US9346883B2 - Antibodies against HER3 - Google Patents
Antibodies against HER3 Download PDFInfo
- Publication number
- US9346883B2 US9346883B2 US14/116,562 US201214116562A US9346883B2 US 9346883 B2 US9346883 B2 US 9346883B2 US 201214116562 A US201214116562 A US 201214116562A US 9346883 B2 US9346883 B2 US 9346883B2
- Authority
- US
- United States
- Prior art keywords
- seq
- antibody
- her3
- antibodies
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
- 101710100969 Receptor tyrosine-protein kinase erbB-3 Proteins 0.000 title abstract description 102
- 102100029986 Receptor tyrosine-protein kinase erbB-3 Human genes 0.000 title abstract description 102
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 35
- 201000011510 cancer Diseases 0.000 claims abstract description 17
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 46
- 238000000034 method Methods 0.000 claims description 23
- 239000013598 vector Substances 0.000 claims description 21
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 18
- 150000007523 nucleic acids Chemical class 0.000 claims description 17
- 108020004707 nucleic acids Proteins 0.000 claims description 16
- 102000039446 nucleic acids Human genes 0.000 claims description 16
- 108010021625 Immunoglobulin Fragments Proteins 0.000 claims description 10
- 102000008394 Immunoglobulin Fragments Human genes 0.000 claims description 10
- 239000008194 pharmaceutical composition Substances 0.000 claims description 8
- 239000003937 drug carrier Substances 0.000 claims description 5
- 238000011282 treatment Methods 0.000 abstract description 18
- 210000004027 cell Anatomy 0.000 description 81
- 230000027455 binding Effects 0.000 description 75
- 230000014509 gene expression Effects 0.000 description 29
- 235000001014 amino acid Nutrition 0.000 description 28
- 108090000623 proteins and genes Proteins 0.000 description 25
- 102100035360 Cerebellar degeneration-related antigen 1 Human genes 0.000 description 24
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 24
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 24
- 229940024606 amino acid Drugs 0.000 description 23
- 150000001413 amino acids Chemical class 0.000 description 22
- 239000000427 antigen Substances 0.000 description 22
- 102000036639 antigens Human genes 0.000 description 22
- 108091007433 antigens Proteins 0.000 description 22
- 230000004048 modification Effects 0.000 description 21
- 238000012986 modification Methods 0.000 description 21
- 102400000058 Neuregulin-1 Human genes 0.000 description 18
- 108090000556 Neuregulin-1 Proteins 0.000 description 18
- 239000000203 mixture Substances 0.000 description 18
- 108090000765 processed proteins & peptides Proteins 0.000 description 18
- 235000018102 proteins Nutrition 0.000 description 17
- 102000004169 proteins and genes Human genes 0.000 description 17
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 16
- 230000013595 glycosylation Effects 0.000 description 15
- 238000006206 glycosylation reaction Methods 0.000 description 15
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 description 13
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 description 13
- YOHYSYJDKVYCJI-UHFFFAOYSA-N n-[3-[[6-[3-(trifluoromethyl)anilino]pyrimidin-4-yl]amino]phenyl]cyclopropanecarboxamide Chemical compound FC(F)(F)C1=CC=CC(NC=2N=CN=C(NC=3C=C(NC(=O)C4CC4)C=CC=3)C=2)=C1 YOHYSYJDKVYCJI-UHFFFAOYSA-N 0.000 description 13
- 239000000243 solution Substances 0.000 description 13
- 101100112922 Candida albicans CDR3 gene Proteins 0.000 description 12
- 238000013459 approach Methods 0.000 description 12
- 102000004196 processed proteins & peptides Human genes 0.000 description 12
- 101001010819 Homo sapiens Receptor tyrosine-protein kinase erbB-3 Proteins 0.000 description 11
- 125000000539 amino acid group Chemical group 0.000 description 11
- 238000004458 analytical method Methods 0.000 description 11
- 239000000872 buffer Substances 0.000 description 11
- 239000012634 fragment Substances 0.000 description 11
- 239000000833 heterodimer Substances 0.000 description 11
- 229920001223 polyethylene glycol Polymers 0.000 description 11
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 10
- 241000699670 Mus sp. Species 0.000 description 10
- 108091028043 Nucleic acid sequence Proteins 0.000 description 10
- 239000002202 Polyethylene glycol Substances 0.000 description 10
- 239000013604 expression vector Substances 0.000 description 10
- 102000057750 human ERBB3 Human genes 0.000 description 10
- 239000003446 ligand Substances 0.000 description 10
- 239000013642 negative control Substances 0.000 description 10
- 102000005962 receptors Human genes 0.000 description 10
- 108020003175 receptors Proteins 0.000 description 10
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 9
- 102100029981 Receptor tyrosine-protein kinase erbB-4 Human genes 0.000 description 9
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 9
- 230000005764 inhibitory process Effects 0.000 description 9
- 230000009257 reactivity Effects 0.000 description 9
- 239000011780 sodium chloride Substances 0.000 description 9
- 230000001225 therapeutic effect Effects 0.000 description 9
- 108020004414 DNA Proteins 0.000 description 8
- 108060003951 Immunoglobulin Proteins 0.000 description 8
- 101710100963 Receptor tyrosine-protein kinase erbB-4 Proteins 0.000 description 8
- 208000035475 disorder Diseases 0.000 description 8
- 239000003814 drug Substances 0.000 description 8
- 102000018358 immunoglobulin Human genes 0.000 description 8
- 239000012528 membrane Substances 0.000 description 8
- 210000004379 membrane Anatomy 0.000 description 8
- 229920001184 polypeptide Polymers 0.000 description 8
- 239000013641 positive control Substances 0.000 description 8
- 241000894006 Bacteria Species 0.000 description 7
- 241000699666 Mus <mouse, genus> Species 0.000 description 7
- 230000015572 biosynthetic process Effects 0.000 description 7
- 230000006870 function Effects 0.000 description 7
- 230000026731 phosphorylation Effects 0.000 description 7
- 238000006366 phosphorylation reaction Methods 0.000 description 7
- 239000003981 vehicle Substances 0.000 description 7
- 238000002965 ELISA Methods 0.000 description 6
- 101100501693 Mus musculus Erbb3 gene Proteins 0.000 description 6
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 6
- 230000000875 corresponding effect Effects 0.000 description 6
- 230000007423 decrease Effects 0.000 description 6
- 238000002474 experimental method Methods 0.000 description 6
- 238000009472 formulation Methods 0.000 description 6
- 238000004519 manufacturing process Methods 0.000 description 6
- 238000002360 preparation method Methods 0.000 description 6
- 150000003839 salts Chemical class 0.000 description 6
- 206010006187 Breast cancer Diseases 0.000 description 5
- 208000026310 Breast neoplasm Diseases 0.000 description 5
- 241000206602 Eukaryota Species 0.000 description 5
- 108010087819 Fc receptors Proteins 0.000 description 5
- 102000009109 Fc receptors Human genes 0.000 description 5
- 241000700605 Viruses Species 0.000 description 5
- 230000000295 complement effect Effects 0.000 description 5
- 239000006185 dispersion Substances 0.000 description 5
- 229940079593 drug Drugs 0.000 description 5
- 239000003623 enhancer Substances 0.000 description 5
- 210000004602 germ cell Anatomy 0.000 description 5
- 238000011534 incubation Methods 0.000 description 5
- 239000002502 liposome Substances 0.000 description 5
- 210000004962 mammalian cell Anatomy 0.000 description 5
- 239000002773 nucleotide Substances 0.000 description 5
- 125000003729 nucleotide group Chemical group 0.000 description 5
- 239000013612 plasmid Substances 0.000 description 5
- 230000004083 survival effect Effects 0.000 description 5
- 238000002877 time resolved fluorescence resonance energy transfer Methods 0.000 description 5
- 229960000575 trastuzumab Drugs 0.000 description 5
- 238000005406 washing Methods 0.000 description 5
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 4
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 4
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 4
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 4
- 108091005804 Peptidases Proteins 0.000 description 4
- 239000004365 Protease Substances 0.000 description 4
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 4
- 239000007976 Tris-NaCl-Tween buffer Substances 0.000 description 4
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 4
- 239000007864 aqueous solution Substances 0.000 description 4
- 239000011230 binding agent Substances 0.000 description 4
- 150000001875 compounds Chemical class 0.000 description 4
- 230000009260 cross reactivity Effects 0.000 description 4
- 238000010790 dilution Methods 0.000 description 4
- 239000012895 dilution Substances 0.000 description 4
- 238000000684 flow cytometry Methods 0.000 description 4
- 239000003112 inhibitor Substances 0.000 description 4
- 239000007788 liquid Substances 0.000 description 4
- 238000002703 mutagenesis Methods 0.000 description 4
- 231100000350 mutagenesis Toxicity 0.000 description 4
- -1 polyethylene Polymers 0.000 description 4
- 238000000746 purification Methods 0.000 description 4
- 230000002829 reductive effect Effects 0.000 description 4
- 230000009870 specific binding Effects 0.000 description 4
- 238000006467 substitution reaction Methods 0.000 description 4
- 230000004614 tumor growth Effects 0.000 description 4
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 3
- 206010009944 Colon cancer Diseases 0.000 description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 3
- 102000001301 EGF receptor Human genes 0.000 description 3
- 238000012286 ELISA Assay Methods 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 3
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 3
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 3
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 3
- 241000124008 Mammalia Species 0.000 description 3
- 241001529936 Murinae Species 0.000 description 3
- 206010061309 Neoplasm progression Diseases 0.000 description 3
- 206010061535 Ovarian neoplasm Diseases 0.000 description 3
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 3
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 3
- 239000002253 acid Substances 0.000 description 3
- 238000007792 addition Methods 0.000 description 3
- 239000012736 aqueous medium Substances 0.000 description 3
- 238000003556 assay Methods 0.000 description 3
- 230000004071 biological effect Effects 0.000 description 3
- 229940098773 bovine serum albumin Drugs 0.000 description 3
- 150000001720 carbohydrates Chemical class 0.000 description 3
- 235000014633 carbohydrates Nutrition 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 239000003795 chemical substances by application Substances 0.000 description 3
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 3
- 230000002860 competitive effect Effects 0.000 description 3
- 230000000694 effects Effects 0.000 description 3
- 125000002446 fucosyl group Chemical group C1([C@@H](O)[C@H](O)[C@H](O)[C@@H](O1)C)* 0.000 description 3
- 238000005734 heterodimerization reaction Methods 0.000 description 3
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 3
- 230000005847 immunogenicity Effects 0.000 description 3
- 239000004615 ingredient Substances 0.000 description 3
- 230000002401 inhibitory effect Effects 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 244000005700 microbiome Species 0.000 description 3
- 239000002105 nanoparticle Substances 0.000 description 3
- 229960002087 pertuzumab Drugs 0.000 description 3
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M potassium chloride Inorganic materials [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 210000002966 serum Anatomy 0.000 description 3
- 230000011664 signaling Effects 0.000 description 3
- 239000007787 solid Substances 0.000 description 3
- 239000002904 solvent Substances 0.000 description 3
- 206010041823 squamous cell carcinoma Diseases 0.000 description 3
- 238000007920 subcutaneous administration Methods 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- 230000005751 tumor progression Effects 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 2
- 206010069754 Acquired gene mutation Diseases 0.000 description 2
- 238000011729 BALB/c nude mouse Methods 0.000 description 2
- 206010005003 Bladder cancer Diseases 0.000 description 2
- 102000004506 Blood Proteins Human genes 0.000 description 2
- 108010017384 Blood Proteins Proteins 0.000 description 2
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 2
- 241000283707 Capra Species 0.000 description 2
- 201000009030 Carcinoma Diseases 0.000 description 2
- SHZGCJCMOBCMKK-UHFFFAOYSA-N D-mannomethylose Natural products CC1OC(O)C(O)C(O)C1O SHZGCJCMOBCMKK-UHFFFAOYSA-N 0.000 description 2
- 108060006698 EGF receptor Proteins 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- PNNNRSAQSRJVSB-SLPGGIOYSA-N Fucose Natural products C[C@H](O)[C@@H](O)[C@H](O)[C@H](O)C=O PNNNRSAQSRJVSB-SLPGGIOYSA-N 0.000 description 2
- 102000006471 Fucosyltransferases Human genes 0.000 description 2
- 108010019236 Fucosyltransferases Proteins 0.000 description 2
- 241000233866 Fungi Species 0.000 description 2
- 206010017993 Gastrointestinal neoplasms Diseases 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- 108091006905 Human Serum Albumin Proteins 0.000 description 2
- 102000008100 Human Serum Albumin Human genes 0.000 description 2
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 2
- 208000008839 Kidney Neoplasms Diseases 0.000 description 2
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 2
- SHZGCJCMOBCMKK-DHVFOXMCSA-N L-fucopyranose Chemical compound C[C@@H]1OC(O)[C@@H](O)[C@H](O)[C@@H]1O SHZGCJCMOBCMKK-DHVFOXMCSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 2
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 2
- 241000282560 Macaca mulatta Species 0.000 description 2
- 241000699660 Mus musculus Species 0.000 description 2
- 206010033128 Ovarian cancer Diseases 0.000 description 2
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 2
- 102000057297 Pepsin A Human genes 0.000 description 2
- 108090000284 Pepsin A Proteins 0.000 description 2
- 102000003992 Peroxidases Human genes 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 2
- 206010038389 Renal cancer Diseases 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 208000005718 Stomach Neoplasms Diseases 0.000 description 2
- 229910052771 Terbium Inorganic materials 0.000 description 2
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 2
- 239000004473 Threonine Substances 0.000 description 2
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 2
- 239000007983 Tris buffer Substances 0.000 description 2
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 2
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 239000004480 active ingredient Substances 0.000 description 2
- 239000013543 active substance Substances 0.000 description 2
- 235000004279 alanine Nutrition 0.000 description 2
- 210000004102 animal cell Anatomy 0.000 description 2
- 210000000481 breast Anatomy 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 239000001913 cellulose Substances 0.000 description 2
- 229920002678 cellulose Polymers 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- 208000029742 colonic neoplasm Diseases 0.000 description 2
