WO1995000552B1 - Prostaglandin receptor ep3 and dna encoding it - Google Patents
Prostaglandin receptor ep3 and dna encoding itInfo
- Publication number
- WO1995000552B1 WO1995000552B1 PCT/CA1994/000320 CA9400320W WO9500552B1 WO 1995000552 B1 WO1995000552 B1 WO 1995000552B1 CA 9400320 W CA9400320 W CA 9400320W WO 9500552 B1 WO9500552 B1 WO 9500552B1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- prostaglandin
- receptor
- dna encoding
- seq
- isolated
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Abstract
A novel prostaglandin receptor group of the EP3 subtype has been identified and DNA encoding the receptor has been isolated, purified, sequenced and expressed in host cells. DNA encoding the novel prostaglandin receptors and host cells expressing the receptors are used to identify modulators of the prostaglandin receptors.
Claims
1. An isolated and purified human prostaglandin EP3 receptor wherein said receptor specifically binds prostaglandin.
2. The isolated and purified prostaglandin receptor protein of Claim 1 wherein said protein is characterized by an amino acid sequence selected from the group consisting of:
MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNL TRPPGSGEDCGSVSVAFPITMLL
TGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW
EHIDPSGRLCTFFGLTMTWGLSSLFIASAMAVERALAIRAPHWY ASHMKTRATRAVLLG
VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTS SSHNWGNLFFASAFAFLGLL
ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
MMLKMIFNQTSVEHCKTHTΕKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQV
RYHTNNYASSSTSLPCQCSSTLMWSDHLER (SEQ.ID.No .: 10);
MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLL
TGFVGNALAMLIVSRSYRRRES KRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW
EHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLG
VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLL
ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQE
ANAVSSCSNDGQKGQPISLSNEIIQTEA (SEQ.ID.NO.: 11); and
MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLLTG
FVGNALAMLLVSRSYRRRES KRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRWEHIDP
SGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLGVWLAVLA
FALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLLALTVTFSCNL
ATIKLALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLIMMLKMIFNQTSVE
HCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQIEFWGN
(SEQ.ID.NO.: 12).
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| DK94918700T DK0705277T3 (en) | 1993-06-25 | 1994-06-09 | Prostaglandin receptor EP3 and DNA encoding it |
| AU69919/94A AU6991994A (en) | 1993-06-25 | 1994-06-09 | Prostaglandin receptor ep3 and dna encoding it |
| EP94918700A EP0705277B1 (en) | 1993-06-25 | 1994-06-09 | Prostaglandin receptor ep3 and dna encoding it |
| CA002165953A CA2165953C (en) | 1993-06-25 | 1994-06-09 | Prostaglandin receptor ep3 and dna encoding it |
| JP50227095A JP3343258B2 (en) | 1993-06-25 | 1994-06-09 | Prostaglandin receptor EP (3) and DNA encoding the receptor |
| DE69414109T DE69414109T2 (en) | 1993-06-25 | 1994-06-09 | PROSTAGLANDIN RECEPTOR EP3 AND ENCODING DNA |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US083,746 | 1987-08-06 | ||
| US8374693A | 1993-06-25 | 1993-06-25 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO1995000552A1 WO1995000552A1 (en) | 1995-01-05 |
| WO1995000552B1 true WO1995000552B1 (en) | 1995-02-02 |
Family
ID=22180426
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/CA1994/000320 Ceased WO1995000552A1 (en) | 1993-06-25 | 1994-06-09 | Prostaglandin receptor ep3 and dna encoding it |
Country Status (9)
| Country | Link |
|---|---|
| EP (1) | EP0705277B1 (en) |
| JP (1) | JP3343258B2 (en) |
| AT (1) | ATE172471T1 (en) |
| AU (1) | AU6991994A (en) |
| CA (1) | CA2165953C (en) |
| DE (1) | DE69414109T2 (en) |
| DK (1) | DK0705277T3 (en) |
| ES (1) | ES2122291T3 (en) |
| WO (1) | WO1995000552A1 (en) |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6894175B1 (en) | 1999-08-04 | 2005-05-17 | The Procter & Gamble Company | 2-Decarboxy-2-phosphinico prostaglandin derivatives and methods for their preparation and use |
| USRE43372E1 (en) | 1999-03-05 | 2012-05-08 | Duke University | C16 unsaturated FP-selective prostaglandins analogs |
| US8906962B2 (en) | 2000-03-31 | 2014-12-09 | Duke University | Compositions and methods for treating hair loss using non-naturally occurring prostaglandins |
| US9346837B2 (en) | 2000-03-31 | 2016-05-24 | Duke University | Cosmetic and pharmaceutical compositions and methods using 2-decarboxy-2-phosphinico derivatives |
Families Citing this family (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6670134B1 (en) | 1993-11-19 | 2003-12-30 | Allergan, Inc. | Human EP3 prostaglandin receptor |
