WO1999051188A2 - A polypeptide comprising the amino acid of an n-terminal choline binding protein a truncate, vaccine derived therefrom and uses thereof - Google Patents
A polypeptide comprising the amino acid of an n-terminal choline binding protein a truncate, vaccine derived therefrom and uses thereof Download PDFInfo
- Publication number
- WO1999051188A2 WO1999051188A2 PCT/US1999/007669 US9907669W WO9951188A2 WO 1999051188 A2 WO1999051188 A2 WO 1999051188A2 US 9907669 W US9907669 W US 9907669W WO 9951188 A2 WO9951188 A2 WO 9951188A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- polypeptide
- amino acid
- acid sequence
- nucleic acid
- set forth
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/315—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Streptococcus (G), e.g. Enterococci
- C07K14/3156—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Streptococcus (G), e.g. Enterococci from Streptococcus pneumoniae (Pneumococcus)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
Definitions
- the present invention relates generally to a polypeptide of a N-terminal choline binding protein A truncate.
- the invention also relates to vaccines which provide protection or elicit protective antibodies to bacterial infection, specifically pneumococcus, and to antibodies and antagonists against such polypeptide for use in diagnosis and passive immune therapy.
- the polypeptide and/or the nucleic acid encoding the polypeptide are also useful as a competitive inhibitor of bacterial adhesin of pneumococcus.
- this invention is directed to therapeutics using the polypeptide.
- Streptococcus pneumoniae is a gram positive bacteria which is a major cause of invasive infections such as sepsis, meningitis, otitis media and lobar pneumonia (Tuomanen et al NEJM 322:1280-1284, 1995).
- Pneumococci bind avidly to cells of the upper and lower respiratory tract. Like most bacteria, adherence of pneumococci to human cells is achieved by presentation of bacterial surface proteins that bind to eukaryotic carbohydrates in a lectin-like fashion (Cundell, D. & Tuomanen, E. (1994) Microb Pathog 17:361-374).
- Pneumococci bind to non-inflamed epithelium, a process that can be viewed as asymptomatic carriage. It has been proposed that the conversion to invasive disease involves the local generation of inflammatory factors which, activating the human cell, change the number and type of receptors available on the human cells (Cundell, D. et al. (1995) Nature, 377:435-438). Presented with an opportunity in this new setting, pneumococci appear to take advantage and engage one of these unregulated receptors, the platelet activating factor (PAF) receptor (Cundell et al. (1995) Nature, 377:435-438. Within minutes of the appearance of the PAF receptor, pneumococci undergo waves of enhanced adherence and invasion.
- PAF platelet activating factor
- Inhibition of bacterial binding to activated cells blocks the progression to disease in animal models (Idanpaan-Heikkila, I. et al. (1997) J. Infect. Dis., 176:704-712).
- Particularly effective in this regard are soluble carbohydrates containing lacto-N- neotetraose with or without an additional sialic acid which prevent pneumococcal attachment to human cells in vitro and prevent colonization in the lung in vivo.
- Pneumococci produce a family of surface proteins capable of binding to the bacterial surface by non-covalent association to the cell wall teichoic acid or lipoteichoic acid.
- the surface of Streptococcus pneumoniae is decorated with a family of CBPs (Choline Binding Proteins) that are non-covalently bound to the phosphorylcholine.
- CBPs Choline Binding Proteins
- CbpA is an 75 kD surface-exposed choline binding protein that shows a chimeric architecture. There is a unique N-terminal domain a proline rich region followed by a C-terminal domain comprised of 10 repeated region responsible for binding to choline.
- CbpA is an adhesin (ligand) for the glycoconjugate containing receptors present on the surface of eucaryotic cells. Mutants with defects in cbpA showed reduced virulence in the infant rat model for nasopharyngeal colonization. This binding is directed to choline determinants which decorate the teichoic acid and is mediated by a signature choline binding domain in each of the members of this family of proteins. The choline binding domain was discovered and fully characterized by Lopez et al. in his studies of the autolytic enzyme (Ronda et al. (1987) Eur. J. Biochem, 164:621-624).
- PspA pneumococcal surface protein A
- CbpA fails to colonize the nasopharynx domain which is shared with its other family members C terminus) but its activity of binding to human cells arises from its unique N- terminal domain.
- the present invention provides an isolated polypeptide comprising an amino acid sequence of a N-terminal choline binding protein A truncate.
- the polypeptide comprises the amino acid sequence as set forth in SEQ ID NOS 1, 3- 7, or 9-11, including fragments, mutants, variants, analogs, or derivatives, thereof.
- this invention provides an isolated polypeptide comprising an amino acid sequence of a N-terminal choline binding protein A truncate having the amino acid as set forth in SEQ ID NO 24, wherein the polypeptide exhibits its tertiary structure and methods of preparation such a polypeptide.
- the isolated polypeptide are suitable for use in immunizing animals and humans against bacterial infection, preferably pneumococci.
- the present invention extends to an N-terminal choline binding protein A truncate having lectin activity and no choline binding activity. Still further, this invention provides an immunogenic N-terminal choline binding protein A truncate or a fragment thereof.
- the present invention also relates to isolated nucleic acids, such as recombinant DNA molecules or cloned genes, or degenerate variants thereof, mutants, analogs, or fragments thereof, which encode the isolated polypeptide or which competitively inhibit the activity of the polypeptide.
- the isolated nucleic acids which includes degenerates, variants, mutants, analogs, or fragments thereof, has a sequence as set forth in SEQ ID NOS: 12, 14-17, 19-22 or 23.
- the full DNA sequence of the recombinant DNA molecule or cloned gene so determined may be operatively linked to an expression control sequence which may be introduced into an appropriate host.
- the invention accordingly extends to unicellular hosts transformed with the cloned gene or recombinant DNA molecule comprising a DNA sequence encoding the present invention, and more particularly, the DNA sequences or fragments thereof determined from the sequences set forth above.
- Antibodies against the isolated polypeptide include naturally raised and recombinantly prepared antibodies. These may include both polyclonal and monoclonal antibodies prepared by known genetic techniques, as well as bi-specific (chimeric) antibodies, and antibodies including other functionalities suiting them for diagnostic use conjunctive with their capability of modulating bacterial adherence including but not limited to acting as competitive agents.
- This invention provides pharmaceutical compositions for use in therapeutic methods which comprise or are based upon the isolated polypeptides, their subunits or their binding partners.
- this invention provides pharmaceutical compositions, vaccines, and diagnostic and therapeutic methods of use thereof.
- FIGURE 1 Schematic representation of choline binding protein A (CbpA) and recombinant truncates RI (from about amino acid 16 to amino acid 321 from the N-terminus of CbpA as set forth in Figure 2) and R2 (from about amino acid 16 to amino acid 444 from the N-terminus of CbpA as set forth in Figure 2).
- CbpA choline binding protein A
- RI from about amino acid 16 to amino acid 321 from the N-terminus of CbpA as set forth in Figure 2
- R2 from about amino acid 16 to amino acid 444 from the N-terminus of CbpA as set forth in Figure 2.
- Domain A is from about amino acid 153 to amino acid 321 from the N-terminus of CbpA amino acid sequence as set forth in Figure 2 ;
- domain B is from about amino acid 270 to amino acid 326 from the N-terminus of CbpA amino acid sequence as set forth in Figure 2); and
- C is from about amino acid 327 to amino acid 433 from the N- terminus of CbpA amino acid sequence as set forth in Figure 2.
- FIGURES 2A-B are identical to FIGURES 2A-B.
- FIGURE 3 Expression and purification of recombinant RI and R2.
- FIGURE 4 Results of passive protection in mice. Immune sera against recombinant R2 protected mice from lethal S. pneumoniae challenge.
- FIGURE 5 Titration of anti-R2 antibody on R6x adhering to LNnT-HSA coated plates.
- FIGURE 6 Titration of anti-Cbp-A and absorbed anti-CbpA antibodies for activity blocking pneumococcal adherence to LNnT-HSA coated plates.
- FIGURE 7 Results of active protection in mice. Immune sera against recombinant RI protected mice from lethal S. pneumoniae challenge (challenge 560 cfu serotype 6B).
- the present invention is directed to an isolated polypeptide comprising an amino acid sequence of a N-terminal choline binding protein A truncate.
- the polypeptides are suitable for use in immunizing animals against pneumococcal infection. These polypeptide or peptide fragments thereof, when formulated with an appropriate adjuvant, are used in vaccines for protection against pneumococci, and against other bacteria with cross-reactive proteins.
- polypeptide comprising an amino acid sequence of a N-terminal choline binding protein A truncate.
- polypeptide has the amino acid sequence as set forth in any of SEQ ID NO 1, 3-5, 7, or 9-11 , including fragments, mutants, variants, analogs, or derivatives, thereof.
- polypeptide has the amino acid KXXE (SEQ ID NO 6).
- This invention provides an isolated polypeptide comprising an amino acid sequence of a N-terminal choline binding protein A truncate as set forth in Figure 2.
- the polypeptide has an amino acid sequence which is a conserved region as set forth in Figure 2.
- conserved regions include but are not limited to amino acid sequence 158 to 210; 158 to 172; 300 to 321; 331 to 339; 355 to 365; 367 to 374; 379 to 389; 409 to 427; and 430 to 447.
- Figure 2 sets forth homologies of various serotypes of the nucleic acid and amino acid sequence of the N-terminal region of CbpA which are contemplated by this invention.
- this invention provides an isolated polypeptide comprising an amino acid sequence of a N-terminal choline binding protein A truncate having the amino acid as set forth in SEQ LD NO 24, wherein the polypeptide exhibits its tertiary structure.
- the polypeptide is an analog, fragment, mutant, or variant thereof.
- Variants contemplated are set forth in Figure 2.
- This invention also provides an isolated polypeptide comprising an amino acid sequence of a N-terminal choline binding protein A truncate having the amino acid from about position 16 to about position 475 of serotype 4 as set forth in Figure 2 or a corresponding amino acid of serotype 4 as shown in Figure 2 , wherein the polypeptide exhibits its tertiary structure.
- tertiary structure corresponds to that present in the native protein.
- Methods of preparation of the polypeptide are for example as follows: cleaving a full length choline binding protein A with hydroxylamine, wherein the hydroxylamine cleaves the choline binding protein A at amino acid Asparagine (N) at position 475 of serotype R6x and serotype 4, or the corresponding amino acid of serotype R6x or serotype 4 in a different serotype as shown in Figure 2, thereby creating the N-terminal choline binding protein A truncate.
- Alternative methods which create a truncated choline binding protein A or fragment thereof, and retain the native tertiary structure (i.e.
- the full length choline binding protein A are contemplated and known to those skilled in the art. Because the polypeptide retains its tertiary structure, the isolated polypeptide is suitable for use as an immunogen in immunizing animals and humans against bacterial infection, preferably pneumococci.
- the polypeptide comprising the amino acid sequence of choline binding protein A (CbpA) serotype type 4 is as follows: ENEGATQVPTSSNRANESQAEQGEQPKKLDSERDKARKEVEEYVKK ⁇ VGESY AKSTKKRHTITVALVNELNNIKNEYLNKIVESTSESQLQILMMESRSKVDEAV SKFEKDSSSSSSSSSDSSTKPEASDTAKPNKPTEPGEKVAEAJQ KVEEAEKKAKD QKEEDRR ⁇ PTITYKTLELEIAESDVEVKKAELELVKVKANEPRDEQKIKQAE AEVESKQAEATRLKKIKTDREEAEEEAKRRADAKEQGKPKGRAKRGVPGEL ATPDKKENDAKSSDSSVGEETLPSPSLKPEKKVAEAEKKVEEAKKKAEDQKE EDRRNYPTNTYKTLELEIAESDVEVKKAELELVKEEAKEPRNEEKVKQAKAE VESKKAEATRLEKIKTDR
- Polypeptide R2 means a polypeptide comprising the amino acid sequences from position 16 to position 444 of the N-terminal truncate of choline binding protein A (CbpA) serotype type 4 (see Figure 1) which has the following sequence : ENEGATQVPTSSNRANESQAEQGEQPKKLDSERDKARKEVEEYVKKIVGESY AKSTKKRHTITVALVNELNNIKNEYLNKIVESTSESQLQILMMESRSKVDEAV SKFEKDSSSSSSSSSDSSTKPEASDTAKPNKPTEPGEKVAEAKKKVEEAEKKAKD QKEEDRRNYPTITYKTLELEIAESDVEVKKAELELVKVKANEPRDEQKIKQAE AEVESKQAEATRLKKIKTDREEAEEEAXRRADAKEQGKPKGRAKRGVPGEL ATPDKKENDAKSSDSSVGEETLPSPSLKPEKKVAEAEKKVEEAKKKAEDQKE EDRRNYPTNTYKTL
- the DNA sequence which encodes polypeptide RI is:
- Polypeptide C/R2 means a polypeptide comprising a repeat region C within R2, wherein the repeat region C has the amino acid sequences from position 327 to position 433 of the N-terminal choline binding protein A (CbpA) serotype type 4 which has the following sequence: KPEKKVAEAEKKVEEAKKKAEDQKEEDRRNYPTNTYKTLELEIAESDVEVK KAELELVKEEAKEPRNEEKVKQAKAEVESKKAEATRLEKIKTDRKKAEEEAK RKA (SEQ ID NO 4).
- Polypeptide A/R2 means a polypeptide comprising a repeat region A within R2, wherein the repeat region A has the amino acid sequences from position 153 to position 269 of the N-terminal of choline binding protein A (CbpA) serotype type 4 which has the following sequence:
- region A of polypeptide R2 is the same region A as within RI .
- the DNA sequence which encodes the polypeptide A/R2 is:
- amino acid residues may be changed or modified to include variants such as, for example, deletions containing less than all of the residues specified for the protein, substitutions wherein one or more residues specified are replaced by other residues and additions wherein one or more amino acid residues are added to a terminal or medial portion of the polypeptide (see Figure 2).
- variants such as, for example, deletions containing less than all of the residues specified for the protein, substitutions wherein one or more residues specified are replaced by other residues and additions wherein one or more amino acid residues are added to a terminal or medial portion of the polypeptide (see Figure 2).