- 230000009137 competitive binding Effects 0.000 description 2
- 230000004540 complement-dependent cytotoxicity Effects 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 238000010168 coupling process Methods 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- 238000012258 culturing Methods 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 238000004163 cytometry Methods 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 230000002950 deficient Effects 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 239000000539 dimer Substances 0.000 description 2
- 239000002612 dispersion medium Substances 0.000 description 2
- 230000003828 downregulation Effects 0.000 description 2
- 230000007783 downstream signaling Effects 0.000 description 2
- 239000012893 effector ligand Substances 0.000 description 2
- 235000013861 fat-free Nutrition 0.000 description 2
- 210000002950 fibroblast Anatomy 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- 238000002825 functional assay Methods 0.000 description 2
- 230000004927 fusion Effects 0.000 description 2
- 101150023212 fut8 gene Proteins 0.000 description 2
- 206010017758 gastric cancer Diseases 0.000 description 2
- 230000002496 gastric effect Effects 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 2
- 230000001771 impaired effect Effects 0.000 description 2
- 238000002513 implantation Methods 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 238000007912 intraperitoneal administration Methods 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 201000010982 kidney cancer Diseases 0.000 description 2
- 208000032839 leukemia Diseases 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 208000014018 liver neoplasm Diseases 0.000 description 2
- 210000004072 lung Anatomy 0.000 description 2
- 201000005202 lung cancer Diseases 0.000 description 2
- 208000020816 lung neoplasm Diseases 0.000 description 2
- 229920002521 macromolecule Polymers 0.000 description 2
- 229910001629 magnesium chloride Inorganic materials 0.000 description 2
- 239000011159 matrix material Substances 0.000 description 2
- 235000013336 milk Nutrition 0.000 description 2
- 239000008267 milk Substances 0.000 description 2
- 210000004080 milk Anatomy 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 238000011580 nude mouse model Methods 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 235000019198 oils Nutrition 0.000 description 2
- 230000002611 ovarian Effects 0.000 description 2
- 238000004806 packaging method and process Methods 0.000 description 2
- 208000008443 pancreatic carcinoma Diseases 0.000 description 2
- 238000007911 parenteral administration Methods 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 230000001575 pathological effect Effects 0.000 description 2
- 230000006320 pegylation Effects 0.000 description 2
- 229940111202 pepsin Drugs 0.000 description 2
- 108040007629 peroxidase activity proteins Proteins 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- YBYRMVIVWMBXKQ-UHFFFAOYSA-N phenylmethanesulfonyl fluoride Chemical compound FS(=O)(=O)CC1=CC=CC=C1 YBYRMVIVWMBXKQ-UHFFFAOYSA-N 0.000 description 2
- 230000004962 physiological condition Effects 0.000 description 2
- 239000001103 potassium chloride Substances 0.000 description 2
- 238000011002 quantification Methods 0.000 description 2
- 230000000717 retained effect Effects 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- 229920006395 saturated elastomer Polymers 0.000 description 2
- 238000002741 site-directed mutagenesis Methods 0.000 description 2
- PUZPDOWCWNUUKD-UHFFFAOYSA-M sodium fluoride Chemical compound [F-].[Na+] PUZPDOWCWNUUKD-UHFFFAOYSA-M 0.000 description 2
- 239000001488 sodium phosphate Substances 0.000 description 2
- 230000037439 somatic mutation Effects 0.000 description 2
- 208000017572 squamous cell neoplasm Diseases 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 201000011549 stomach cancer Diseases 0.000 description 2
- 238000003860 storage Methods 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 239000004094 surface-active agent Substances 0.000 description 2
- 238000002626 targeted therapy Methods 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 238000013518 transcription Methods 0.000 description 2
- 230000035897 transcription Effects 0.000 description 2
- 230000014616 translation Effects 0.000 description 2
- GETQZCLCWQTVFV-UHFFFAOYSA-N trimethylamine Chemical compound CN(C)C GETQZCLCWQTVFV-UHFFFAOYSA-N 0.000 description 2
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 2
- 210000004881 tumor cell Anatomy 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 201000005112 urinary bladder cancer Diseases 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 239000013603 viral vector Substances 0.000 description 2
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- ASOKPJOREAFHNY-UHFFFAOYSA-N 1-Hydroxybenzotriazole Chemical compound C1=CC=C2N(O)N=NC2=C1 ASOKPJOREAFHNY-UHFFFAOYSA-N 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- 239000013607 AAV vector Substances 0.000 description 1
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 1
- 206010061424 Anal cancer Diseases 0.000 description 1
- 101100067974 Arabidopsis thaliana POP2 gene Proteins 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 238000009010 Bradford assay Methods 0.000 description 1
- 230000005724 C-terminal phosphorylation Effects 0.000 description 1
- 241000282465 Canis Species 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 1
- 101150074155 DHFR gene Proteins 0.000 description 1
- 230000004544 DNA amplification Effects 0.000 description 1
- 206010061818 Disease progression Diseases 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 102400001368 Epidermal growth factor Human genes 0.000 description 1
- 101800003838 Epidermal growth factor Proteins 0.000 description 1
- 241000282324 Felis Species 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 102000051366 Glycosyltransferases Human genes 0.000 description 1
- 108700023372 Glycosyltransferases Proteins 0.000 description 1
- 101150054472 HER2 gene Proteins 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101100118549 Homo sapiens EGFR gene Proteins 0.000 description 1
- 101500025419 Homo sapiens Epidermal growth factor Proteins 0.000 description 1
- 101000851181 Homo sapiens Epidermal growth factor receptor Proteins 0.000 description 1
- 101001010823 Homo sapiens Receptor tyrosine-protein kinase erbB-4 Proteins 0.000 description 1
- 229920002153 Hydroxypropyl cellulose Polymers 0.000 description 1
- 108010073807 IgG Receptors Proteins 0.000 description 1
- 102100026120 IgG receptor FcRn large subunit p51 Human genes 0.000 description 1
- 101710177940 IgG receptor FcRn large subunit p51 Proteins 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 241000283162 Inia geoffrensis Species 0.000 description 1
- 238000010824 Kaplan-Meier survival analysis Methods 0.000 description 1
- 241000235649 Kluyveromyces Species 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- 239000005411 L01XE02 - Gefitinib Substances 0.000 description 1
- 239000005551 L01XE03 - Erlotinib Substances 0.000 description 1
- 239000002136 L01XE07 - Lapatinib Substances 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 1
- 206010025323 Lymphomas Diseases 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- BELBBZDIHDAJOR-UHFFFAOYSA-N Phenolsulfonephthalein Chemical compound C1=CC(O)=CC=C1C1(C=2C=CC(O)=CC=2)C2=CC=CC=C2S(=O)(=O)O1 BELBBZDIHDAJOR-UHFFFAOYSA-N 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 206010060862 Prostate cancer Diseases 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 1
- 102000001253 Protein Kinase Human genes 0.000 description 1
- 101100431670 Rattus norvegicus Ybx3 gene Proteins 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 208000015634 Rectal Neoplasms Diseases 0.000 description 1
- 102000002278 Ribosomal Proteins Human genes 0.000 description 1
- 108010000605 Ribosomal Proteins Proteins 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 239000006146 Roswell Park Memorial Institute medium Substances 0.000 description 1
- 101100123851 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) HER1 gene Proteins 0.000 description 1
- 206010061934 Salivary gland cancer Diseases 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 206010041067 Small cell lung cancer Diseases 0.000 description 1
- KEAYESYHFKHZAL-UHFFFAOYSA-N Sodium Chemical compound [Na] KEAYESYHFKHZAL-UHFFFAOYSA-N 0.000 description 1
- 108010022394 Threonine synthase Proteins 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 206010047741 Vulval cancer Diseases 0.000 description 1
- 230000001594 aberrant effect Effects 0.000 description 1
- 238000010306 acid treatment Methods 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 238000005917 acylation reaction Methods 0.000 description 1
- 210000001789 adipocyte Anatomy 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 150000001294 alanine derivatives Chemical class 0.000 description 1
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 1
- 238000012867 alanine scanning Methods 0.000 description 1
- 150000001299 aldehydes Chemical class 0.000 description 1
- 238000005804 alkylation reaction Methods 0.000 description 1
- 230000000172 allergic effect Effects 0.000 description 1
- 230000003281 allosteric effect Effects 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 201000007538 anal carcinoma Diseases 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 238000011230 antibody-based therapy Methods 0.000 description 1
- 229940121375 antifungal agent Drugs 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 210000004507 artificial chromosome Anatomy 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 208000010668 atopic eczema Diseases 0.000 description 1
- 239000002585 base Substances 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 238000004166 bioassay Methods 0.000 description 1
- 229920002988 biodegradable polymer Polymers 0.000 description 1
- 239000004621 biodegradable polymer Substances 0.000 description 1
- 201000000053 blastoma Diseases 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 238000000423 cell based assay Methods 0.000 description 1
- 230000022131 cell cycle Effects 0.000 description 1
- 230000025084 cell cycle arrest Effects 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 230000004709 cell invasion Effects 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 230000005889 cellular cytotoxicity Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 229960005395 cetuximab Drugs 0.000 description 1
- 239000003638 chemical reducing agent Substances 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 238000011281 clinical therapy Methods 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 238000012875 competitive assay Methods 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 238000005520 cutting process Methods 0.000 description 1
- WZHCOOQXZCIUNC-UHFFFAOYSA-N cyclandelate Chemical compound C1C(C)(C)CC(C)CC1OC(=O)C(O)C1=CC=CC=C1 WZHCOOQXZCIUNC-UHFFFAOYSA-N 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- 230000001461 cytolytic effect Effects 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- UGMCXQCYOVCMTB-UHFFFAOYSA-K dihydroxy(stearato)aluminium Chemical compound CCCCCCCCCCCCCCCCCC(=O)O[Al](O)O UGMCXQCYOVCMTB-UHFFFAOYSA-K 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 230000005750 disease progression Effects 0.000 description 1
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 1
- 229910000397 disodium phosphate Inorganic materials 0.000 description 1
- 235000019800 disodium phosphate Nutrition 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 201000008184 embryoma Diseases 0.000 description 1
- 210000002308 embryonic cell Anatomy 0.000 description 1
- 201000003914 endometrial carcinoma Diseases 0.000 description 1
- 230000002357 endometrial effect Effects 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 229940088598 enzyme Drugs 0.000 description 1
- 229940116977 epidermal growth factor Drugs 0.000 description 1
- 210000002919 epithelial cell Anatomy 0.000 description 1
- 108700020302 erbB-2 Genes Proteins 0.000 description 1
- 229960001433 erlotinib Drugs 0.000 description 1
- AAKJLRGGTJKAMG-UHFFFAOYSA-N erlotinib Chemical compound C=12C=C(OCCOC)C(OCCOC)=CC2=NC=NC=1NC1=CC=CC(C#C)=C1 AAKJLRGGTJKAMG-UHFFFAOYSA-N 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 230000005284 excitation Effects 0.000 description 1
- 208000021045 exocrine pancreatic carcinoma Diseases 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 238000002866 fluorescence resonance energy transfer Methods 0.000 description 1
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 1
- 125000002485 formyl group Chemical group [H]C(*)=O 0.000 description 1
- 239000012458 free base Substances 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 230000033581 fucosylation Effects 0.000 description 1
- 230000005714 functional activity Effects 0.000 description 1
- 229960002584 gefitinib Drugs 0.000 description 1
- XGALLCVXEZPNRQ-UHFFFAOYSA-N gefitinib Chemical compound C=12C=C(OCCCN3CCOCC3)C(OC)=CC2=NC=NC=1NC1=CC=C(F)C(Cl)=C1 XGALLCVXEZPNRQ-UHFFFAOYSA-N 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 208000005017 glioblastoma Diseases 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 108700014210 glycosyltransferase activity proteins Proteins 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 201000010536 head and neck cancer Diseases 0.000 description 1
- 208000014829 head and neck neoplasm Diseases 0.000 description 1
- 230000002440 hepatic effect Effects 0.000 description 1
- 229940022353 herceptin Drugs 0.000 description 1
- 102000045108 human EGFR Human genes 0.000 description 1
- 102000053810 human ERBB4 Human genes 0.000 description 1
- 229940116978 human epidermal growth factor Drugs 0.000 description 1
- 235000003642 hunger Nutrition 0.000 description 1
- 235000011167 hydrochloric acid Nutrition 0.000 description 1
- 150000004679 hydroxides Chemical class 0.000 description 1
- NPZTUJOABDZTLV-UHFFFAOYSA-N hydroxybenzotriazole Substances O=C1C=CC=C2NNN=C12 NPZTUJOABDZTLV-UHFFFAOYSA-N 0.000 description 1
- 238000012872 hydroxylapatite chromatography Methods 0.000 description 1
- 239000001863 hydroxypropyl cellulose Substances 0.000 description 1
- 235000010977 hydroxypropyl cellulose Nutrition 0.000 description 1
- 230000001024 immunotherapeutic effect Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 150000007529 inorganic bases Chemical class 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 230000009545 invasion Effects 0.000 description 1
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 1
- JJWLVOIRVHMVIS-UHFFFAOYSA-N isopropylamine Chemical compound CC(C)N JJWLVOIRVHMVIS-UHFFFAOYSA-N 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 229960004891 lapatinib Drugs 0.000 description 1
- BCFGMOOMADDAQU-UHFFFAOYSA-N lapatinib Chemical compound O1C(CNCCS(=O)(=O)C)=CC=C1C1=CC=C(N=CN=C2NC=3C=C(Cl)C(OCC=4C=C(F)C=CC=4)=CC=3)C2=C1 BCFGMOOMADDAQU-UHFFFAOYSA-N 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 108020001756 ligand binding domains Proteins 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 201000007270 liver cancer Diseases 0.000 description 1
- 201000005249 lung adenocarcinoma Diseases 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- 238000013507 mapping Methods 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 150000007522 mineralic acids Chemical class 0.000 description 1
