WO1995000552B1 - Prostaglandin receptor ep3 and dna encoding it - Google Patents
Prostaglandin receptor ep3 and dna encoding itInfo
- Publication number
- WO1995000552B1 WO1995000552B1 PCT/CA1994/000320 CA9400320W WO9500552B1 WO 1995000552 B1 WO1995000552 B1 WO 1995000552B1 CA 9400320 W CA9400320 W CA 9400320W WO 9500552 B1 WO9500552 B1 WO 9500552B1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- prostaglandin
- receptor
- dna encoding
- seq
- isolated
- Prior art date
Links
- 108010050183 Prostaglandin Receptors Proteins 0.000 title claims abstract 5
- 102000015433 Prostaglandin Receptors Human genes 0.000 title claims abstract 5
- 229920003013 deoxyribonucleic acid Polymers 0.000 title abstract 3
- 108020003175 receptors Proteins 0.000 claims abstract 3
- 102000005962 receptors Human genes 0.000 claims abstract 3
- 150000003180 prostaglandins Chemical class 0.000 claims 2
- 101710011552 PTGER3 Proteins 0.000 claims 1
- 125000003275 alpha amino acid group Chemical group 0.000 claims 1
- 108090000623 proteins and genes Proteins 0.000 claims 1
- 102000004169 proteins and genes Human genes 0.000 claims 1
- 230000000051 modifying Effects 0.000 abstract 1
Abstract
A novel prostaglandin receptor group of the EP3 subtype has been identified and DNA encoding the receptor has been isolated, purified, sequenced and expressed in host cells. DNA encoding the novel prostaglandin receptors and host cells expressing the receptors are used to identify modulators of the prostaglandin receptors.
Claims
1. An isolated and purified human prostaglandin EP3 receptor wherein said receptor specifically binds prostaglandin.
2. The isolated and purified prostaglandin receptor protein of Claim 1 wherein said protein is characterized by an amino acid sequence selected from the group consisting of:
MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNL TRPPGSGEDCGSVSVAFPITMLL
TGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW
EHIDPSGRLCTFFGLTMTWGLSSLFIASAMAVERALAIRAPHWY ASHMKTRATRAVLLG
VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTS SSHNWGNLFFASAFAFLGLL
ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
MMLKMIFNQTSVEHCKTHTΕKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQV
RYHTNNYASSSTSLPCQCSSTLMWSDHLER (SEQ.ID.No .: 10);
MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLL
TGFVGNALAMLIVSRSYRRRES KRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW
EHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLG
VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLL
ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQE
ANAVSSCSNDGQKGQPISLSNEIIQTEA (SEQ.ID.NO.: 11); and
MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLLTG
FVGNALAMLLVSRSYRRRES KRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRWEHIDP
SGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLGVWLAVLA
FALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLLALTVTFSCNL
ATIKLALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLIMMLKMIFNQTSVE
HCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQIEFWGN
(SEQ.ID.NO.: 12).
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA002165953A CA2165953C (en) | 1993-06-25 | 1994-06-09 | Prostaglandin receptor ep3 and dna encoding it |
| AU69919/94A AU6991994A (en) | 1993-06-25 | 1994-06-09 | Prostaglandin receptor ep3 and dna encoding it |
| DE69414109T DE69414109T2 (en) | 1993-06-25 | 1994-06-09 | PROSTAGLANDIN RECEPTOR EP3 AND ENCODING DNA |
| JP50227095A JP3343258B2 (en) | 1993-06-25 | 1994-06-09 | Prostaglandin receptor EP (3) and DNA encoding the receptor |
| DK94918700T DK0705277T3 (en) | 1993-06-25 | 1994-06-09 | Prostaglandin receptor EP3 and DNA encoding it |
| EP94918700A EP0705277B1 (en) | 1993-06-25 | 1994-06-09 | Prostaglandin receptor ep3 and dna encoding it |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US8374693A | 1993-06-25 | 1993-06-25 | |
| US083,746 | 1993-06-25 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO1995000552A1 WO1995000552A1 (en) | 1995-01-05 |
| WO1995000552B1 true WO1995000552B1 (en) | 1995-02-02 |
Family
ID=22180426
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/CA1994/000320 WO1995000552A1 (en) | 1993-06-25 | 1994-06-09 | Prostaglandin receptor ep3 and dna encoding it |
Country Status (9)
| Country | Link |
|---|---|
| EP (1) | EP0705277B1 (en) |
| JP (1) | JP3343258B2 (en) |
| AT (1) | ATE172471T1 (en) |
| AU (1) | AU6991994A (en) |
| CA (1) | CA2165953C (en) |
| DE (1) | DE69414109T2 (en) |
| DK (1) | DK0705277T3 (en) |
| ES (1) | ES2122291T3 (en) |
| WO (1) | WO1995000552A1 (en) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| USRE43372E1 (en) | 1999-03-05 | 2012-05-08 | Duke University | C16 unsaturated FP-selective prostaglandins analogs |
| US8906962B2 (en) | 2000-03-31 | 2014-12-09 | Duke University | Compositions and methods for treating hair loss using non-naturally occurring prostaglandins |