- These molecules include: the incorporation of codons "preferred" for expression by selected non- mammalian hosts; the provision of sites for cleavage by restriction endonuclease enzymes; and the provision of additional initial, terminal or intermediate DNA sequences that facilitate construction of readily expressed vectors.
- examples of the amino acid substitutions of serotype 4 are as follows: E at position 154 is substituted with K; P at position 155 is substituted with L; G at position 156 is substituted with E; E at position 157 is substituted with K; K at position 181 is substituted with E; D at position 182 is substituted with A; R at position 187 is substituted with Y, H, or L; I at position 194 is substituted with N; E at position 200 is substituted with D; E at position 202 is substituted with D; E at position 209 is substituted with K; K at position 212 is substituted with E; V at position 218 is substituted with L; V at position 220 is substituted with K or E; K at position 221 is substituted with E; N at position 223 is substituted with D or K; P at position 225 is substituted with S, T, or R; D at position 227 is substituted with N; E at position 228 is substituted with K; Q at position 229 is substituted with S, T, or R
- Polypeptide R2 serotype - R6x means an polypeptide comprising the amino acid sequences from position 16 to position 444 of the N-terminal truncate of Choline Binding Protein A (CbpA) serotype R6x which has the following sequence: ENEGSTQAATSSNMAKTEHRKAAKQVVDEYIEKMLREIQLDRRKHTQNVAL NIKLSAIKTKYLRELNVLEEKSKDELPSEIKAKLDAAFEKFKKDTLKPGEKVA EAKKKVEEAKKKAEDQKEEDRRNYPTNTYKTLELEIAEFDVKVKEAELELVK EEAKESRNEGTIKQAKEKVESKKAEATRLEMKTDRKKAEEEAKRKADAKLK EANVATSDQGKPKGRAKRGVPGELATPDKKENDAKSSDSSVGEETLPSSSLK SGKKVAEAEKKVEEAEKKAKDQKEEDRRNYPTNTYKTLDLEIAESDVKVKE AELELV
- Polypeptide RI Serotype R6x means an polypeptide comprising the amino acid sequences from position 16 to position 321 of the N-terminal truncate/truncate of choline binding protein A (CbpA) serotype R6x which has the following sequence : ENEGSTQAATSSNMAKTEHRKAAKQVVDEYIEKMLREIQLDRRKHTQNVAL NIKLSAIKTKYLRELNVLEEKSKDELPSEIKAKLDAAFEKFKKDTLKPGEKVA EAKKKVEEAKKKAEDQKEEDRRNYPTNTYKTLELEIAEFDVKVKEAELELVK EEAKESRNEGTIKQAKEKVESKKAEATRLENIKTDRKKAEEEAKRKADAKLK EANVATSDQGKPKGRAKRGVPGELATPDKKENDAKSSDSSVGEETL (SEQ ID NO 9).
- the DNA sequence which encodes polypeptide RI is:
- Polypeptide C/R2 serotype R6x means an polypeptide comprising a repeat region C within R2 (see Figure 2), wherein the repeat region C has the amino acid sequences from position 327 to position 433 of the N-terminal of choline binding protein A (CbpA) serotype R6x which has the following sequence:
- Polypeptide A/R2 serotype R6x means an polypeptide comprising a repeat region A within R2 (see Figure 2), wherein the repeat region A has the amino acid sequences from position 155 to position 265 of the N-terminal of choline binding protein A (CbpA) serotype R6X which has the following sequence: PGEKVAEAKKKVEEAKKKAEDQKEEDRRNYPTNTYKTLELEIAEFDVKVKE AELELVKEEAKESRNEGTIKQAKEKVESKKAEATRLENIKTDRKKAEEEAKR KADA (SEQ LD NO l l)
- the DNA sequence which encodes the polypeptide A/R2 serotype R6x is: CC AGGAGAAAAGGTAGC AGAAGCTAAGAAGAAGGTTGAAGAAGCTAAGA AAAAAGCCGAGGATCAAAAAGAAGAAGATCGTCGTAACTACCCAACCAA TACTTACAAAACGCTTGAACTTGAAATTGCTGAGTTCGATGTGAAAGTTA AAGAAGCGGAGCTTGAACTAGTAAAAGAGGAAGCTAAAGAAtCTCGAAAC GAGGGCACAATTAAGCAAGCAAAAGAGAAAGTTGAGAGTAAAAAAGCTG AGGCTAC AAGGTTAGAAAACAtCAAGACAGATCGTAAAAAAAAAAGAAAAAAAAAAAAAGCTG AGGCTAC AAGGTTAGAAAACAtCAAGACAGATCGTAAAAAAGCAGAAGA AGAAGCTAAACGAAAAGCAGATGCT (SEQ ID NO 21).
- This invention is directed to an isolated polypeptide, wherein the isolated polypeptide consists of the amino acid sequence as set forth in SEQ ID NOS 22 or 23, including fragments, mutants, variants, or analogs, or derivatives, thereof.
- Polypeptide B/R2 means a polypeptide comprising the amino acid sequences from position 270 to position 326 of the N-terminal truncate of choline binding protein A (CbpA) serotype type 4 as set forth in Figure 2.
- Polypeptide B/R2 serotype - R6x means an polypeptide comprising the amino acid sequences from position 264 to position 326 of the N-terminal truncate of Choline Binding Protein A (CbpA) serotype R6x as set forth in Figure 2.
- This invention contemplates a polypeptide having the amino acid sequence of regions A, B, C, A+B, B+C, A+C as shown in Figure 1.
- this invention provides an isolated polypeptide comprising an amino acid sequence of a N-terminal choline binding protein A truncate, wherein the polypeptide has the amino acid KXXE (SEQ ID NO 6).
- This invention is directed to a polypeptide comprising an amino acid sequence of a N- terminal choline binding protein A truncate, wherein the amino acid sequence is set forth in Figure 2.
- the polypeptide has an amino acid sequence which is a conserved region as set forth in Figure 2.
- conserved regions include but are not limited to amino acid sequence 158 to 172; 300 to 321; 331 to 339; 355 to 365; 367 to 374; 379 to 389; 409 to 427; and 430 to 447
- Figure 2 sets forth homologies of various serotypes of the nucleic acid and amino acid sequence of the N-terminal region of CbpA which are contemplated by this invention.
- This invention provides an isolated polypeptide comprising an amino acid sequence of a N-terminal choline binding protein A truncate, wherein the polypeptide has lectin activity and does not bind to choline.
- the polypeptide has the amino acid sequence as set forth in any of SEQ ID NO 1, 3-5, 7, or 9-11 including fragments, mutants, variants, analogs, or derivatives, thereof.
- a polypeptide having a lectin activity means a polypeptide, peptide or protein which binds noncovalently to a carbohydrate.
- adheresin means noncovalent binding of a bacteria to a human cell or secretion that is stable enough to withstand washing.
- binds to the LNnT means binds to Lacto-N-neotetraose coated substrates more than albumin-control.
- This invention provides an isolated immunogenic polypeptide comprising an amino acid sequence of an N-terminal choline binding protein A truncate. It is contemplated by this invention that the immunogenic polypeptide has the amino acid sequence as set forth in any of SEQ ID NOS 1, 3-7, or 9-11, including fragments, mutants, variants, analogs, or derivatives, thereof.
- This invention provides an isolated polypeptide comprising an amino acid sequence of a N-terminal choline binding protein A truncate as set forth in Figure 2. In one embodiment, the polypeptide has an amino acid sequence which is a conserved region as set forth in Figure 2.
- This invention is directed to analogs of the polypeptide which comprise the amino acid sequence as set forth above.
- the analog polypeptide may have an N-terminal methionine or an N-terminal polyhistidine optionally attached to the N or COOH terminus of the polypeptide which comprise the amino acid sequence.
- this invention contemplates peptide fragments of the polypeptide which result from proteolytic digestion products of the polypeptide.
- the derivative of the polypeptide has one or more chemical moieties attached thereto.
- the chemical moiety is a water soluble polymer.
- the chemical moiety is polyethylene glycol.
- the chemical moiety is mon-, di-, tri- or tetrapegylated.
- the chemical moiety is N-terminal monopegylated.
- PEG polyethylene glycol
- Attachment of polyethylene glycol (PEG) to compounds is particularly useful because PEG has very low toxicity in mammals (Carpenter et al., 1971).
- PEG adduct of adenosine deaminase was approved in the United States for use in humans for the treatment of severe combined immunodeficiency syndrome.
- a second advantage afforded by the conjugation of PEG is that of effectively reducing the immunogenicty and antigenicity of heterologous compounds.
- a PEG adduct of a human protein might be useful for the treatment of disease in other mammalian species without the risk of triggering a severe immune response.
- the compound of the present invention may be delivered in a microencapsulation device so as to reduce or prevent an host immune response against the compound or against cells which may produce the compound.
- the compound of the present invention may also be delivered microencapsulated in a membrane, such as a liposome.
- PEG reagents for reaction with protein amino groups include active esters of carboxylic acid or carbonate derivatives, particularly those in which the leaving groups are N-hydroxysuccinimide, p-nitrophenol, imidazole or l-hydroxy-2- nitrobenzene-4-sulfonate.
- PEG derivatives containing maleimido or haloacetyl groups are useful reagents for the modification of protein free sulfhydryl groups.
- PEG reagents containing amino hydrazine or hydrazide groups are useful for reaction with aldehydes generated by periodate oxidation of carbohydrate groups in proteins.
- amino acid residues of the polypeptide described herein are preferred to be in the "L" isomeric form.
- residues in the "D" isomeric form can be substituted for any L-amino acid residue, as long as the desired functional property of lectin activity is retained by the polypeptide.
- NH 2 refers to the free amino group present at the amino terminus of a polypeptide.
- COOH refers to the free carboxy group present at the carboxy terminus of a polypeptide.
- Abbreviations used herein are in keeping with standard polypeptide nomenclature, J. Biol. Chem., 243:3552- 59 (1969).
- amino-acid residue sequences are represented herein by formulae whose left and right orientation is in the conventional direction of amino- terminus to carboxy-terminus. Furthermore, it should be noted that a dash at the beginning or end of an amino acid residue sequence indicates a peptide bond to a further sequence of one or more amino-acid residues.
- Synthetic polypeptide prepared using the well known techniques of solid phase, liquid phase, or peptide condensation techniques, or any combination thereof, can include natural and unnatural amino acids.
- Amino acids used for peptide synthesis may be standard Boc (N ⁇ -amino protected N ⁇ -t-butyloxycarbonyl) amino acid resin with the standard deprotecting, neutralization, coupling and wash protocols of the original solid phase procedure of Merrifield (1963, J. Am. Chem. Soc. 85:2149-2154), or the base- labile N ⁇ -amino protected 9-fluorenylmethoxycarbonyl (Fmoc) amino acids first described by Carpino and Han (1972, J. Org. Chem. 37:3403-3409).
- polypeptide of the invention may comprise D-amino acids, a combination of D- and L-amino acids, and various "designer" amino acids (e.g., ⁇ -methyl amino acids, C -methyl amino acids, and N ⁇ -methyl amino acids, etc.) to convey special properties.
- Synthetic amino acids include ornithine for lysine, fluorophenylalanine for phenylalanine, and norleucine for leucine or isoleucine. Additionally, by assigning specific amino acids at specific coupling steps, ⁇ -helices, ⁇ turns, ⁇ sheets, ⁇ -turns, and cyclic peptides can be generated.
- the peptides may comprise a special amino acid at the C- terminus which incorporates either a CO 2 H or CONH 2 side chain to simulate a free glycine or a glycine-amide group. Another way to consider this special residue would be as a D or L amino acid analog with a side chain consisting of the linker or bond to the bead.
- the pseudo-free C-terminal residue may be of the D or the L optical configuration; in another embodiment, a racemic mixture of D and L-isomers may be used.
- pyroglutamate may be included as the N-terminal residue of the peptide.
- pyroglutamate is not amenable to sequence by Edman degradation, by limiting substitution to only 50% of the peptides on a given bead with N-terminal pyroglutamate, there will remain enough non-pyroglutamate peptide on the bead for sequencing.
- this technique could be used for sequencing of any peptide that incorporates a residue resistant to Edman degradation at the N-terminus. Other methods to characterize individual peptides that demonstrate desired activity are described in detail infra.
- peptides that have more well defined structural properties, and the use of peptidomimetics, and peptidomimetic bonds, such as ester bonds, to prepare peptides with novel properties.
- a peptide may be generated that incorporates a reduced peptide bond, i.e., R r CH 2 -NH- R 2 , where R, and R 2 are amino acid residues or sequences.
- a reduced peptide bond may be introduced as a dipeptide subunit.
- Such a molecule would be resistant to peptide bond hydrolysis, e.g., protease activity.
- Such peptides would provide ligands with unique function and activity, such as extended half-lives in vivo due to resistance to metabolic breakdown, or protease activity. Furthermore, it is well known that in certain systems constrained peptides show enhanced functional activity (Hruby, 1982, Life Sciences 31:189-199; Hruby et al., 1990, Biochem J. 268:249-262); the present invention provides a method to produce a constrained peptide that incorporates random sequences at all other positions.
- a constrained, cyclic or rigidized peptide may be prepared synthetically, provided that in at least two positions in the sequence of the peptide an amino acid or amino acid analog is inserted that provides a chemical functional group capable of cross-linking to constrain, cyclise or rigidize the peptide after treatment to form the cross-link. Cyclization will be favored when a turn-inducing amino acid is incorporated.
- Examples of amino acids capable of cross-linking a peptide are cysteine to form disulfide, aspartic acid to form a lactone or a lactase, and a chelator such as ⁇ -carboxyl-glutamic acid (Gla) (Bachem) to chelate a transition metal and form a cross-link.
- Protected ⁇ -carboxyl glutamic acid may be prepared by modifying the synthesis described by Zee-Cheng and Olson (1980, Biophys. Biochem. Res. Commun. 94:1128-1132).
- a peptide in which the peptide sequence comprises at least two amino acids capable of cross-linking may be treated, e.g., by oxidation of cysteine residues to form a disulfide or addition of a metal ion to form a chelate, so as to cross-link the peptide and form a constrained, cyclic or rigidized peptide.