- 230000002297 mitogenic effect Effects 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 229910000403 monosodium phosphate Inorganic materials 0.000 description 1
- 235000019799 monosodium phosphate Nutrition 0.000 description 1
- 239000002088 nanocapsule Substances 0.000 description 1
- 230000027405 negative regulation of phosphorylation Effects 0.000 description 1
- GVUGOAYIVIDWIO-UFWWTJHBSA-N nepidermin Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CS)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CS)NC(=O)[C@H](C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCSC)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CS)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O)C(C)C)[C@@H](C)CC)C(C)C)C(C)C)C1=CC=C(O)C=C1 GVUGOAYIVIDWIO-UFWWTJHBSA-N 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 231100000590 oncogenic Toxicity 0.000 description 1
- 230000002246 oncogenic effect Effects 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 150000007530 organic bases Chemical class 0.000 description 1
- 201000002528 pancreatic cancer Diseases 0.000 description 1
- 229960001972 panitumumab Drugs 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 230000035515 penetration Effects 0.000 description 1
- 208000030940 penile carcinoma Diseases 0.000 description 1
- 201000008174 penis carcinoma Diseases 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 201000002628 peritoneum cancer Diseases 0.000 description 1
- 229960003742 phenol Drugs 0.000 description 1
- 229960003531 phenolsulfonphthalein Drugs 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 235000011007 phosphoric acid Nutrition 0.000 description 1
- 150000003016 phosphoric acids Chemical class 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 229920000771 poly (alkylcyanoacrylate) Polymers 0.000 description 1
- 229920000573 polyethylene Polymers 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 1
- 238000010837 poor prognosis Methods 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- MFDFERRIHVXMIY-UHFFFAOYSA-N procaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1 MFDFERRIHVXMIY-UHFFFAOYSA-N 0.000 description 1
- 229960004919 procaine Drugs 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000009465 prokaryotic expression Effects 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 125000006239 protecting group Chemical group 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 239000003531 protein hydrolysate Substances 0.000 description 1
- 108060006633 protein kinase Proteins 0.000 description 1
- 238000001243 protein synthesis Methods 0.000 description 1
- 230000012743 protein tagging Effects 0.000 description 1
- 102000027426 receptor tyrosine kinases Human genes 0.000 description 1
- 108091008598 receptor tyrosine kinases Proteins 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 206010038038 rectal cancer Diseases 0.000 description 1
- 201000001275 rectum cancer Diseases 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 201000003804 salivary gland carcinoma Diseases 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 235000020161 semi-skimmed milk Nutrition 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 239000012679 serum free medium Substances 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 208000000587 small cell lung carcinoma Diseases 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 239000011775 sodium fluoride Substances 0.000 description 1
- 235000013024 sodium fluoride Nutrition 0.000 description 1
- 238000010532 solid phase synthesis reaction Methods 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 238000012289 standard assay Methods 0.000 description 1
- 230000037351 starvation Effects 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- GZCRRIHWUXGPOV-UHFFFAOYSA-N terbium atom Chemical compound [Tb] GZCRRIHWUXGPOV-UHFFFAOYSA-N 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- 230000036962 time dependent Effects 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- 238000003146 transient transfection Methods 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 230000001296 transplacental effect Effects 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- IHIXIJGXTJIKRB-UHFFFAOYSA-N trisodium vanadate Chemical compound [Na+].[Na+].[Na+].[O-][V]([O-])([O-])=O IHIXIJGXTJIKRB-UHFFFAOYSA-N 0.000 description 1
- GPRLSGONYQIRFK-MNYXATJNSA-N triton Chemical compound [3H+] GPRLSGONYQIRFK-MNYXATJNSA-N 0.000 description 1
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 1
- 239000011882 ultra-fine particle Substances 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 239000002691 unilamellar liposome Substances 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
- 208000012991 uterine carcinoma Diseases 0.000 description 1
- 238000001291 vacuum drying Methods 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 210000003501 vero cell Anatomy 0.000 description 1
- 201000005102 vulva cancer Diseases 0.000 description 1
- 229920003169 water-soluble polymer Polymers 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/32—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
Definitions
- the present invention relates to antibodies that bind to HER-3 (ErbB3).
- the human epidermal growth factor (EGF) family of receptor tyrosine kinases includes four members: EGFR (ErbB1, HER1), HER2 (c-Neu, ErbB2), HER3 (ErB3) and HER4 (ErbB4) (Hynes et. al. (1994)).
- HER receptors are predicted to consist of an extracellular ligand-binding domain, a membrane-spanning domain, a cytosolic protein tyrosine kinase (PTK) domain and a C-terminal phosphorylation domain (see, e.g., Kim et al., (1998)). Receptor activation via ligand binding leads to downstream signalling that influence cell proliferation, invasion and survival of normal cells and cancer cells.
- PTK cytosolic protein tyrosine kinase
- EGFR and HER2 Aberrant expression or activity of EGFR and HER2 have been correlated with many cancers including but not limited to lung, breast, ovarian, colon and bladder cancer and several targeted therapies have shown clinical efficiencies (see review of Hynes and Lane, Nature Rev., 2005).
- ectodomain-binding antibodies cetuximab, panitumumab and trastuzumab
- inhibitor of the tyrosine kinase domain erlotinib, gefitinib, and lapatinib
- EGFR and HER2 receptors ectodomain-binding antibodies
- trastuzumab inhibitor of the tyrosine kinase domain
- these targeted therapies over EGFR and HER2 are limited due to acquired resistance problems. Indeed, patients that receiving these agents exhibit primary or intrinsic resistance to these inhibitors and for those who do not respond they eventually manifest secondary or acquired resistance (Kruser and Wheeler, Exp Cell Res, 2010). Moreover, these therapies are prescribed only at certain stages of malignant disease. Only 20-30% of patients with breast cancer over-expressing the HER2 receptor or demonstrating HER2 gene amplification in tumors, are eligible for treatment with Trastuzumab, reducing its therapeutic indications.
- HER3 has also been described (Plowman (1990)), and it role in cancer has been explored (Horst et al. (2005); Xue et al. (2006)).
- Binding of the ligand Heregulin (HRG) to HER3 receptor triggers the heterodimerization of HER3 with the others HER family receptors.
- the HER3 kinase domain acts as an allosteric activator of its HER family partner (Campiglio M, et al. (1999); Karamouzis M V et al. (2007)).
- the heterodimer HER2/HER3 has the strongest mitogenic activity in the HER family and is the major oncogenic signal leading to the proliferation and invasion of tumor cells in breast cancers (Citri et al. (2006); Lee-Hoeflich et al. (2008)).
- HER3 expression or signalling has been found associated with resistance to antibody-based therapies against the EGFR and HER2 (see for review Campbell et al., (2010)).
- tumors with low expression of HER2 which are not eligible for treatment with trastuzumab, often demonstrate a high expression of HER3 receptor, associated with poor prognosis (Travis et al. (1996); Naidu et al. (1998), Menendez et al. (2006)). In both cases, this HER3 programming promotes the formation of HER2/HER3 heterodimers.
- HER3-targeted agents and in particular antibodies, might be used as efficient immuno-therapeutics.
- Murine and chimeric anti-HER3 antibodies have been reported: U.S. Pat. No. 5,968,511, U.S. Pat. No. 5,480,968, WO03013602. Human anti-HER3 antibodies have also been reported: US2008/0124345, US2009/0291085A1.
- the present invention relates to an anti-HER3 antibody comprising a heavy chain wherein the variable domain comprises SEQ ID NO: 1 for H-CDR1, SEQ ID NO: 2 for H-CDR2 and SEQ ID NO: 3 for H-CDR3.
- the present invention also relates to a pharmaceutical composition
- a pharmaceutical composition comprising said antibody and a pharmaceutically acceptable carrier.
- the invention further relates to an antibody of the invention for use in the treatment of cancer.
- anti-HER3 antibody refers to an antibody directed against HER3, in particular human HER3.
- Anti-HER3 antibody might be directed against HER3 monomer or HER3 in a heterodimer comprising HER3 selected from the group consisting of HER2-HER3, also called therein HER2-HER3 complex, EGFR-HER3 and HER4-HER3.
- HER3 sequence is disclosed in uniprot under the reference number P21860.
- amino acids of HER3 are numbered in reference to uniprot.
- anti-HER3 antibody refers to an antibody that binds to the extracellular domain of human HER3 polypeptide as defined in SEQ ID NO: 32 (Table A).
- antibody or “immunoglobulin” have the same meaning, and will be used equally in the present invention.
- the term “antibody” as used herein refers to immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, i.e., molecules that contain an antigen binding site that immunospecifically binds an antigen.
- the term antibody encompasses not only whole antibody molecules, but also antibody fragments, including antigen-binding fragments, as well as variants (including derivatives) of antibodies and antibody fragments.
- two heavy chains are linked to each other by disulfide bonds and each heavy chain is linked to a light chain by a disulfide bond.
- the light chain includes two domains, a variable domain (VL) and a constant domain (CL).
- the heavy chain includes four domains, a variable domain (VH) and three constant domains (CH1, CH2 and CH3, collectively referred to as CH).
- the variable regions of both light (VL) and heavy (VH) chains determine binding recognition and specificity to the antigen.
- the constant region domains of the light (CL) and heavy (CH) chains confer important biological properties such as antibody chain association, secretion, trans-placental mobility, complement binding, and binding to Fc receptors (FcR).
- the Fv fragment is the N-terminal part of the Fab fragment of an immunoglobulin and consists of the variable portions of one light chain and one heavy chain.
- the specificity of the antibody resides in the structural complementarity between the antibody combining site and the antigenic determinant.
- Antibody combining sites are made up of residues that are primarily from the hypervariable or complementarity determining regions (CDRs). Occasionally, residues from nonhypervariable or framework regions (FR) influence the overall domain structure and hence the combining site.
- Complementarity Determining Regions or CDRs refer to amino acid sequences which together define the binding affinity and specificity of the natural Fv region of a native immunoglobulin binding site.
- the light and heavy chains of an immunoglobulin each have three CDRs, designated L-CDR1, L-CDR2, L-CDR3 and H-CDR1, H-CDR2, H-CDR3, respectively.
- An antigen-binding site therefore, includes six CDRs, comprising the CDR set from each of a heavy and a light chain V region.
- Framework Regions (FRs) refer to amino acid sequences interposed between CDRs.
- human antibody refers to an antibody in which a substantial portion of the antibody molecule resembles, in amino acid sequence or structure, that of an antibody derived from human origin.
- H3A-32, H3A-76, H3A-81, H4B-05 and H4B-121 are human antibodies.
- a “human antibody” may be considered more suitable in instances where it is desirable to reduce the immunogenicity of the antibody for administration to humans for therapeutic purposes.
- Fab denotes an antibody fragment having a molecular weight of about 50,000 and antigen binding activity, in which about a half of the N-terminal side of H chain and the entire L chain, among fragments obtained by treating IgG with a protease, papaine, are bound together through a disulfide bond.
- F(ab′)2 refers to an antibody fragment having a molecular weight of about 100,000 and antigen binding activity, which is slightly larger than the Fab bound via a disulfide bond of the hinge region, among fragments obtained by treating IgG with a protease, pepsin.
- Fab′ refers to an antibody fragment having a molecular weight of about 50,000 and antigen binding activity, which is obtained by cutting a disulfide bond of the hinge region of the F(ab′)2.
- a single chain Fv (“scFv”) polypeptide is a covalently linked VH::VL heterodimer which is usually expressed from a gene fusion including VH and VL encoding genes linked by a peptide-encoding linker.
- dsFv is a VH::VL heterodimer stabilised by a disulfide bond.
- Divalent and multivalent antibody fragments can form either spontaneously by association of monovalent scFvs, or can be generated by coupling monovalent scFvs by a peptide linker, such as divalent sc(Fv)2.
- diabodies refers to small antibody fragments with two antigen-binding sites, which fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (VL) in the same polypeptide chain (VH-VL).
- VH heavy-chain variable domain
- VL light-chain variable domain
- linker that is too short to allow pairing between the two domains on the same chain, the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites.
- purified and “isolated” it is meant, when referring to a polypeptide (i.e. an antibody according to the invention) or to a nucleotide sequence, that the indicated molecule is present in the substantial absence of other biological macromolecules of the same type.
- the term “purified” as used herein preferably means at least 75% by weight, more preferably at least 85% by weight, more preferably still at least 95% by weight, and most preferably at least 98% by weight, of biological macromolecules of the same type are present.
- nucleic acid molecule which encodes a particular polypeptide refers to a nucleic acid molecule which is substantially free of other nucleic acid molecules that do not encode the polypeptide; however, the molecule may include some additional bases or moieties which do not deleteriously affect the basic characteristics of the composition.
- a “therapeutically effective amount” is intended for a minimal amount of active agent (e.g., anti-HER3 antibodies) which is necessary to impart therapeutic benefit to a subject.
- a “therapeutically effective amount” to a mammal is such an amount which induces, ameliorates or otherwise causes an improvement in the pathological symptoms, disease progression or physiological conditions associated with or resistance to succumbing to a disorder.
