using the PolyATract mRNA Isolation System (Promega) according to the manufacturer's instructions.
- Avian myeloblastosis virus reverse transcriptase (Promega) was used to generate cDNA from 0.5 ⁇ g poly(A + )RNA, or from 3.0 ⁇ g of total RNA, using 1 ⁇ g of oligo(dT) in standard reaction conditions (Sambrook et al., Molecular Cloning.
- a + RNA was obtained from this total RNA using the PolyATract mRNA Isolation System (Promega) according to the manufacturer's instructions.
- Avian myeloblastosis virus reverse transcriptase (Promega) was used to generate cDNA from
- a 500+ bp product was amplified from cDNA prepared as described abpve, by 30 cycles of polymerase chain reaction (PCR), each cycle comprising 40 seconds at
- the 500 bp product obtained by PCR was cloned in the cloning vector, pCR2.1 (Invitrogen, Carlsbad, CA), and sequenced by sequenase dideoxy chain termination (United States Biochemicals) using the following primers:
- Dl-FRILa This sequence was designated "Dl-FRILa,” as relating to the gene encoding the protein of interest, designated “Dl-FRIL” as noted above.
- Dl-FRILa Based on the sequence of the Dl-FRILa amplified product, a specific primer was prepared:
- MLI GC(TC)CA(AG)TC(TC)CT(TC)TC(TC)TT SEQ ID NO: _
- the MLX and MLI primers were used in combination to amplify a 480 bp product from cDNA prepared as described above, through 30 PCR cycles using the same conditions described above.
- This secondary amplified fragment was cloned in the pCR2.1 vector and sequenced as described above, and was designated "Dl- FRILb.”
- the 3' end of Dl-FRIL was obtained through rapid amplification of cDNA ends by polymerase chain reaction (RACE-PCR) (see, e.g., Frohman "RACE: Rapid amplification of cDNA ends," pp. 28-38 in PCR Protocols: A Guide to Methods and Applications, Innis MA, Gelfand DH, Sninsky JJ, and White TJ, eds., Academic Press, San Diego, 1990) using the 5 ' /3 ' RACEKIT (Boehringer Mannheim, Indianapolis, IN) according to the manufacturer's instructions.
- RACE-PCR polymerase chain reaction
- AP oligo(dT) anchor primer
- Nested PCR amplifications were performed using the AP anchor primer in combination with a specific primer having the following sequence: MLB AAGTTAGACAGTGCAGGAAAC (SEQ ID NO: __).
- the amplification conditions were again 30 cycles of 40 seconds at 94 °C, 40 seconds at 55 °C, 60 seconds at 72 °C each, with an extension step at 72 °C for 10 min.
- a 900+ bp product was obtained, which was subcloned in pCR2.1 and sequenced as described above, and was designated "Dl-FRILc" (SEQ ID NO:l).
- the anchor primer AP was used in combination with a specific primer corresponding to the first 5 amino acids encoded at the 5 '-terminus:
- the full length cDNA was obtained through 30 cycles of PCR, each cycle comprising 60 seconds at 94 °C, 60 seconds at 58 °C, 90 seconds at 72 °C, with an extension step at 72 °C for 10 min.
- the reaction was performed in 100 ⁇ L containing 30 pmol of each primer, 0.2 mM deoxyribonucleotide, 1.0 unit of Pfu polymerase
- the Dl-FRILc clone was sequenced completely using the dideoxy chain termination method.
- the nucleotide sequence of the full-length cDNA was determined tobe:
- the Dl-FRIL nucleotide sequence enabled inference of the following derived amino acid sequence for the Dl-FRIL protein:
- the naturally-occurring signal sequence from the FRIL family member isolated from Dolichos lab lab i.e., Dl-FRIL
- Dl-FRIL has the following sequence: MASSNLLT A LFLVLLTHAN SA (SEQ ID NO: 4)
- This sequence is located directly N-terminal to the first amino acid of SEQ ID NO: 2.
- the nucleic acid sequence of the naturally-occurring Dl-FRIL protein is provided below.
- FIG. 2 A comparative illustration of the derived Dl-FRIL amino acid sequence with the reported amino acid sequence of the mannose lectin as determined by Gowda et al. (/. Biol. Chem. 269:18789-18793, 1994) is shown in Fig. 2.
- SEQ ID NO: subunit of the protein described by Gowda et al., supra.
- Gowda et al. (supra) protein is assigned to the N-terminal domain and is followed linearly by the ⁇ subunit, the arrangement of the polypeptides shows homology to other legume lectins.
- the derived Dl-FRIL amino acid sequence comprises an additional of seven amino acid residues (aa27-34) that does not occur in the amino acid sequence described Gowda et al., supra.
- Several other differences between the amino acid sequences of Dl-FRIL and the amino acid sequence described by Gowda et al., supra, are also readily discernible from Fig.2.
- Dl-FRIL .YLNPDYG.DPNYIHIGIDV SEQIDNO:__
- the primary PCR products were purified with the QIAquick PCR Purification kit (QIAGEN, Valencia, CA), according to the manufacturer's instructions. The overlapping primary products were then combined and amplified together in a single second reaction using flanking primers:
- APEcoRI GAATTCGACCACGCGTATCGATGTCGAC (SEQ ID NO: _) Both the primary and the secondary PCR reactions were performed in 100 ⁇ L containing 50 pmol of each primer, 0.4 mM deoxyribonucleotide and 1.0 unit Pfu polymerase (Stratagene) in the corresponding buffer.
- the primary PCR reaction amplified the two separate fragments in 30 cycles, each cycle comprising 40 seconds at 94 °C, 40 seconds at 50 °C, 60 seconds at 72 °C, with an extension step at 72 °C for 10 min.
- the second PCR reaction amplified the recombinant fragment in 12 cycles using the same conditions described above.
- the resulting full-length fragment contained the mutation.
- the recombinant mutated product was cloned in the EcoRI site of the cloning vector pCRZ.l, as illustrated schematically in Fig. 3, and sequenced as described above. This plasmid is referred to as "pCR2.1-DLA(D)."
- Recombinant PCR was used to modify the 5 ' ends of both the wild-type and the mutant Dl-FRIL clones, to introduce a signal peptide for entry of the protein into the endoplasmic reticulum.
- sequence encoding the signal peptide and the full-length cDNA clones were amplified in two separate primary PCR reactions.
- the signal peptide sequence was obtained from the amplification of the binary vector pTA4, harboring the complete sequence of the ⁇ -amylase inhibitor gene (Hoffman et al., Nucleic Acids Res. 10:7819- 7828, 1982; Moreno et al., Proc. Natl. Acad. Sci. USA 86:7885-7889, 1989).
- the following primers were used for amplification of the signal peptide sequence: Sigforw GAATTCATGGCTTCCTCCAAC (SEQ ID NO: _) Sigrev TGACTGTGCGGCTGAGTTTGCGTGGGTG (SEQ ID NO: _)
- the primers used for the secondary reactions were Sigforw and AP EcoRI, which were designed to generate EcoRI sites at the 5' and the 3' ends. Both the primary and the secondary PCR reactions were performed as discussed above for the site-directed mutagenesis.
- the wild-type recombinant product SpDLA was cloned in the EcoRI site of the pBluescript SK+ cloning vector (Stratagene) to give the vector pBS-SpDLA, as shown in Fig. 4.
- the mutant SpDLA(D) was cloned in the same site of the cloning vector pCR2.1 to give the vector pCR2.1-SpMl, as shown in Fig. 5.
- the nucleotide sequence of each PCR product was determined as described above to verify the correct attachment of the signal peptide.
- the nucleotide sequence of SpDLA is defined by SEQ ID NO:22, and the derived amino acid sequence is defined by SEQ ID NO:23.
- sequences of SEQ ID NO: 22 and SEQ ID NO: 23 are as follows:
- ATCAGTTATC ATGGTGGTTT TCTTGGACTC TTTCCCAACG CAAACACTCT CAACAACTCT *420
- a binary vector was constructed for seed-specific expression of Dl-FRIL.
- the vicilin promoter obtained from the pCW66 Higgins et al., Plant Mol. Biol. 11:683-695, 1988
- the SpDLA cDNA sequence was ligated into the EcoRI/S ⁇ cI site, giving rise to the pBINVicPro-SpDLA, which is illustrated in Fig. 7.
- the mutated cDNA clone SpDLA(D) was ligated in EcoRI site of the pBINVicPro vector to yield pBINVicPro-SpDLA(D), which is illustrated in Fig. 8. No additional termination sequences were added, relying instead on the stop codons and the polyadenylation site of the DLA and DLA(D) cDNA clones. Both vectors were transferred into Agrobacterium tumefaciens strain LBA4404 according to the freeze-thaw procedure reported by An et al., "Binary vectors," in Plant Molecular Biology Manual, Vol. A3, Gelvin SB, Schilperoort RA, and Verma DPS, eds., Kluwer Academic Publisher, Dordrecht, The Netherlands, pp. 1-19, 1988).
- Nicotiana tabacum leaf disks were carried out and assayed as described (Horsch et al., Science 227:1229-1231, 1985) using LBA4404 harboring the seed-specific expression vector pBINVicPro-SpDLA ( Figure 9).
- Kanamycin-resistant plants resistance being conferred by transformation with the pBIN19-based vectors that carry the gene
- Recombinant Dl-FRIL fusion proteins were cleaved by the transformed plant cells in vivo.
- the transformed plant cells produced mature Dl-FRIL which, when purified, had a molecular mass of 60 kDa and comprised four subunits, two alpha subunits and two beta subunits (i.e., an 2 ⁇ 2 heterodimer), where each subunit is about 15-18 kDa.
- the Dl-FRIL wild-type cDNA and mutant clones were ligated into the EcoRI/ Sail and EcoRI/X/rol of the expression vector pGEX 4T-1 (Pharmacia Biotech, Uppsala, Sweden), to form the expression constructs pGEX-Ml and pGEX M1(D), respectively illustrated in Figs. 9 and 10.
- the host E. coli strain
- BL21(D3) was purchased from Novagen (Madison, WI, and transformed with the above construct using the calcium chloride method (see Sambrook et al., supra; Gelvin and Schilperoort, Plant Molecular Biology Manual, Kluwer Academic Publishers, Dordrecht, The Netherlands, 1988; Altabella et al., Plant Physiol 93:805- 810, 1990; and Pueyo et al., Planta 196:586-596, 1995).
- the induction of the tac promoter was achieved by adding IPTG (isopropyl- ⁇ -D- thiogalactopyranoside) (Sigma) at a 1.0 mM final concentration when the cells reached an optical density of 0.4 - 0.6 at 600 nm.
- IPTG isopropyl- ⁇ -D- thiogalactopyranoside
- the cultures were allowed to grow for 12 hours at 37 °C after the addition of IPTG. Control non-induced cultures were maintained under similar conditions.
- the cells were lysed by treatment with 4 mg/mL lysozyme in phosphate-buffered saline containing 1% TRITON® X-100.
- Total cellular protein was extracted from transformed E. coli cells and analyzed on SDS-PAGE on a 15% gel using a standard procedure (Sambrook et al., supra).
- the cells from 1 mL of E. coli culture were suspended in the same volume of loading buffer (50 mM Tris HCl pH 6.8, 100 mM DTT, 2% SDS, 10% glycerol, 0.1% bromophenol blue) and vortexed. Following transfer to a nitrocellulose membrane, protein was stained with Coomassie Brilliant Blue R250. A representative separation is shown in Fig. 11, with the lanes identified in Table 1, below.
- Fig. 11 shows that the induced cells (lanes 3, 5) both produced an abundant polypeptide having a molecular mass of about 60 kDa (indicated by arrow). The non-induced cells failed to produce any significant amount of this protein (Fig. 11, lanes 2, 4).
- E. coZ ⁇ cells (200 mL) as described above were harvested after 12 hour induction at 37 °C by centrifugation at 5000 g for 10 min. The pellet was washed with 50 mM Tris-HCl pH 8.0, 2 mM EDTA, and resuspended in 1/10 vol of 1% TRITON surfactant in TBS (20 mM Tris pH 7.5, 500 mM NaCl). The cells were lysed by adding 4 mg/mL of lysozyme and incubating at room temperature for 30-60 min.
- the recombinant fusion protein solubilized by guanidine-HCl was purified on GST-Sepharose beads (Pharmacia Biotech, Uppsala, Sweden) according the manufacturer's instructions and eluted in 1 mL of reduced glutathione (Sigma). Samples of the purified fusion proteins were cleaved with thrombin (Novagen) using 5 cleavage units /mL purified fusion protein. For immunoblot analysis (Western blot), the purified proteins were separated by SDS-PAGE in general accordance with the method described above.