- the present invention provides strategies to systematically prepare cross-links.
- cysteine residues are incorporated in the peptide sequence
- different protecting groups may be used (Hiskey, 1981, in The Peptides: Analysis, Synthesis, Biology, Vol. 3, Gross and Meienhofer, eds., Academic Press: New York, pp. 137-167; Ponsanti et al., 1990, Tetrahedron 46:8255-8266).
- the first pair of cysteine may be deprotected and oxidized, then the second set may be deprotected and oxidized. In this way a defined set of disulfide cross-links may be formed.
- a pair of cysteine and a pair of collating amino acid analogs may be incorporated so that the cross- links are of a different chemical nature.
- non-classical amino acids may be incorporated in the peptide in order to introduce particular conformational motifs: 1 ,2,3,4-tetrahydroisoquinoline-3-carboxylate (Kazmierski et al., 1991, J. Am. Chem. Soc.
- LL-Acp LL-3-amino- 2-propenidone-6-carboxylic acid
- ⁇ -turn inducing dipeptide analog Kemp et al., 1985, J. Org. Chem. 50:5834-5838
- ⁇ -sheet inducing analogs Kemp et al., 1988, Tetrahedron Lett. 29:5081-5082
- ⁇ -turn inducing analogs Kemp et al., 1988, Tetrahedron Lett.
- the present invention further provides for modification or derivatization of the polypeptide or peptide of the invention.
- Modifications of peptides are well known to one of ordinary skill, and include phosphorylation, carboxymethylation, and acylation.
- glycosylated or fatty acylated peptide derivatives may be prepared. Preparation of glycosylated or fatty acylated peptides is well known in the art. Fatty acyl peptide derivatives may also be prepared. For example, and not by way of limitation, a free amino group (N-terminal or lysyl) may be acylated, e.g., myristoylated. In another embodiment an amino acid comprising an aliphatic side chain of the structure -
- Mutations can be made in a nucleic acid encoding the polypeptide such that a particular codon is changed to a codon which codes for a different amino acid. Such a mutation is generally made by making the fewest nucleotide changes possible.
- a substitution mutation of this sort can be made to change an amino acid in the resulting protein in a non-conservative manner (i.e., by changing the codon from an amino acid belonging to a grouping of amino acids having a particular size or characteristic to an amino acid belonging to another grouping) or in a conservative manner (i.e., by changing the codon from an amino acid belonging to a grouping of amino acids having a particular size or characteristic to an amino acid belonging to the same grouping).
- the present invention should be considered to include sequences containing conservative changes which do not significantly alter the activity or binding characteristics of the resulting protein.
- Substitutes for an amino acid within the sequence may be selected from other members of the class to which the amino acid belongs.
- the nonpolar (hydrophobic) amino acids include alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan and methionine.
- Amino acids containing aromatic ring structures are phenylalanine, tryptophan, and tyrosine.
- the polar neutral amino acids include glycine, serine, threonine, cysteine, tyrosine, asparagine, and glutamine.
- the positively charged (basic) amino acids include arginine, lysine and histidine.
- the negatively charged (acidic) amino acids include aspartic acid and glutamic acid. Such alterations will not be expected to affect apparent molecular weight as determined by polyacrylamide gel electrophoresis, or isoelectric point.
- Synthetic DNA sequences allow convenient construction of genes which will express analogs or "muteins".
- a general method for site-specific incorporation of unnatural amino acids into proteins is described inNoren, et al. Science, 244:182-188 (April 1989). This method may be used to create analogs with unnatural amino acids.
- pyroglutamate may be included as the N-terminal residue of the peptide.
- pyroglutamate is not amenable to sequence by Edman degradation, by limiting substitution to only 50% of the peptides on a given bead with N-terminal pyroglutatamate, there will remain enough non-pyroglutamate peptide on the bead for sequencing.
- this technique could be used for sequencing of any peptide that incorporates a residue resistant to Edman degradation at the N-terminus.
- Other methods to characterize individual peptides that demonstrate desired activity are described in detail infra. Specific activity of a peptide that comprises a blocked N-terminal group, e.g. , pyroglutamate, when the particular N-terminal group is present in 50% of the peptides, would readily be demonstrated by comparing activity of a completely (100%) blocked peptide with a non-blocked (0%) peptide.
- Chemical Moieties for Derivatization may be selected from among water soluble polymers.
- the polymer selected should be water soluble so that the component to which it is attached does not precipitate in an aqueous environment, such as a physiological environment.
- the polymer will be pharmaceutically acceptable.
- One skilled in the art will be able to select the desired polymer based on such considerations as whether the polymer/component conjugate will be used therapeutically, and if so, the desired dosage, circulation time, resistance to proteolysis, and other considerations. For the present component or components, these may be ascertained using the assays provided herein.
- the water soluble polymer may be selected from the group consisting of, for example, polyethylene glycol, copolymers of ethylene glycol propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-1, 3-dioxolane, poly-1, 3, 6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and dextran or poly(n-vinyl pyrrolidone)polyethylene glycol, propropylene glycol homopolymers, prolypropylene oxide/ethylene oxide co- polymers, polyoxyethylated polyols and polyvinyl alcohol.
- Polyethylene glycol propionaldenhyde may have advantages in manufacturing due to its stability in water.
- the polymer may be of any molecular weight, and may be branched or unbranched.
- the preferred molecular weight is between about 2kDa and about lOOkDa (the term "about” indicating that in preparations of polyethylene glycol, some molecules will weigh more, some less, than the stated molecular weight) for ease in handling and manufacturing.
- Other sizes may be used, depending on the desired therapeutic profile (e.g., the duration of sustained release desired, the effects, if any on biological activity, the ease in handling, the degree or lack of antigenicity and other known effects of the polyethylene glycol to a therapeutic protein or analog).
- the number of polymer molecules so attached may vary, and one skilled in the art will be able to ascertain the effect on function.
- One may mono-derivatize, or may provide for a di-, tri-, tetra- or some combination of derivatization, with the same or different chemical moieties (e.g., polymers, such as different weights of polyethylene glycols).
- the proportion of polymer molecules to component or components molecules will vary, as will their concentrations in the reaction mixture.
- the optimum ratio in terms of efficiency of reaction in that there is no excess unreacted component or components and polymer
- the desired degree of derivatization e.g., mono, di-, tri-, etc.
- the molecular weight of the polymer selected whether the polymer is branched or unbranched, and the reaction conditions.
- the polyethylene glycol molecules (or other chemical moieties) should be attached to the component or components with consideration of effects on functional or antigenic domains of the protein. There are a number of attachment methods available to those skilled in the art, e.g., EP 0 401 384 herein incorporated by reference (coupling PEG to G-CSF), see also Malik et al., 1992, Exp.
- polyethylene glycol may be covalently bound through amino acid residues via a reactive group, such as, a free amino or carboxyl group.
- Reactive groups are those to which an activated polyethylene glycol molecule may be bound.
- the amino acid residues having a free amino group include lysine residues and the - terminal amino acid residues; those having a free carboxyl group include aspartic acid residues glutamic acid residues and the C-terminal amino acid residue.
- Sulfhydrl groups may also be used as a reactive group for attaching the polyethylene glycol molecule(s). Preferred for therapeutic purposes is attachment at an amino group, such as attachment at the N-terminus or lysine group.
- This invention provides an isolated nucleic acid encoding a polypeptide comprising an amino acid sequence of a N-terminal choline binding protein A truncate.
- This invention provides an isolated nucleic acid encoding a polypeptide comprising an amino acid sequence of a N-terminal choline binding protein A truncate as set forth in Figure 2.
- the nucleic acid is set forth in any of SEQ LD NOS 12, 14-17, or 19-21, including fragments, mutants, variants, analogs, or derivatives, thereof.
- the nucleic acid is DNA, cDNA, genomic DNA, RNA.
- the isolated nucleic acid may be operatively linked to a promoter of RNA transcription. It is contemplated that the nucleic acid is used to competitively inhibit the lectin activity.
- a "vector” is a replicon, such as plasmid, phage or cosmid, to which another DNA segment may be attached so as to bring about the replication of the attached segment.
- a "DNA” refers to the polymeric form of deoxyribonucleotides (adenine, guanine, thymine, or cytosine) in its either single stranded form, or a double-stranded helix. This term refers only to the primary and secondary structure of the molecule, and does not limit it to any particular tertiary forms. Thus, this term includes double-stranded DNA found, inter alia, in linear DNA molecules (e.g., restriction fragments), viruses, plasmids, and chromosomes.
- linear DNA molecules e.g., restriction fragments
- viruses e.g., plasmids, and chromosomes.
- sequences may be described herein according to the normal convention of giving only the sequence in the 5' to 3' direction along the nontranscribed strand of DNA (i.e., the strand having a sequence homologous to the mRNA).
- a DNA sequence is "operatively linked" to an expression control sequence when the expression control sequence controls and regulates the transcription and translation of that DNA sequence.
- the term "operatively linked” includes having an appropriate start signal (e.g., ATG) in front of the DNA sequence to be expressed and maintaining the correct reading frame to permit expression of the DNA sequence under the control of the expression control sequence and production of the desired product encoded by the DNA sequence. If a gene that one desires to insert into a recombinant DNA molecule does not contain an appropriate start signal, such a start signal can be inserted in front of the gene.
- this invention also provides a vector which comprises the above-described nucleic acid molecule.
- the promoter may be, or is identical to, a bacterial, yeast, insect or mammalian promoter.
- the vector may be a plasmid, cosmid, yeast artificial chromosome (YAC), bacteriophage or eukaryotic viral DNA.
- vector backbones known in the art as useful for expressing protein may be employed.
- Such vectors include, but are not limited to: adenovirus (AV), adeno- associated virus (AAV), simian virus 40 (SV40), cytomegalovirus (CMV), mouse mammary tumor virus (MMTV), Moloney murine leukemia virus, DNA delivery systems, i.e. liposomes, and expression plasmid delivery systems.
- AV adenovirus
- AAV adeno- associated virus
- CMV cytomegalovirus
- MMTV mouse mammary tumor virus
- Moloney murine leukemia virus DNA delivery systems
- DNA delivery systems i.e. liposomes
- MMTV mouse mammary tumor virus
- Moloney murine leukemia virus DNA delivery systems
- DNA delivery systems i.e. liposomes
- MMTV mouse mammary tumor virus
- Moloney murine leukemia virus DNA delivery systems
- DNA delivery systems i.
- This invention also provides a host vector system for the production of a polypeptide which comprises the vector of a suitable host cell.
- Suitable host cells include, but are not limited to, prokaryotic or eukaryotic cells, e.g. bacterial cells (including gram positive cells), yeast cells, fungal cells, insect cells, and animals cells. Numerous mammalian cells may be used as hosts, including, but not limited to, the mouse fibroblast cell NTH 3T3, CHO cells, HeLa cells, Ltk " cells, Cos cells, etc.
- a wide variety of host/expression vector combinations may be employed in expressing the DNA sequences of this invention.
- Useful expression vectors may consist of segments of chromosomal, non-chromosomal and synthetic DNA sequences.
- Suitable vectors include derivatives of SV40 and known bacterial plasmids, e.g., E.
- phage DNAS e.g., the numerous derivatives of phage ⁇ , e.g., NM989, and other phage DNA, e.g., Ml 3 and filamentous single stranded
- any of a wide variety of expression control sequences ⁇ sequences that control the expression of a DNA sequence operatively linked to it — may be used in these vectors to express the DNA sequences of this invention.
- useful expression control sequences include, for example, the early or late promoters of S V40, CMV, vaccinia, polyoma or adenovirus, the lac system, the trp system, the TAC system, the TRC system, the LTR system, the major operator and promoter regions of phage ⁇ , the control regions of fd coat protein, the promoter for 3-phosphoglycerate kinase or other glycolytic enzymes, the promoters of acid phosphatase (e.g. , Pho5), the promoters of the yeast ⁇ -mating factors, and other sequences known to control the expression of genes of prokaryotic or eukaryotic cells or their viruses, and various combinations thereof.
- a wide variety of unicellular host cells are also useful in expressing the DNA sequences of this invention.
- These hosts may include well known eukaryotic and prokaryotic hosts, such as strains of E. coli, Pseudomonas, Bacillus, Streptomyces, fungi such as yeasts, and animal cells, such as CHO, Rl.l, B-W and L-M cells, African Green Monkey kidney cells (e.g., COS 1, COS 7, BSC1, BSC40, and BMT10), insect cells (e.g., Sf9), and human cells and plant cells in tissue culture.
- eukaryotic and prokaryotic hosts such as strains of E. coli, Pseudomonas, Bacillus, Streptomyces, fungi such as yeasts, and animal cells, such as CHO, Rl.l, B-W and L-M cells, African Green Monkey kidney cells (e.g., COS 1, COS 7, BSC1, BSC40, and
- Suitable unicellular hosts will be selected by consideration of, e.g., their compatibility with the chosen vector, their secretion characteristics, their ability to fold proteins correctly, and their fermentation requirements, as well as the toxicity to the host of the product encoded by the DNA sequences to be expressed, and the ease of purification of the expression products.
- This invention further provides a method of producing a polypeptide which comprises growing the above-described host vector system under suitable conditions permitting the production of the polypeptide and recovering the polypeptide so produced.
- the antibody may be a monoclonal or polyclonal antibody. Further, the antibody may be labeled with a detectable marker that is either a radioactive, colorimetric, fluorescent, or a luminescent marker.
- the labeled antibody may be a polyclonal or monoclonal antibody. In one embodiment, the labeled antibody is a purified labeled antibody. Methods of labeling antibodies are well known in the art.
- the term "antibody” includes, by way of example, both naturally occurring and non- naturally occurring antibodies. Specifically, the term “antibody” includes polyclonal and monoclonal antibodies, and fragments thereof. Furthermore, the term “antibody” includes chimeric antibodies and wholly synthetic antibodies, and fragments thereof.Such antibodies include but are not limited to polyclonal, monoclonal, chimeric, single chain, Fab fragments, and an Fab expression library.