- the term “subject” denotes a mammal, such as a rodent, a feline, a canine, and a primate.
- a subject according to the invention is a human.
- Treatment or treating refers to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) the targeted pathologic condition or disorder.
- Those in need of treatment include those already with the disorder as well as those prone to have the disorder or those in whom the disorder is to be prevented.
- the subject to be treated herein may have been diagnosed as having the disorder or may be predisposed or susceptible to the disorder.
- cancer and “cancerous” refer to or describe the physiological condition in subjects that is typically characterized by unregulated cell growth or death.
- cancer include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia or lymphoid malignancies. More particular examples of such cancers include squamous cell cancer (e.g.
- lung cancer including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, rectal cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, anal carcinoma, penile carcinoma, as well as head and neck cancer.
- lung cancer including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer,
- the inventors have cloned and characterized the variable domains of the light and heavy chains of many human anti-HER3 monoclonal antibodies (mAbs). Among these mAbs, the inventors have identified that mAbs with complementarity determining regions (CDRs), as described in table 1, were inhibitors of HER3 biological activity.
- CDRs complementarity determining regions
- anti-HER3 antibodies were potent inhibitors of the formation of a heterodimer comprising HER3 selected from the group consisting of HER2-HER3 complex, EGFR-HER3 and HER4-HER3, and more particularly of the formation of HER2-HER3 complex.
- the inventors have, notably, shown that the antibodies of the invention exhibit a higher binding to HER3 when HER3 is in the heterodimer HER2-HER3 compared with known anti-HER3 antibodies, for example those described in patent US2008/0124345A1 and US2009/0291085A1.
- the inventors have also shown that the antibodies of the invention inhibit the binding of heregulin to HER3.
- H-CDR1 DYAMH SEQ ID NO: 1
- H-CDR2 ISWNSGSIGYADSVKG SEQ ID NO: 2
- H-CDR3 EGQWPNYGMDV SEQ ID NO: 3
- the invention relates to an anti-HER3 antibody comprising a heavy chain wherein the variable domain comprises SEQ ID NO: 1 for H-CDR1, SEQ ID NO: 2 for H-CDR2 and SEQ ID NO: 3 for H-CDR3.
- mAb H3A-32 mAb H3A-76
- mAb H3A-81 mAb H4B-05
- mAb H4B-121 mAb H4B-121.
- the VH, VL and CDR domains of these antibodies are respectively described in table 2 to 6.
- VH, VL and CDR domains of mAb H3A-32 MAb H3A-32 Domains VH EVQLVESGGGLVQPGGSLRLSCAASGFTFDDYAMHWVRQA PGKGLEWVSGISWNSGSIGYADSVKGRFTISRDNAKNSLYL QMNSLRAEDTAVYYCAREGQWPNYGMDVWGQGTTVTVS S (SEQ ID NO: 14) VH CDR1 DYAMH (SEQ ID NO: 1) VH CDR2 ISWNSGSIGYADSVKG (SEQ ID NO: 2) VH CDR3 EGQWPNYGMDV (SEQ ID NO: 3) VL QSVLTQPPSASGTPGQRVTISCSGSSSNIGSDPVNWYQQLPG TAPKLLIYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEA DYYCAAWDDSLRGYVFGTGTKLTVL (SEQ ID NO: 15) VL CDR1 SGSSSNI
- VH, VL and CDR domains of mAb H3A-76 MAb H3A-76 Domains VH EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQA PGKGLEWVSGISWNSGSIGYADSVKGRFTISRDNAKDSLYL QMNSLRAEDTAVYYCAREGQWPNYGMDVWGQGTTVTVS S (SEQ ID NO: 21) VH CDR1 DYAMH (SEQ ID NO: 1) VH CDR2 ISWNSGSIGYADSVKG (SEQ ID NO: 2) VH CDR3 EGQWPNYGMDV (SEQ ID NO: 3) VL QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNSLNWYQQLPG TAPKLLIYSNNQRPPGVPDRFSGSRSGSSASLAISGLQSGDEG DYYCAAWDDSLKGYVFGTGTQLTVL (SEQ ID NO: 22) VL CDR1 SGSS
- VH, VL and CDR domains of mAb H3A-81 MAb H3A-81 Domains VH EVQLVESGGGLVQPGGSLRLSCAASGFTFDDYAMHWVRQA PGKGLEWVSGISWNSGSIGYADSVKGRFTISRDNAKNSLYL QMNSLRAEDTAVYYCAREGQWPNYGMDVWGQGTTVTVS S (SEQ ID NO: 14) VH CDR1 DYAMH (SEQ ID NO:1) VH CDR2 ISWNSGSIGYADSVKG (SEQ ID NO: 2) VH CDR3 EGQWPNYGMDV (SEQ ID NO: 3) VL QSVLTQPPSASGTPGQRVTISCSGSSSNIGGDTVNWYQQLPG TAPKLLIYSNNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEA DYYCAAWDDSLNGYVFGTGTKLTVL (SEQ ID NO: 27) VL CDR1 SGSSSN
- VH, VL and CDR domains of mAb H4B-05 MAb H4B-05 Domains VH EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQA PGKGLEWVSGISWNSGSIGYADSVKGRFTISRDNAKNSLYL QMNSLRAEDTAVYYCAREGQWPNYGMDVWGQGTTVTVS S (SEQ ID NO: 7) VH CDR1 DYAMH (SEQ ID NO: 1) VH CDR2 ISWNSGSIGYADSVKG (SEQ ID NO: 2) VH CDR3 EGQWPNYGMDV (SEQ ID NO: 3) VL QSVLTQPPSASGTPGQRVTISCSGSRSNIGSNTVSWYQQLPG TAPKLLIYSNNQRPSGVPDRFSGSQSGTSASLAISGLQSEDEA DYYCAAWDDSLNGYVFGTGTKLTVL (SEQ ID NO: 30) VL CDR1 SGSRSNI
- VH, VL and CDR domains of mAb H4B-121 MAb H4B-121 Domains VH EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQA PGKGLEWVSGISWNSGSIGYADSVKGRFTISRDNAKNSLYL QMNSLRAEDTAVYYCAREGQWPNYGMDVWGQGTTVTVS S (SEQ ID NO: 7) VH CDR1 DYAMH (SEQ ID NO: 1) VH CDR2 ISWNSGSIGYADSVKG (SEQ ID NO: 2) VH CDR3 EGQWPNYGMDV (SEQ ID NO: 3) VL QSVLTQPPSVSAAPGQKVTISCPGSSSNIGNNYVSWYQQLPG TAPKLLIYDNNERPSGIPDRFSGSTSGTSATLDITDLQAEDEA TYYCGAWDNTLGVYVLGTGTQLTVL (SEQ ID NO: 8) VL CDR1 PGSSSNIGN
- the heavy chain variable domain has the amino acid sequence selected from the group consisting of SEQ ID NO: 7, SEQ ID NO: 14 and SEQ ID NO: 21.
- the light chain variable domain of the antibody according to the invention comprises a light chain which the variable domain comprises:
- the light chain variable domain has the amino acid sequence selected from the group consisting of SEQ ID NO: 8, SEQ ID NO: 15, SEQ ID NO: 22, SEQ ID NO: 27 and SEQ ID NO: 30.
- said anti-HER3 antibody is selected from the group consisting of:
- said anti-HER3 antibody is a human antibody.
- Said antibodies can be produced by any technique well known in the art.
- said antibodies are produced by techniques as hereinafter described.
- the invention further provides for fragments of said antibodies which include but are not limited to Fv, Fab, F(ab′)2, Fab′, dsFv, scFv, sc(Fv)2 and diabodies; and multispecific antibodies formed from antibody fragments.
- Antibodies and polypeptides of the invention can be used in an isolated (e.g., purified) form or contained in a vector, such as a membrane or lipid vesicle (e.g. a liposome).
- a vector such as a membrane or lipid vesicle (e.g. a liposome).
- a further object of the invention relates to a nucleic acid comprising a sequence encoding at least the heavy chain of the antibody according to the invention or an antigen-binding fragment thereof.
- the invention relates to a nucleic acid sequence encoding the VH domain or the VL domain of mAb H3A-32, mAb H3A-76, mAb H3A-81, mAb H4B-05 and mAb H4B-121 as disclosed in Table 7.
- VH and VL domains of mAbs of to the invention Nucleic acids of VH and VL domains of mAbs of to the invention mAb H3A-32 VH domain: GAGGTGCAGCTGGTGGAGTCCGGGGGAGGCTTAGT TCAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGC CTCTGGATTCACCTTTGATGATTATGCCATGCACTG GGTCCGGCAAGCTCCAGGGAAGGGCCTGGAGTGGG TCTCAGGTATTAGTTGGAATAGTGGTAGCATAGGCT ATGCGGACTCTGTGAAGGGCCGATTCACCATCTCCA GAGACAACGCCAAGAACTCACTGTATCTGCAAATG AACAGCCTGAGAGCCGAGGACACGGCTGTGTATTA CTGTGCGAGAGAAGGGCAGTGGCCGAACTACGGTA TGGACGTCTGGGGCCAAGGGACCACGGTCACCGTC TCCTCA (SEQ ID NO: 16) VL domain: CAGTCTGTGCTGACTCAGCCACC
- said nucleic acid is a DNA or RNA molecule, which may be included in any suitable vector, such as a plasmid, cosmid, episome, artificial chromosome, phage or a viral vector.
- vector means the vehicle by which a DNA or RNA sequence (e.g. a foreign gene) can be introduced into a host cell, so as to transform the host and promote expression (e.g. transcription and translation) of the introduced sequence.
- a DNA or RNA sequence e.g. a foreign gene
- a further object of the invention relates to a vector comprising a nucleic acid of the invention.
- Such vectors may comprise regulatory elements, such as a promoter, enhancer, terminator and the like, to cause or direct expression of said antibody upon administration to a subject.
- promoters and enhancers used in the expression vector for animal cell include early promoter and enhancer of SV40 (Mizukami T. et al. 1987), LTR promoter and enhancer of Moloney mouse leukemia virus (Kuwana Y et al. 1987), promoter (Mason J O et al. 1985) and enhancer (Gillies S D et al. 1983) of immunoglobulin H chain and the like.
- Any expression vector for animal cell can be used, so long as a gene encoding the human antibody C region can be inserted and expressed.
- suitable vectors include pAGE107 (Miyaji H et al. 1990), pAGE103 (Mizukami T et al. 1987), pHSG274 (Brady G et al. 1984), pKCR (O'Hare K et al. 1981), pSG1 beta d2-4-(Miyaji H et al. 1990) and the like.
- Plasmids include replicating plasmids comprising an origin of replication, or integrative plasmids, such as for instance pUC, pcDNA, pBR, and the like.
- viral vector examples include adenoviral, retroviral, herpes virus and AAV vectors.
- recombinant viruses may be produced by techniques known in the art, such as by transfecting packaging cells or by transient transfection with helper plasmids or viruses.
- virus packaging cells include PA317 cells, PsiCRIP cells, GPenv+ cells, 293 cells, etc.
- Detailed protocols for producing such replication-defective recombinant viruses may be found for instance in WO 95/14785, WO 96/22378, U.S. Pat. No. 5,882,877, U.S. Pat. No. 6,013,516, U.S. Pat. No. 4,861,719, U.S. Pat. No. 5,278,056 and WO 94/19478.
- a further object of the present invention relates to a host cell comprising a nucleic acid or a vector according to the invention.
- the host a cell has been transfected, infected or transformed by a nucleic acid or a vector according to the invention
- transformation means the introduction of a “foreign” (i.e. extrinsic or extracellular) gene, DNA or RNA sequence to a host cell, so that the host cell will express the introduced gene or sequence to produce a desired substance, typically a protein or enzyme coded by the introduced gene or sequence.
- a host cell that receives and expresses introduced DNA or RNA has been “transformed”.
- the nucleic acids of the invention may be used to produce an antibody of the invention in a suitable expression system.
- expression system means a host cell and compatible vector under suitable conditions, e.g. for the expression of a protein encoded by foreign DNA carried by the vector and introduced to the host cell.
- Common expression systems include E. coli host cells and plasmid vectors, insect host cells and Baculovirus vectors, and mammalian host cells and vectors.
- Other examples of host cells include, without limitation, prokaryotic cells (such as bacteria) and eukaryotic cells (such as yeast cells, mammalian cells, insect cells, plant cells, etc.). Specific examples include E.
- mammalian cell lines e.g., Vero cells, CHO cells, 3T3 cells, COS cells, etc.
- primary or established mammalian cell cultures e.g., produced from lymphoblasts, fibroblasts, embryonic cells, epithelial cells, nervous cells, adipocytes, etc.
- Examples also include mouse SP2/0-Ag14 cell (ATCC CRL1581), mouse P3X63-Ag8.653 cell (ATCC CRL1580), CHO cell in which a dihydrofolate reductase gene (hereinafter referred to as “DHFR gene”) is defective (Urlaub G et al; 1980), rat YB2/3HL.P2.G11.16Ag.20 cell (ATCC CRL1662, hereinafter referred to as “YB2/0 cell”), and the like.
- DHFR gene dihydrofolate reductase gene
- the present invention also relates to a method of producing a recombinant host cell expressing an antibody according to the invention, said method comprising the steps of: (i) introducing in vitro or ex vivo a recombinant nucleic acid or a vector as described above into a competent host cell, (ii) culturing in vitro or ex vivo the recombinant host cell obtained and (iii), optionally, selecting the cells which express and/or secrete said antibody.
- recombinant host cells can be used for the production of antibodies of the invention.
- Antibodies of the invention may be produced by any technique known in the art, such as, without limitation, any chemical, biological, genetic or enzymatic technique, either alone or in combination.