- the gel was equilibrated in transfer buffer (25 mM Tris pH 8.3, 192 mM Glycine, 20% MeOH) and blotted onto nitrocellulose (Bio-Rad, Hercules, CA) for 1 hour at 100 V using a Bio-Rad electrotransfer apparatus. Non-specific binding was blocked by incubating the blots for at least 1 hour in IX TBS (20 mM Tris pH 7.5, 500 mM NaCl) containing 3% gelatin.
- Blotting was followed by incubation with a primary antibody (a polyclonal rabbit serum raised against the N-terminal peptide of the ⁇ -subunit of Phaseolus vulgaris FRIL (i.e., Pv-FRIL), 1:100 dilution, 3 hour; described below in Example 5), followed by incubation with a secondary antibody (goat anti-rabbit IgG conjugated to horseradish peroxidase at 1:1000 dilution for 1 hour). The blots were washed and the color developed with the color development reagent (Bio-Rad). A representative result is shown in Fig. 12, with the lanes identified in Table 2, below.
- a primary antibody a polyclonal rabbit serum raised against the N-terminal peptide of the ⁇ -subunit of Phaseolus vulgaris FRIL (i.e., Pv-FRIL), 1:100 dilution, 3 hour; described below in Example 5
- a secondary antibody goat anti-rabbit IgG conjugated to horseradish peroxid
- Fig. 12 The separation shown in Fig. 12 demonstrates that the two forms of fusion protein have similar molecular masses of about 60 kDa, and that thrombin cleaved both types of fusion protein to produce a new polypeptide of molecular mass 30 kDa.
- EXAMPLE 2 Recombinant Dl-FRIL Specifically Stimulates Proliferation of 3T3 Cells Expressing the FLT3 Receptor Dl-FRIL interacts with the mammalian FLK2/FLT3 tyrosine kinase receptor.
- 3T3 cells cultured in tissue culture plates were removed from the plates by washing cells twice in Hank's buffered saline solution (HBSS; Gibco Laboratories, Grand Island, NY).
- HBSS Hank's buffered saline solution
- Non-enzymatic cell dissociation buffer Gibco was added for 15 minutes at room temperature. The resulting cells wee washed in medium.
- FLT33T3 cells were cultured at a final concentration of 3,000 cells per well in a volume of 100 ⁇ L of serum-defined medium containing 10 mg/mL rhlLl- ⁇ , 10% AIMV (Gibco, Grand Island, NY) and 90% Dulbecco's modification of Eagle's medium (DMEM; Gibco) in 96 well plates. Under these assay conditions, cells die after two to four days of culture in a humidified incubator at 37 °C and 5% C0 2 unless exogenously added ligand rescues cells from death. Each 96 well plate contained wells of cells containing calf serum, which stimulates all 3T3 cells, as a positive controls and wells of cells containing medium only as a negative control ("blank").
- 3T3 cells served as untransfected control cells. Proliferation and cell survival was quantitated by addition of XTT (2,3-bis[Methoxy-4-nitro ⁇ 5sulfophenyl]-2H- tetrazolium-5 carboxanilide inner salt) (Diagnostic Chemicals Ltd, Charlottetown, Prince Edward Island, Canada), which is a tetraformazan salt cleaved by actively respiring cells (Roehm et al., /. Immunol. Methods 142: 257-265, 1991).
- XTT 2,3-bis[Methoxy-4-nitro ⁇ 5sulfophenyl]-2H- tetrazolium-5 carboxanilide inner salt
- Figs. 13A and 13B The data from this experiment are summarized in Figs. 13A and 13B. Specifically, Fig. 13A is a graph showing that the crude extract of the E.
- FIG. 13A coli culture containing expressed Dl-FRIL specifically stimulates hFLT3 cells;
- Figure 13B is a graph showing that the same extract does not stimulate untransfected 3T3 cells.
- medium control is represented by a solid line.
- the ordinate indicates cell viability measured by XTT at three days; the abscissa shows the reciprocal dilution of the extract sample.
- the apparent inhibition of proliferation observed at higher concentrations (Fig. 13 A) is not understood, but may relate to toxic components in the crude E. coli extract or the consequences of dose-related preservation of the 3T3 fibroblasts.
- Figs. 14A and 14B, and Table 3 illustrate the results of experiments in which recombinant Dl-FRIL was shown to act in a dose- responsive manner to preserve human cord blood progenitors.
- umbilical cord blood from healthy donors was collected in 100 units /ml of heparin.
- Cord blood mononuclear cells (CB mnc) were isolated within 4 hours of collection by FICOLL-PAQUE® separation (Pharmacia Biotech, Piscataway, NJ) following manufacturer's instruction and washed in X-VTVO 10 medium (BioWhittaker, Walkersville, MD).
- CB mnc were then cultured in six well tissue culture plates (Corning Inc., Corning, NY) at a concentration of 200,000 cells/mL in a volume of 4 mL of X-VIVO 10 (i.e., 800,000 cells total per well).
- Dl-FRIL and/or recombinant E. coZz Flt3-L were added at a concentration of 40 ng/ml at the outset (with no addition as a control). Cultures were incubated in humidified chambers without medium changes for up to 29 days.
- the cultured CB mnc cells were harvested by washing in X- VIVO 10 (i.e., harvested cells were pelleted and resuspended in X-VIVO 10) to remove the Dl-FRIL and/or recFL, and then determining viable cell number by trypan blue (Sigma) exclusion.
- Fig. 14 A The progenitor number and capacity of harvested cells were assessed by plating the washed cells in triplicate in fetal bovine serum-free, methylcellulose colony assay medium containing IL-2, granulocyte-macrophage CSF, and kit ligand (StemCell Technologies, Vancouver, BC, Canada).
- Figs. 14A and 14B show that recombinant Dl-FRIL preserved cord blood mononuclear cells and progenitors in a dose-responsive manner in liquid culture.
- Table 3 shows the resulting colonies after 15, 21, or 29 days of incubation, demonstrating that Dl-FRIL, but not recFL, preserved progenitors in suspension culture.
- the reported experiment is a representative of four experiments.
- Figs. 14A and 14B in Table 3, "blast” refers to colonies consisting of primitive, morphologically undifferentiated cells; "mix” refers to colonies consisting of myeloid and erythroid cells; “erythroid” refers to colonies consisting of erythroid cells; and “myeloid” refers to colonies consisting of myeloid cells.
- cell number (Fig. 14A) or colony number (Fig. 14B) is shown on the ordinate; the abscissa shows the reciprocal dilution of the sample.
- Fig. 15A in addition to myeloid and erythroid colonies, day 21 cultures contained small colonies consisting of undifferentiated cells.
- Fig. 15B shows that only blast-like colonies were observed when the cells were cultured in Dl-FRIL for 29 days (see also Table 3).
- Fig. 16 A schematic diagram of this experiment is shown in Fig. 16. As schematically diagramed in Fig. 16, the frequency of blast-like colonies cultured in Dl-FRIL alone decreased by 2.1 fold from day 21 to day 29, from 1 in 4,790 to 1 in 10,000, and 7.5 fold in Dl-FRIL + recFL cultures from 1 in 2,667 to 1 in 20,000 of the initial CB mnc cells cultures.
- cord blood mononuclear cells were first enriched for progenitors expressing the CD34 antigen by immunomagnetic bead isolation (Dynal Corp., Lake Success, NY).
- CD34 + cells Five hundred CD34 + cells were placed into wells containing 100 ⁇ L of serum-free medium (BIT9500, StemCell Technologies, Vancouver, BC, Canada) either in the presence of recFL (PeproTech, Princeton, NJ) or a cytokine cocktail of recombinant human interleukin 3 (rhIL3) + recombinant human interleukin 6 (rhIL6) + recombinant human interleukin 11 (rhILll) + rhTpo Thrombopoietin + FL (FLT3-Ligand) (BioSource International,
- the mFlt3/Fms 3T3 cell line is a 3T3 cell line transfected with nucleic acid encoding a fusion protein consisting of the murine extracellular domain of the Flt3 receptor fused to the transmembrane and intracellular domains of the human Fms (provided by Dr. Ihor Lemischka, Princeton University, Princeton, NJ).
- the Stk 3T3 cell line is a 3T3 cell line transfected with the full-length human Flt3 receptor (provided by Dr.
- the human FMS 3T3 cell line is a 3T3 cell line transfected with the full-length human Fms receptor (provided by Dr. Charles Sherr, Saint Jude Children's Research Hospital, Memphis, TN.
- Parent 3T3 cells were purchased from American Type Culture Collection ("ATCC"; Manassas, VA). Receptor-transfected cells contained Neo resistance genes and were maintained in medium containing 750 g/ml of G418 (Life Technologies, Rockville, MD).
- 3T3 cell lines were assayed in 96 well plates (Becton Dickinson Labware,
- the FMS 3T3 cells (transfected with cDNA encoding the human Fms tyrosine kinase receptor) and its ligand, human M-CSF, served as a model system.
- Recombinant human M-CSF stock of 1 ⁇ g/mL was serially diluted (where the first dilution, 1:20, was 50 ng/mL) was used to stimulate Fms3T3 cells.
- Fms 3T3 cells responded to M-CSF in a dose-responsive manner.
- Various sources of conditioned medium were screened for the presence of
- PHA phytohemagglutinin
- PHA-LCM PHA leukocyte-conditioned medium
- Mononuclear cells were isolated by FICOLL-PAQUE®, washed in AIMV, and cultured at a concentration of 2 x 10 6 cells/ml in AIMV containing a 1% volume of crude red kidney bean extract containing PHA from Life Technologies (catalog number 10576-015) in either T150 flasks (Becton Dickinson Labware, Lincoln Park, NJ) or roller bottles (Becton Dickinson Labware) for one week. Cells and debris were removed by centrifugation and conditioned medium was stored at -20°C. PHA-LCM induced proliferation of mFlt3/Fms 3T3 cells and Stk 3T3
- PHA-LCM Each batch of PHA-LCM was generated in serum-free medium with cells from individual normal donors. To start purification, the PHA-LCM with Flt33T3 activity was pooled in 30 liter lots with approximately 10 7 Flt3 3T3 units. Twenty- five liters of PHA-LCM was diafiltered into 50 mM Tris-HCl, pH 7.6, 50 mM NaCl and then concentrated to 2-2.5 liters by tangential flow ultrafiltration on a 10 kDa molecular weight cutoff membrane (Pellicon, Millipore, Bedford, MA).
- the column was washed with equilibration buffer and then eluted at 12 ml/min with a continuous gradient of 0-0.7 M NaCl in 10 mM Tris. Fractions were collected (6 ml/fraction) and an aliquot of each fraction was tested for Flt33T3 activity (i.e., an ability to stimulate mFlt3/fms 3T3 cells and/or Stk 3T3 cells) in 96 well plates.
- Flt33T3 activity i.e., an ability to stimulate mFlt3/fms 3T3 cells and/or Stk 3T3 cells
- a phenyl-sepharose HP (Pharmacia Biotech) column (1.6 cm x 10 cm) was equilibrated with 20 mM phosphate, pH 7, 1.5 M NH4SO4.
- the pooled sample from Q-sepharose was adjusted to 1.5 M NH4SO4 and applied to the phenyl-sepharose column.
- the column was washed with equilibration buffer and eluted at 1 ml/min with a gradient of 1.5-0.1 M NH4SO4 in 20 mM phosphate, pH 7.
- Fractions (1 ml) were collected and tested for Flt33T3 activity. Fractions with Flt33T3 activity were pooled and dialyzed against 50 mM Tris-HCl, pH 7.2, 100 mM NaCl and concentrated by vacuum centrifugation.
- a Superdex 75 (Pharmacia Biotech) column (1.6 cm x 60 cm) was equilibrated with 50 mM Tris-HCl, pH 7.4, 100 mM NaCl. The pooled sample from phenyl- sepharose was applied to the Superdex 75 column and eluted at 0.6 ml/min. Fractions (1.8 ml) were collected and tested for Ht3 3T3 activity. The active fractions were dialyzed against Tris-HCl, pH 7.2 and concentrated by vacuum centrifugation.
- a C4 reverse-phase column (4.6 mm x 100 mm, Vydac, Hesperia, CA) was equilibrated with 0.1% trifluoroacetic acid (TFA) in HPLC grade H 2O. Pooled and concentrated sample from Superdex 75 chromatography was applied to the C4 column and the column was eluted with a gradient of 10-55% acetonitrile, 0.1% TFA over 70 min at 0.5 ml/min. Fractions of 0.5 mL were collected and evaporated by vacuum centrifugation.
- TFA trifluoroacetic acid
- cytokines ILl- ⁇ , ILl- ⁇ , IL2, IL3, IL4, IL6, GM-CSF, G- CSF and SCF
- cytokines ILl- ⁇ , ILl- ⁇ , IL2, IL3, IL4, IL6, GM-CSF, G- CSF and SCF
- AQS-peptide a peptide corresponding to Pv-FRIL (AQSLSF[N, C, S]FTKFDLD), referred to as the AQS- peptide.