- polypeptide can be conjugated to an immunogenic carrier, e.g., bovine serum albumin (BSA) or keyhole limpet hemocyanin (KLH).
- BSA bovine serum albumin
- KLH keyhole limpet hemocyanin
- Various adjuvant may be used to increase the immunological response, depending on the host species.
- any technique that provides for the production of antibody molecules by continuous cell lines in culture may be used (see, e.g., Antibodies — A Laboratory Manual, Harlow and Lane, eds., Cold Spring Harbor Laboratory Press: Cold Spring Harbor, Ne York, 1988).
- monoclonal antibodies can be produced in germ- free animals utilizing recent technology (PCT/US90/02545).
- human antibodies may be used and can be obtained by using human hybridomas (Cote et al., 1983, Proc. Natl. Acad. Sci. U.S.A. 80:2026-2030) or by transforming human B cells with EBV virus in vitro (Cole et al., 1985, in Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, pp. 77-96).
- human hybridomas Cote et al., 1983, Proc. Natl. Acad. Sci. U.S.A. 80:2026-2030
- EBV virus Cold-d Antibodies
- chimeric antibodies Manton et al., 1984, J. Bacteriol.
- human or humanized chimeric antibodies are preferred for use in therapy of human diseases or disorders (described infra), since the human or humanized antibodies are much less likely than xenogenic antibodies to induce an immune response, in particular an allergic response, themselves.
- An additional embodiment of the invention utilizes the techniques described for the construction of Fab expression libraries (Huse et al., 1989, Science 246:1275-1281) to allow rapid and easy identification of monoclonal Fab fragments with the desired specificity for the polypeptide, or its derivatives, or analogs.
- Antibody fragments which contain the idiotype of the antibody molecule can be generated by known techniques.
- such fragments include but are not limited to: the F(ab') 2 fragment which can be produced by pepsin digestion of the antibody molecule; the Fab' fragments which can be generated by reducing the disulfide bridges of the F(ab') 2 fragment, and the Fab fragments which can be generated by treating the antibody molecule with papain and a reducing agent.
- screening for the desired antibody can be accomplished by techniques known in the art, e.g., radioimmunoassay, ELISA (enzyme-linked immunosorbant assay), "sandwich” immunoassays, immunoradiometric assays, gel diffusion precipitin reactions, immunodiffusion assays, in situ immunoassays (using colloidal gold, enzyme or radioisotope labels, for example), western blots, precipitation reactions, agglutination assays (e.g., gel agglutination assays, hemagglutination assays), complement fixation assays, immunofluorescence assays, protein A assays, and immunoelectrophoresis assays, etc.
- radioimmunoassay e.g., ELISA (enzyme-linked immunosorbant assay), "sandwich” immunoassays, immunoradiometric assays, gel diffusion precipitin reactions, immunodiffusion assays, in situ immunoa
- antibody binding is detected by detecting a label on the primary antibody.
- the primary antibody is detected by detecting binding of a secondary antibody or reagent to the primary antibody.
- the secondary antibody is labeled.
- Antibodies can be labeled for detection in vitro, e.g., with labels such as enzymes, fluorophores, chromophores, radioisotopes, dyes, colloidal gold, latex particles, and chemiluminescent agents.
- the antibodies can be labeled for detection in vivo, e.g., with radioisotopes (preferably technetium or iodine); magnetic resonance shift reagents (such as gadolinium and manganese); or radio-opaque reagents.
- radioisotopes preferably technetium or iodine
- magnetic resonance shift reagents such as gadolinium and manganese
- radio-opaque reagents preferably radioisotopes (preferably technetium or iodine); magnetic resonance shift reagents (such as gadolinium and manganese); or radio-opaque reagents.
- the labels most commonly employed for these studies are radioactive elements, enzymes, chemicals which fluoresce when exposed to ultraviolet light, and others.
- a number of fluorescent materials are known and can be utilized as labels. These include, for example, fluorescein, rhodamine, auramine, Texas Red, AMCA blue and Lucifer Yellow.
- a particular detecting material is anti-rabbit antibody prepared in goats and conjugated with fluorescein through an isothiocyanate.
- the polypeptide can also be labeled with a radioactive element or with an enzyme.
- the radioactive label can be detected by any of the currently available counting procedures.
- the preferred isotope may be selected from ⁇ , 14 C, 32 P, 35 S, 36 Cl, 51 Cr, 57 Co, 58 Co, 59 Fe, 90 Y, 125 I, 131 I, and 186 Re.
- Enzyme labels are likewise useful, and can be detected by any of the presently utilized colorimetric, spectrophotometric, fluorospectrophotometric, amperometric or gasometric techniques.
- the enzyme is conjugated to the selected particle by reaction with bridging molecules such as carbodiimides, dusocyanates, glutaraldehyde and the like. Many enzymes which can be used in these procedures are known and can be utilized. The preferred are peroxidase, ⁇ -glucuronidase, ⁇ -D-glucosidase, ⁇ -D-galactosidase, urease, glucose oxidase plus peroxidase and alkaline phosphatase.
- U.S. Patent Nos. 3,654,090; 3,850,752; and 4,016,043 are referred to by way of example for their disclosure of alternate labeling material and methods.
- kits suitable for use by a medical specialist may be prepared to determine the presence or absence of predetermined binding activity or predetermined binding activity capability to suspected target cells.
- one class of such kits will contain at least the labeled polypeptide or its binding partner, for instance an antibody specific thereto, and directions, of course, depending upon the method selected, e.g., "competitive,” “sandwich,” “DASP” and the like.
- the kits may also contain peripheral reagents such as buffers, stabilizers, etc.
- test kit may be prepared for the demonstration of the presence or capability of cells for predetermined bacterial binding activity, comprising:
- This invention provides antagonist or blocking agents which include but are not limited to: peptide fragments, mimetics, a nucleic acid molecule, a ribozyme, a polypeptide, a small molecule, a carbohydrate molecule, a monosaccharide, an oligosaccharide or an antibody. Also, agents which competitively block or inhibit pneumococcal bacterium are contemplmated by this invention.
- This invention provides an agent which comprises an inorganic compound, a nucleic acid molecule, an oligonucleotide, an organic compound, a peptide, a peptidomimetic compound, or a protein which inhibits the polypeptide.
- This invention provides a vaccine which comprises the polypeptide having the amino acid sequence as set forth in any of SEQ ID NOS: 1, 3-7, 9-11, 22, and 23 and a pharmaceutically acceptable adjuvant or carrier.
- the polypeptide may comprise an amino acid sequence of a N-terminal choline binding protein A truncate as set forth in Figure 2.
- This invention provides a vaccine which comprises the polypeptide having the amino acid sequence which comprises a conserved region as set forth in Figure 2 and a pharmaceutically acceptable adjuvant or carrier.
- conserved regions include but are not limited to amino acid sequence 158 to 172; 300 to 321; 331 to 339; 355 to 365; 367 to 374; 379 to 389; 409 to 427; and 430 to 447.
- This invention provides a vaccine comprising the isolated nucleic acid encoding the polypeptide and a pharmaceutically acceptable adjuvant or carrier.
- Active immunity against Gram positive bacteria can be induced by immunization (vaccination) with an immunogenic amount of the polypeptide, or peptide derivative or fragment thereof, and an adjuvant, wherein the polypeptide, or antigenic derivative or fragment thereof, is the antigenic component of the vaccine.
- polypeptides of the present invention can be prepared in an admixture with an adjuvant to prepare a vaccine.
- the derivative or fragment thereof, used as the antigenic component of the vaccine is an adhesin.
- the polypeptide or peptide derivative or fragment thereof, used as the antigenic component of the vaccine is an antigen common to all or many strains of a species of Gram positive bacteria, or common to closely related species of bacteria.
- the antigenic component of the vaccine is an adhesin that is a common antigen.
- Vectors containing the nucleic acid-based vaccine of the invention can be introduced into the desired host by methods known in the art, e.g., transfection, electroporation, microinj ection, transduction, cell fusion, DE AE dextran, calcium phosphate precipitation, lipofection (lysosome fusion), use of a gene gun, or a DNA vector transporter (see, e.g., Wu et al., 1992, J. Biol. Chem. 267:963-967; Wu and Wu, 1988, J. Biol. Chem. 263:14621-14624; Hartmut et al., Canadian Patent Application No. 2,012,311, filed March 15, 1990).
- the vaccine can be administered via any parenteral route, including but not limited to intramuscular, intraperitoneal, intravenous, and the like.
- parenteral route including but not limited to intramuscular, intraperitoneal, intravenous, and the like.
- the desired result of vaccination is to elucidate an immune response to the antigen, and thereby to the pathogenic organism
- administration directly, or by targeting or choice of a viral vector, indirectly, to lymphoid tissues, e.g., lymph nodes or spleen is desirable.
- lymphoid tissues e.g., lymph nodes or spleen
- Passive immunity can be conferred to an animal subject suspected of suffering an infection with a Gram positive bacterium, preferably streptococcal, and more preferably pneumoccal, by administering antiserum, polyclonal antibodies, or a neutralizing monoclonal antibody against a polypeptide of the invention to the patient.
- a Gram positive bacterium preferably streptococcal, and more preferably pneumoccal
- antiserum preferably antiserum, polyclonal antibodies, or a neutralizing monoclonal antibody against a polypeptide of the invention.
- Passive immunity is particularly important for the treatment of antibiotic resistant strains of Gram positive bacteria, since no other therapy may be available.
- the antibodies administered for passive immune therapy are autologous antibodies.
- the antibodies are of human origin or have been "humanized,” in order to minimize the possibility of an immune response against the antibodies.
- the active or passive vaccines of the invention, or the administration of an adhesin can be used to protect an animal subject from infection of a Gram positive bacteria, preferably streptococcus, and more preferably, pneumococcus.
- This invention provides a pharmaceutical composition
- a pharmaceutical composition comprising an amount of the polypeptide as described and a pharmaceutically acceptable carrier or diluent.
- such pharmaceutical composition for preventing pneumococcal attachment to mucosal surface may include antibody to lectin domain and/or soluble excess lectin domain proteins. Blocking adherence by either mechanism blocks the initial step in infection thereby reducing colonization. This in turn decreases person to person transmission and prevents development of symptomatic disease.
- This invention provides a method of inducing an immune response in a subj ect which has been exposed to or infected with a pneumococcal bacterium comprising administering to the subject an amount of the pharmaceutical composition, thereby inducing an immune response.
- This invention provides a method for preventing infection by a pneumococcal bacterium in a subject comprising administering to the subject an amount of the pharmaceutical composition effective to prevent pneumococcal bacterium attachment, thereby preventing infection by a pneumococcal bacterium.
- This invention provides a method for preventing infection by a pneumococcal bacterium in a subject comprising administering to the subject an amount of a pharmaceutical composition comprising the antibody and a pharmaceutically acceptable carrier or diluent, thereby preventing infection by a pneumococcal bacterium.
- This invention provides a method for treating a subject infected with or exposed to pneumococcal bacterium comprising administering to the subject a therapeutically effective amount of a vaccine of the invention, thereby treating the subject.
- This invention provides a method of inhibiting colonization of host cells in a subject which has been exposed to or infected with a pneumococcal bacterium comprising administering to the subject an amount of the pharmaceutical composition comprising the polypeptide consisting of the amino acid sequence as set forth in any of SEQ LD NOS 1, 3-5, 7, or 9-11, thereby inducing an immune response.
- the therapeutic peptide that blocks colonization is delivered by the respiratory mucosa.
- the pharmaceutical composition comprising the polypeptide consisting of the amino acid sequence as set forth in Figure 2.
- pharmaceutical composition could mean therapeutically effective amounts of polypeptide products of the invention together with suitable diluents, preservatives, solubilizers, emulsifiers, adjuvant and/or carriers useful in to confer a therapeutic effect or benefit by e.g. preventing pneumococcal colonization.
- a “therapeutically effective amount” as used herein refers to that amount which provides a therapeutic effect for a given condition and administration regimen.
- compositions are liquids or lyophilized or otherwise dried formulations and include diluents of various buffer content (e.g., Tris-HCL, acetate, phosphate), pH and ionic strength, additives such as albumin or gelatin to prevent absorption to surfaces, detergents (e.g., Tween 20, Tween 80, Pluronic F68, bile acid salts), solubilizing agents (e.g., glycerol, polyethylene glycerol), anti-oxidants (e.g., ascorbic acid, sodium metabisulfite), preservatives (e.g., Thimerosal, benzyl alcohol, parabens), bulking substances or tonicity modifiers (e.g., lactose, mannitol), covalent attachment of polymers such as polyethylene glycol to the protein, complexation with metal ions, or incorporation of the material into or onto particulate preparations of polymeric compounds such as polylactic acid, polglycolic acid,
- compositions will influence the physical state, solubility, stability, rate of in vivo release, and rate of in vivo clearance of the therapeutic agent.
- the choice of compositions will depend on the physical and chemical properties of the protein having therapeutic activity. For example, a product derived from a membrane-bound form of the active may require a formulation containing detergent.
- Controlled or sustained release compositions include formulation in lipophilic depots (e.g., fatty acids, waxes, oils).
- particulate compositions coated with polymers e.g., poloxamers or poloxamines
- actives coupled to antibodies directed against tissue-specific receptors, ligands or antigens or coupled to ligands of tissue-specific receptors.
- Other embodiments of the compositions of the invention incorporate particulate forms protective coatings, protease inhibitors or permeation enhancers for various routes of administration, including parenteral, pulmonary, nasal and oral.
- pharmaceutically acceptable carrier include, but are not limited to, 0.01-0. IM and preferably 0.05M phosphate buffer or 0.8% saline.
- pharmaceutically acceptable carriers may be aqueous or non-aqueous solutions, suspensions, and emulsions.
- non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate.
- Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media.
- Parenteral vehicles include sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's or fixed oils.
- Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers such as those based on Ringer's dextrose, and the like. Preservatives and other additives may also be present, such as, for example, antimicrobials, antioxidants, collating agents, inert gases and the like.
- adjuvant refers to a compound or mixture that enhances the immune response to an antigen.