- antibodies of the invention can be synthesized using well-known solid phase method, preferably using a commercially available peptide synthesis apparatus (such as that made by Applied Biosystems, Foster City, Calif.) and following the manufacturer's instructions.
- antibodies of the invention can be synthesized by recombinant DNA techniques well-known in the art.
- antibodies can be obtained as DNA expression products after incorporation of DNA sequences encoding the antibodies into expression vectors and introduction of such vectors into suitable eukaryotic or prokaryotic hosts that will express the desired antibodies, from which they can be later isolated using well-known techniques.
- the invention further relates to a method of producing an antibody of the invention, which method comprises the steps consisting of: (i) culturing a transformed host cell according to the invention under conditions suitable to allow expression of said antibody; and (ii) recovering the expressed antibody.
- Antibodies of the invention are suitably separated from the culture medium by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
- the Fab of the present invention can be obtained by treating an antibody which specifically reacts with HER3 with a protease, papaine. Also, the Fab can be produced by inserting DNA encoding Fab of the antibody into a vector for prokaryotic expression system, or for eukaryotic expression system, and introducing the vector into a procaryote or eucaryote (as appropriate) to express the Fab.
- the F(ab′)2 of the present invention can be obtained treating an antibody of the invention with a protease, pepsin. Also, the F(ab′)2 can be produced by binding Fab′ described below via a thioether bond or a disulfide bond.
- the Fab′ of the present invention can be obtained treating F(ab′)2 of the invention with a reducing agent, dithiothreitol. Also, the Fab′ can be produced by inserting DNA encoding Fab′ fragment of the antibody into an expression vector for prokaryote, or an expression vector for eukaryote, and introducing the vector into a prokaryote or eukaryote (as appropriate) to perform its expression.
- the scFv of the present invention can be produced by obtaining cDNA encoding the VH and VL domains as previously described, constructing DNA encoding scFv, inserting the DNA into an expression vector for prokaryote, or an expression vector for eukaryote, and then introducing the expression vector into a prokaryote or eukaryote (as appropriate) to express the scFv.
- an antibody of the invention has variable region heavy and light chain nucleotide sequences, or variable region heavy and light chain amino acid sequences that are homologous to the amino acid and nucleotide sequences of the antibodies described herein, and wherein the antibodies retain the desired functional properties of the anti-HER3 antibodies of the invention.
- the invention provides an antibody (or a functional protein comprising an antigen binding portion thereof) comprising a heavy chain wherein the variable domain comprises:
- Binding affinity can be measured using standard assays known in the art, such as, for example, Biacore analysis.
- the invention relates to homologous antibodies that bind to human HER3 and/or HER3/HER2 complex with a K D of 10 ⁇ M or less, 1 ⁇ M or 100 nM or less.
- K D is intended to refer to the dissociation constant, which is obtained from the ratio of Kd to Ka (i.e. Kd/Ka) and is expressed as a molar concentration (M).
- K D values for antibodies can be determined using methods well established in the Art. One method for determining the K D of an antibody is by using surface Plasmon resonance, or using a biosensor system such as a Biacore® system.
- the antibodies of the invention have advantageously HER3 inhibiting or neutralizing activity.
- an antibody that inhibits HER3 biological activity is an antibody that inhibits the formation of heterodimer comprising HER3, in particular HER2-HER3 complex, as measured for example in T-FRET assay.
- the invention provides an antibody (or a functional protein comprising an antigen binding portion thereof) comprising a heavy chain variable region and a light chain variable region, wherein: the heavy chain variable region comprises an amino acid sequence that is at least 80%, at least 90% or at least 95% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:7, SEQ ID NO: 14 and SEQ ID NO:21; the light chain variable region comprises an amino acid sequence that is at least 80%, at least 90% or at least 95% identical to an amino acid sequence selected from the group consisting of SEQ ID NO: 8, SEQ ID NO: 15, SEQ ID NO: 22, SEQ ID NO: 27 and SEQ ID NO:30; the antibody specifically binds to HER3 and/or HER2-HER3 complex with substantially the same affinity as an antibody comprising a heavy chain wherein the variable domain comprises SEQ ID NO: 1 for H-CDR1, SEQ ID NO: 2 for H-CDR2 and SEQ ID NO: 3 for H-CDR3, and more preferably with
- the invention provides an antibody, (or a functional protein comprising an antigen binding portion thereof) comprising a heavy chain variable region and a light chain variable region, wherein: the heavy chain variable region is encoded by a nucleotide sequence that is at least 80%, at least 90% or at least 95% identical to nucleotide sequence selected from the group consisting of SEQ ID NO:9, SEQ ID NO: 16 and SEQ ID NO:23; the light chain variable region is encoded by a nucleotide sequence that is at least 80%, at least 90% or at least 95% identical to a nucleotide sequence selected from the group consisting of SEQ ID NO:10, SEQ ID NO: 17, SEQ ID NO: 24, SEQ ID NO: 28 and SEQ ID NO:31; the antibody specifically binds to HER3 and/or HER2-HER3 complex with substantially the same affinity as an antibody comprising a heavy chain wherein the variable domain comprises SEQ ID NO: 1 for H-CDR1, SEQ ID NO: 2 for H
- the antibody according to the invention also encompasses antibody which specifically binds to HER3 and/or HER2-HER3 complex with substantially the same affinity as an antibody comprising a heavy chain wherein the variable domain comprises SEQ ID NO: 1 for H-CDR1, SEQ ID NO: 2 for H-CDR2 and SEQ ID NO: 3 for H-CDR3, and more preferably with substantially the same affinity as one of the following antibodies: mAb H3A-32, mAb H3A-76, mAb H3A-81, mAb H4B-05 and mAb H4B-121, as described above, and wherein 1, 2 or 3 amino acids have been substituted in either H-CDR1, H-CDR2 or H-CDR3 comparing to SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 3, respectively.
- the VH and/or VL amino acid sequences may be identical except an amino acid substitution in no more than 1, 2, 3, 4 or 5 amino acid position.
- An antibody having VH and VL regions having high (i.e., 90% or greater) identity to the VH and VL regions of SEQ ID NO:7, SEQ ID NO: 14 or SEQ ID NO:21, and SEQ ID NO:8, SEQ ID NO: 15, SEQ ID NO: 22, SEQ ID NO: 27 or SEQ ID NO:30 respectively, can be obtained by mutagenesis (e.g., site-directed or PCR-mediated mutagenesis) of nucleic acid molecules encoding SEQ ID NO:9, SEQ ID NO: 16 or SEQ ID NO:23 and SEQ ID NO:10, SEQ ID NO: 17, SEQ ID NO: 24, SEQ ID NO: 28 and SEQ ID NO:31 respectively, followed by testing of the encoded altered antibody for retained function (i.e., the functions set forth above) using the functional assays described herein.
- mutagenesis
- the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm, as described below.
- the percent identity between two amino acid sequences can be determined using the algorithm of E. Meyers and W. Miller (Comput. Appl. Biosci., 4:1 1-17, 1988) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
- the percent identity between two amino acid sequences can be determined using the Needleman and Wunsch (J. MoI, Biol.
- an antibody of the invention has a heavy chain variable region comprising CDR1, CDR2, and CDR3 sequences and a light chain variable region comprising CDR1, CDR2, and CDR3 sequences, wherein one or more of these CDR sequences have specified amino acid sequences based on the antibodies described herein or conservative modifications thereof, and wherein the antibodies retain the desired functional properties of the anti-HER3 antibodies of the invention.
- the invention provides an isolated recombinant antibody, or a functional protein comprising an antigen binding portion thereof, consisting of a heavy chain variable region comprising H-CDR1, H-CDR2, and H-CDR3 sequences and a light chain variable region comprising L-CDR1, L-CDR2, and L-CDR3 sequences, wherein:
- H-CDR1 amino acid sequence is set forth as SEQ ID NO:1 and conservative modifications thereof;
- H-CDR2 amino acid sequences is set forth as SEQ ID NO: 2 and conservative modifications thereof;
- the H-CDR3 amino acid sequences is set forth SEQ ID NO: 3, and conservative modifications thereof;
- L-CDR1 amino acid sequences are selected from the group consisting of SEQ ID NO:4, SEQ ID NO:11, SEQ ID NO:18, SEQ ID NO:25 and SEQ ID NO:29, and conservative modifications thereof;
- L-CDR2 amino acid sequences are selected from the group consisting of SEQ ID NO:5, SEQ ID NO:12 and SEQ ID NO:19 and conservative modifications thereof;
- L-CDR3 amino acid sequences are selected from the group consisting of SEQ ID NO:6, SEQ ID NO:13, SEQ ID NO:20 and SEQ ID NO:26;
- the antibody specifically binds to HER3 and/or HER2-HER3 complex with substantially the same affinity as an antibody comprising a heavy chain with CDRs as follows SEQ ID NO: 1 for H-CDR1, SEQ ID NO: 2 for H-CDR2 and SEQ ID NO: 3 for H-CDR3, and more preferably with substantially the same affinity as one of the following antibodies: mAb H3A-32, mAb H3A-76, mAb H3A-81, mAb H4B-05 and mAb H4B-121, as described above.
- conservative sequence modifications is intended to refer to amino acid modifications that do not significantly affect or alter the binding characteristics of the antibody containing the amino acid sequence. Such conservative modifications include amino acid substitutions, additions and deletions. Modifications can be introduced into an antibody of the invention by standard techniques known in the art, such as site-directed mutagenesis and PCR-mediated mutagenesis. Conservative amino acid substitutions are ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art.
- amino acids with basic side chains e.g., lysine, arginine, histidine
- acidic side chains e.g., aspartic acid, glutamic acid
- uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan
- nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine
- beta-branched side chains e.g., threonine, valine, isoleucine
- aromatic side chains e.g., tyrosine, phenylalanine, tryptophan, histidine.
- one or more amino acid residues within the CDR regions of an antibody of the invention can be replaced with other amino acid residues from the same side chain family, and the altered antibody can be tested for retained function using the functional assays
- the invention provides an antibody that binds to the same epitope as do the various specific anti-HER3 antibodies of the invention described herein, and more preferably with substantially the same affinity as one of the following antibodies: mAb H3A-32, mAb H3A-76, mAb H3A-81, mAb H4B-05 and mAb H4B-121, as described above.
- the anti-HER3 antibody of the invention binds to the epitope being comprised between amino acids 352 to 357 of HER3 (SEQ ID NO: 36).
- the epitope being comprised between amino acids 352 to 357 of HER3 is not in the binding site of heregulin to HER3.
- Additional antibodies can therefore be identified based on their ability to cross-compete (e.g., to competitively inhibit the binding of, in a statistically significant manner) with other antibodies of the invention in standard HER3 binding assays.
- the ability of a test antibody to inhibit the binding of antibodies of the present invention to human HER3 demonstrates that the test antibody can compete with that antibody for binding to human HER3; such an antibody may, according to non-limiting theory, bind to the same or a related (e.g., a structurally similar or spatially proximal) epitope on human HER3 as the antibody with which it competes.
- another aspect of the invention provides antibodies that bind to the same antigen as, and compete with, the antibodies disclosed herein by sequence.
- the antibody that binds to the same epitope on human HER3 as the antibodies of the present invention is a human recombinant antibody.
- Such human recombinant antibodies can be prepared and isolated as described in the Examples.
- Engineered antibodies of the invention include those in which modifications have been made to framework residues within VH and/or VL, e.g. to improve the properties of the antibody. Typically such framework modifications are made to decrease the immunogenicity of the antibody. For example, one approach is to “backmutate” one or more framework residues to the corresponding germline sequence. More specifically, an antibody that has undergone somatic mutation may contain framework residues that differ from the germline sequence from which the antibody is derived. Such residues can be identified by comparing the antibody framework sequences to the germline sequences from which the antibody is derived.
- the somatic mutations can be “backmutated” to the germline sequence by, for example, site-directed mutagenesis or PCR-mediated mutagenesis.
- Such “backmutated” antibodies are also intended to be encompassed by the invention.
- Another type of framework modification involves mutating one or more residues within the framework region, or even within one or more CDR regions, to remove T cell-epitopes to thereby reduce the potential immunogenicity of the antibody. This approach is also referred to as “deimmunization” and is described in further detail in U.S. Patent Publication No. 20030153043 by Carr et al.
- antibodies of the invention may be engineered to include modifications within the Fc region, typically to alter one or more functional properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding, and/or antigen-dependent cellular cytotoxicity.
- an antibody of the invention may be chemically modified (e.g., one or more chemical moieties can be attached to the antibody) or be modified to alter its glycosylation, again to alter one or more functional properties of the antibody.
- the hinge region of CH1 is modified such that the number of cysteine residues in the hinge region is altered, e.g., increased or decreased.
- This approach is described further in U.S. Pat. No. 5,677,425 by Bodmer et al.
- the number of cysteine residues in the hinge region of CH1 is altered to, for example, facilitate assembly of the light and heavy chains or to increase or decrease the stability of the antibody.
- the Fc hinge region of an antibody is mutated to decrease the biological half-life of the antibody. More specifically, one or more amino acid mutations are introduced into the CH2-CH3 domain interface region of the Fc-hinge fragment such that the antibody has impaired Staphylococcyl protein A (SpA) binding relative to native Fc-hinge domain SpA binding.
- SpA Staphylococcyl protein A
- the antibody is modified to increase its biological half-life.
- Various approaches are possible. For example, one or more of the following mutations can be introduced: T252L, T254S, T256F, as described in U.S. Pat. No. 6,277,375 by Ward.