- Samples were glutaraldehyde conjugated to keyhole limpet hemocyanin (KLH, Sigma).
- KLH keyhole limpet hemocyanin
- the rabbit was immunized with KLH-AQS peptide-containing samples using either Complete Freund's Adjuvant (Sigma) or Hunter's Titermax (Vaxcel, Inc., Norcross, GA).
- Antiserum demonstrated a 1:5,000 liter to the AQS peptide in an ELISA (data not shown). Since the antiserum contained reactivities to other proteins, further enrichment for AQS peptide-specific antibodies was achieved by either depletion of cross-reactive antibodies or by affinity purification using a AQS peptide covalently linked to an agarose support (AminoLink coupling gel, Pierce).
- An anti-AQS affinity column was prepared either by purifying IgG from high titer rabbit antiserum by protein A affinity chromatography (ImmunoPure kit, Pierce) or antibody isolated from the AQS peptide column and then covalently linking antibody to an activated agarose support (AminoLink coupling gel, Pierce).
- Mononuclear cells were isolated by FICOLL-PAQUE® (Pharmacia Biotech, Piscataway, NJ), washed in HBSS, and resuspended in serum- defined medium, either AIMV or XVIVO-10 (BioWhittaker, Walkersville, MD). Mononuclear cells were enriched for Flt3 + progenitors by CD34 immunomagnetic bead selection (Dynal Corporation, Lake Success, NY).
- CD34 + cells were cultured in 6 well plates (Becton Dickinson Labware) in at a concentration of 10 5 cells in 1 mL of DMEM containing 10 ng/mL recombinant human IL3 (BioSource International, Camarillo, CA) and 10% fetal calf serum. The number of refractive cells present in culture wells was scored microscopically.
- FIG. 20A shows that cord blood cells responded to column fractions in two regions of the material eluted from an anion exchange column. The first region of activity corresponded with Flt33T3 stimulatory activity (Figs. 20B and 20C); the second associated with an activity detected with Fms 3T3 cells (Fig. 20D); no response was detected in untransfected 3T3 cells (data not shown).
- Flt33T3 activity was depleted but not eliminated either by adding neutralizing antibodies to ILl or by removing ILl by antibody affinity chromatography (data not shown).
- levels ⁇ 1 ng/mL
- exogenous recombinant hILl- ⁇ by itself had no stimulatory activity (data not shown).
- This observation suggested the possibility that ILl- ⁇ may act as a necessary co-factor to obtain maximal stimulation by PvFRIL.
- the co-factor requirement was met by the addition of either ILl- ⁇ or PHA-LCM added at a concentration that did not stimulate Flt33T3 cells by itself.
- Pv-FRIL was purified by its ability to stimulate Flt3-expressing 3T3 cells using four different chromatographic media. This resulted in a 80,000-fold purification with a 1% yield.
- SDS-PAGE showed the purified material to contain a limited number of polypeptides and the molecular size of the active material was determined by eluting the protein from SDS-PAGE gel slices run under non-reducing conditions and assaying the activity of the eluted material.
- Flt33T3 activity was always found in a gel slice that contained 14-22 kDa polypeptides and sometimes in a gel slice containing 32-43 kDa polypeptides (data not shown).
- polypeptide(s) in the active fraction corresponding to the 14-22 kDa range were subjected to aminoterminal sequencing by Edman degradation.
- an 18 kDa species from C4 reverse-phase chromatography was resolved by SDS-PAGE, electroblotted onto polyvinylidene difluoride (PVDF) membrane (Immobilon-P, Millipore) and stained with Ponceau S (Bio-Rad Laboratories, Inc., Hercules, CA).
- PVDF polyvinylidene difluoride
- the 18 kDa band was cut from the PVDF membrane and N-terminal sequence was determined by automated Edman degradation on an ABI model 477A protein sequencer (PE Applied Biosystems, Foster, CA).
- the derived peptide sequences were compared against the SwissProt protein sequence database.
- sequence AQSLSFXFTKDALD was obtained from a polypeptide of 18 kDa (where X is an unknown amino acid).
- X is an unknown amino acid
- the aminoterminal sequence of TDSRWAVEFDXFP was found twice.
- the amino terminus of a smooth muscle protein (SM22- ⁇ ) was found twice and the amino terminus of myoglobin identified once. Since the sequence starting with AQS was the only sequence identified in each experiment, this polypeptide was concluded to be responsible for Flt33T3 activity.
- Pv-FRIL Further purification of Pv-FRIL was obtained by immunoaffinity chromatography using a rabbit antiserum described above that was generated against a synthetic peptide of 13 amino acids corresponding to the N-terminus obtained for the 18 kDa polypeptide (referred to as anti-AQS).
- Crude PHA-LCM was applied to a rabbit anti-AQS affinity column, and after washing, bound protein was eluted under acidic conditions.
- Four pools of fractions were assayed for activity in the two different assay systems.
- FIG. 22A-22D shows results of an experiment where the pooled fractions were assayed on cord blood cells in the presence of IL3. After two weeks of suspension culture, the number of viable cells and status of CD34 expression was evaluated. A representative of three AQS affinity chromatography experiments is shown in Figs. 22A-22D.
- Cell cultures supplemented with the two early column fraction pools contained approximately four-fold more cells (426,000 cells and 466,250 cells, respectively) than at the 100,000 cells seeded and no appreciable CD34 staining (Figs. 22A and 22B). The increase in cell number and loss of CD34 expression is attributed to the expected consequences of IL3-induced proliferation and differentiation. In contrast, cell cultures treated with the late-eluting fraction pool (Fig.
- Pv-FRIL Is Derived From Phaseolus vulgaris Because PHA is derived form red kidney bean extract and because a FRIL family member, Dl-FRIL, was isolated from another legume, namely Dolichos lab lab,
- Mannose-binding lectins 16 mannose-binding lectins were isolated from red kidney bean ( Phaseolus vulgaris) extract using standard methods, such as the procedure of Rudiger, H., Isolation of Plant Lectins, H.-J. Gabius and S. Gabius, eds., pp. 31-46, Berlin, 1993).
- the kidney bean mannose-binding lectin consisted of polypeptides with molecular weights of 18 kDa and 15 kDa, and the aminotermini of these two polypeptides started with
- Pv-FRIL isolated from Phaseolus vulgaris was tested for activity in the Flt3 3T3 cell assay. As shown in Fig. 23, Ht3 3T3 cells responded in a dose dependent manner to Pv-FRIL, while parent untransfected 3T3 cells did not.
- Dry seeds from the red and white kidney beans ( Phaseolus vulgaris) were purchased from W. Atlee Burpee & Company, Warminster, PA. Lectins were eluted using a standard protocol. Briefly, beans were pulverized in a home coffee grinder and added to buffer of 50 mM Tris/HCl, pH. 8.0, 1 nM each of MgCl 2 and CaCl 2 for 4 hours at 4°C with constant mixing. Bean solids were pelleted by centrifugation at 10,000 x g for 20 min.
- the pH of the supernatant was modified to pH 4.0 with acetic acid and constant mixing to remove contaminating storage proteins, followed by centrifugation to clarify the supernatant, and finally the pH was readjusted to 8.0 with sodium hydroxide before storing at -20 °C.
- PVAlfa2 TAR TTW GGR TCR ATR TTR GCR TT Two sequential polymerase chain reactions (PCR) were performed.
- 10 ng of bean genomic DNA was amplified by 30 cycles of PCR, each cycle comprising 40 seconds at 94 °C, 40 seconds at 50 °C, 60 seconds at 72 °C, and an extension step at 72 °C for 10 min.
- the reactions were performed in 50 ⁇ l containing 30 pmol of each primer, PVbeta 1 and PValfal, 0.2 mM deoxyribonucleotides and 0.5 unit of Ampli-Taq polymerase (Perkin Elmer) in the corresponding buffer.
- PCR product was amplified by 30 PCR cycles using the same conditions as described above.
- the reaction was performed in 50 ⁇ L containing 30 pmol of the two primers, PVbeta 2 and PV alfa2, using 0.2 mM deoxyribonucleotides and 0.5 unit of Ampli-Taq polymerase (Perkin Elmer) in the corresponding buffer.
- the 460 bp fragment obtained was cloned in a T/ A plasmid, pCR2.1 (Invitrogen) and sequenced by sequenase dideoxy chain termination (United States Biochemicals).
- RNA was prepared from mid-maturation Phaseolus vulgaris seeds stored at -70°C following the procedure reported by Pawloski et al. (Mol. Plant Biol. Manual 5: 1 - 13, 1994).
- the 5'/3' RACEKIT Boehringer Mannheim was used to generate cDNA from 5.0 ⁇ g total RNA used according to the manufacturer's instructions.
- the oligo(dT) anchor primer was at the concentration of 32.5 ⁇ M, in the standard conditions.
- a specific primer (SPV1) was used at the concentration of 32.5 ⁇ M.
- SPV1 specific primer
- Pv-FRIL-Encoding Nucleic Acid The 3' end of Pv-FRIL was obtained through rapid amplification of cDNA ends by polymerase chain reaction (RACE-PCR) using the 5'/3' RACEKIT (Boehringer Mannheim) used according to the manufacturer's instructions. Nested
- PCR amplifications were performed using the PCR- Anchor primer with the specific primers (PV3 and PV4) in two successive amplification reactions.
- the sequences of these primers is as follows:
- PV3 CAA TGT CTT ACA ACT CAC TAA
- PV4 AGT GTG GGA AGA GTG TTA TTC
- the amplification conditions were 30 cycles of 40 seconds at 94 °C, 40 seconds at 55 °C, 60 seconds at 72 °C each and an extension step at 72 °C for 10 min.
- the reactions were performed in 50 ⁇ L containing 30 pmol of each primer, PV3 and
- SPV2 ACC AAA GCT TTG GTT TTC AGA
- the amplification conditions for both reactions were 30 cycles of 40 seconds at 94
- the primary PCR products were purified with the QIAquick PCR
- APEcoRI GAA TTC GAC CAC GCG TAT CGA TGT CGAC
- Both primary and secondary PCR reactions were performed in 100 ⁇ L containing 50 pmol of each primer, 0.4 mM deoxyribonucleotide and 1.0 unit Pfu polymerase (Stratagene) in the corresponding buffer.
- the primary PCR reaction amplified the two separate fragments by 30 cycles, each cycle comprising 40 seconds at 94°C, 40 seconds at 50°C, 60 seconds at 72°C and an extension step at 72°C for 10 min.
- the second PCR reaction amplified the recombinant fragment in 12 cycles using the same conditions reported above.
- the full lengthed product was cloned in the EcoRI site of the cloning vector pCR2.1 (Fig. 24 A) and sequenced as noted above.
- This plasmid is referred to as pCR2.1-Pv-FRIL.
- the nucleic acid sequence of the Pv-FRIL cDNA is as follows:
- Pv-FRIL The amino acid sequence of Pv-FRIL is as follows: AQSLSFNFTKFDLDQKD IFQGDATSTNNVLQLTKLDSGGNPVGASVGRVLFSAPFH WENS MAVSSFETNLTIQISTPHPYYAADGFAFFLAPHDTVIPPNSWGKF GLYSNVFRNSPTSENQ SFGDVNTDSRWAVEFDTF PNANIDPNYRHIG IDVNS IKSKETARWEWQNG TATARI S YNS
- the amino acid sequence of Pv-FRIL was compared to the amino acid sequences of Dl-FRIL and of the PHA-E lectin. This comparison is shown on Fig. 24B.
- the signal peptide and the full length cDNA clone were amplified in two separate primary PCR reactions.
- the signal peptide was obtained from the amplification of the binary vector pTA4, harboring the complete sequence of the bean ⁇ -amylase inhibitor gene (Hoffman et al., L.M., Y. Ma and R.F. Barker, Nucleic Acid Res. 10: 7819-7828, 1982; Moreno and Chrispeels, Proc. Natl. Acad. Sci. USA 86: 7885-7889, 1989).
- the primers used for the two primary reactions are the following: Amplification of the Signal Peptide Sigforw Bglll: AGA TCT ATG GCT TCC TCC AAC
- SpMlforw CAC GCA AAC TCA GCC GCT CAG TCA TTA TCT TT APXhoI: CTC GAG GAC CAC GCG TAT CGA TGT CGA
- the primers used for the secondary reactions, Sigforw and AP were designed to generate Bglll sites at the 5' and Xhol at the 3' ends. Both, primary and secondary PCR reactions were performed as discussed above.
- the recombinant product SpPv-FRIL was incubated for 10 min. at 72 °C with 0.5 units of Ampli-Taq polymerase (Perkin Elmer) and cloned in the cloning vector pCR2.1 (Fig. 25).
- the nucleotide sequence of the PCR product was determined as described above to verify the correct attachment of the signal peptide.