- An adjuvant can serve as a tissue depot that slowly releases the antigen and also as a lymphoid system activator that non-specifically enhances the immune response (Hood et al., Immunology, Second Ed., 1984, Benjamin/Cummings: Menlo Park, California, p. 384).
- a primary challenge with an antigen alone, in the absence of an adjuvant will fail to elicit a humoral or cellular immune response.
- Adjuvant include, but are not limited to, complete Freund's adjuvant, incomplete Freund's adjuvant, saponin, mineral gels such as aluminum hydroxide, surface active substances such as l solecithin luronic ol ols ol anions, e tides, oil or h drocarbon emulsions, keyhole limpet hemocyanins, dinitrophenol, and potentially useful human adjuvant such as BCG (bacille Calmette-Gueri ) and Corynebacterium parvum.
- the adjuvant is pharmaceutically acceptable.
- Controlled or sustained release compositions include formulation in lipophilic depots (e.g. fatty acids, waxes, oils). Also comprehended by the invention are particulate compositions coated with polymers (e.g. poloxamers or poloxamines) and the compound coupled to antibodies directed against tissue-specific receptors, ligands or antigens or coupled to ligands of tissue-specific receptors. Other embodiments of the compositions of the invention incorporate particulate forms protective coatings, protease inhibitors or permeation enhancers for various routes of administration, including parenteral, pulmonary, nasal and oral.
- polymers e.g. poloxamers or poloxamines
- Other embodiments of the compositions of the invention incorporate particulate forms protective coatings, protease inhibitors or permeation enhancers for various routes of administration, including parenteral, pulmonary, nasal and oral.
- Such modifications may also increase the compound's solubility in aqueous solution, eliminate aggregation, enhance the physical and chemical stability of the compound, and greatly reduce the immunogenicity and reactivity of the compound.
- the desired in vivo biological activity may be achieved by the administration of such polymer-compound abducts less frequently or in lower doses than with the unmodified compound.
- the sufficient amount may include but is not limited to from about 1 ⁇ g/kg to about 1000 mg/kg.
- the amount may be 10 mg/kg.
- the pharmaceutically acceptable form of the composition includes a pharmaceutically acceptable carrier.
- the present invention provides therapeutic compositions comprising pharmaceutical compositions comprising vectors, vaccines, polypeptides, nucleic acids and antibodies, anti-antibodies, and agents, to compete with the pneumococcus bacterium for pathogenic activities, such as adherence to host cells.
- compositions which contain an active component are well understood in the art.
- such compositions are prepared as an aerosol of the polypeptide delivered to the nasopharynx or as injectables, either as liquid solutions or suspensions, however, solid forms suitable for solution in, or suspension in, liquid prior to injection can also be prepared.
- the preparation can also be emulsified.
- the active therapeutic ingredient is often mixed with excipients which are pharmaceutically acceptable and compatible with the active ingredient. Suitable excipients are, for example, water, saline, dextrose, glycerol, ethanol, or the like and combinations thereof.
- the composition can contain minor amounts of auxiliary substances such as wetting or emulsifying agents, pH buffering agents which enhance the effectiveness of the active ingredient.
- An active component can be formulated into the therapeutic composition as neutralized pharmaceutically acceptable salt forms.
- Pharmaceutically acceptable salts include the acid addition salts (formed with the free amino groups of the polypeptide or antibody molecule) and which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric, mandelic, and the like. Salts formed from the free carboxyl groups can also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, 2-ethylamino ethanol, histidine, procaine, and the like.
- a composition comprising "A” (where "A” is a single protein, DNA molecule, vector, etc.) is substantially free of “B” (where “B” comprises one or more contaminating proteins, DNA molecules, vectors, etc.) when at least about 75% by weight of the proteins, DNA, vectors (depending on the category of species to which A and B belong) in the composition is "A".
- "A” comprises at least about 90% by weight of the A+B species in the composition, most preferably at least about 99% by weight.
- terapéuticaally effective amount is used herein to mean an amount sufficient to reduce by at least about 15 percent, preferably by at least 50 percent, more preferably by at least 90 percent, and most preferably prevent, a clinically significant deficit in the activity, function and response of the host.
- a therapeutically effective amount is sufficient to cause an improvement in a clinically significant condition in the host.
- a deficit in the response of the host is evidenced by continuing or spreading bacterial infection.
- An improvement in a clinically significant condition in the host includes a decrease in bacterial load, clearance of bacteria from colonized host cells, reduction in fever or inflammation associated with infection, or a reduction in any symptom associated with the bacterial infection.
- the component or components of a therapeutic composition of the invention may be introduced parenterally, transmucosally, e.g., orally, nasally, pulmonarailly, or rectally, or transdermally .
- administration is parenteral, e.g. , via intravenous injection, and also including, but is not limited to, intra-arterial, intramuscular, intradermal, subcutaneous, intraperitoneal, intraventricular, and intracranial administration.
- Oral or pulmonary delivery may be preferred to activate mucosal immunity; since pneumococci generally colonize the nasopharyngeal and pulmonary mucosa, mucosal immunity may be a particularly effective preventive treatment.
- unit dose when used in reference to a therapeutic composition of the present invention refers to physically discrete units suitable as unitary dosage for humans, each unit containing a predetermined quantity of active material calculated to produce the desired therapeutic effect in association with the required diluent; i. e. , carrier, or vehicle.
- the active compound can be delivered in a vesicle, in particular a liposome (see Langer, Science 249:1527-1533 (1990); Treat et al., in Liposomes in the Therapy of Infectious Disease and Cancer, Lopez-Berestein and Fidler (eds.), Liss, New York, pp. 353-365 (1989); Lopez-Berestein, ibid., pp. 317-327; see generally ibid).
- a liposome see Langer, Science 249:1527-1533 (1990); Treat et al., in Liposomes in the Therapy of Infectious Disease and Cancer, Lopez-Berestein and Fidler (eds.), Liss, New York, pp. 353-365 (1989); Lopez-Berestein, ibid., pp. 317-327; see generally ibid).
- the therapeutic compound can be delivered in a controlled release s stem.
- a controlled release s stem For exam le the ol e tide ma be administered usin i r infusion, an implantable osmotic pump, a transdermal patch, liposomes, or other modes of administration.
- a pump may be used (see Langer, supra; Sefton, CRC Crit. Ref. Biomed. Eng. 14:201 (1987); Buchwald et al., Surgery 88:507 (1980); Saudek et al., N. Engl. J. Med. 321:574 (1989)).
- polymeric materials can be used (see Medical Applications of Controlled Release, Langer and Wise (eds.), CRC Pres., Boca Raton, Florida (1974); Controlled Drug Bioavailability, Drug Product Design and Performance, Smolen and Ball (eds.), Wiley, New York (1984); Ranger and Peppas, J. Macromol. Sci. Rev. Macromol. Chem. 23:61 (1983); see also Levy et al., Science 228:190 (1985); During et al., Ann. Neurol. 25:351 (1989); Howard et al., J. Neurosurg. 71:105 (1989)).
- a controlled release system can be placed in proximity of the therapeutic target, i.e., the brain, thus requiring only a fraction of the systemic dose (see, e.g., Goodson, in Medical Applications of Controlled Release, supra, vol. 2, pp. 115-138 (1984)).
- a controlled release device is introduced into a subject in proximity of the site of inappropriate immune activation or a tumor.
- Other controlled release systems are discussed in the review by Langer (Science 249:1527-1533 (1990)).
- a subject in whom administration of an active component as set forth above is an effective therapeutic regimen for a bacterial infection is preferably a human, but can be any animal.
- the methods and pharmaceutical compositions of the present invention are particularly suited to administration to any animal, particularly a mammal, and including, but by no means limited to, domestic animals, such as feline or canine subjects, farm animals, such as but not limited to bovine, equine, caprine, ovine, and porcine subjects, wild animals (whether in the wild or in a zoological garden), research animals, such as mice, rats, rabbits, goats, sheep, pigs, dogs, cats, etc., i.e., for veterinary medical use.
- a therapeutically effective dosage of the active component is provided.
- a therapeutically effective dosage can be determined by the ordinary skilled medical worker based on patient characteristics (age, weight, sex, condition, complications, other diseases, etc.), as is well known in the art. Furthermore, as further routine studies are conducted, more specific information will emerge regarding appropriate dosage levels for treatment of various conditions in various patients, and the ordinary skilled worker, considering the therapeutic context, age and general health of the recipient, is able to ascertain proper dosing. Generally, for intravenous injection or infusion, dosage may be lower than for intraperitoneal, intramuscular, or other route of administration. The dosing schedule may vary, depending on the circulation half-life, and the formulation used.
- compositions are administered in a manner compatible with the dosage formulation in the therapeutically effective amount.
- Precise amounts of active ingredient required to be administered depend on the judgment of the practitioner and are peculiar to each individual.
- suitable dosages may range from about 0.1 to 20, preferably about 0.5 to about 10, and more preferably one to several, milligrams of active ingredient per kilogram body weight of individual per day and depend on the route of administration.
- Suitable regimes for initial administration and booster shots are also variable, but are typified by an initial administration followed by repeated doses at one or more hour intervals by a subsequent injection or other administration.
- continuous intravenous infusion sufficient to maintain concentrations of ten nanomolar to ten micromolar in the blood are contemplated.
- Administration with other compounds For treatment of a bacterial infection, one may administer the present active component in conjunction with one or more pharmaceutical compositions used for treating bacterial infection, including but not limited to (1) antibiotics; (2) soluble carbohydrate inhibitors of bacterial adhesin; (3) other small molecule inhibitors of bacterial adhesin; (4) inhibitors of bacterial metabolism, transport, or transformation; (5) stimulators of bacterial lysis, or (6) anti-bacterial antibodies or vaccines directed at other bacterial antigens.
- Other potential active components include anti-inflammatory agents, such as steroids and non-steroidal anti- inflammatory drugs.
- Administration may be simultaneous (for example, administration of a mixture of the present active component and an antibiotic), or may be in seriatim.
- the therapeutic compositions may further include an effective amount of the active component, and one or more of the following active ingredients: an antibiotic, a steroid, etc.
- active ingredients an antibiotic, a steroid, etc.
- Polypeptide antagonist 5.0 sodium bisulfite USP 3.2 disodium edetate USP 0.1 water for inj ection q.s.a.d. 1.0 ml
- the polypeptide is introduced to block the interaction of the bacteria with the host cell.
- pulmonary delivery of the present polypeptide having lectin activity which acts as an adhesin inhibitory agent (or derivatives thereof), of the invention is delivered to the lungs of a mammal, where it can interfere with bacterial, i.e., streptococcal, and preferably pneumococcal binding to host cells.
- adhesin inhibitory agent or derivative
- Other reports of preparation of proteins for pulmonary delivery are found in the art [Adjei et al.
- adhesin inhibitory agent or derivative
- each formulation is specific to the type of device employed and may involve the use of an appropriate propellant material, in addition to the usual diluents, adjuvant and/or carriers useful in therapy.
- the use of liposomes, microcapsules or microspheres, inclusion complexes, or other types of carriers is contemplated.
- Chemically modified adhesin inhibitory agent may also be prepared in different formulations depending on the type of chemical modification or the type of device employed.
- Formulations suitable for use with a nebulizer will typically comprise adhesin inhibitory agent (or derivative) dissolved in water at a concentration of about 0.1 to 25 mg of biologically active adhesin inhibitory agent per ml of solution.
- the formulation may also include a buffer and a simple sugar (e.g. , for adhesin inhibitory agent stabilization and regulation of osmotic pressure).
- the nebulizer formulation may also contain a surfactant, to reduce or prevent surface induced aggregation of the adhesin inhibitory agent caused by atomization of the solution in forming the aerosol.
- Formulations for use with a metered-dose inhaler device will generally comprise a finely divided powder containing the adhesin inhibitory agent (or derivative) suspended in a propellant with the aid of a surfactant.
- the propellant may be any conventional material employed for this purpose, such as a chlorofluorocarbon, a hydrochlorofluorocarbon, a hydrofluorocarbon, or a hydrocarbon, including trichlorofluoromethane, dichlorodifluoromethane, dichlorotetrafluoroethanol, and 1,1,1,2-tetrafluoroethane, or combinations thereof.
- Suitable surfactants include sorbitan trioleate and soya lecithin. Oleic acid may also be useful as a surfactant.
- the liquid aerosol formulations contain adhesin inhibitory agent and a dispersing agent in a physiologically acceptable diluent.
- the dry powder aerosol formulations of the present invention consist of a finely divided solid form of adhesin inhibitory agent and a dispersing agent. With either the liquid or dry powder aerosol formulation, the formulation must be aerosolized. That is, it must be broken down into liquid or solid particles in order to ensure that the aerosolized dose actually reaches the mucous membranes of the nasal passages or the lung.
- aerosol particle is used herein to describe the liquid or solid particle suitable for nasal or pulmonary administration, i.e., that will reach the mucous membranes.
- the mass median dynamic diameter will be 5 micrometers or less in order to ensure that the drug particles reach the lung alveoli [Wearley, L.L., Crit. Rev. in Ther. Drug Carrier Systems 8:333 (1991)].
- an aerosol formulation of the present invention can include other therapeutically or pharmacologically active ingredients in addition to adhesin inhibitory agent, such as but not limited to an antibiotic, a steroid, a non-steroidal anti-inflammatory drug, etc.
- the present invention provides aerosol formulations and dosage forms for use in treating subjects suffering from bacterial, e.g., streptococcal, in particularly pneumococcal, infection.
- dosage forms contain adhesin inhibitory agent in a pharmaceutically acceptable diluent.
- Pharmaceutically acceptable diluents include but are not limited to sterile water, saline, buffered saline, dextrose solution, and the like.
- a diluent that may be used in the present invention or the pharmaceutical formulation of the present invention is phosphate buffered saline, or a buffered saline solution generally between the pH 7.0-8.0 range, or water.
- the liquid aerosol formulation of the present invention may include, as optional ingredients, pharmaceutically acceptable carriers, diluents, solubilizing or emulsifying agents, surfactants and excipients.
- the formulation may include a carrier.