- the antibody can be altered within the CH1 or CL region to contain a salvage receptor binding epitope taken from two loops of a CH2 domain of an Fc region of an IgG, as described in U.S. Pat. Nos. 5,869,046 and 6,121,022 by Presta et al.
- the Fc region is altered by replacing at least one amino acid residue with a different amino acid residue to alter the effector functions of the antibody.
- one or more amino acids can be replaced with a different amino acid residue such that the antibody has an altered affinity for an effector ligand but retains the antigen-binding ability of the parent antibody.
- the effector ligand to which affinity is altered can be, for example, an Fc receptor or the C1 component of complement. This approach is described in further detail in U.S. Pat. Nos. 5,624,821 and 5,648,260, both by Winter et al.
- one or more amino acids selected from amino acid residues can be replaced with a different amino acid residue such that the antibody has altered C1q binding and/or reduced or abolished complement dependent cytotoxicity (CDC).
- CDC complement dependent cytotoxicity
- one or more amino acid residues are altered to thereby alter the ability of the antibody to fix complement. This approach is described further in PCT Publication WO 94/29351 by Bodmer et al.
- the Fc region is modified to increase the ability of the antibody to mediate antibody dependent cellular cytotoxicity (ADCC) and/or to increase the affinity of the antibody for an Fc receptor by modifying one or more amino acids.
- ADCC antibody dependent cellular cytotoxicity
- This approach is described further in PCT Publication WO 00/42072 by Presta.
- the binding sites on human IgGI for Fc ⁇ RI, Fc ⁇ RII, Fc ⁇ RIII and FcRn have been mapped and variants with improved binding have been described (see Shields, R. L. et al., 2001 J. Biol. Chen. 276:6591-6604, WO2010106180).
- the glycosylation of an antibody is modified.
- an aglycoslated antibody can be made (i.e., the antibody lacks glycosylation).
- Glycosylation can be altered to, for example, increase the affinity of the antibody for the antigen.
- carbohydrate modifications can be accomplished by, for example, altering one or more sites of glycosylation within the antibody sequence.
- one or more amino acid substitutions can be made that result in elimination of one or more variable region framework glycosylation sites to thereby eliminate glycosylation at that site.
- Such aglycosylation may increase the affinity of the antibody for antigen.
- an antibody can be made that has an altered type of glycosylation, such as a hypofucosylated or non-fucosylated antibody having reduced amounts of or no fucosyl residues or an antibody having increased bisecting GlcNac structures.
- altered glycosylation patterns have been demonstrated to increase the ADCC ability of antibodies.
- carbohydrate modifications can be accomplished by, for example, expressing the antibody in a host cell with altered glycosylation machinery. Cells with altered glycosylation machinery have been described in the art and can be used as host cells in which to express recombinant antibodies of the invention to thereby produce an antibody with altered glycosylation.
- the antibodies of the invention may be produced by recombinant expression in a cell line which exhibit hypofucosylation or non-fucosylation pattern, for example, a mammalian cell line with deficient expression of the FUT8 gene encoding fucosyltransferase.
- PCT Publication WO 03/035835 by Presta describes a variant CHO cell line, Lec13 cells, with reduced ability to attach fucose to Asn(297)-linked carbohydrates, also resulting in hypofucosylation of antibodies expressed in that host cell (see also Shields, R. L. et al., 2002 J. Biol. Chem. 277:26733-26740).
- PCT Publication WO 99/54342 by Umana et al.
- glycoprotein-modifying glycosyl transferases e.g., beta(1,4)-N acetylglucosaminyltransferase III (GnTIII)
- GnTIII glycoprotein-modifying glycosyl transferases
- Eureka Therapeutics further describes genetically engineered CHO mammalian cells capable of producing antibodies with altered mammalian glycosylation pattern devoid of fucosyl residues (http://www.eurekainc.com/a&boutus/companyoverview.html).
- the antibodies of the invention can be produced in yeasts or filamentous fungi engineered for mammalian-like glycosylation pattern and capable of producing antibodies lacking fucose as glycosylation pattern (see for example EP1297172B1).
- An antibody can be pegylated to, for example, increase the biological (e.g., serum) half-life of the antibody.
- the antibody, or fragment thereof typically is reacted with polyethylene glycol (PEG), such as a reactive ester or aldehyde derivative of PEG, under conditions in which one or more PEG groups become attached to the antibody or antibody fragment.
- PEG polyethylene glycol
- the pegylation can be carried out by an acylation reaction or an alkylation reaction with a reactive PEG molecule (or an analogous reactive water-soluble polymer).
- polyethylene glycol is intended to encompass any of the forms of PEG that have been used to derivatize other proteins, such as mono (C1-C10) alkoxy- or aryloxy-polyethylene glycol or polyethylene glycol-maleimide.
- the antibody to be pegylated is an aglycosylated antibody. Methods for pegylating proteins are known in the art and can be applied to the antibodies of the invention. See for example, EP 0 154 316 by Nishimura et al. and EP 0 401 384 by Ishikawa et al.
- Another modification of the antibodies that is contemplated by the invention is a conjugate or a protein fusion of at least the antigen-binding region of the antibody of the invention to serum protein, such as human serum albumin or a fragment thereof to increase half-life of the resulting molecule.
- serum protein such as human serum albumin or a fragment thereof to increase half-life of the resulting molecule.
- Another possibility is a fusion of at least the antigen-binding region of the antibody of the invention to proteins capable of binding to serum proteins, such human serum albumin to increase half life of the resulting molecule.
- proteins capable of binding to serum proteins such human serum albumin to increase half life of the resulting molecule.
- a further object of the invention provides anti-HER3 antibody for use as a drug.
- the invention relates to the use of an anti-HER3 antibody according to the invention as a drug.
- HER3 is known to play a key role in cancer.
- a further aspect of the invention provides methods and pharmaceutical compositions for the treatment of cancer or other related disorders where HER2-HER3 complex and/or HER3 has been shown to be a therapeutic target.
- the invention thus relates to an antibody of the invention for use in the treatment of cancer.
- the invention also relates to the use of an anti-HER3 antibody according to the invention in the preparation of a drug useful for the treatment of cancer.
- the invention also relates to a method for treating cancer which comprises the step of administering to a subject in need thereof an antibody of the invention.
- the invention also relates to pharmaceutical composition
- pharmaceutical composition comprising antibodies of the invention and a pharmaceutically acceptable carrier.
- antibodies of the invention may optionally be combined with sustained-release matrices, such as biodegradable polymers, to form therapeutic compositions.
- “Pharmaceutically” or “pharmaceutically acceptable” refers to molecular entities and compositions that do not produce an adverse, allergic or other untoward reaction when administered to a mammal, especially a human, as appropriate.
- a pharmaceutically acceptable carrier refers to a non-toxic solid, semi-solid or liquid filler, diluent, encapsulating material or formulation auxiliary of any type.
- compositions for example, the route of administration, the dosage and the regimen naturally depend upon the condition to be treated, the severity of the illness, the age, weight, and sex of the patient, etc.
- compositions of the invention can be formulated for a topical, oral, parenteral, intranasal, intravenous, intramuscular, subcutaneous or intraocular administration and the like.
- the pharmaceutical compositions contain vehicles which are pharmaceutically acceptable for a formulation capable of being injected.
- vehicles which are pharmaceutically acceptable for a formulation capable of being injected.
- These may be in particular isotonic, sterile, saline solutions (monosodium or disodium phosphate, sodium, potassium, calcium or magnesium chloride and the like or mixtures of such salts), or dry, especially freeze-dried compositions which upon addition, depending on the case, of sterilized water or physiological saline, permit the constitution of injectable solutions.
- the doses used for the administration can be adapted as a function of various parameters, and in particular as a function of the mode of administration used, of the relevant pathology, or alternatively of the desired duration of treatment.
- an effective amount of the antibody may be dissolved or dispersed in a pharmaceutically acceptable carrier or aqueous medium.
- the pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions; formulations including sesame oil, peanut oil or aqueous propylene glycol; and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions.
- the form must be sterile and must be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms, such as bacteria and fungi.
- Solutions of the active compounds as free base or pharmacologically acceptable salts can be prepared in water suitably mixed with a surfactant, such as hydroxypropylcellulose. Dispersions can also be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.
- An antibody of the invention can be formulated into a composition in a neutral or salt form.
- Pharmaceutically acceptable salts include the acid addition salts (formed with the free amino groups of the protein) and which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric, mandelic, and the like. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, histidine, procaine and the like.
- the carrier can also be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetables oils.
- the proper fluidity can be maintained, for example, by the use of a coating, such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- the prevention of the action of microorganisms can be brought about by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like.
- isotonic agents for example, sugars or sodium chloride.
- Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminium monostearate and gelatin.
- Sterile injectable solutions are prepared by incorporating the active compounds in the required amount in the appropriate solvent with several of the other ingredients enumerated above, as required, followed by filtered sterilization.
- dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above.
- the preferred methods of preparation are vacuum-drying and freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- solutions Upon formulation, solutions will be administered in a manner compatible with the dosage formulation and in such amount as is therapeutically effective.
- the formulations are easily administered in a variety of dosage forms, such as the type of injectable solutions described above, but drug release capsules and the like can also be employed.
- aqueous solutions For parenteral administration in an aqueous solution, for example, the solution should be suitably buffered if necessary and the liquid diluent first rendered isotonic with sufficient saline or glucose.
- aqueous solutions are especially suitable for intravenous, intramuscular, subcutaneous and intraperitoneal administration.
- sterile aqueous media which can be employed will be known to those of skill in the art in light of the present disclosure.
- one dosage could be dissolved in 1 ml of isotonic NaCl solution and either added to 1000 ml of hypodermoclysis fluid or injected at the proposed site of infusion, (see for example, “Remington's Pharmaceutical Sciences” 15th Edition, pages 1035-1038 and 1570-1580). Some variation in dosage will necessarily occur depending on the condition of the subject being treated. The person responsible for administration will, in any event, determine the appropriate dose for the individual subject.
- the antibodies of the invention may be formulated within a therapeutic mixture to comprise about 0.0001 to 1.0 milligrams, or about 0.001 to 0.1 milligrams, or about 0.1 to 1.0 or even about 10 milligrams per dose or so. Multiple doses can also be administered.
- other pharmaceutically acceptable forms include, e.g. tablets or other solids for oral administration; time release capsules; and any other form currently used.
- liposomes and/or nanoparticles are contemplated for the introduction of antibodies into host cells.
- the formation and use of liposomes and/or nanoparticles are known to those of skill in the art.
- Nanocapsules can generally entrap compounds in a stable and reproducible way.
- ultrafine particles sized around 0.1 ⁇ m
- Biodegradable polyalkyl-cyanoacrylate nanoparticles that meet these requirements are contemplated for use in the present invention, and such particles may be are easily made.
- Liposomes are formed from phospholipids that are dispersed in an aqueous medium and spontaneously form multilamellar concentric bilayer vesicles (also termed multilamellar vesicles (MLVs)).
- MLVs generally have diameters of from 25 nm to 4 ⁇ m. Sonication of MLVs results in the formation of small unilamellar vesicles (SUVs) with diameters in the range of 200 to 500 ⁇ , containing an aqueous solution in the core.
- SUVs small unilamellar vesicles
- the physical characteristics of liposomes depend on pH, ionic strength and the presence of divalent cations.
- kits comprising at least one antibody of the invention.
- Kits containing antibodies of the invention find use therapeutic assays.
- FIG. 1 shows the results of specificity binding Phage-ELISA for several antibodies according to the invention.
- FIG. 2 shows an example of the competitive ELISA results.
- the competitive ELISA was performed by a competition for binding to HER3 (EbB3) between the phage-scFv H3A-81 versus each other human Fabs.
- the residual binding of the phage-scFv-H3A-81 at a concentration of 2 ⁇ g/ml of Fabs used as competitor was assigned in percentage.
- An irrelevant Fab (clone H3A-02) was used as negative control.
- the Fab H3A-81 was used as positive control (competition with himself: phage-scFv-H3A-81 versus Fab-H3A-81).
- FIG. 3 shows the results of ELISA binding curves for the purified human IgG of the invention.
- the clone H3A-02 is an irrelevant antibody used as negative control.
- FIG. 4 shows the binding curves of the H4B-121 compared with two other anti-HER3 antibodies (Ab#6 and U1-59).
- FIG. 5 shows the reactivity of the purified human IgG antibodies of the invention towards human HER3 vs mouse HER3.
- Antibodies D, E, G and H are positive control anti-HER3.
- FIG. 6 shows the dose dependence reactivity of the H4B-121 antibody towards human HER3 and mouse HER3.
- FIGS. 7A-F show flow cytometry specific binding profile of purified human IgG H3A-81, H3A-32, H4B-05, H3A-76 and H4B-121 to wt (A), EGFR (B), HER2 (C), EGFR/HER4 (D), HER3 (E) and HER2/HER3 complex (F) transfected NIH 3T3 cells.
- T ⁇ is the negative control clone H3A-02.
- FIG. 8 shows the FACS competition experiment between HER3-specific antibody H4B-121, two others anti-HER3 (D and G) used as control antibodies, and heregulin on SKBR3 cells.
- FIG. 9 shows the results of the TR-FRET assay for HER2-HER3 heterodimerization analysis in transfected NIH-3T3 cells.
- the anti-HER2 antibodies trastuzumab and pertuzumab were used as positive control.
- the irrelevant mAb Px was the negative control.
- FIG. 10 shows the epitope analysis recognized by the antibody H4B-121. Spot binding was measured by pixel quantification of H4B-121 binding to HER3 (peptides 5imageJ software).