- a binary vector was constructed for constitutive expression of Pv-FRIL in tobacco plants.
- the recombinant SpPv-FRIL was cloned in Bglll/Xhol sites of a plant expression vector resulting in the formation of pM-SpPv-FRIL (Fig. 26).
- the binary vector was transferred in Agrobacterium tumefaciens strain C58 according to the freeze-thaw procedure reported of An et al., supra.
- Agrobacterium- mediated transformation of Nicotiana tabacum leaf disks was carried out as described by Horsh et al. (Science 227: 1229 - 1231, 1985) using C58 harboring the expression vector pM-SpPv-FRIL.
- Kanamycin resistant plants were scored for their ability to form roots in two consecutive steps of propagation in Murashige-Skoog medium containing 3% sucrose and kanamycin sulfate (Sigma) at 100 mg/L.
- Tobacco plants transformed with this construct were grown in a growth room under controlled conditions.
- the leaves (20 grams) of young plants were harvested and frozen in liquid nitrogen and powdered in a mortar with a pestle.
- the powder was stirred in a buffer mixture consisting of 1 x phosphate buffered saline containing ImM CaCl 2 with a cocktail of protease inhibitors (PMSF, Pepstatin and Leupeptin).
- PMSF protease inhibitors
- This slurry was centrifuged at 2000 rpm and the supernatant was centrifuged at 40,000 rpm in a Beckman ultracentrifuge.
- the clear supernatant was tumbled with 1 ml of ovalbumin-Sepharose for 3 hours.
- the beads were washed with the same buffer and tumbled overnight with 200 mM trehalose in 1/10 phosphate buffered saline containing the cocktail of protease inhibitors. Coomassie blue stained gel showed this preparation to be pure Pv-FRIL. An immunoblot showed the presence of both alpha and beta subunits, thus, the single polypeptide chain encoding both subunits was cleaved by the transformed cells in vivo. Binding to the ovalbumin-sepharose and release by trehalose shows that the product of the transgene is an active lectin.
- Dl-FRIL Supports Prolonged ex vivo Maintenance of Quiescent Human CD34+CD38-/SCID-Repopulating Cells
- a functional in vivo assay for primitive human hematopoietic cells was used to determine the cells' ability to home to and repopulate the marrow of sublethally irradiated C.B-17 and NOD/LtSz mice homozygous for the severe combined immunodeficiency Prkdc s °id mutation (Lapidot et al., Science 255:1137, 1992; Larochelle et al., Nat. Med. 2:1329-1337, 1996). To do this, the following methods were used:
- CB samples Human umbilical cord blood (CB) samples were obtained from full term deliveries. The blood samples were diluted 1:1 in phosphate-buffered-saline (PBS) without Mg +2 /Ca +2 , supplemented with 10% fetal bovine serum (FBS). Low density mononuclear cells were collected after standard separation on Ficoll-Paque (Pharmacia Biotech, Uppsala, Sweden), and washed in RPMI with 10% FBS. Some samples were frozen in 10% DMSO, while the others were used fresh. Enrichment of CD34+ cells was performed with mini MACS separation kit (Miltenyi Biotec, Bergisch Gladbach, Germany) according to the manufacturer's instructions.
- PBS phosphate-buffered-saline
- FBS fetal bovine serum
- CD34 + CD38"/low cells were purified by FACS sorting (FACStar + , Becton Dickinson, San Jose, CA) after staining CD34+ enriched cells with mAb anti human CD34-FITC (Becton Dickinson) and anti human CD38 PE (Coulter, Miami FL USA) (Purity >99%).
- FACS sorting FACS sorting
- mAb anti human CD34-FITC Becton Dickinson
- anti human CD38 PE Coulter, Miami FL USA
- NOD/SCID ⁇ 2 microglobulin knockout mice hereafter termed NOD/SCID B2M KM (Christianson et al., /. Immunol. 158:3578-3586, 1997), bred and maintained under defined flora conditions in sterile micro isolator cages, were irradiated with a sublethal dose of 375 cGy at 67cGy/min. from a cobalt (60Co) source prior to transplantation.
- NOD/SCID B2M KM bred and maintained under defined flora conditions in sterile micro isolator cages, were irradiated with a sublethal dose of 375 cGy at 67cGy/min. from a cobalt (60Co) source prior to transplantation.
- irradiated mice Human cells were injected into the tail vein of irradiated mice in 0.5 mL of RPMI with 10% FBS.
- non engrafting irradiated (1500 cGy) CD34" cells served as carrier cells, and were cotransplanted with cultured cells at a final concentration of 0.5x106 cells/mouse.
- Mice were sacrificed 1 month post transplantation, and bone marrow (BM) cells were flushed from the 8 bones of each mouse (femurs, tibias, humeri, and pelvis).
- BM bone marrow
- Human CD34+ enriched cells were cultured in 24 well plates (2-4x105 cells in 0.5 mL), containing RPMI supplemented with 10% FBS+1% BSA. Ex vivo cultures contained the following cytokine combination: Stem cell factor (SCF) - 100 ng/mL and Flt3 ligand (Flt3-L) - 100 ng/mL (R&D Systems Inc.
- SCF Stem cell factor
- Flt3 ligand Flt3-L
- the growth factor cocktail included 300 ng/mL SCF, 300 ng/mL Flt3-L, 50 ng/mL G-CSF, 10 ng/mL IL-3 (R&D Systems), and 10 ng/mL IL-6.
- Dl-FRIL was isolated from the seeds of hyacinth beans (Dolichos lab lab) using the protocol described above in Example 1.
- Semisolid cultures were performed in order to detect the levels of human progenitors in ex vivo cultures, and in the marrow of transplanted mice.
- the cells were plated (4x10-3 cells/mL) in 0.9% methylcellulose (Sigma, St. Louis, MO, USA), 30% FBS, 5X10 ⁇ 5M 2ME, 50 ng/mL SCF, 5 ng/mL IL-3, 5 ng/mL GM-CSF (R&D), and 2 u/mL Erythropoietin (Ortho Bio Tech, Don Mills, ON, Canada).
- Human cells from the BM of engrafted mice were plated (2 xlO- ⁇ cells/mL) in 15% FBS + 15% human plasma, selective for human colonies only. The cultures were incubated at 37°C in a humidified atmosphere containing 5% CO2 and scored 14 days later with an inverted microscope for myeloid, erythroid, and mixed colonies by morphologic criteria.
- Cells were analyzed for their DNA content by staining with propidium iodide (Sigma). The cells were cultured in ex vivo cultures as described, for 3,6,10, and 13 days as indicated. At each time point, the cells were collected, resuspended to a final concentration of O.l-lxlO ⁇ cells/mL, and incubated with 0.1% Triton X 100 (Sigma) for 20 minutes on ice. 50 mg/mL propidium iodide (PI) were added before analysis. Flow cytometeric analyses were performed using FACSort (Becton Dickinson, San Jose, CA).
- Human and mouse Fc receptors on BM cells from transplanted mice were blocked by using human plasma (1:50) and anti mouse Fc receptor blockers (anti mouse CD16/CD32 mAb, Pharmingen, San Diego, CA, USA). Isotype control mAb were used in order to exclude false positive cells (Coulter, Miami FL USA). The purity of enriched subpopulations after magnetic bead separation, were analyzed by two color staining, using anti-human CD34 FITC (Becton Dickinson, San Jose, CA, USA) and anti-human CD38 PE (Coulter).
- the levels of human cells and lymphoid lineages in the marrow of engrafted mice were detected by double staining with anti-human CD45 FITC (Immuno Quality Products, Groningen, The Netherlands) together with anti-human CD19 PE (Coulter) for detection of pre B cells, or with anti-human CD56 PE (Coulter) for detection of NK cells.
- Cells were washed with PBS supplemented with 1% FBS and 0.02% azide, suspended to a volume of 0.1- 1x10 ⁇ cells/mL, stained with direct-labeled mAb and incubated for 25 minutes on ice. After staining, cells were washed once in the same buffer and analyzed on a FACSort (Becton Dickinson). Analysis was performed using CELLquest software (Becton Dickinson).
- the levels of human cell engraftment were determined by both flow cytometry for analysis of human myeloid CD45+ and lymphoid CD45 + CD19 + pre B cells and quantification of human DNA as previously described (Lapidot et al., Science 255:1137, 1992; Larochelle et al., Nat . Med. 2:1329-1337, 1996; Peled et al., Science 283:845-848, 1999). Briefly, high molecular weight DNA was obtained from the BM of transplanted mice by phenol /chloroform extraction.
- DNA (5 g) was digested with EcoRI, subjected to electrophoresis on 0.6% agarose gel, blotted onto a nylon membrane, and hybridized with a human chromosome 17-specific ⁇ -satellite probe (pl7H8) labeled with 32p (Lapidot et al., supra).
- the intensity of the bands in the samples were compared to artificial human/mouse DNA mixtures (0%, 0.1%, 1%, and 10% human DNA) to quantify the human DNA (lanes to the right of lane 4 in Fig. 31). Multiple exposures of the autoradiographs were taken to ensure sensitivity down to 0.01% human DNA.
- a transplanted mouse was scored positive when both human myeloid and lymphoid cells and human DNA were detected in its BM.
- Dl-FRIL by itself preserves immature CB progenitor cells up to a month in suspension culture without medium changes (see, e.g., Figs 14A and 14B, and Table 3).
- cytokines SCF, Flt3-L, IL-6, and sIL6-R
- enriched CB CD34 + cells were cultured with either Dl-FRIL or cytokines for 3, 6, 10, or 13 days in medium containing 10% FBS and 1% BSA in RPMI. Fresh media and Dl-FRIL and/or cytokines were added on day 6. Cells harvested at each time point were counted and assayed for clonogenic progenitor cells by plating (i.e., seeding) in semisolid media.
- Fig. 27 A the total number of cells in Dl-FRIL cultures gradually declined over time from 2x10 ⁇ cells initially seeded to 1.26x10 ° " cells at day 13, in contrast to the expected 14.3-fold increase to 2.8x106 cells in cytokine cultures at day 13.
- Fig. 27B the levels of progenitor cells in Dl-FRIL cultures also remained relatively constant until day 10, after which they declined to 9 % of the starting population (from 24.7x10-3 colonies on day 0 to 2.3x10-3 colonies on day 13).
- Progenitor levels increased in cytokine cultures by 10-fold from the outset to day 13 of culture (Fig. 27B).
- Dl-FRIL maintains the expansion capacity of CD34 ⁇ progenitors up to 2 weeks in ex vivo culture
- CD34+ cells cultured for 6 days with Dl-FRIL were washed and exposed to cytokines (without Dl-FRIL) for an additional 4 days.
- Total cell counts and clonogenic progenitor assays were performed and the results were compared to cells cultured for 10 days with Dl-FRIL.
- Fresh media and Dl-FRIL were added on day 6.
- the Dl-FRIL-cultured cells proliferated in response to cytokine stimulation, resulting in a 3.4-fold increase in cell numbers (Fig. 28A) and 13-fold increase in progenitor levels (Fig. 28B).
- Dl-FRIL maintains SCID repopulating stem cells (SRC) in ex vivo cultures
- SRC SCID repopulating stem cells
- the human CB CD34 cells were collected and the content of each well was assayed for progenitor levels (described above) and 2x10 ⁇ of the remaining cells were transplanted into one mouse.
- mice were sacrificed and their bone marrows were harvested and assayed for the presence of human myeloid and lymphoid cells.
- human DNA levels in the bone marrow of individual transplanted mice was quantitated by Southern blotting analysis. A representative Southern blot analysis showing the detection of a 0%, 0.1%, 1%, and 10% human DNA per murine DNA is provided in Fig. 29E.
- Figs. 29A-29D show representative Southern blot analyses of the BM of mice transplanted with ex vivo cultured cells.
- Fig. 29A is a representative Southern blot showing human DNA in the marrow of mice transplanted with cells cultured with FRIL for 6 days (lane 1), FRIL for 10 days (lane 2), or with FRIL for 6 days followed by 4 days with cytokine stimulation (lane 3).
- the levels of engraftment by cells cultured with Dl-FRIL for 10 days decreased by approximately 10-fold from cells cultured with Dl-FRIL for 6 days (Fig. 29 A, lanes 1 and 2).
- FIG. 29C shows the results of another experiment, where the difference between engraftment levels obtained by cells cultured with Dl-FRIL for 10 days (lane 1) or with Dl-FRIL for 6 days followed by 4 days of cytokine stimulation (lane 2) are minor. Nevertheless, a 10-fold increase was observed for cells cultured either with Dl-FRIL for 13 days (Fig. 29D, lane 3) or with Dl-FRIL for
- Cells cultured with Dl-FRIL followed by cytokines, engrafted at levels 7.4-fold greater than cells cultured with Dl-FRIL alone for 10 days (Fig. 30, p 0.05).