- the carrier is a macromolecule which is soluble in the circulatory system and which is physiologically acceptable where physiological acceptance means that those of skill in the art would accept injection of said carrier into a patient as part of a therapeutic regime.
- the carrier preferably is relatively stable in the circulatory system with an acceptable plasma half life for clearance.
- Such macromolecules include but are not limited to Soya lecithin, oleic acid and sorbitan trioleate, with sorbitan trioleate preferred.
- the formulations of the present embodiment may also include other agents useful for pH maintenance, solution stabilization, or for the regulation of osmotic pressure.
- agents include but are not limited to salts, such as sodium chloride, or potassium chloride, and carbohydrates, such as glucose, galactose or mannose, and the like.
- the present invention further contemplates liquid aerosol formulations comprising adhesin inhibitory agent and another therapeutically effective drug, such as an antibiotic, a steroid, a non-steroidal anti-inflammatory drug, etc.
- another therapeutically effective drug such as an antibiotic, a steroid, a non-steroidal anti-inflammatory drug, etc.
- Aerosol Dry Powder Formulations It is also contemplated that the present aerosol formulation can be prepared as a dry powder formulation comprising a finely divided powder form of adhesin inhibitory agent and a dispersant.
- Formulations for dispensing from a powder inhaler device will comprise a finely divided dry powder containing adhesin inhibitory agent (or derivative) and may also include a bulking agent, such as lactose, sorbitol, sucrose, or mannitol in amounts which facilitate dispersal of the powder from the device, e.g., 50 to 90% by weight of the formulation.
- adhesin inhibitory agent (or derivative) should most advantageously be prepared in particulate form with an average particle size of less than 10 mm (or microns), most preferably 0.5 to 5 mm, for most effective delivery to the distal lung.
- the dry powder formulation can comprise a finely divided dry powder containing adhesin inhibitory agent, a dispersing agent and also a bulking agent.
- Bulking agents useful in conjunction with the present formulation include such agents as lactose, sorbitol, sucrose, or mannitol, in amounts that facilitate the dispersal of the powder from the device.
- the present invention further contemplates dry powder formulations comprising adhesin inhibitory agent and another therapeutically effective drug, such as an antibiotic, a steroid, a non-steroidal anti-inflammatory drug, etc.
- a therapeutically effective drug such as an antibiotic, a steroid, a non-steroidal anti-inflammatory drug, etc.
- Contemplated for use herein are oral solid dosage forms, which are described generally in Remington's Pharmaceutical Sciences, 18th Ed.1990 (Mack Publishing Co. Easton PA 18042) at Chapter 89, which is herein incorporated by reference.
- Solid dosage forms include tablets, capsules, pills, troches or lozenges, cachets or pellets.
- liposomal or proteinoid encapsulation may be used to formulate the present compositions (as, for example, proteinoid microspheres reported in U.S. Patent No. 4,925,673).
- Liposomal encapsulation may be used and the liposomes may be derivatized with various polymers (e.g., U.S. Patent No. 5,013,556).
- various polymers e.g., U.S. Patent No. 5,013,556
- a description of possible solid dosage forms for the therapeutic is given by Marshall, K. In: Modern Pharmaceutics Edited by G.S. Banker and CT. Rhodes Chapter 10, 1979, herein incorporated by reference.
- the formulation will include the component or components (or chemically modified forms thereof) and inert ingredients which allow for protection against the stomach environment, and release of the biologically active material in the intestine.
- oral dosage forms of the above derivatized component or components may be chemically modified so that oral delivery of the derivative is efficacious.
- the chemical modification contemplated is the attachment of at least one moiety to the component molecule itself, where said moiety permits (a) inhibition of proteolysis; and (b) uptake into the blood stream from the stomach or intestine.
- the increase in overall stability of the component or components and increase in circulation time in the body examples include: polyethylene glycol, copolymers of ethylene glycol and propylene glycol, carboxymethyl cellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone and polyproline.
- the location of release may be the stomach, the small intestine (the duodenum, the jejunem, or the ileum), or the large intestine.
- the stomach the small intestine (the duodenum, the jejunem, or the ileum), or the large intestine.
- One skilled in the art has available formulations which will not dissolve in the stomach, yet will release the material in the duodenum or elsewhere in the intestine.
- the release will avoid the deleterious effects of the stomach environment, either by protection of the protein (or derivative) or by release of the biologically active material beyond the stomach environment, such as in the intestine.
- a coating impermeable to at least pH 5.0 is essential.
- examples of the more common inert ingredients that are used as enteric coatings are cellulose acetate trimellitate (CAT), hydroxypropylmethylcellulose phthalate (HPMCP), HPMCP 50, HPMCP 55, polyvinyl acetate phthalate (PVAP), Eudragit L30D, Aquateric, cellulose acetate phthalate (CAP), Eudragit L, Eudragit S, and Shellac. These coatings may be used as mixed films.
- a coating or mixture of coatings can also be used on tablets, which are not intended for protection against the stomach. This can include sugar coatings, or coatings which make the tablet easier to swallow.
- Capsules may consist of a hard shell (such as gelatin) for delivery of dry therapeutic i.e. powder; for liquid forms, a soft gelatin shell may be used.
- the shell material of cachets could be thick starch or other edible paper. For pills, lozenges, molded tablets or tablet triturates, moist massing techniques can be used.
- the peptide therapeutic can be included in the formulation as fine multiparticulates in the form of granules or pellets of particle size about 1mm.
- the formulation of the material for capsule administration could also be as a powder, lightly compressed plugs or even as tablets.
- the therapeutic could be prepared by compression.
- Colorants and flavoring agents may all be included.
- the protein (or derivative) may be formulated (such as by liposome or microsphere encapsulation) and then further contained within an edible product, such as a refrigerated beverage containing colorants and flavoring agents.
- diluents could include carbohydrates, especially mannitol, a-lactose, anhydrous lactose, cellulose, sucrose, modified dextran and starch.
- Certain inorganic salts may be also be used as fillers including calcium triphosphate, magnesium carbonate and sodium chloride.
- Some commercially available diluents are Fast-Flo, Emdex, STA-Rx 1500, Emcompress and Avicell.
- Disintegrants may be included in the formulation of the therapeutic into a solid dosage form.
- Materials used as disintegrates include but are not limited to starch, including the commercial disintegrant based on starch, Explotab. Sodium starch glycolate, Amberlite, sodium carboxymethylcellulose, ultramylopectin, sodium alginate, gelatin, orange peel, acid carboxymethyl cellulose, natural sponge and bentonite may all be used.
- Another form of the disintegrants are the insoluble cationic exchange resins.
- Powdered gums may be used as disintegrants and as binders and these can include powdered gums such as agar, Karaya or tragacanth. Alginic acid and its sodium salt are also useful as disintegrants.
- Binders may be used to hold the therapeutic agent together to form a hard tablet and include materials from natural products such as acacia, tragacanth, starch and gelatin. Others include methyl cellulose (MC), ethyl cellulose (EC) and carboxymethyl cellulose (CMC). Polyvinyl pyrrolidone (PVP) and hydroxypropylmethyl cellulose (HPMC) could both be used in alcoholic solutions to granulate the therapeutic.
- MC methyl cellulose
- EC ethyl cellulose
- CMC carboxymethyl cellulose
- PVP polyvinyl pyrrolidone
- HPMC hydroxypropylmethyl cellulose
- Lubricants may be used as a layer between the therapeutic and the die wall, and these can include but are not limited to; stearic acid including its magnesium and calcium salts, polytetrafluoroethylene (PTFE), liquid paraffin, vegetable oils and waxes. Soluble lubricants may also be used such as sodium lauryl sulfate, magnesium lauryl sulfate, polyethylene glycol of various molecular weights, Carbowax 4000 and 6000.
- the glidants may include starch, talc, pyrogenic silica and hydrated silicoaluminate.
- surfactant might be added as a wetting agent.
- Surfactants may include anionic detergents such as sodium lauryl sulfate, dioctyl sodium sulfosuccinate and dioctyl sodium sulfonate.
- anionic detergents such as sodium lauryl sulfate, dioctyl sodium sulfosuccinate and dioctyl sodium sulfonate.
- Cationic detergents might be used and could include benzalkonium chloride or benzethomium chloride.
- nonionic detergents that could be included in the formulation as surfactants are lauromacrogol 400, polyoxyl 40 stearate, polyoxyethylene hydrogenated castor oil 10, 50 and 60, glycerol monostearate, polysorbate 40, 60, 65 and 80, sucrose fatty acid ester, methyl cellulose and carboxymethyl cellulose. These surfactants could be present in the formulation of the protein or derivative either alone or as a mixture in different ratios.
- Additives which potentially enhance uptake of the polypeptide (or derivative) are for instance the fatty acids oleic acid, linoleic acid and linolenic acid.
- Pulmonary Delivery also contemplated herein is pulmonary delivery of the present polypeptide (or derivatives thereof).
- the polypeptide (or derivative) is delivered to the lungs of a mammal while inhaling and coats the mucosal surface of the alveoli.
- Other reports of this include Adjei et al., 1990, Pharmaceutical Research, 7:565-569; Adjei et al., 1990, International Journal of Pharmaceutics, 63:135-144 (leuprolide acetate); Braquet et al, 1989, Journal of Cardiovascular Pharmacology, 13(suppl. 5):143-146 (endothelin-1); Hubbard et al., 1989, Annals of Internal Medicine, Vol. Ill, pp.
- Contemplated for use in the practice of this invention are a wide range of mechanical devices designed for pulmonary delivery of therapeutic products, including but not limited to nebulizers, metered dose inhalers, and powder inhalers, all of which are familiar to those skilled in the art.
- Formulations suitable for use with a nebulizer will typically comprise polypeptide (or derivative) dissolved in water at a concentration of about 0.1 to 25 mg of biologically active protein per mL of solution.
- the formulation may also include a buffer and a simple sugar (e.g., for protein stabilization and regulation of osmotic pressure).
- the nebulizer formulation may also contain a surfactant, to reduce or prevent surface induced aggregation of the protein caused by atomization of the solution in forming the aerosol.
- Formulations for use with a metered-dose inhaler device will generally comprise a finely divided powder containing the polypeptide (or derivative) suspended in a propellant with the aid of a surfactant.
- the propellant may be any conventional material employed for this purpose, such as a chlorofluorocarbon, a hydrochlorofluorocarbon, a hydrofluorocarbon, or a hydrocarbon, including trichlorofiuoromethane, dichlorodifluoromethane, dichlorotetrafluoroethanol, and 1,1,1,2-tetrafluoroethane, or combinations thereof.
- Suitable surfactants include sorbitan trioleate and soya lecithin. Oleic acid may also be useful as a surfactant.
- Formulations for dispensing from a powder inhaler device will comprise a finely divided dry powder containing polypeptide (or derivative) and may also include a bulking agent, such as lactose, sorbitol, sucrose, or mannitol in amounts which facilitate dispersal of the powder from the device, e.g., 50 to 90% by weight of the formulation.
- the protein (or derivative) should most advantageously be prepared in particulate form with an average particle size of less than 10 mm (or microns), most preferably 0.5 to 5 mm, for most effective delivery to the distal lung.
- Nasal Delivery Nasal or nasopharyngeal delivery of the polypeptide (or derivative) is also contemplated. Nasal delivery allows the passage of the polypeptide directly over the upper respiratory tract mucosal after administering the therapeutic product to the nose, without the necessity for deposition of the product in the lung.
- Formulations for nasal delivery include those with dextran or cyclodextran.
- EXAMPLE 1 Peptide truncates of choline binding protein A (CbpA)
- a polypeptide comprising a truncated N-terminal fragment of the CbpA (serotype 4) was generated.
- Full length CbpA was amplified with PCR primers SJ533 and SJ537, the primers were designed based on the derived N-terminal amino acid sequence of the CbpA polypeptide.
- This degenerate primer designed from the amino acid sequence XENEG incorporates both BamHI and Ncol restriction sites and an ATG start codon.
- PCR product was generated from genomic DNA as a template with primers SJ533 and SJ537 amplified 30 cycles with an annealing temperature of 50°C using High Fidelity enzyme (Boehringer Mannheim).
- the resulting PCR products were purified using QIAquick PCR Purification Kit (Qiagen, Inc.) then digested with BamHI and Sail restriction enzymes and cloned into the pQE30 expression vector (Qiagen, Inc.) digested with BamHI, Xbal, and Smal restriction enzymes.
- polypeptide R2 is set forth in SEQ ID NO 1, Polypeptide RI :
- a single colony was selected from plated bacteria containing the recombinant plasmid and grown overnight at 37° in 6.0 mis LB buffer with 50 ⁇ g/ml kanamycin and lOO ⁇ g/ml ampicillin.
- This 6.0 ml culture was added to IL LB with antibiotics at above concentrations.
- IM IPTG was added to the IL culture to a final concentration of lmM.
- the culture was then shaken at 37°C for 3-4 hrs.
- the IL culture was spun for 15 min at 4000 rpm in a model J-6B centrifuge. The supernatant was discarded and the pellet stored at -20 °C
- the IL pellet was re-suspended in 25 ml 50 mM NaH 2 PO 4 , lOmM Tris, 6M GuCl, 300mM NaCl, pH 8.0 (Buffer A). This mixture was rotated at room temperature for 30 minutes and sonicated on a (VibraCell Sonicator (Sonics and Materials, Inc., Danbury, CT) using the micro tip, two times, for 30 sees, at 50% Cuty Cycle and with the output setting at 7. The mixture was spun 5 min at 10K in a JA20 rotor and the supernatant removed and discarded.
- VibraCell Sonicator Sonics and Materials, Inc., Danbury, CT
- the supernatant was loaded onto a 10 ml Talon (Clonetech, Palo Alto, CA) resin column attached to a GradiFrac System (Pharmacia Biotech, Upsala, Sweden).
- the column was equilibrated with 100 ml Buffer A and washed with an additional 200 ml of this buffer.
- a volume based pH gradient using 100% 50 mM NaH 2 PO 4 , 8M Urea, 20mM MES, pH6.0 (Buffer B) as the final target buffer was run over a total volume of 100 ml. Protein eluted at -30% Buffer B. Eluted peaks were collected and pooled.