| US6057433A (en) | 1993-11-19 | 2000-05-02 | Allergan Sales, Inc. | Nucleic acid encoding human EP3 prostaglandin receptor |
| JP3064015B2 (en) | 1995-01-26 | 2000-07-12 | メルク フロスト カナダ アンド カンパニー | Prostaglandin receptor DP |
| US20020037914A1 (en) | 2000-03-31 | 2002-03-28 | Delong Mitchell Anthony | Compositions and methods for treating hair loss using C16-C20 aromatic tetrahydro prostaglandins |
| US20030157599A1 (en) * | 2002-01-30 | 2003-08-21 | Decode Genetics Ehf | Gene for peripheral arterial occlusive disease |
| WO2004074830A2 (en) * | 2003-02-24 | 2004-09-02 | Bayer Healthcare Ag | Diagnostics and therapeutics for diseases associated with g-protein coupled receptor prostaglandin e2 ep3 iii (prostaglandin e2 ep3 iii) |
| WO2004075814A2 (en) * | 2003-02-26 | 2004-09-10 | Bayer Healthcare Ag | Diagnostics and therapeutics for diseases associated with g-protein coupled receptor prostaglandin e2 ep3 i (prostaglandin e2 ep3 i) |
| WO2004075813A2 (en) * | 2003-02-26 | 2004-09-10 | Bayer Healthcare Ag | Diagnostics and therapeutics for diseases associated with g-protein coupled receptor prostaglandin e2 ep3 ii (prostaglandin e2 ep3 ii) |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP3508865B2 (en) * | 1992-02-24 | 2004-03-22 | 周 成宮 | Prostaglandin E receptor protein, DNA encoding the same and method for producing the same |
-
1994
- 1994-06-09 ES ES94918700T patent/ES2122291T3/en not_active Expired - Lifetime
- 1994-06-09 AT AT94918700T patent/ATE172471T1/en not_active IP Right Cessation
- 1994-06-09 DK DK94918700T patent/DK0705277T3/en active
- 1994-06-09 AU AU69919/94A patent/AU6991994A/en not_active Abandoned
- 1994-06-09 EP EP94918700A patent/EP0705277B1/en not_active Expired - Lifetime
- 1994-06-09 JP JP50227095A patent/JP3343258B2/en not_active Expired - Lifetime
- 1994-06-09 CA CA002165953A patent/CA2165953C/en not_active Expired - Lifetime
- 1994-06-09 DE DE69414109T patent/DE69414109T2/en not_active Expired - Lifetime
- 1994-06-09 WO PCT/CA1994/000320 patent/WO1995000552A1/en not_active Ceased
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| USRE43372E1 (en) | 1999-03-05 | 2012-05-08 | Duke University | C16 unsaturated FP-selective prostaglandins analogs |
| US6894175B1 (en) | 1999-08-04 | 2005-05-17 | The Procter & Gamble Company | 2-Decarboxy-2-phosphinico prostaglandin derivatives and methods for their preparation and use |
| US8906962B2 (en) | 2000-03-31 | 2014-12-09 | Duke University | Compositions and methods for treating hair loss using non-naturally occurring prostaglandins |
| US9346837B2 (en) | 2000-03-31 | 2016-05-24 | Duke University | Cosmetic and pharmaceutical compositions and methods using 2-decarboxy-2-phosphinico derivatives |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| WO1995009872B1 (en) | Dna encoding prostaglandin receptor ip | |
| WO1995000551B1 (en) | Prostaglandin receptor fp and dna encoding it | |
| AU779461C (en) | Osteoprotegerin binding proteins and receptors | |
| WO1999014330A8 (en) | DcR3 POLYPEPTIDE, A TNFR HOMOLOG | |
| CA2032153A1 (en) | Application of new dna fragments as sequence coding for a signal peptide for the secretion of mature proteins by recombinant yeasts, expression cassettes, processed yeasts and corresponding protein preparation process. | |
| EP1591529A3 (en) | Human CLTA-8 and uses of CTLA-8-related proteins | |
| CA2087261A1 (en) | Purification directed cloning of peptides | |
| WO1995000552B1 (en) | Prostaglandin receptor ep3 and dna encoding it | |
| WO1998055508A3 (en) | HUMAN PROTEINS HAVING TRANSMEMBRANE DOMAINS AND DNAs ENCODING THESE PROTEINS | |
| CA2170509A1 (en) | Dna encoding prostaglandin receptor ep2 | |
| CA2173595A1 (en) | Dna encoding prostaglandin receptor ip | |
| KR19980701570A (en) | ||
| NZ296748A (en) | Peripheral nervous system specific sodium channel proteins, DNA coding therefor, compositions and methods | |
| EP0175360A3 (en) | Peptide antibodies and their use in detecting oncogene products | |
| AU6991894A (en) | Prostaglandin receptor fp and dna encoding it | |
| IE861977L (en) | Fusion proteins | |
| WO1999002693A8 (en) | Microbial swollenin protein; dna sequences encoding such swollenins and method of producing such swollenins | |
| WO1996023066A3 (en) | Prostaglandin receptor, dp | |
| EP1380648A3 (en) | Recombinant DNAase B derived from streptococcus pyogenes | |
| CA2230111A1 (en) | Antisecretory factor peptides regulating pathological permeability changes | |
| WO1996007739A3 (en) | Interleukin-1 type 3 receptors | |
| AU6839994A (en) | Dna encoding prostaglandin receptor ep1 | |
| CA2165953A1 (en) | Prostaglandin receptor ep3 and dna encoding it | |
| CA2032167A1 (en) | Dna coding for protein binds to enhancer of.alpha.-fetoprotein gene | |
| WO1996023884A3 (en) | Human peroxisome proliferator activated receptors |