- CD34 + cells isolated by immunomagnetic beads were further sorted by
- CD34+CD38 cells (99% purity) cultured with either Dl-FRIL alone or Dl-FRIL followed by cytokines showed patterns of engraftment in NOD/SCID B2M MM ⁇ mice (Christianson et al., supra), similar to those observed for CD34 + cells. These mice have been used successfully for secondary human stem cell transplantation (Peled et al., supra), have less innate immunity due to lack of NK activity and thus require fewer (10 fold) human cells for engraftment compared to NOD/SCID mice.
- FIG. 31 is a representative Southern blot (1 out of 4 experiments) showing the relative level of engraftment of cells that were cultured with Dl-FRIL for 10 days (lane 4) compared to 6 days with Dl-FRIL followed by 4 days cytokine stimulation (lanes 1-3) prior to transplantation into mice.
- High molecular weight DNA was obtained from the BM of transplanted mice and subjected to Southern blotting analysis for the presence of human DNA.
- mice transplanted with cells that were treated with Dl-FRIL followed by cytokines were about 10-fold higher compared to the mouse transplanted with cells cultured with Dl-FRIL alone (Fig. 31, lane 4).
- Dl-FRIL preserves long-term repopulating stem cells.
- Bone marrows harvested from NOD/SCID mice that were initially transplanted with CD34+ cord blood cells cultured in Dl-FRIL were transplanted into a second set of sublethaly irradiated NOD/SCID mouse recipients. After one month, bone marrows from the second set of recipients were analyzed for the presence of human hematopoiesis, as determined using the assays described above. Multilineage engraftment was observed in the second set sublethaly irradiated NOD/SCID mouse recipients. This observed persistence of repopulating cells in this serial transplantation study indicated the presence of long-term repopulating stem cells.
- Dl-FRIL preserves SRC potential of multilineage differentiation in the murine
- BM of transplanted mice was collected 1 month later and the cells were either seeded in semisolid media selective for human colonies (results shown in Fig. 33A) or were analyzed for lineage specific markers by flow cytometry (results shown in Figs. 33B- 33F).
- Fig. 33A shows that the levels of human progenitors in the bone marrow of transplanted mice increased 2.3-fold when SRC were stimulated with cytokines for 4 days after 6 days of Dl-FRIL incubation compared to Dl-FRIL alone for 10 days prior to transplantation. Moreover, both myeloid and erythroid colonies formed in the colony assays (data not shown) as well as human B cell differentiation that was determined by flow cytometry (Figs.
- mice To determine whether human lymphoid precursors in the marrow of transplanted mice have the potential to differentiate in addition to myeloid cells also into lymphoid NK cells, cells from transplanted murine bone marrow were also cultured with SCF and IL-15 for 10 days. Cells harvested from cultures were analyzed for human NK cells by flow cytometry using the human-specific monoclonal antibodies to CD45 and the NK cell antigen, CD56. Cells from mice transplanted with CD34+ or CD34+CD38 "/low ce ll s are shown (1% or 7.7% of CD56 + cells; Figs. 33E and 33F, respectively).
- Dl-FRIL vascular endothelial growth factor receptor
- Flt3-L both stimulate proliferation of Flt33T3 cells, they exert different activities on CB progenitor cells.
- Flt3-L induces quiescent primitive cells into cycle (Lyman and Jacobsen, Blood 91:1101-11345, 1998).
- Dl-FRIL by itself maintains progenitors in serum-defined medium from 15-29 days in culture without medium changes (Colucci et al., Proc. Natl. Acad. Sci. USA 96(2):646-650, 1999).
- the abilities of Dl-FRIL or Flt3-L to maintain CB CD34 + progenitors in suspension cultures consisting of 10% FBS and 1% BSA in RPMI for 10 days were compared in the presence and absence of cytokines. The cells were then were seeded for CFU assay.
- Fig. 34 A the number of total cells harvested after 10 days of suspension culture in Dl-FRIL increased minimally by 1.9-fold, whereas cells cultured in either Flt3-L alone or in combination with Dl-FRIL increased by 4.5-fold and 5.4-fold, respectively (p ⁇ 0.05).
- Dl-FRIL maintains higher levels of CD34 ⁇ cells in Gn/G ⁇ phase of cell cycle compared to cytokine treated cells
- CD34+ cells are predominantly quiescent, non-cycling cells (Young et al, Blood 87:545, 1996; Movassagh et al, Stem Cells 15:214-222, 1997; Ladd et al., Blood 90:658-668, 1997). Since Dl-FRIL maintains relatively constant levels of progenitor cells over two weeks in suspension culture that can subsequently respond to cytokine stimulation (see Fig. 27), the cell cycle status of CD34 + cells incubated with Dl-FRIL was investigated and compared to cultures with cytokine stimulation. DNA content of CB CD34+ cells was analyzed by flow cytometry immediately after isolation of cells.
- Dl-FRIL Cytokines Days in Dl-FRIL Cytokines (%) Dl-FRIL Cytokines Fold increase culture (%) (cells xl ⁇ 3) (cells xlO 3 ) induced by cytokines day 3 17.7 ⁇ 1.9 50.8+1.4 35 212 6 day 6 20 ⁇ 2 26 43.6 389.5 9 day 10 10 ⁇ 1.9 29.7+1 26.4 553 21 day 13 9.1 ⁇ 4.1 23.14 11.4 664.6 60
- CD34+ cells were cultured (2xl0 b cells/0.5 ml) with Dl-FRIL or SCF+Flt3 ligand+IL-3+G- CSF+IL-6. Cell cycle analysis was performed with propidium iodide staining. Cell numbers were calculated by multiplying percent of cycling cells by total cell numbers. Data represents mean ⁇ SE values, from 5 experiments.
- the number of cells in SG2M phase during culture differed from the 6.8x 10 cells in SG2M phase initially seeded.
- the average number of cycling cells in Dl-FRIL cultures remained relatively constant from 35x103 cells at day 3 and 43.6x103 cells at day 6 to a reduced level of 26.4x103 cells at day 10 and 11.4x103 cells at day 13.
- This pattern of cells in cycle explains the low levels of total cell numbers and progenitor cells (see Fig. 27).
- the expected number of cycling cells in cytokine cultures increased dramatically.
- Figs. 35A-35G show representative cell cycle histograms of CD34 + cells cultured with no addition (Fig. 35A), Dl-FRIL alone (Fig. 35B) or various cytokines or combinations thereof (Figs. 35C-35G) for 3 days, and the mean percentage of cells in each cell cycle phase is summarized in Table 6.
- Dl-FRIL maintains a significantly higher percentage of quiescent cells and lower percentage of cycling cells (Fig.35B and Table 6) compared to stimulation with cytokines (Figs. 35C-35G and Table 6).
- Cultures containing Dl- FRIL and Flt3-L together slightly increased the percentage of cells in SG 2M phase, from 17.7% (with Dl-FRIL alone) to 24.3% (p ⁇ 0.05, Table 6).
- Dl-FRIL Preserves CB Progenitors in a Dormant State in the Presence of Potent Stimulators Dl-FRIL was purified from Dolichos lab lab as described above in Example 1. Dl-FRIL was assayed over a 5-log dose range (10 ng/m.L-1,000 ng/mL) on human
- the number of viable MNC and progenitors were evaluated after 5 days in culture. Results from 1 of 3 representative experiments are shown in Table 7 below.
- the number of viable MNC at the end of culture was reduced by 1.7 - to 5-fold in cultures containing 10-1,000 ng/ml of Dl-FRIL.
- the frequencies of myeloid and erythroid progenitors in these cultures increased from 1.4- to 2.4-fold over the same dose range.
- CB MNC Culture of CB MNC in Dl-FRIL results in fewer MNC and a greater frequency of progenitors. 4 x 10 6 CB MNC were cultured in 2 mL of
- AIMV Life Technologies
- Agar-SCM StemCell Technologies
- Dl-FRIL Dl-FRIL
- MNC Reduction in MNC correlates with the relative increase in frequency of progenitors.
- the relative reduction in MNC of Dl- FRIL cultures is consistent with increased progenitor frequency in corresponding samples.
- Dl-FRIL protects CB MNC from the toxicity of chemotherapy drugs.
- a-C cytarabine
- Dox doxorubicin
- Fig. 36B doxorubicin
- 5-FU 5-fluorouracil
- Dl-FRIL was purified from Dolichos lab lab as described above in Example 1. Cultures containing Dl-FRIL (either at 10 ng/ml or 100 ng/ml) resulted in a 2-3 log dose shift of CB MNC to Ara-C (Fig. 36A and Dox (Fig. 36B). As shown in Fig. 36C, the presence of Dl-FRIL in 5-FU cultures increased viability over a large dose range.
- mice tolerate high levels of Dl-FRIL The in vivo toxicity of Dl-FRIL was determined in mice. Initially, Dl-FRIL was administered intravenously to mice over a 3-log dose range of 0.006-1 mg/kg (0.32-20 ⁇ g/mouse). Dl-FRIL was well tolerated and these mice have subsequently received 2 monthly challenges of Dl-FRIL without any observable short- or long- term adverse effects.
- Protocols to test chemoprotective properties of cytokines in mice typically involve daily pre-treatment (bolus or continuous delivery) regimens of 4-10 days before starting chemotherapy. Using this framework as a starting point, Dl-FRIL was injected at 5 mg/kg (100 ⁇ g/mouse) intravenously daily for 4 days. No gross adverse effects have been observed in over 150 mice treated with this dose regimen. Dl-FRIL was purified from Dolichos lab lab as described above in Example 1.
- mice 500 mg/kg and monitored the survival of mice for 48 hours. Of the four BALB/c mice receiving this treatment (2 males and 2 females, aged 5 months), only 1 mouse (a male) survived 48 hours. The surviving mouse's weight decreased by approximately 15% in the first 2 day and returned to normal by day 4. The surviving mouse's blood counts were in the normal range 3 days after injection of FRIL. The results demonstrate that even a very large dose of Dl-FRIL is not completely toxic.
- EXAMPLE 10 in vivo modulation of progenitors by Dl-FRIL in mice Using the initial planned dose regimen of Dl-FRIL (5 mg/kg x 4 days) for testing chemoprotection, hematopoietic parameters were examined in mice 3, 5, and 7 days after completing Dl-FRIL treatment.
- Dl-FRIL was purified from Dolichos lab lab as described above in Example 1. Weight-matched BALB/c mice (females, aged 8 weeks) were injected intravenously with either 0.2 ml of Dl-FRIL (500 mg/ml) or 0.2 ml of HBSS daily for 4 days. Two mice from each group were evaluated at 3 days, 5 days, and 7 days after completing Dl-FRIL treatment.
- the peripheral blood counts (red blood cell (RBC) and white blood cell (WBC)) of Dl-FRIL-treated mice were found to be reduced by 1.7- and 2.9-fold, respectively, at 3 days, and returned to normal by day 5.
- Bone marrow (BM) cellularity was also reduced by 2.5-fold at day 3, and returned to normal after 7 days. The spleen cellularity was lower at day 5 but normal at day 3 and day 7.
- the frequency of progenitors was slightly increased in bone marrow, by 1.6- to 1.85-fold at day 3, but the total number of progenitors in the bone marrow remained unchanged.
- a compensatory organ during hematopoiesis stress a 2.83-fold higher frequency and 3.35-fold higher number of erythroid progenitors were observed in the spleen at day 3 (see Table 9).
- the frequencies and total number of progenitors in the bone marrow appeared normal at day 5 but fewer mature erythroid progenitors (CFU-E) and more primitive progenitors (BFU-E /mix) were observed at day 7.
- CFU-E mature erythroid progenitors
- BFU-E /mix primitive progenitors
- Dl-FRIL protects mice from 5-FU induced death in the critical first week A dose regimen was established to determine whether FRIL protects mice from death resulting from hematopoietic toxicity of Ara-C and Dox.
- This murine 5- FU chemoprotection model is based on studies showing that a single dose of 5-FU (150 mg/kg) resulted in >90% reduction of bone marrow cellularity but had limited cytotoxic effect on stem cells (Lerner and Harrison, Exp. Hematol. 18:114-118, 1990). This finding was consistent with the understanding that stem cells reside in the bone marrow in predominantly a quiescent state.
- the pretreatment dose regimen for Dl-FRIL described above (5 mg/kg x 4 days) was selected based on the requirement of treating animals with cytokines for several days prior to starting chemotherapy and because Dl-FRIL-treated mice easily tolerated doses (5 mg/kg) that were 10- to 100- fold greater than that used for cytokines.
- this pretreatment dose regimen was used to test whether Dl-FRIL can protect mice from 5-FU administered at 2 intervals in the first week: 5-FU (150 mg/kg) was injected at day 0 and then a second dose (also at 150 mg/kg) was injected either on day 3 (dO/3 dose interval) or day 5 (dO/5 dose interval). No survival on the day 3 interval was observed by de Haan et al. (supra) at day 3.