- dialysis was carried out with a 2L volume of PBS at room temperature for approximately 3 hrs using dialysis tubing with a molecular weight cutoff of 14,000. The sample was then dialyzed overnight in 2L of PBS at 4°C Additional buffer exchange was accomplished during the concentration of the protein using Centriprep-30 spin columns by adding PBS to the spun retenate and re-spinning. The protein concentration was determined using the BCA protein assay and the purity visualized using a Coomassie stained 4-20% SDS-PAGE gel ( Figure 3).
- LNnt is a carbohydrate analog of the receptors for pneumococci present on eukaryotic cells. It has been shown that a CbpA defective pneumococcal mutant failed to adhere to either eukaryotic cells or immobilized sugar indicating that CbpA is the adhesive ligand.
- CbpA is a modular protein that can be divided into two regions: the N-Terminal functional domain and the C-terminal choline binding domain ( Figure 1). Polypeptides RI and R2 were analyzed for biological activity to determine if the activities of the entire CbpA were localized in the unique N terminus (modelled by R2) or a fragment thereof (modelled by RI).
- the assay was to coat tissue culture wells with glycoconjugates known to be recognized by CbpA: LNnT-albumin, 3 ' sialyl lactose-albumin, and the negative control albumin.
- the plates were then blocked with the albumin, washed and either full length CbpA Polypeptide R2, or polypeptide RI were added for 15 minutes (0.8 ⁇ g/ml), then, without washing, fluoresein labelled R6 pneumococci were added for 30 minutes, washed and adherent bacteria counted visually.
- Binding of R6 to carbohydrate without any peptide addition was the positive control and was calibrated at 100% (Table 1).
- CbpA full length or Polypeptide R2 competitively inhibited binding of pneumococci to LNnT coated surfaces.
- CbpA full length inhibited to 71. 64% and 63% of control: polypeptide R2 inhibited to 65%, 53% and 74% of control.
- the equivalent activity of CbpA and R2 indicates the choline binding domain is not necessary for LNnT lectin activity of CbpA, and that R2 is a candidate LNnT lectin.
- Lectin activity correlates with cell binding activity
- N-terminal region of CbpA contains two repeats of -110 amino acids each (see Figure 1, regions A and C within polypeptide R2).
- polypeptide RI did not inhibit adherence to LNnT at all (91, 92, and 112% of wild type).
- polypeptide RI demonstrated some inhibition of binding to Sialyl lactose (68 and 40% of control). This demonstrates that the polypeptide R2 is required for LNnT lectin activity and R2 is a candidate LNnT lectin domain. In contrast RI seems to be active in recognition of sialic acid.
- N-terminal domain of CbpA binds cells
- interference with the N-terminal domain activity will prevent or reverse bacterial binding to cells or purified glycoconjugates.
- One such mechanism of interference is antibody.
- Antisera raised to the recombinant N-terminal domain of CbpA (R2) was tested for the ability to block adherence of pneumococci to LNnT.
- Rabbit polyclonal anti CbpA antisera (5 ⁇ l) plus 5 ⁇ l of 2 x 10 7 of labeled bacteria were incubated at room temperature for 30 min. This mixture was overlaid onto immobilized LNnT for 30 min., and then washed 3 times with PBS to remove unbound bacteria. Bacteria bound to the plates were enumerated microscopically and results are presented as the mean values plus the standard deviation from six wells. Results shown in Table 3 demonstrate that antisera raised against the R2 polypeptide blocked the binding of pneumococci to LNnT.
- Figure 5 demonstrates a titration curve of prelmmune versus anti-CbpA R2 antibody for inhibition of binding of pneumococci R6x to the model receptor LNnT. Greater than 70% of pneumococcal adherence was blocked by anti-R2 at dilutions of 1 : 100 and 1 :200. Further dilution to 1:400 eliminated activity indicating the specificity of the effect.
- the CbpA used to prepare the antisera shown in Table 3 and Figure 5 was raised against CbpA from serotype 4.
- the R6x strain pneumococci used in the inhibition of adherence assay was derived from serotype 2.
- the ability of the antibody to block adherence of a heterologous serotype of bacteria indicates cross protective activity across serotypes. Such activity is highly desired for an effective vaccine immunogen.
- CbpA can be purified over a choline affinity column from its natural host, the pneumococcus, as described by Rosenow et al.
- a polyhistidine tag can be engineered onto the end of the gene such that the transcribed protein is extended by several histidine residues. These residues facilitate purification over a nickel affinity matrix Purification of full length polypeptides as opposed to shorter truncates favors retention of the native tertiary structure.
- CbpA purified especially from pneumococcus but also from E. coli or other host bacteria by these biochemical means retains its native tertiary structure.
- CbpA Used as an immunogen, natively folded CbpA engenders antibodies that potentially differ from those elicited by immunization with a truncate which may fold differently.
- CbpA used as a therapeutic may have tertiary structure differing from the truncate which would improve its ability to block adherence.
- CBD C terminal
- treatment with hydroxylamine will cleave CbpA at amino acid position 475 of serotype R6x and of serotype 4 of choline binding protein A, separating the N and C termini.
- the N terminal fragment is then suitable as a therapeutic or an immunogen.
- native CbpA can be used as an immunogen and antisera to the active structure.
- the bioactive anti-N terminal antibodies in this mixture can be enriched by removing antibodies to the BD by absorption.
- Such an antibody was prepared by incubating 200, ul serum with 1 x 10 8 CbpA defective - bacteria for 1 hour at RI .
- the other choline binding proteins on this mutant absorb out anti-CBD antibodies which are then removed from the antiserum by centrifuging and removing the bacteria.
- mice C3H/HeJ mice (5/group) were passively immunized intraperitoneally by with 100 ⁇ l of a 1 :2 dilution of rabbit anti R2 or preimmune sera in sterile PBS (pre-immune and day 31 immune sera).
- mice were challenged with 1600 CFU Streptococcus pneumoniae serotype 6B (strain SP317). Mice were monitored for 14 days for survival. Eighty percent of the mice immunized with rabbit immune serum raised against polypeptide R2 survived challenge (Figure 4). All mice immunized with pre-immune rabbit serum were dead by day 7.
- C3H/HeJ mice (10/group) were immunized intraperitoneally with CbpA truncate protein RI (15 ⁇ g in 50 ⁇ l PBS, plus 50 ⁇ l Complete Freund's Adjuvant).
- a group of 10 sham immunized mice received PBS and adjuvant.
- a second immunization was administered four weeks later, 15 ⁇ g protein i.p. with Incomplete Freund's Adjuvant (sham received PBS plus IF A). Blood was drawn (retro-orbital bleed) at weeks 3, 6, and 9 for analysis of immune response.
- the ELISA end point anti-CbpA truncate titer of pooled sera from the 10 CbpA immunized mice at 9 weeks was 4,096,000.
- mice No antibody was detected in sera from sham immunized mice.
- Mice were challenged at week 10 with 560 CFU Streptococcus pneumoniae serotype 6B (strain SPSJ2p, provided by P. Flynn, St. Jude Children's Research Hospital, Memphis, TN). Mice were monitored for 14 days for survival. Eighty percent of the mice immunized with CbpA truncate protein RI survived challenge. All sham immunized mice were dead by day 8 ( Figure 7).
- EXAMPLE 5 Prophylaxis against nasopharyngeal colonization in the infant rat In vitro the N terminal domain of CbpA competitively inhibited pneumococcal attachment. To demonstrate the therapeutic utility of peptides with this activity, infant rats were administered truncate peptides, then challenged with pneumococci and colonization of the nasopharynx was evaluated.
- Rats were treated intranasally with 10 ⁇ l of PBS containing 0.8 ⁇ g of polypeptide R2 or RI or no protein. 15 min later Type 3 pneumococci (Strain SIII) (10 ⁇ l containing 1 x 10 5 cfer) were introduced intranasally. To determine the ability of the polypeptide to competitively inhibit pneumococcal adherence and colonization, nasal washing was performed at 72 hours and the number of pneumococci recovered was quantitated in each of 4 animals per group. Rats receiving SHI alone displayed 2200, 6500, 6900 and 8700 (mean 6075) colonies per lO ⁇ l.
- Animals treated with truncate R2 showed the greatest decrease (3600, 3500, 2500, 2100) to mean 2925 bacteria lO ⁇ l (48% of control). Animals treated with truncate RI also showed decreased colonization (5000, 4800, 3500, 1600) to mean 3725 (61% of control).
- polypeptide R2 when: 1) administered as a vaccine antigen elicits protective antibodies and is a preferred composition for a vaccine formulation; and 2) delivered as a peptide to the respiratory tract and/or nasopharynx receptor, competitively prevents pneumococcal attachment and is a preferred composition for a prophylactic and therapeutic agent against colonization or invasive disease.
- truncates of CbpA function as lectins without the CBD.
- Two carbohydrates are recognized: LNnT by a peptide containing both N-terminal repeats (A and C) in Figure 1 and sialic acid by a peptide containing only the single most N- terminal repeat (A).
- the truncate containing the N-terminal repeat polypeptide RI and R2 demonstrates lectin activity in cell culture assays as well.
- polypeptide R2 activity includes: 1) complete correlation of bioactivity of polypeptide R2 and full length CbpA for recognition of purified glycoconjugate receptor analogs, lung cells and animal models. Correlation is also demonstrated for antibodies to them; and 2) cross protection between type 4 derived agents and bacteria in in vitro assays using other serotype (e.g. 6B and 2) which is important for useful vaccine, prophylactic and therapeutic modalities.
- serotype e.g. 6B and 2
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Veterinary Medicine (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Pharmacology & Pharmacy (AREA)
- General Chemical & Material Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Public Health (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Pulmonology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biochemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2000541960A JP4739521B2 (ja) | 1998-04-07 | 1999-04-07 | N−末端コリン結合プロテインa切端形のアミノ酸を含むポリペプチド、それに由来するワクチンおよびその使用 |
| NZ507983A NZ507983A (en) | 1998-04-07 | 1999-04-07 | A polypeptide comprising the amino acid of an n- terminal choline binding protein a truncate, vaccine derived therefrom and uses thereof |
| AU34797/99A AU764811B2 (en) | 1998-04-07 | 1999-04-07 | A polypeptide comprising the amino acid of an n-terminal choline binding protein A truncate, vaccine derived therefrom and uses thereof |
| MXPA00009899A MXPA00009899A (es) | 1998-04-07 | 1999-04-07 | Polipeptido que comprende la secuencia de aminoacidos de un truncado n- terminal de proteina a de union a colina, vacuna derivada del mismo y usos del los mismos. |
| CA2326388A CA2326388C (en) | 1998-04-07 | 1999-04-07 | A polypeptide comprising the amino acid of an n-terminal choline binding protein a truncate, vaccine derived therefrom and uses thereof |
| BR9909910-1A BR9909910A (pt) | 1998-04-07 | 1999-04-07 | Polipeptìdeo compreendendo o aminoácido de um truncado de proteìna a de ligação à colina de terminal n, vacina derivada dele e seus empregos |
| IL13893999A IL138939A0 (en) | 1998-04-07 | 1999-04-07 | A polypeptide comprising the amino acid of an n-terminal choline binding protein a truncate, vaccine derived therefrom and uses thereof |
| HU0102306A HUP0102306A3 (en) | 1998-04-07 | 1999-04-07 | A polypeptide comprising the amino acid of an n-terminal choline binding protein a truncate, vaccine derived therefrom and uses thereof |
| NO20005081A NO20005081L (no) | 1998-04-07 | 2000-10-09 | Et polypeptid som omfatter aminosyren fra et N-terminalt kolinbindende protein A trunkat, vaksine avledet derav og anvendelser derav |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US8087898P | 1998-04-07 | 1998-04-07 | |
| US09/056,019 | 1998-04-07 | ||
| US09/056,019 US6858706B2 (en) | 1998-04-07 | 1998-04-07 | Polypeptide comprising the amino acid of an N-terminal choline binding protein a truncate, vaccine derived therefrom and uses thereof |
| US60/080,878 | 1998-04-07 |
Publications (3)
| Publication Number | Publication Date |
|---|---|
| WO1999051188A2 true WO1999051188A2 (en) | 1999-10-14 |
| WO1999051188A9 WO1999051188A9 (en) | 2000-10-12 |
| WO1999051188A3 WO1999051188A3 (en) | 2001-04-19 |
Family
ID=26734874
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US1999/007669 Ceased WO1999051188A2 (en) | 1998-04-07 | 1999-04-07 | A polypeptide comprising the amino acid of an n-terminal choline binding protein a truncate, vaccine derived therefrom and uses thereof |
Country Status (14)
| Country | Link |
|---|---|
| JP (1) | JP4739521B2 (https=) |
| KR (1) | KR100638503B1 (https=) |
| CN (1) | CN1191851C (https=) |