- FIG. 11 identifies the Spot-Contributing Residues (SCR) on the HER3 receptor which interact with H4B-121 antibody
- FIGS. 12A-B show the inhibition of tumor progression by the antibody H4B-121 in nude mice xenografted with epidermoid A431 cancer cells (A), and the corresponding Kaplan-Meier survival curve (B). The relative expression of the EGFR, HER2 and HER3 receptors at the surface of A431 cells are also indicated.
- FIG. 13 show the inhibition of tumor progression by the antibody H4B-121 in nude mice xenografted with pancreatic BxPC3 cancer cells (A) and the corresponding Kaplan-Meier survival curve (B).
- A pancreatic BxPC3 cancer cells
- B Kaplan-Meier survival curve
- Inside blot in FIG. 13B shows the phosphorylation level of the HER3 receptor in extracted BxPC3 xenografts from vehicle- or H4B-121-treated mice.
- FIG. 14A shows H4B-121-induced inhibition of HER3 internalization in BxPC3 pancreatic carcinoma by western blot and FIG. 14B quantifies time-dependent antibody-induced HER3 internalization.
- a human scFv phage library was screened against HER3-Fc protein (R&D Systems) to select anti-HER3 antibodies. 10 5 clones were selected.
- scFv binders were assessed by phage-ELISA assay to determine the specificity for HER3 over other HER receptor (HER4 for example here). Phages-scFv expression and phage-ELISA assay were similar as described above. Each Phages-scFv supernatants were added to the microtiter plate wells previously coated with human HER3-Fc, human HER4-Fc (recombinant human extracellular domain ErbB3/HER3 or ErbB4/HER4 Fc chimera, R&D Systems) or Bovine serum Albumin. HER4-Fc and BSA were used as negative controls. As shown in FIG. 1 , several Phages-scFv that exhibited specific binding for HER3 over HER4 have been isolated from the human scFv library.
- the DNA sequence of the scFv binders was determined. Analysis of the scFv DNA sequences has showed that 57/105 clones were unique. Moreover, this genetic diversity analysis after the selection shows a preferential enrichment of the clone H3A-76 (34/105).
- H3A-32 (2/105), H3A-81, H4B-05 (2/105) and H4B-121 share the three CDR-H (SEQ ID NO:1 for H-CDR1; SEQ ID NO: 2 for H-CDR2; SEQ ID NO: 3 for H-CDR3,) as the H3A-76 clone.
- the sequence of the amino acid sequences of the variable heavy (VH) and light chain (VL) regions for the clones H3A-32 H3A-76, H3A-81, H4B-05 and H4B-121 is set forth in Tables 2 to 6.
- Clones H3A-32 and H3A-81 have identical entire VH domain and H4B-05 and H4B-121 have also a same VH domain.
- Tables 2 to 6 show the amino acid sequences of the CDR of the variable heavy (CDR-H) and light chain (CDR-L) regions.
- the clones H3A-32, H3A-76, H3A-81, H4B-05, H4B-121 were converted in the Fab format.
- the VH and VL regions were subcloned in a bicistronic bacteria expression vector that permit the periplasmic expression of Fab fragment with a V5 tag for detection and a C-terminal 6 ⁇ His tag for purification.
- pMG92 was used for clones with a kappa light chain and pMG94 were used for clones with a lambda light chain.
- VH domains were cloned using NcoI/XhoI restriction site and VL domains were cloned using BamHI/SalI restriction site.
- Fabs were performed in HB2151 E coli strain with IPTG induction (0.5 mM) during 16 hours at 20° C. Cell cultures were collected and periplasmic fractions were prepared by standard protocols. Purification was done using Ni-NTA resin (Qiagen). Expression of Fabs from these systems yields from 50-200 ⁇ g depending on the Fab.
- the purified human Fabs at various concentrations were incubated for 2 hours at 37° C. in coated wells at 250 ng HER3-Fc (or HER4-Fc).
- the bound Fabs were detected by using HRP-labeled anti-V5 antibody (Invitrogen). Revelation was done at 450 nm in the presence of TMB (Sigma).
- the Fabs were tested simultaneously for binding on HER3-Fc, HER4-Fc and on Bovine serum Albumin as control. All the Fabs clones described above exhibited high specific binding on HER3 with no cross-reactivity over HER4.
- the HER3 epitope bound by each antibody of the invention can be determined by competitive binding analysis.
- the aim was to group the anti-HER3 antibodies based on their ability to block binding of each others.
- the competition for binding to HER3 of each anti-HER3 between them was compared with the competition by an irrelevant antibody used as negative control and with the competition by the antibody clone evaluated to itself as a positive control.
- This competitive binding assay can be done in different format of the anti-HER3 antibody. As described in this example, the competitive experiments were done in the phage-scFv format at a defined concentration versus Fab at various dilutions.
- FIG. 2 exhibits an overview of the competition for binding to HER3 between the phage-scFv clone H3A-81 versus each other Fabs.
- the residual binding of the phage-scFv-H3A-81 at a concentration of 1 ⁇ 10 ⁇ 7 M of the competitor Fabs was assigned in percentage.
- the irrelevant Fab clone H3A-02 was used as negative control and the clone H3A-81 in the Fab format was used as positive control (competition to himself).
- the clones H3A-81, H4B-05, H3A-76, H3A-32 and H4B-121 compete for HER3 binding with the clone H3A-81. This data suggests that these clones share the same epitope or have in common a same recognition area at the surface of the HER3 receptor.
- VH and VL regions of the human recombinant antibodies were assembled by overlapping PCR with appropriate leader sequences (human heavy chain leader or human light chain leader) and inserted into the vectors pMGM09-H (for Heavy chain expression) and pMGM09-Llambda (for Lambda Light chain expression) or pMGM09-Lkappa (for kappa Light chain expression).
- pMGM09-H for Heavy chain expression
- pMGM09-Llambda for Lambda Light chain expression
- pMGM09-Lkappa for kappa Light chain expression.
- the IgG expression procedure was done according to the supplier's protocol in 24 (or 6)-well plates. Seven days after transfection, cells were centrifuged to recover supernatants containing antibodies. These human anti-HER3 antibodies were purified using standard protein A purification methods.
- the purified human IgG anti-HER3 were incubated for 2 hours at 37° C. in coated wells at 50 ng human HER3-Fc (or HER4-Fc) at three concentrations: 0.5 ⁇ g/ml, 0.25 ⁇ g/ml, 0.125 ⁇ g/ml.
- the bound IgG were detected by using HRP-F(ab′) 2 goat anti human IgG F(ab′)2 specific (Interchim). All the IgG tested exhibit no cross-reactivity against HER4.
- the IgG anti-HER3 of the invention show distinct affinity binding to human HER3 and H4B-121 shows the strongest reactivity from this group of related antibodies.
- the antibody H4B-121 was compared with two others anti-HER3 antibodies Ab#6 (Merrimack Pharmaceuticals) and U1-59 (Amgen/U3 Pharma-Daiichi Sankyo). These antibodies U1-59 and Ab#6 were constructed based disclosure of sequences in patent US2008/0124345A1 and US2009/0291085A1 respectively. As shown in FIG. 4 , the H4B-121 clearly exhibit better reactivity compared to Ab#6 and U1-59.
- the cross-reactivity were assessed by a comparative ELISA assay with immobilized human HER3-Fc and mouse HER3-Fc (recombinant mouse extracellular domain ErbB3/HER3 Fc chimera, R&D Systems) coated at 250 ng/ml
- the five clones of the invention, at a concentration of 1 ⁇ g/ml cross reacted with mouse HER3 ( FIG. 5 ) as well as the Ab#6 antibody.
- the clone H4B-121 is the best binder of this group of clones and FIG. 6 illustrated the dose dependence reactivity of H4B-121 with the human and mouse HER3 receptors.
- Irrelevant control antibody H3A-02 bound neither human nor mouse HER3.
- HER3- and HER2/HER3 complex-transfected NIH 3T3 fibroblasts (10 6 cells) were incubated with the purified human IgG anti-HER3 in PBS-BSA 0.1% at 4° C. for 1 h. After three washes in PBS-BSA 0.1%, cells were incubated with the fluorescein-conjugated anti-human IgG-Fragment Fc specific (Sigma) at 4° C. in the dark for 45 min. Cells were then washed three times and suspended in PBS for analysis using an EPICS flow cytometer (Beckman-Coulter, Fullerton, Calif.). As shown in FIG.
- H4B-121 antibody, as well as positive-control antibody D showed a HRG-dependent binding decrease to the HER3 receptor, demonstrating that surprisingly epitopes recognized by these antibodies could be impaired for antibody binding when HRG induces transconformation of active HER3 receptor for heterodimerization and further signalling ( FIG. 8 ).
- positive-control antibody G did not compete with HRG binding.
- Inhibitory concentration of 50% binding ranged around 2.5 nM of HRG ligand. Similar results were obtained either by sequential or co-incubation of HRG with antibodies.
- the TR-FRET assay was performed using the mouse anti-HER3 mAb 15D4-F2 labeled with Lumi4-terbium cryptate (donor) and the anti-HER2 antibody FRP5 conjugated to the d2 dye (acceptor) (Cisbio Bioassay).
- Cells were plated at 10 5 per well in 96-well sterile black microplates in DMEM (without phenol red) for 24 h, then washed with KREBS buffer, fixed in 10% formalin for 2 min and washed once with KREBS buffer. After incubation with the labeled mAbs in KREBS buffer at 37° C. for 6 hours, cells were washed 4 times with KREBS buffer.
- the fluorescence of Lumi4 Tb and d2 were measured respectively at 620 and 665 nm (60 ⁇ s delay, 400 ⁇ s integration) upon 337 nm excitation using a Pherastar FS instrument.
- the F665 background and F620 background values were obtained by measuring the fluorescence of a plate containing only reading buffer.
- the TR-FRET signal expressed as Delta F665(%) represents relative amount of HER2/HER3 dimers normalized to the level of HER2.
- the human IgG of the invention were incubated 30 minutes with the HER2-HER3-transfected NIH-3T3 cells at 0, 1, 10 and 100 ⁇ g/ml. After the treatment, cells were fixed in 10% formalin to immobilize the dimers and to avoid any modifications during the labelling step with the Lumi4-Tb and d2 antibodies.
- the irrelevant mAb Px was used as a negative control.
- the anti-HER2 antibodies trastuzumab (Herceptin®; Roche/Genentech) and pertuzumab (Roche/Genentech) were used as positive control.
- Heregulin was used to confirm its ability to increase the concentration of HER2-HER3 heterodimer in this assay.
- the anti-HER3 antibody H4B-121 inhibits the HER2-HER3 heterodimer formation from 1 ⁇ g/ml and furthermore in a ligand-independent manner (without heregulin stimulation).
- Membranes were obtained from Abimed (Langenfeld, Germany). Fmoc amino acids and N-hydroxybenzotriazole were obtained from Novabiochem (Läufelfingen, Switzerland). The ASP222 robot (Abimed) was used for the coupling steps. Two hundred-and-thirteen overlapping pentadecapeptides frameshifted by three residues, representing the extracellular domain of HER3 receptor, were synthesized on cellulose membranes. All peptides were acetylated at their N-terminus. After the peptide sequences were assembled, the side-chain protecting groups were removed by trifluoroacetic acid treatment.
- the membrane was saturated with TBS buffer containing 0.1% Tween 20 (TBS-T) and 2% semi-skimmed milk for 18 h at 4° C.
- TBS-T Tween 20
- a 1 ⁇ g/ml solution of the antibody H4B-121 was added to the membrane for 1 h30 at 37° C. Bound antibody was detected by incubation of the membrane at 37° C. for 1 h in a 1:10000 dilution of a peroxidase-conjugated anti-human F(ab′)2 (Jackson ImmunoResearch), and subsequent electrochimioluminescent revelation.
- SCR Spot Contributing Residues
- Residues Trp 354 , His 355 and Lys 356 are phylogenetically conserved among murine and monkey HER3, explaining why H4B-121 both bind to human and murine HER3 by ELISA ( FIG. 4A ), and suggesting that H4B-121 probably cross-reacted with rhesus monkey HER3 (Macaca mulatta).
- sequence alignment with human EGFR, HER2 and HER4 receptors demonstrated amino-acid differences in HER3/D3 region 353-357, thus explaining why this antibody did not recognized other HER family receptors by flow cytometry.
- H4B-121 binding motif 352 DPWHKI 357 (SEQ ID NO: 36) protruded at the junction between D2 and D3 domains, this binding motif overhanging the D2 domain.
- H4B-121 binding motif 352 DPWHKI 357 (SEQ ID NO: 36) protruded at the junction between D2 and D3 domains, this binding motif overhanging the D2 domain.
- no crystal structure of HER3 receptor bound to a ligand has been reported.
- epitope recognized by HER3-specific antibody H4B-121 was superimposed on the crystallographic structure of the HER2 receptor bound to pertuzumab (pdb 1S78), thus indicated that the epitope is accessible even in the closed conformation of the HER3 receptor.
- Athymic, 6- to 8-week-old, female BALB/c nude mice were purchased from Janvier and Charles Rivers Laboratories.
- HER2-non amplified/PIK3CA-wt/p53-mut skin A431 (1 ⁇ 10 6 ) and HER2-non amplified/PIK3CA-wt/p53-wt BxPC3 (3.5 ⁇ 10 6 ) cancer cells were injected s.c. into the right flank of athymic BALB/c nude mice. They both expressed HER3 receptor at low level (between 10000 and 20000 receptors/cell).
- A431 cancer cells secreted HER3 ligand HRG and are HRG-addicted (Yonesaka, 2011).
- Tumor-bearing mice were randomized in the different treatment groups when the tumors reached an approximate volume of 100 mm 3 .
- the mice were treated by i.p. injections with 0.9% NaCl of HER3-specific H4B-121 antibody.