- Dl-FRIL was purified from Dolichos lab lab as described above in Example 1. Weight-matched BALB/c mice (10 mice/group) were injected intravenously with either with 0.2 mL of Dl-FRIL (500 mg/mL) or 0.2 mL of HBSS daily for 4 days. Two hours after the final treatment of Dl-FRIL, mice were injected intraperitoneally with 5-FU (150 mg/kg). Groups of mice received a second dose of 5-FU (150 mg/kg) at either day 3 or day 5. No mice died from a single dose of 5-FU. As shown in Table 10, Dl-FRIL pretreatment improved survival of mice in two separate experiments. TABLE 10
- mice 8 wk 0/10 0/10 4/10 1/10 Improved survival of mice pretreated with FRIL (5mg/kg x 4 days) prior to undergoing 5-FU dose intervals of dO/3 and dO/5.
- mice survived a dO/3 dose interval of 5-FU compared to no mice in the HBSS pretreatment control.
- 4 of 10 mice pretreated with Dl-FRIL survived a dO/5 dose interval of 5-FU compared to 1 of 10 for HBSS pretreated mice.
- Dl- FRIL accounts for approximately 0.02% of the mass of hyacinth beans.
- Dl-FRIL is purified by carbohydrate affinity chromatography as described in
- Example 1 is evaluated for purity by SDS-PAGE (5 discrete bands are visualized on an overloaded gel; see Fig. 37); is analyzed for mass and composition by amino acid analysis; and is assayed in the cord blood progenitor assay described above.
- the murine 5-FU chemoprotection model (Lerner and Harrison, supra; de
- Dl-FRIL is administered intravenously to mice over a 3- log dose range (5 - 5,000 mg/kg) under various regimens that include Dl-FRIL treatment prior to chemotherapy (daily from 3 days to 2 hour before initiation of chemotherapy) and during chemotherapy.
- mice used in these studies are BALB/c female mice, 8-10 weeks at outset of experiments (Jackson Laboratory, Bar Harbor, ME), weight matched each for experiment, where there are 10 mice per group. Organs from mice receiving a dose of 5,000 mg/kg of FRIL (with no 5-FU treatment) are collected for toxicity studies
- the five doses of Dl-FRIL are 0, 5, 50, 500, and 5,000 ⁇ g/kg.
- the four dose regimens of Dl-FRIL will be -2hour; -lday and -2hour; -2day, -lday, and -2hour; - 3day, -2day, -lday, and -2hour prior to 5-FU treatment.
- the two maintenance regimens are either daily x 7 day (-2hour to day 7) or every other d (days 0, 2, 4, 6).
- one group of mice will receive a dose of Dl-FRIL daily for 7 days; while the second group will receive a dose of Dl-FRIL every other day for 7 days.
- the 5-FU dose intervals of 150 mg/kg are at dose intervals of d0/3, dO/5, and d0/7.
- a FRIL family member has chemoprotective properties with widely used cell cycle-active chemotherapeuti.es After establishing the optimal dose regimen of a FRIL family member, the
- EXAMPLE 14 Characterization of the hematopoietic status of mice during optimal dose regimen of a FRIL family member to protect mice from 5-FU induced death
- Peripheral blood counts and the status of hematopoietic progenitors are characterized in mice during and after receiving the optimal dose regimen of a FRIL family member. To do this, mice injected with a dose regimen of a FRIL family member with no 5-FU treatment are evaluated daily during and for one week after treatment with the FRIL family member.
- mice are evaluated for the following hematopoietic parameters: WBC and RBC counts; bone marrow and spleen cellulariti.es; and progenitor status, which includes hematopoietic colony assays (StemCell Technologies).
- the progenitors assayed are myeloid (CFU-C), erythroid (CFU-E), and primitive, multipotential (BFU-E/Mix).
- CFU-C myeloid
- CFU-E erythroid
- BFU-E/Mix primitive, multipotential
- the clearance of a FRIL family member from the circulation and its accumulation in the body is determined by preliminary pharmacokinetics.
- 125 I-FRIL is injected into mice (dosage of FRIL based on optimization results). Clearance of FRIL from the blood is evaluated at the following timepoints after injection: 5 min., 15 min., 30 min., 1 hour, 2 hours, 4 hours, 8 hours, 12 hours, 36 hours, 48 hours. Two mice are evaluated at each timepoint. Following this study, the animals are sacrificed and the organs collected and evaluated.
- Dose-range finding experiments determine the maximal tolerated dose of a FRIL family member by various routes of administration (intravenous, intraperitoneal, subcutaneous, and oral).
- routes of administration intravenous, intraperitoneal, subcutaneous, oral.
- the highest dose of a FRIL family member is 1 g/kg.
- the dosage of the FRIL family member is reduced by 2-fold until mice survive. Survival is measured at 48 hours after treatment.
- Other clinical observations are made, including behavorial, lethargy, vocalization, diarrhea.
- CBC analyses are made. The animals are evaluated for any necropsy ( i.e., gross lesions). Following this study, the animals are sacrificed and the organs collected and evaluated.
- Acute dose toxicity studies allow identify target organs that may develop lesions after exposure to a FRIL family member.
- a dose is selected, and a FRIL family member is injected daily for 7 days.
- Acute toxicity is evaluated at 7 days, and recovery from acute toxicity is evaluated at 21 days.
- Blood chemistries, target organs, bone marrow and blood, and other health indicator are evaluated.
- Hypersensitivity studies in guinea pigs are performed to test for any adverse immunologic reactions. To do this, fifteen guinea pigs (5 FRIL, 5 DNCB positive control, 5 saline negative control) are used.
- a FRIL family member is intradermally injected at 0.1 mL. Daily clinical observations at site for redness and edema are compared to the DNCB positive control.
- the FRIL guinea pigs are challenged at at 2 weeks with 0.05 mL of the FRIL family member, and daily clinical observations are made.
- a determination of development of mouse anti-FRIL family member antibodies in mice receiving treatment with a FRIL family member is made to determine the extent and nature of the body's response to a FRIL family member.
- a FRIL family member is attached to Dynal's tosylactivated magnetic beads.
- the FRIL family member-coated beads are incubated with plasma (pooled or individual) from a mouse who has received treatment with the FRIL family member.
- plasma pooled or individual
- the presence of FRIL family member-specific antibodies is evaluated by SDS-PAGE and Western blot analysis (horseradish peroxidase or chemiluminesce).
- a determination is made as to whether sugar blocks antibody binding ( -D- mannopyranoside and negative control).
- Dl-FRIL was purified from Dolichos lab lab seeds as described in Example 1.
- Dl-FRIL can be immobilized on magnetic beads (M-280 Dynabeads Tosylactivated, Lake Success, NY) via amino- and sulfhydryl-groups of the lectin according to the manufacturer's directions.
- Dl-FRIL can also immobilized on magnetic beads by a biotin-strepavidin interaction.
- Dl-FRIL was immobilized on magnetic beads by a biotin- strepavidin interaction.
- Biotinylation of Dl-FRIL via primary amine-groups was carried out according to the manufacturer's directions.
- Biotinylated Dl-FRIL was incubated with strepavidin-labeled magnetic beads (Dynal or Miltenyi Biotec, Auburn, CA) according to the manufacturer's directions.
- CB Human cord blood
- peripheral blood collected in sterile receptacles containing anticoagulant (e.g., heparin, EDTA)
- anticoagulant e.g., heparin, EDTA
- mnc mononuclear cells
- Mononuclear cells harvested at the interface of plasma and Ficoll-Paque were washed and resuspended in serum-defined medium (e.g., XV ⁇ VO-10, Biowhittaker, Walkerville, MD or AIM-V, Life Technologies, Rockville, MD).
- serum-defined medium e.g., XV ⁇ VO-10, Biowhittaker, Walkerville, MD or AIM-V, Life Technologies, Rockville, MD).
- Dl-FRIL-beads detachment of Dl-FRIL-beads from cells.
- binding studies have demonstrated that excess mannose and ⁇ -methyl ⁇ -D-mannoside prevent Dl-FRIL from binding to Flt3, neither sugar released tightly bound Dl-FRIL-beads from CB mnc.
- the cells were incubated in 100 mM trehalose (Sigma, St. Louis, MO) for one hour on a rocker in the cold room.
- Miltenyi beads are very small (approximately 50 nm) as compared to Dynal beads (approximately 10 ⁇ m), when Miltenyi beads were used to purify Dl-FRIL-binding progenitor cells, the beads were allowed to remain attached to the purified progenitor cells.
- Receptor tyrosine kinase gene expression was characterized by RT-PCR. Using these methods, the following results were obtained:
- Dl-FRIL bead-selected CB mnc Functional properties of Dl-FRIL bead-selected CB mnc
- the progenitor capacity of Dl-FRIL-selected CB mnc was tested in a methylcellulose colony assay under conditions to promote proliferation and differentiation along either the hematopoietic or endothelial lineages (as described above.
- Table 11 shows the number of hematopoietic colonies (myeloid, erythroid, and mix) and endothelial colonies (other) that formed after culture of unselected cells (CB mnc), Dl-FRIL-selected cells (Dl-FRIL + ) and CB mnc that did not bind to Dl-FRIL-beads (Dl-FRIL ).
- Dl-FRIL " 0 0 0 5 5 Cord blood mononuclear cells were isolated by Ficoll-Paque, bead selected, and plated in MethoCultD, StemCell Technologies, Vancouver, BC, Canada).
- Dl-FRIL-selection increased the number of hematopoietic colonies (stimulated with colony stimulating factors (CSFs) by 14- fold for myeloid colonies, 3.3- to 10-fold for erythroid colonies (CB mnc and Dl-
- FRIL- cells FRIL- cells, respectively), and by 2-fold for mixed colonies. Similar levels of Dl- FRIL-bead enrichment was observed for endothelial colonies (stimulated with vascular endothelial growth factor (VEGF)): 9.5-fold over CB mnc and 3.8-fold for Dl-FRIL ' cells.
- VEGF vascular endothelial growth factor
- the cell surface phenotypic properties of Dl-FRIL bead-selected CB mnc was characterized by flow cytometry.
- Table 12 shows the phenotypes (by percentage of cells expressing the indicated cell surface phenotype marker) of the three CB cell populations: (1) cells not selected by Dl-FRIL-beads (Dl-FRIL ' ); (2) cells that detached from Dl-FRIL-beads after overnight incubation in the coldroom on a rocker (Dl-FRIL 4" ); and (3) cells that retained Dl-FRIL-beads after overnight incubation (D1-FRIL ++ ).
- the two Dl-FRIL-binding cell populations were analyzed separately to see whether tightness of binding (avidity) related to type of cells selected. Isotype control levels were set at 2%; all values of 2% represent no reactivity with test antibody.
- Dl-FRIL-beads did not capture CB mnc that express CD34, the hallmark marker of hematopoietic stem cells and progenitors. This observation was unexpected because Dl-FRIL-selected cells enrich for progenitors (see Table 11). Although CB CD34 + cells uniformly express FLT3, only 70% of Flt3 + CB mnc also express CD34 (Rappold et al, Blood 90:111-125, 1997). Consequently, 30% of CB mnc expressed the phenotype of CD34 " Flt3 + . Dl-FRIL-beads appeared to capture this latter population of cells.
- Dl-FRIL 4"4" cells Cells that retained Dl-FRIL-beads after overnight incubation on a rocker in the cold room (Dl-FRIL 4"4" cells) were observed as single cells or as clumps of bead- bound cells. These clumps could not be disrupted either by mechanical means or by elution with competing sugars, mannose or mannose derivatives (data not shown).
- ⁇ , ⁇ - trehalose demonstrated a 3.6-fold greater potency than mannose and a 1.6- to 2.1- fold greater potency than ⁇ -methyl ⁇ -D-mannoside derivatives that were tested (Mo et al, Glycobiology 9:173-179, 1999).
- Incubation of clumped Dl-FRIL-bead bound cells with 100 mM Trehalose effectively disrupted the clumped cells and removed most of the Dl-FRIL-beads from cells.
- CD117 c-kit CD117 c-kit, progenitors 2 12 j
- FRIL +++ cells in Table 13 was greater than those observed for Dl-FRIL " cells and Dl- FRIL 4"4" cells in Table 12.
- the percentage of CD3, CD13, CD32, and CD33 cells decreased by 1.6- to 3.7-fold in Dl-FRIL +++ cells compared to Dl-FRIL 4"4" cells.
- the percentage of CDllb, CDllc, CD19, CD117, and CD135 cells increased by 1.5- to 6-fold in Dl-FRIL +++ cells compared to Dl-FRIL 4"4" cells.
- CD34 was observed in either cell population.
- Dl-FRIL has neither an extending carbohydrate combining-binding site nor a hydrophobic binding site adjacent to it (Mo et al., Glycobiology 9:173-179, 1999).