| AU (2) | AU3479699A (https=) |
| BR (1) | BR9909910A (https=) |
| CA (1) | CA2326388C (https=) |
| HU (1) | HUP0102306A3 (https=) |
| IL (1) | IL138939A0 (https=) |
| MX (1) | MXPA00009899A (https=) |
| NO (1) | NO20005081L (https=) |
| NZ (1) | NZ507983A (https=) |
| PL (1) | PL193132B1 (https=) |
| TR (1) | TR200003498T2 (https=) |
| WO (1) | WO1999051188A2 (https=) |
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2007071711A2 (en) | 2005-12-22 | 2007-06-28 | Glaxosmithkline Biologicals Sa | Vaccine |
| WO2007116028A2 (en) | 2006-04-07 | 2007-10-18 | Glaxosmithkline Biologicals S.A. | Conjugate vaccines |
| US20080081050A1 (en) * | 2000-09-15 | 2008-04-03 | Philippe Hermand | Vaccine against streptococcus pneumoniae |
| WO2009000826A1 (en) | 2007-06-26 | 2008-12-31 | Glaxosmithkline Biologicals S.A. | Vaccine comprising streptococcus pneumoniae capsular polysaccharide conjugates |
| EP2364724A1 (en) | 2005-12-13 | 2011-09-14 | GlaxoSmithKline Biologicals S.A. | Vaccine compositions comprising a saponin adjuvant |
| WO2011110241A1 (en) | 2010-03-09 | 2011-09-15 | Glaxosmithkline Biologicals S.A. | Immunogenic composition comprising s. pneumoniae polysaccharides conjugated to carrier proteins |
| WO2012156391A1 (en) | 2011-05-17 | 2012-11-22 | Glaxosmithkline Biologicals S.A. | Vaccine against streptococcus pneumoniae |
| EP2612680A1 (en) | 2008-04-16 | 2013-07-10 | GlaxoSmithKline Biologicals SA | Vaccine |
| WO2017067962A1 (en) | 2015-10-21 | 2017-04-27 | Glaxosmithkline Biologicals S.A. | Vaccine |
| EP4717778A2 (en) | 2017-07-19 | 2026-04-01 | GlaxoSmithKline Biologicals SA | Immunogenic composition |
Family Cites Families (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6592876B1 (en) * | 1993-04-20 | 2003-07-15 | Uab Research Foundation | Pneumococcal genes, portions thereof, expression products therefrom, and uses of such genes, portions and products |
| ES2262177T3 (es) * | 1996-05-01 | 2006-11-16 | The Rockefeller University | Proteinas de union a colina para vacunas frente a neumococos. |
| JP4469026B2 (ja) * | 1996-10-31 | 2010-05-26 | ヒューマン ジノーム サイエンシーズ,インコーポレイテッド | Streptococcus pneumoniaeの抗原およびワクチン |
| JP2002503087A (ja) * | 1996-11-12 | 2002-01-29 | リージェンツ オブ ザ ユニバーシティ オブ ミネソタ | ストレプトコッカス・ニューモニアのc3結合タンパク質 |
| DE69942176D1 (de) * | 1998-04-07 | 2010-05-06 | Medimmune Llc | Choline-bindende proteine derivate aus pneumokoken als impfstoff |
| US6858706B2 (en) * | 1998-04-07 | 2005-02-22 | St. Jude Children's Research Hospital | Polypeptide comprising the amino acid of an N-terminal choline binding protein a truncate, vaccine derived therefrom and uses thereof |
-
1999
- 1999-04-07 IL IL13893999A patent/IL138939A0/xx unknown
- 1999-04-07 BR BR9909910-1A patent/BR9909910A/pt not_active Application Discontinuation
- 1999-04-07 AU AU34796/99A patent/AU3479699A/en not_active Withdrawn
- 1999-04-07 WO PCT/US1999/007669 patent/WO1999051188A2/en not_active Ceased
- 1999-04-07 KR KR1020007011206A patent/KR100638503B1/ko not_active Expired - Fee Related
- 1999-04-07 PL PL347946A patent/PL193132B1/pl unknown
- 1999-04-07 CA CA2326388A patent/CA2326388C/en not_active Expired - Fee Related
- 1999-04-07 HU HU0102306A patent/HUP0102306A3/hu unknown
- 1999-04-07 MX MXPA00009899A patent/MXPA00009899A/es unknown
- 1999-04-07 JP JP2000541960A patent/JP4739521B2/ja not_active Expired - Fee Related
- 1999-04-07 TR TR2000/03498T patent/TR200003498T2/xx unknown
- 1999-04-07 CN CNB998108545A patent/CN1191851C/zh not_active Expired - Fee Related
- 1999-04-07 AU AU34797/99A patent/AU764811B2/en not_active Ceased
- 1999-04-07 NZ NZ507983A patent/NZ507983A/xx not_active IP Right Cessation
-
2000
- 2000-10-09 NO NO20005081A patent/NO20005081L/no not_active Application Discontinuation
Cited By (30)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2140878A1 (en) | 2000-09-15 | 2010-01-06 | GlaxoSmithKline Biologicals S.A. | Vaccine against streptococcus pneumoniae |
| US20140099339A1 (en) * | 2000-09-15 | 2014-04-10 | Glaxosmithkline Biologicals S.A. | Vaccine against streptococcus pneumoniae |
| EP2314313A1 (en) | 2000-09-15 | 2011-04-27 | GlaxoSmithKline Biologicals S.A. | Vaccine against streptococcus pneumoniae |
| EP2305297A1 (en) | 2000-09-15 | 2011-04-06 | GlaxoSmithKline Biologicals s.a. | Vaccine against streptococcus pneumoniae |
| US20080081050A1 (en) * | 2000-09-15 | 2008-04-03 | Philippe Hermand | Vaccine against streptococcus pneumoniae |
| EP2305298A1 (en) | 2000-09-15 | 2011-04-06 | GlaxoSmithKline Biologicals s.a. | Vaccine against streptococcus pneumoniae |
| CN101502648A (zh) * | 2000-09-15 | 2009-08-12 | 史密斯克莱.比奇曼生物公司 | 疫苗 |
| EP2364723A1 (en) | 2005-12-13 | 2011-09-14 | GlaxoSmithKline Biologicals S.A. | Vaccine compositions comprising a saponin adjuvant |
| EP2364720A1 (en) | 2005-12-13 | 2011-09-14 | GlaxoSmithKline Biologicals S.A. | Vaccine compositions comprising a saponin adjuvant |
| US10143745B2 (en) | 2005-12-13 | 2018-12-04 | GlacoSmithKline Biologicals, S.A. | Vaccine compositions comprising a saponin adjuvant |
| US10039823B2 (en) | 2005-12-13 | 2018-08-07 | Glaxosmithkline Biologicals, S.A. | Vaccine compositions comprising a saponin adjuvant |
| EP2364724A1 (en) | 2005-12-13 | 2011-09-14 | GlaxoSmithKline Biologicals S.A. | Vaccine compositions comprising a saponin adjuvant |
| EP2364721A1 (en) | 2005-12-13 | 2011-09-14 | GlaxoSmithKline Biologicals S.A. | Vaccine compositions comprising a saponin adjuvant |
| EP2364722A1 (en) | 2005-12-13 | 2011-09-14 | GlaxoSmithKline Biologicals S.A. | Vaccine compositions comprising a saponin adjuvant |
| EP2384765A2 (en) | 2005-12-22 | 2011-11-09 | GlaxoSmithKline Biologicals S.A. | Streptococcus pneumoniae vaccine |
| WO2007071707A2 (en) | 2005-12-22 | 2007-06-28 | Glaxosmithkline Biologicals Sa | Pneumococcal polysaccharide conjugate vaccine |
| EP2382986A2 (en) | 2005-12-22 | 2011-11-02 | GlaxoSmithKline Biologicals s.a. | Vaccine against streptococcus pneumoniae |
| WO2007071711A2 (en) | 2005-12-22 | 2007-06-28 | Glaxosmithkline Biologicals Sa | Vaccine |
| EP2402025A2 (en) | 2005-12-22 | 2012-01-04 | GlaxoSmithKline Biologicals S.A. | Vaccine |
| WO2007071710A2 (en) | 2005-12-22 | 2007-06-28 | Glaxosmithkline Biologicals Sa | Vaccine comprising streptococcus pneumoniae capsular polysaccharide conjugates |
| EP3020411A1 (en) | 2005-12-22 | 2016-05-18 | GlaxoSmithKline Biologicals s.a. | Vaccine |
| WO2007116028A2 (en) | 2006-04-07 | 2007-10-18 | Glaxosmithkline Biologicals S.A. | Conjugate vaccines |
| EP2392346A1 (en) | 2006-04-07 | 2011-12-07 | GlaxoSmithKline Biologicals SA | Streptococcus pneumoniae vaccine |
| WO2009000826A1 (en) | 2007-06-26 | 2008-12-31 | Glaxosmithkline Biologicals S.A. | Vaccine comprising streptococcus pneumoniae capsular polysaccharide conjugates |
| EP2687228A2 (en) | 2007-06-26 | 2014-01-22 | GlaxoSmithKline Biologicals S.A. | Vaccine comprising streptococcus pneumoniae capsular polysaccharide conjugates |
| EP2612680A1 (en) | 2008-04-16 | 2013-07-10 | GlaxoSmithKline Biologicals SA | Vaccine |
| WO2011110241A1 (en) | 2010-03-09 | 2011-09-15 | Glaxosmithkline Biologicals S.A. | Immunogenic composition comprising s. pneumoniae polysaccharides conjugated to carrier proteins |
| WO2012156391A1 (en) | 2011-05-17 | 2012-11-22 | Glaxosmithkline Biologicals S.A. | Vaccine against streptococcus pneumoniae |
| WO2017067962A1 (en) | 2015-10-21 | 2017-04-27 | Glaxosmithkline Biologicals S.A. | Vaccine |
| EP4717778A2 (en) | 2017-07-19 | 2026-04-01 | GlaxoSmithKline Biologicals SA | Immunogenic composition |
Also Published As
| Publication number | Publication date |
|---|---|
| BR9909910A (pt) | 2002-01-15 |
| NO20005081D0 (no) | 2000-10-09 |
| CA2326388C (en) | 2014-02-04 |
| CA2326388A1 (en) | 1999-10-14 |
| WO1999051188A3 (en) | 2001-04-19 |
| JP2002516662A (ja) | 2002-06-11 |
| AU3479699A (en) | 1999-10-25 |
| NO20005081L (no) | 2000-12-06 |
| AU764811B2 (en) | 2003-08-28 |
| NZ507983A (en) | 2004-03-26 |
| TR200003498T2 (tr) | 2001-10-22 |
| MXPA00009899A (es) | 2002-05-08 |
| PL347946A1 (en) | 2002-04-22 |
| KR100638503B1 (ko) | 2006-10-26 |
| HUP0102306A1 (hu) | 2001-09-28 |
| WO1999051188A9 (en) | 2000-10-12 |
| KR20010052244A (ko) | 2001-06-25 |
| AU3479799A (en) | 1999-10-25 |
| CN1191851C (zh) | 2005-03-09 |
| HUP0102306A3 (en) | 2008-04-28 |
| JP4739521B2 (ja) | 2011-08-03 |
| IL138939A0 (en) | 2001-11-25 |
| PL193132B1 (pl) | 2007-01-31 |
| CN1342088A (zh) | 2002-03-27 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10632183B2 (en) | Methods and compositions employing immunogenic fusion proteins | |
| EP1810978B1 (en) | Group B streptococcus polypeptides nucleic acids and therapeutic composition and vaccines thereof | |
| US9249199B2 (en) | Synthetic Streptococcus pneumoniae vaccine | |
| US6858706B2 (en) | Polypeptide comprising the amino acid of an N-terminal choline binding protein a truncate, vaccine derived therefrom and uses thereof | |
| US8529912B2 (en) | Group B Streptococcus polypeptides, nucleic acids and therapeutic compositions and vaccines thereof | |
| US6495139B2 (en) | Identification and characterization of novel pneumococcal choline binding protein, CBPG, and diagnostic and therapeutic uses thereof | |
| CA2326388C (en) | A polypeptide comprising the amino acid of an n-terminal choline binding protein a truncate, vaccine derived therefrom and uses thereof | |
| WO2000029434A2 (en) | PNEUMOCOCCAL CHOLINE BINDING PROTEINS, CbpG AND CbpD, DIAGNOSTIC AND THERAPEUTIC USES THEREOF | |
| WO1999064610A1 (en) | ZmpB, A NEW DETERMINANT OF VIRULENCE FOR STREPTOCOCCUS PNEUMONIAE, VACCINE DERIVED THEREFROM AND USES THEREOF | |
| CZ20003803A3 (cs) | Izolovaný polypeptid, izolovaný analog polypeptidu, izolovaný imunogenní polypeptid, izolovaná nukleová kyselina, vektor, hostitelský vektorový systém, protilátka, farmaceutický prostředek, způsob vyvolání imunitní odpovědi, způsob zabránění infekce, vakcína a způsob léčení |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 99810854.5 Country of ref document: CN |
|
| AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AL AM AT AU AZ BA BB BG BR BY CA CH CN CU CZ DE DK EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT UA UG US UZ VN YU ZA ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): GH GM KE LS MW SD SL SZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |
|
| 122 | Ep: pct application non-entry in european phase | ||
| ENP | Entry into the national phase |
Ref document number: 2326388 Country of ref document: CA Ref document number: 2326388 Country of ref document: CA Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020007011206 Country of ref document: KR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 138939 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: PA/a/2000/009899 Country of ref document: MX |
|
| ENP | Entry into the national phase |
Ref document number: 2000 541960 Country of ref document: JP Kind code of ref document: A |
|
| AK | Designated states |
Kind code of ref document: C2 Designated state(s): AE AL AM AT AU AZ BA BB BG BR BY CA CH CN CU CZ DE DK EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT UA UG US UZ VN YU ZA ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: C2 Designated state(s): GH GM KE LS MW SD SL SZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
| COP | Corrected version of pamphlet |
Free format text: PAGES 1/8-8/8, DRAWINGS, REPLACED BY NEW PAGES 1/11-11/11; DUE TO LATE TRANSMITTAL BY THE RECEIVING OFFICE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: PV2000-3803 Country of ref document: CZ |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2000/06309 Country of ref document: ZA Ref document number: 34797/99 Country of ref document: AU Ref document number: 200006309 Country of ref document: ZA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: IN/PCT/2000/00588/MU Country of ref document: IN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 507983 Country of ref document: NZ |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2000/03498 Country of ref document: TR |
|
| DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
| AK | Designated states |
Kind code of ref document: A3 Designated state(s): AE AL AM AT AU AZ BA BB BG BR BY CA CH CN CU CZ DE DK EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT UA UG US UZ VN YU ZA ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A3 Designated state(s): GH GM KE LS MW SD SL SZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
| WWP | Wipo information: published in national office |
Ref document number: PV2000-3803 Country of ref document: CZ |
|
| WWP | Wipo information: published in national office |
Ref document number: 1020007011206 Country of ref document: KR |
|
| 122 | Ep: pct application non-entry in european phase | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 243/MUMNP/2003 Country of ref document: IN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2003/01629 Country of ref document: TR |
|
| WWG | Wipo information: grant in national office |
Ref document number: 34797/99 Country of ref document: AU |
|
| WWG | Wipo information: grant in national office |
Ref document number: 1020007011206 Country of ref document: KR |