| US9346837B2 (en) | 2000-03-31 | 2016-05-24 | Duke University | Cosmetic and pharmaceutical compositions and methods using 2-decarboxy-2-phosphinico derivatives |
Families Citing this family (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6670134B1 (en) | 1993-11-19 | 2003-12-30 | Allergan, Inc. | Human EP3 prostaglandin receptor |
| US6057433A (en) | 1993-11-19 | 2000-05-02 | Allergan Sales, Inc. | Nucleic acid encoding human EP3 prostaglandin receptor |
| EP0812353A2 (en) | 1995-01-26 | 1997-12-17 | Merck Frosst Canada Inc. | Prostaglandin receptor dp |
| US20030157599A1 (en) * | 2002-01-30 | 2003-08-21 | Decode Genetics Ehf | Gene for peripheral arterial occlusive disease |
| WO2004074830A2 (en) * | 2003-02-24 | 2004-09-02 | Bayer Healthcare Ag | Diagnostics and therapeutics for diseases associated with g-protein coupled receptor prostaglandin e2 ep3 iii (prostaglandin e2 ep3 iii) |
| WO2004075813A2 (en) * | 2003-02-26 | 2004-09-10 | Bayer Healthcare Ag | Diagnostics and therapeutics for diseases associated with g-protein coupled receptor prostaglandin e2 ep3 ii (prostaglandin e2 ep3 ii) |
| WO2004075814A2 (en) * | 2003-02-26 | 2004-09-10 | Bayer Healthcare Ag | Diagnostics and therapeutics for diseases associated with g-protein coupled receptor prostaglandin e2 ep3 i (prostaglandin e2 ep3 i) |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP3508865B2 (en) * | 1992-02-24 | 2004-03-22 | 周 成宮 | Prostaglandin E receptor protein, DNA encoding the same and method for producing the same |
-
1994
- 1994-06-09 ES ES94918700T patent/ES2122291T3/en not_active Expired - Lifetime
- 1994-06-09 JP JP50227095A patent/JP3343258B2/en not_active Expired - Lifetime
- 1994-06-09 WO PCT/CA1994/000320 patent/WO1995000552A1/en active IP Right Grant
- 1994-06-09 DE DE69414109T patent/DE69414109T2/en not_active Expired - Lifetime
- 1994-06-09 EP EP94918700A patent/EP0705277B1/en not_active Expired - Lifetime
- 1994-06-09 AU AU69919/94A patent/AU6991994A/en not_active Abandoned
- 1994-06-09 DK DK94918700T patent/DK0705277T3/en active
- 1994-06-09 AT AT94918700T patent/ATE172471T1/en not_active IP Right Cessation
- 1994-06-09 CA CA002165953A patent/CA2165953C/en not_active Expired - Lifetime
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| USRE43372E1 (en) | 1999-03-05 | 2012-05-08 | Duke University | C16 unsaturated FP-selective prostaglandins analogs |
| US8906962B2 (en) | 2000-03-31 | 2014-12-09 | Duke University | Compositions and methods for treating hair loss using non-naturally occurring prostaglandins |
| US9346837B2 (en) | 2000-03-31 | 2016-05-24 | Duke University | Cosmetic and pharmaceutical compositions and methods using 2-decarboxy-2-phosphinico derivatives |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| WO1995009872B1 (en) | Dna encoding prostaglandin receptor ip | |
| WO1995000551B1 (en) | Prostaglandin receptor fp and dna encoding it | |
| AU779461C (en) | Osteoprotegerin binding proteins and receptors | |
| WO1999014330A8 (en) | DcR3 POLYPEPTIDE, A TNFR HOMOLOG | |
| WO1996022371A3 (en) | C-C CHEMOKINE RECEPTOR 3: CKP-3 OR Eos-L2 | |
| CA2032153A1 (en) | Application of new dna fragments as sequence coding for a signal peptide for the secretion of mature proteins by recombinant yeasts, expression cassettes, processed yeasts and corresponding protein preparation process. | |
| EP1591529A3 (en) | Human CLTA-8 and uses of CTLA-8-related proteins | |
| WO1998055508A3 (en) | HUMAN PROTEINS HAVING TRANSMEMBRANE DOMAINS AND DNAs ENCODING THESE PROTEINS | |
| RS50358B (en) | Osteoprotegerin binding proteins and receptors | |
| CA2400295A1 (en) | Modified factor viii | |
| CA2170509A1 (en) | Dna encoding prostaglandin receptor ep2 | |
| CA2173595A1 (en) | Dna encoding prostaglandin receptor ip | |
| NZ296748A (en) | Peripheral nervous system specific sodium channel proteins, DNA coding therefor, compositions and methods | |
| AU6991894A (en) | Prostaglandin receptor fp and dna encoding it | |
| WO1999002693A3 (en) | Microbial swollenin protein; dna sequences encoding such swollenins and method of producing such swollenins | |
| WO1995000552B1 (en) | Prostaglandin receptor ep3 and dna encoding it | |
| WO1996023066A3 (en) | Prostaglandin receptor, dp | |
| EP1380648A3 (en) | Recombinant DNAase B derived from streptococcus pyogenes | |
| CA2230111A1 (en) | Antisecretory factor peptides regulating pathological permeability changes | |
| AU6839994A (en) | Dna encoding prostaglandin receptor ep1 | |
| WO1996007739A3 (en) | Interleukin-1 type 3 receptors | |
| AU7939894A (en) | Recombinant pilc proteins, process for producing them and their use | |
| CA2165953A1 (en) | Prostaglandin receptor ep3 and dna encoding it | |
| CA2032167A1 (en) | Dna coding for protein binds to enhancer of.alpha.-fetoprotein gene | |
| AU3711597A (en) | A novel galanin receptor |