- Dl-FRIL binds most tightly to a trimannoysl structure that is the basis for N-linked glycosylation in mammals. Consequently, Dl-FRIL may bind cells that have undergone less processing of glycosylation, which is consistent with more primitive cells. This property of Dl-FRIL-binding may provide a unique method to isolate primitive cells not currently possible by antibodies to CD34.
- Dl-FRIL binds the normally glycosylated FLT3 receptor more tightly than the FLT3-Ligand binds to normally glycosylated FLT3.
- Dl-FRIL binds normally glycosylated FLT3 receptor more tightly than the typical antibody binds its specific ligand.
- the number of cell surface receptors and markers increases as pluripotent hematopoietic stem cells proliferate and differentiate.
- the number of functional receptors on the most primitive cells is probably less than ten.
- the levels of detection for flow cytometry are probably in the range of several hundred cell surface molecules. Consequently, analysis of primitive cell populations cannot be analyzed by flow cytometry.
- the presence or absence of functional tyrosine kinase receptors on primitive cells was further characterized by RT-PCR.
- Expression of Flt3, Kit, Fms, Flkl, Fltl, and Flt4 mRNA was determined for CB mnc, CD34-selected cells, and Dl-FRIL- selected cells.
- CB mnc the PCR products for the receptors were either faint or not detectable.
- the pattern of gene expression for cells selected by CD34-beads or Dl-FRIL-beads was the same; all tyrosine kinase receptors showed stronger PCR signals.
- CD34 ' CD38 " Lin A rare human stem cell population with the phenotype of CD34 ' CD38 " Lin has been identified by its ability to establish multilineage engraftment in NOD/SCID mice (Bhatia et al., Nat. Med. 4:1038-1045, 1998). These repopulating cells give rise to stem cells that express the hallmark CD34 marker. Isolating CD34 " CD38 ' Lin cells is labor-intensive methods of negative selection that includes the use of immunomagnetic beads and flow cytometry to deplete cells that express CD34, CD38, and lineage markers. Rapid, efficient, positive selection of CD34 " CD38 ' Lin cells would be preferable for clinical uses. However, the absence of the highly expressed CD34 marker and low number of functional receptors on this rare population of cells will prevent use of antibodies for cell isolation.
- FRIL attached to magnetic beads are used in a unique method to isolate the rare CD34 " CD38 ' Lin " cell population by binding primitive cells that express this phenotype. Isolation of CD34 " CD38 ' Lin " is achieved by a single-step cell isolation. However, since FRIL-beads also recognize cells that express CDllb, CDllc, and CD38, optimal isolation of CD34 " CD38 ' Lin " cells is improved by first negatively selecting unwanted cells by immunomagnetic beads that bind to CDllb, CDllc, and/or CD38.
- FRIL does not interact with two cell leukemic lines tested with the CD34 + Flt3 + phenotype (KG1-A and ML-1). FRIL neither effects growth of these leukemic cell lines nor do FRIL-beads capture appreciable numbers of cells (data not shown). Since FRIL-beads select normal progenitors with the phenotype of CD34 ' Flt3 + , FRIL- beads provide a unique method that distinguishes between normal and leukemic cells. A FRIL family member attached to magnetic beads is used to isolate normal hematopoietic stem cells and progenitors from the bone marrow and peripheral blood of leukemia patients.
- FRIL-beads binds CD34 Flt3 + normal cells. Since FRIL also interacts with Flt3-expressing CDllb and CDllc cells, prior exposure and removal of the cells that immunomagnetic beads that bind to CDllb and/or CDllc (i.e., negative selection) may permit enrichment of primitive cells.
- FRIL-beads to isolate dendritic progenitors and mature cells from normal individuals
- DC Dendritic cells
- DC are immune cells that capture antigens and initiate T cell- mediated immune responses (Banchereau and Steinman, Nature 392:245-252, 1998).
- DC act as first lines of defense in the skin, gut, and lymphoid organs.
- Antigens on DC can activate na ' ⁇ ve and quiescent T cells and small numbers of DC pulsed with lose dosages of antigens stimulate strong T cell responses. Under certain circumstances, DC also induce T cell tolerance. Consequently, the unique properties of DC has generated significant interest to use these cells to treat cancer and AIDS.
- DC are derived from CD34 4" progenitors in the bone marrow of humans.
- FRIL interacts with the Flt3 receptor on DC, and FRIL-beads capture cells with the dendritic phenotype of CDllb and CDllc. Selecting dendritic cells with FRIL-beads from human bone marrow, peripheral blood, or cord blood allows the efficient and effective isolation of DC for clinical use.
- Endothelial stem cells and progenitors give rise to cells that form blood vessels in a process called angiogenesis. During strokes and heart attacks, new blood vessels are needed to repair damage. Activation of endothelial stem cells and progenitors to produce more mature cells is mediated by the cytokines that activate the Flkl/KDR, Fltl, and Flt4 tyrosine kinase receptors. Flt3 is expressed on very primitive endothelial progenitors. FRIL-beads are used to capture a population of cells from cord blood that express all of these receptors.
- FRIL is used as a targeting vehicle to deliver small molecules to Flt3-expressing cells such as stem cells, progenitors, and dendritic cells.
- FRIL has several advantages for drug delivery: 1) FRIL specific for Flt3; 2) FRIL is stable in the cytoplasm; 3) FRIL is capable of undergoing conjugation with small molecules; 4) FRIL can be delivered in dose-responsive manner; and 5) FRIL provides specificity for overlapping pathways of signal transduction.
- lectins can also delivery small molecule drugs to specific cell populations.
- the lectins PHA and ConA both bind to CD3-T cell receptor complex and the FC-gamma receptor (CD32) (Leca et al. Scand. /. Immunol. 23:535-544, 1986); UDA binds the V ⁇ domain of the T cell receptor (Galelli et al., /. Immunol. 151:1821-1831, 1993).
- Standard methods of conjugation are used to attach small molecules, oligos, or enzymes to plant lectins.
- YamFRIL Purification and Cloning of YamFRIL from Sphenostylis stenocarpa
- Yam bean Sphenostylis stenocarpa
- the powder was extracted with 5 volumes of 10 mM Na Acetate buffer, pH 5.2, containing 1 mM CaCl for 1 hour at 4°C. After centrifugation, the clear supernatant was neutalized with Tris-HCl pH 8.0.
- YamFril purification was achieved through and absorption on a ovalbumin gel affinity column (Sigma) and was eluted with 200 mM trehalose.
- the resulting protein was fractionated into 2 polypeptides that were submitted to N-terminal amino acid sequences.
- Beta band AQSVSFTFTKFDSDQ ( SEQ ID NO : 9 )
- Alpha band AASNNWAVEFDTXPN ( SEQ ID NO : 10 )
- Reverse-transcriptase PCR was performed on total RNA obtained from International Institute of Tropical Agriculture (Ibadan, Oyo State, Nigeria), using degenerate primers based on the alpha and beta N-terminus sequences (i.e., SEQ ID NO: 10 and SEQ ID NO: 9, respectively).
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biochemistry (AREA)
- Toxicology (AREA)
- Botany (AREA)
- Gastroenterology & Hepatology (AREA)
- Hematology (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Diabetes (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Agricultural Chemicals And Associated Chemicals (AREA)
- Peptides Or Proteins (AREA)
- Investigating Or Analysing Biological Materials (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Immobilizing And Processing Of Enzymes And Microorganisms (AREA)
Priority Applications (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP99967798A EP1246919B1 (en) | 1999-12-30 | 1999-12-30 | Progenitor cell preservation factors and related methods and products |
| HK03102128.8A HK1050027B (en) | 1999-12-30 | 1999-12-30 | Progenitor cell preservation factors and related methods and products |
| DE69926920T DE69926920T2 (de) | 1999-12-30 | 1999-12-30 | Konservierungsfaktoren von Vorläuferzellen und damit verbundene Verfahren und Produkte |
| JP2001550379A JP2003521900A (ja) | 1999-12-30 | 1999-12-30 | 前駆細胞保存因子、並びに関連する方法および産物 |
| CN99817102A CN1406280A (zh) | 1999-12-30 | 1999-12-30 | 祖细胞保护因子和相关的方法和产物 |
| ES99967798T ES2249058T3 (es) | 1999-12-30 | 1999-12-30 | Factores de preservacion de celulas progenitoras y metodos y productos relacionados. |
| AT99967798T ATE302848T1 (de) | 1999-12-30 | 1999-12-30 | Stammzellen schutzfaktor und verwandte methoden und produkte |
| CA002395625A CA2395625A1 (en) | 1999-12-30 | 1999-12-30 | Progenitor cell preservation factors and related methods and products |
| AU24014/00A AU784361C (en) | 1999-12-30 | 1999-12-30 | Progenitor cell preservation factors and related methods and products |
| PCT/US1999/031307 WO2001049851A1 (en) | 1999-12-30 | 1999-12-30 | Progenitor cell preservation factors and related methods and products |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PCT/US1999/031307 WO2001049851A1 (en) | 1999-12-30 | 1999-12-30 | Progenitor cell preservation factors and related methods and products |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2001049851A1 true WO2001049851A1 (en) | 2001-07-12 |
Family
ID=22274423
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US1999/031307 Ceased WO2001049851A1 (en) | 1999-12-30 | 1999-12-30 | Progenitor cell preservation factors and related methods and products |
Country Status (10)
| Country | Link |
|---|---|
| EP (1) | EP1246919B1 (https=) |
| JP (1) | JP2003521900A (https=) |
| CN (1) | CN1406280A (https=) |
| AT (1) | ATE302848T1 (https=) |
| AU (1) | AU784361C (https=) |
| CA (1) | CA2395625A1 (https=) |
| DE (1) | DE69926920T2 (https=) |
| ES (1) | ES2249058T3 (https=) |
| HK (1) | HK1050027B (https=) |
| WO (1) | WO2001049851A1 (https=) |
Cited By (20)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1377302A4 (en) * | 2001-02-27 | 2004-04-21 | COMPOSITIONS AND METHODS FOR PROTECTING TISSUES AND CELLS AGAINST LESIONS AND FOR REPAIRING DAMAGED TISSUES | |
| US7112653B2 (en) | 1996-12-09 | 2006-09-26 | Inclone Systems, Incorporated | Composition and method for preserving progenitor cells |
| WO2006110577A3 (en) * | 2005-04-08 | 2007-05-18 | Morningside Venture Invest Ltd | Use of fril proteins for reducing the production of pro-inflammatory cytokines |
| WO2008087257A1 (en) | 2007-01-18 | 2008-07-24 | Suomen Punainen Risti, Veripalvelu | Novel methods and reagents directed to production of cells |
| US7544357B2 (en) | 2001-01-09 | 2009-06-09 | Baylor Research Institute | Methods for treating autoimmune diseases in a subject and in vitro diagnostic assays |
| US11083190B2 (en) | 2007-06-29 | 2021-08-10 | Makoto Funaki | Soft gel systems in modulating stem cell development |
| US11608486B2 (en) | 2015-07-02 | 2023-03-21 | Terumo Bct, Inc. | Cell growth with mechanical stimuli |
| US11613727B2 (en) | 2010-10-08 | 2023-03-28 | Terumo Bct, Inc. | Configurable methods and systems of growing and harvesting cells in a hollow fiber bioreactor system |
| US11624046B2 (en) | 2017-03-31 | 2023-04-11 | Terumo Bct, Inc. | Cell expansion |
| US11629332B2 (en) | 2017-03-31 | 2023-04-18 | Terumo Bct, Inc. | Cell expansion |
| US11634677B2 (en) | 2016-06-07 | 2023-04-25 | Terumo Bct, Inc. | Coating a bioreactor in a cell expansion system |
| US11667876B2 (en) | 2013-11-16 | 2023-06-06 | Terumo Bct, Inc. | Expanding cells in a bioreactor |
| US11667881B2 (en) | 2014-09-26 | 2023-06-06 | Terumo Bct, Inc. | Scheduled feed |
| US11685883B2 (en) | 2016-06-07 | 2023-06-27 | Terumo Bct, Inc. | Methods and systems for coating a cell growth surface |
| US11795432B2 (en) | 2014-03-25 | 2023-10-24 | Terumo Bct, Inc. | Passive replacement of media |
| US11965175B2 (en) | 2016-05-25 | 2024-04-23 | Terumo Bct, Inc. | Cell expansion |
| US12043823B2 (en) | 2021-03-23 | 2024-07-23 | Terumo Bct, Inc. | Cell capture and expansion |
| US12152699B2 (en) | 2022-02-28 | 2024-11-26 | Terumo Bct, Inc. | Multiple-tube pinch valve assembly |
| US12234441B2 (en) | 2017-03-31 | 2025-02-25 | Terumo Bct, Inc. | Cell expansion |
| USD1099116S1 (en) | 2022-09-01 | 2025-10-21 | Terumo Bct, Inc. | Display screen or portion thereof with a graphical user interface for displaying cell culture process steps and measurements of an associated bioreactor device |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1686948A2 (en) * | 2003-11-12 | 2006-08-09 | Morningside Venture Investments Limited | Methods and compositions for the treatment of b cell lymphomas and other cancers |
| JP6247472B2 (ja) * | 2013-08-06 | 2017-12-13 | 日本メナード化粧品株式会社 | 幹細胞の未分化状態維持剤及び増殖促進剤 |
| CN114262683B (zh) * | 2022-03-01 | 2022-06-17 | 中国科学院动物研究所 | 一种表达vegfr3 d2多肽的细菌制剂及其构建方法和应用 |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1997041224A1 (en) * | 1996-04-26 | 1997-11-06 | Amcell Corporation | Human hematopoietic stem and progenitor cell antigen and methods for its use |
| WO1998025457A1 (en) * | 1996-12-09 | 1998-06-18 | Imclone Systems Incorporated | Composition and method for preserving progenitor cells |
| WO1998059038A1 (en) * | 1997-06-24 | 1998-12-30 | Imclone Systems Incorporated | Nucleic acid encoding a lectin-derived progenitor cell preservation factor |
-
1999
- 1999-12-30 DE DE69926920T patent/DE69926920T2/de not_active Expired - Fee Related
- 1999-12-30 JP JP2001550379A patent/JP2003521900A/ja active Pending
- 1999-12-30 AT AT99967798T patent/ATE302848T1/de not_active IP Right Cessation
- 1999-12-30 AU AU24014/00A patent/AU784361C/en not_active Ceased
- 1999-12-30 EP EP99967798A patent/EP1246919B1/en not_active Expired - Lifetime
- 1999-12-30 CA CA002395625A patent/CA2395625A1/en not_active Abandoned
- 1999-12-30 CN CN99817102A patent/CN1406280A/zh active Pending
- 1999-12-30 HK HK03102128.8A patent/HK1050027B/en not_active IP Right Cessation
- 1999-12-30 WO PCT/US1999/031307 patent/WO2001049851A1/en not_active Ceased
- 1999-12-30 ES ES99967798T patent/ES2249058T3/es not_active Expired - Lifetime
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1997041224A1 (en) * | 1996-04-26 | 1997-11-06 | Amcell Corporation | Human hematopoietic stem and progenitor cell antigen and methods for its use |
| WO1998025457A1 (en) * | 1996-12-09 | 1998-06-18 | Imclone Systems Incorporated | Composition and method for preserving progenitor cells |
| WO1998059038A1 (en) * | 1997-06-24 | 1998-12-30 | Imclone Systems Incorporated | Nucleic acid encoding a lectin-derived progenitor cell preservation factor |
Non-Patent Citations (5)
| Title |
|---|
| COLUCCI G. ET AL.: "cDNA cloning of FRIL, a lectin from Dolichos lablab, that preserves hematopoietic progenitors in suspension culture.", PROC. NATL. ACAD. SCI. USA, vol. 96, January 1999 (1999-01-01), pages 646 - 650, XP002145996 * |
| GOWDA L.R. ET AL.: "The complete primary structure of a unique Mannose/Glucose-specific lectin from field bean (Dolichos lab lab)", J. BIOL. CHEM., vol. 269, no. 29, 22 July 1994 (1994-07-22), pages 18789 - 18793, XP002145997 * |
| KEMSHEAD J T: "IMMUNOMAGNETIC MANIPULATION OF HEMATOPOIETIC CELLS: A REVIEW OF CURRENT TECHNOLOGY", INTERNATIONAL CONFERENCE ON METERING APPARATUS AND TARIFFS FOR ELECTRICITY SUPPLY,XX,XX, vol. 1, no. 1, 1992, pages 35 - 44, XP000613792 * |
| LENFANT M ET AL: "INHIBITOR OF HEMATOPOIETIC PLURIPOTENT STEM CELL PROLIFERATION: PURIFICATION AND DETERMINATION OF ITS STRUCTURE", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF USA,US,NATIONAL ACADEMY OF SCIENCE. WASHINGTON, vol. 86, 1 February 1989 (1989-02-01), pages 779 - 782, XP002032459, ISSN: 0027-8424 * |
| MOORE J.G. EZ AL.: "Preservation of hematopoietic progenitors for prolonged periods in suspension cultures by Flk2/flt3 receptor-interacting lectin (FRIL), a new lectin identified in red kidney beans", BLOOD, vol. 90, 15 November 1997 (1997-11-15), pages 428A, XP000938895 * |
Cited By (30)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7112653B2 (en) | 1996-12-09 | 2006-09-26 | Inclone Systems, Incorporated | Composition and method for preserving progenitor cells |
| US7544357B2 (en) | 2001-01-09 | 2009-06-09 | Baylor Research Institute | Methods for treating autoimmune diseases in a subject and in vitro diagnostic assays |
| EP1377302A4 (en) * | 2001-02-27 | 2004-04-21 | COMPOSITIONS AND METHODS FOR PROTECTING TISSUES AND CELLS AGAINST LESIONS AND FOR REPAIRING DAMAGED TISSUES | |
| WO2006110577A3 (en) * | 2005-04-08 | 2007-05-18 | Morningside Venture Invest Ltd | Use of fril proteins for reducing the production of pro-inflammatory cytokines |
| WO2008087257A1 (en) | 2007-01-18 | 2008-07-24 | Suomen Punainen Risti, Veripalvelu | Novel methods and reagents directed to production of cells |
| US11083190B2 (en) | 2007-06-29 | 2021-08-10 | Makoto Funaki | Soft gel systems in modulating stem cell development |
| US11773363B2 (en) | 2010-10-08 | 2023-10-03 | Terumo Bct, Inc. | Configurable methods and systems of growing and harvesting cells in a hollow fiber bioreactor system |
| US11613727B2 (en) | 2010-10-08 | 2023-03-28 | Terumo Bct, Inc. | Configurable methods and systems of growing and harvesting cells in a hollow fiber bioreactor system |
| US11746319B2 (en) | 2010-10-08 | 2023-09-05 | Terumo Bct, Inc. | Customizable methods and systems of growing and harvesting cells in a hollow fiber bioreactor system |
| US11708554B2 (en) | 2013-11-16 | 2023-07-25 | Terumo Bct, Inc. | Expanding cells in a bioreactor |
| US11667876B2 (en) | 2013-11-16 | 2023-06-06 | Terumo Bct, Inc. | Expanding cells in a bioreactor |
| US11795432B2 (en) | 2014-03-25 | 2023-10-24 | Terumo Bct, Inc. | Passive replacement of media |
| US11667881B2 (en) | 2014-09-26 | 2023-06-06 | Terumo Bct, Inc. | Scheduled feed |
| US12065637B2 (en) | 2014-09-26 | 2024-08-20 | Terumo Bct, Inc. | Scheduled feed |
| US11608486B2 (en) | 2015-07-02 | 2023-03-21 | Terumo Bct, Inc. | Cell growth with mechanical stimuli |
| US11965175B2 (en) | 2016-05-25 | 2024-04-23 | Terumo Bct, Inc. | Cell expansion |
| US11634677B2 (en) | 2016-06-07 | 2023-04-25 | Terumo Bct, Inc. | Coating a bioreactor in a cell expansion system |
| US11685883B2 (en) | 2016-06-07 | 2023-06-27 | Terumo Bct, Inc. | Methods and systems for coating a cell growth surface |
| US11999929B2 (en) | 2016-06-07 | 2024-06-04 | Terumo Bct, Inc. | Methods and systems for coating a cell growth surface |
| US12077739B2 (en) | 2016-06-07 | 2024-09-03 | Terumo Bct, Inc. | Coating a bioreactor in a cell expansion system |
| US11702634B2 (en) | 2017-03-31 | 2023-07-18 | Terumo Bct, Inc. | Expanding cells in a bioreactor |
| US11629332B2 (en) | 2017-03-31 | 2023-04-18 | Terumo Bct, Inc. | Cell expansion |
| US11624046B2 (en) | 2017-03-31 | 2023-04-11 | Terumo Bct, Inc. | Cell expansion |
| US12234441B2 (en) | 2017-03-31 | 2025-02-25 | Terumo Bct, Inc. | Cell expansion |
| US12359170B2 (en) | 2017-03-31 | 2025-07-15 | Terumo Bct, Inc. | Expanding cells in a bioreactor |
| US12570960B2 (en) | 2017-03-31 | 2026-03-10 | Terumo Bct, Inc. | Expanding cells in a bioreactor |
| US12043823B2 (en) | 2021-03-23 | 2024-07-23 | Terumo Bct, Inc. | Cell capture and expansion |
| US12152699B2 (en) | 2022-02-28 | 2024-11-26 | Terumo Bct, Inc. | Multiple-tube pinch valve assembly |
| US12209689B2 (en) | 2022-02-28 | 2025-01-28 | Terumo Kabushiki Kaisha | Multiple-tube pinch valve assembly |
| USD1099116S1 (en) | 2022-09-01 | 2025-10-21 | Terumo Bct, Inc. | Display screen or portion thereof with a graphical user interface for displaying cell culture process steps and measurements of an associated bioreactor device |
Also Published As
| Publication number | Publication date |
|---|---|
| CN1406280A (zh) | 2003-03-26 |
| JP2003521900A (ja) | 2003-07-22 |
| EP1246919A1 (en) | 2002-10-09 |
| ES2249058T3 (es) | 2006-03-16 |
| AU784361C (en) | 2007-03-15 |
| HK1050027B (en) | 2006-04-13 |
| ATE302848T1 (de) | 2005-09-15 |
| AU784361B2 (en) | 2006-03-16 |
| AU2401400A (en) | 2001-07-16 |
| DE69926920D1 (de) | 2005-09-29 |
| DE69926920T2 (de) | 2006-06-29 |
| HK1050027A1 (en) | 2003-06-06 |
| CA2395625A1 (en) | 2001-07-12 |
| EP1246919B1 (en) | 2005-08-24 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU784361C (en) | Progenitor cell preservation factors and related methods and products | |
| US6310195B1 (en) | Nucleic acid encoding a lectin-derived progenitor cell preservation factor | |
| US6280724B1 (en) | Composition and method for preserving progenitor cells | |
| US20040067583A1 (en) | Methods for immortalizing cells | |
| JP2021088608A (ja) | 造血コンパートメントの再構築及び自家再構築の増進 | |
| Caux et al. | Sequential loss of CD34 and class II MHC antigens on purified cord blood hematopoietic progenitors cultured with IL-3: characterization of CD34-, HLA-DR+ cells | |
| JP2022088551A (ja) | 増殖造血幹細胞/前駆細胞集団の利用 | |
| AU693032B2 (en) | Methods for increasing hematopoietic cells | |
| US6991794B1 (en) | Progenitor cell preservation factors and methods for and products of their use | |
| EP1584686A1 (en) | Progenitor cell preservation factors and related methods and products | |
| HK1084413A (en) | Progenitor cell preservation factors and related methods and products | |
| US20020132017A1 (en) | Composition and method for preserving progenitor cells | |
| JP5500773B2 (ja) | 副甲状腺ホルモン受容体の活性化並びに幹細胞及び前駆細胞の増殖 | |
| CN114174328B (zh) | Gaba激动剂和拮抗剂影响造血干细胞和巨核系祖细胞的分化 | |
| DE DK et al. | NUKLEINSÄURE, WELCHE EINEN VON LEKTIN ABSTAMMENDEN FAKTOR ZUR PRÄSERVIERUNG VON PROGENITORZELLEN KODIERT ACIDE NUCLEIQUE CODANT UN FACTEUR DE CONSERVATION DE CELLULES PROGENITRICES DERIVE DE LA LECTINE | |
| CA2582216A1 (en) | Method for ex-vivo purging in autologous transplantation | |
| Sharkis | STEM CELL PLASTICITY: WILL IT BE USEFUL TO REPAIR INJURY? | |
| HK1219051B (zh) | 增殖骨髓细胞群体的方法及其应用 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AK | Designated states |
Kind code of ref document: A1 Designated state(s): AE AL AM AT AU AZ BA BB BG BR BY CA CH CN CU CZ DE DK EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT UA UG UZ VN YU ZA ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A1 Designated state(s): GH GM KE LS MW SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 2395625 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref country code: JP Ref document number: 2001 550379 Kind code of ref document: A Format of ref document f/p: F |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 24014/00 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1999967798 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 998171026 Country of ref document: CN |
|
| WWP | Wipo information: published in national office |
Ref document number: 1999967798 Country of ref document: EP |
|
| REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |
|
| WWG | Wipo information: grant in national office |
Ref document number: 1999967798 Country of ref document: EP |
|
| WWG | Wipo information: grant in national office |
Ref document number: 24014/00 Country of ref document: AU |