- the amount of injected antibody was 300 ⁇ g/injection, three-time week (Q2d, 15 mg/kg), for 6 weeks consecutively.
- Tumor dimensions were measured twice weekly with a caliper and the volumes were calculated by the formula D1 ⁇ D2 ⁇ D3/2. Tumor progression was calculated using the formula [(final volume) ⁇ (initial volume)]/(initial volume).
- results were also expressed by a Kaplan-Meier survival curve, using the time taken for the tumor to reach a determined final volume of 2,000 mm 3 .
- a median delay was defined as the time at which 50% of the mice had a tumor reaching the determined volume.
- the administration of 300 ⁇ g (Q2d) of the human antibody H4B-121 results in a significant inhibition of tumor growth.
- anti-HER3 antibody H4B-121 inhibited significantly tumor growth by approximately 53 ⁇ 6% in mice xenografted with A431 cancer cells, compared with vehicle control ( FIG. 12A ).
- the median delay to reach a tumor size of 2,000 mm3 is increased by 14 days ( FIG.
- FIG. 13A we observed a significant 68 ⁇ 4%-reduction in pancreatic BxPC3 tumor growth in antibody-treated mice at day 56 post-tumor implantation (corresponding to 26 days after the beginning of antibody treatment), with regard to tumor size measured in mice treated with vehicle (p ⁇ 0.001).
- Kaplan-Meier analysis revealed an 18-day delay in 50%-mean survival time for pancreatic BxPC3-xenografted mice treated with H4B-121 antibody ( FIG. 13B ).
- FIG. 13B inside
- tumors extracted from H4B-121-treated mice demonstrated an inhibition of Tyr1289 HER3 phosphorylation and a downregulation of the HER3 receptor, with regard to tumors extracted from vehicle-treated mice.
- BxPC3 tumor cells Five hundred and thousand BxPC3 tumor cells were added to each well of a 6-well culture plate for 24 h at 37° C. After serum starvation for 16 h in a RPMI complete medium with 1% FCS and further washing, cells were pre-incubated with a 50 ⁇ g/l concentration of H4B-121 antibody, negative control Px antibody or Ab#6 antibody for 1 h at 37° C., before washing and subsequent stimulating or not with a 100 ng/ml dilution of heregulin.
- TNT buffer peroxidase-conjugated rabbit, goat or mouse polyclonal antibodies (Sigma-Aldrich) were added as appropriate in TNT buffer containing 5% nonfat dry milk for 1 h at 25° C. After five washes in TNT buffer, the blots were visualized using a chemiluminescent substrate (Western lightning Plus-ECL, Perkin Elmer).
- D3-specific antibody H4B-121 blocked ligand-induced phosphorylation at Tyr1289 residue on HER3.
- Inhibition of Akt phosphorylation on Ser473 and Thr308 was concomitantly demonstrated following a 15 min short-time treatment of antibodies on BxPC3 cells.
- Phosphorylation of AKT-triggered downstream signalling was also affected by H4B-121 antibody, i.e.
- BxPC3 cells were analyzed for cell surface expression of HER2 and HER3 receptors after exposure to H4B-121 antibody for different times and temperatures.
- FIG. 14A a 2h-antibody incubation of BxPC3 cells at 37° C. strongly reduced HER3 cell surface expression, but did not affect EGFR and HER2 receptors ( FIG. 14A ).
- Antibody-induced HER3 down-regulation was abrogated when cells were treated at 4° C., thus demonstrating that HER3-specific antibody H4B-121 induced HER3 internalization. Quantification of HER3 internalization demonstrated that H4B-121 is more efficient than Ab#6 to induce HER3 internalization ( FIG. 14B ).
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Oncology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Neurosurgery (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Neurology (AREA)
- Biomedical Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP11305583 | 2011-05-13 | ||
EP11305583.4 | 2011-05-13 | ||
EP11305583 | 2011-05-13 | ||
PCT/EP2012/058769 WO2012156309A1 (en) | 2011-05-13 | 2012-05-11 | Antibodies against her3 |
Publications (2)
Publication Number | Publication Date |
---|---|
US20140141019A1 US20140141019A1 (en) | 2014-05-22 |
US9346883B2 true US9346883B2 (en) | 2016-05-24 |
Family
ID=46046250
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/116,562 Active US9346883B2 (en) | 2011-05-13 | 2012-05-11 | Antibodies against HER3 |
Country Status (8)
Families Citing this family (9)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP2606070B1 (en) | 2010-08-20 | 2016-12-21 | Novartis AG | Antibodies for epidermal growth factor receptor 3 (her3) |
CN104093742A (zh) * | 2011-12-05 | 2014-10-08 | 诺华股份有限公司 | 抗her3的结构域iii和结构域iv的表皮生长因子受体3(her3)抗体 |
AU2015223566B2 (en) | 2014-02-28 | 2020-10-08 | Merus N.V. | Antibodies that bind EGFR and ErbB3 |
LT3110849T (lt) | 2014-02-28 | 2020-12-10 | Merus N.V. | Antikūnai, surišantys erbb-2 ir erbb-3 |
CN115925944A (zh) | 2015-10-23 | 2023-04-07 | 美勒斯公司 | 抑制癌症生长的结合分子 |
IL310223A (en) | 2017-03-31 | 2024-03-01 | Merus Nv | Bispecific antibodies that bind ERBB-2 and ERBB3 for use in the treatment of cells with a fusion gene NRG1 |
US12195551B2 (en) | 2017-05-17 | 2025-01-14 | Merus N.V. | Combination of an ErbB-2/ErbB-3 bispecific antibody with endocrine therapy for breast cancer |
CA3064333A1 (en) * | 2017-05-29 | 2018-12-06 | Gamamabs Pharma | Cancer-associated immunosuppression inhibitor |
SI3665198T1 (sl) | 2017-08-09 | 2025-06-30 | Merus N.V. | Protitelesa, ki vežejo egfr in cmet |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2007077028A2 (en) | 2005-12-30 | 2007-07-12 | U3 Pharma Ag | Antibodies directed to her-3 and uses thereof |
WO2008100624A2 (en) | 2007-02-16 | 2008-08-21 | Merrimack Pharmaceuticals, Inc. | Antibodies against erbb3 and uses thereof |
Family Cites Families (30)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP0154316B1 (en) | 1984-03-06 | 1989-09-13 | Takeda Chemical Industries, Ltd. | Chemically modified lymphokine and production thereof |
US4861719A (en) | 1986-04-25 | 1989-08-29 | Fred Hutchinson Cancer Research Center | DNA constructs for retrovirus packaging cell lines |
EP0307434B2 (en) | 1987-03-18 | 1998-07-29 | Scotgen Biopharmaceuticals, Inc. | Altered antibodies |
US5677425A (en) | 1987-09-04 | 1997-10-14 | Celltech Therapeutics Limited | Recombinant antibody |
GB8725529D0 (en) | 1987-10-30 | 1987-12-02 | Delta Biotechnology Ltd | Polypeptides |
US5278056A (en) | 1988-02-05 | 1994-01-11 | The Trustees Of Columbia University In The City Of New York | Retroviral packaging cell lines and process of using same |
WO1990006952A1 (en) | 1988-12-22 | 1990-06-28 | Kirin-Amgen, Inc. | Chemically modified granulocyte colony stimulating factor |
SE509359C2 (sv) | 1989-08-01 | 1999-01-18 | Cemu Bioteknik Ab | Användning av stabiliserade protein- eller peptidkonjugat för framställning av ett läkemedel |
US5183884A (en) | 1989-12-01 | 1993-02-02 | United States Of America | Dna segment encoding a gene for a receptor related to the epidermal growth factor receptor |
US5670488A (en) | 1992-12-03 | 1997-09-23 | Genzyme Corporation | Adenovirus vector for gene therapy |
US5714350A (en) | 1992-03-09 | 1998-02-03 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region |
EP0640094A1 (en) | 1992-04-24 | 1995-03-01 | The Board Of Regents, The University Of Texas System | Recombinant production of immunoglobulin-like domains in prokaryotic cells |
JP3866760B2 (ja) | 1993-02-22 | 2007-01-10 | ザ ロックフェラー ユニバーシティ | 一過性トランスフェクションによる高力価のヘルパーフリーのレトロウイルスの生産 |
JPH08511420A (ja) | 1993-06-16 | 1996-12-03 | セルテック・セラピューテイクス・リミテッド | 抗 体 |
FR2712812B1 (fr) | 1993-11-23 | 1996-02-09 | Centre Nat Rech Scient | Composition pour la production de produits thérapeutiques in vivo. |
IL116816A (en) | 1995-01-20 | 2003-05-29 | Rhone Poulenc Rorer Sa | Cell for the production of a defective recombinant adenovirus or an adeno-associated virus and the various uses thereof |
US6121022A (en) | 1995-04-14 | 2000-09-19 | Genentech, Inc. | Altered polypeptides with increased half-life |
US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
US6013516A (en) | 1995-10-06 | 2000-01-11 | The Salk Institute For Biological Studies | Vector and method of use for nucleic acid delivery to non-dividing cells |
US5968511A (en) | 1996-03-27 | 1999-10-19 | Genentech, Inc. | ErbB3 antibodies |
US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
ATE319745T1 (de) | 1997-05-21 | 2006-03-15 | Biovation Ltd | Verfahren zur herstellung von nicht-immunogenen proteinen |
US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
AU3657899A (en) | 1998-04-20 | 1999-11-08 | James E. Bailey | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
EP2366713A3 (en) | 1999-01-15 | 2012-06-27 | Genentech, Inc. | Polypeptide variants with altered effector function |
EP2270148A3 (en) | 1999-04-09 | 2011-06-08 | Kyowa Hakko Kirin Co., Ltd. | Method for controlling the activity of immunologically functional molecule |
EP1522590B1 (en) | 2000-06-28 | 2009-08-26 | Glycofi, Inc. | Methods for producing modified glycoproteins |
EP1283053A1 (en) | 2001-08-09 | 2003-02-12 | Max-Planck-Gesellschaft zur Förderung der Wissenschaften e.V. | Inhibitors of HER3 activity |
ES2326964T3 (es) | 2001-10-25 | 2009-10-22 | Genentech, Inc. | Composiciones de glicoproteina. |
EP2233500A1 (en) | 2009-03-20 | 2010-09-29 | LFB Biotechnologies | Optimized Fc variants |
-
2012
- 2012-05-11 NO NO12719763A patent/NO2707391T3/no unknown
- 2012-05-11 WO PCT/EP2012/058769 patent/WO2012156309A1/en active Application Filing
- 2012-05-11 DK DK12719763.0T patent/DK2707391T3/en active
- 2012-05-11 US US14/116,562 patent/US9346883B2/en active Active
- 2012-05-11 EP EP12719763.0A patent/EP2707391B1/en active Active
- 2012-05-11 PL PL12719763T patent/PL2707391T3/pl unknown
- 2012-05-11 ES ES12719763.0T patent/ES2657862T3/es active Active
- 2012-05-11 PT PT127197630T patent/PT2707391T/pt unknown
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2007077028A2 (en) | 2005-12-30 | 2007-07-12 | U3 Pharma Ag | Antibodies directed to her-3 and uses thereof |
WO2008100624A2 (en) | 2007-02-16 | 2008-08-21 | Merrimack Pharmaceuticals, Inc. | Antibodies against erbb3 and uses thereof |
Non-Patent Citations (6)
Title |
---|
Casset et al. (BBRC, 2003, 307:198-205). * |
MacCallum et al. (J. Mol. Biol., 1996, 262: 732-745). * |
McKay et al., "Tolerance to single, but not multiple, amino acid replacements in antibody V-H CDR2: A means of minimizing B cell wastage from somatic hypermutation?", Journal of Immunology, Jan. 1, 1996, pp. 3285-3291, vol. 156, No. 9. |
Pascalis et al. (The Journal of Immunology, 2002, 169: 3076-3084). * |
Rudikoff et al. (Proc Natl Acad Sci USA 1982 vol. 79 p. 1979). * |
Xu et al (Immunity, 2000, 13:37-45). * |
Also Published As
Publication number | Publication date |
---|---|
NO2707391T3 (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html) | 2018-04-07 |
WO2012156309A1 (en) | 2012-11-22 |
DK2707391T3 (en) | 2018-02-05 |
PT2707391T (pt) | 2018-02-06 |
ES2657862T3 (es) | 2018-03-07 |
EP2707391A1 (en) | 2014-03-19 |
PL2707391T3 (pl) | 2018-04-30 |
US20140141019A1 (en) | 2014-05-22 |
EP2707391B1 (en) | 2017-11-08 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US9346883B2 (en) | Antibodies against HER3 | |
EP3665198B9 (en) | Antibodies that bind egfr and cmet | |
CN108424456B (zh) | 特异于her3的结合分子及其用途 | |
JP6033293B2 (ja) | 抗Axl抗体及びその使用 | |
JP6120833B2 (ja) | 抗Axl抗体及びその使用 | |
JP2022071071A (ja) | ErbB-2およびErbB-3に結合する抗体 | |
KR20210109520A (ko) | 항체 및 이의 용도 | |
EP2710040B1 (en) | Anti-human-her3 antibodies and uses thereof | |
JP2017512756A (ja) | Egfrおよびerbb3に結合する抗体 | |
KR20170070076A (ko) | 항-nkg2a 제제를 이용하는 암 치료 | |
JP2009532358A (ja) | 突然変異型egf受容体を発現する腫瘍の治療 | |
WO2015048008A2 (en) | Binding molecules specific for her3 and uses thereof | |
WO2018182420A1 (en) | Antibodies for the treatment of erbb-2/erbb-3 positive tumors | |
JP6449876B2 (ja) | ニューレグリンに対して非競合的でアロステリックな抗ヒトher3抗体及びその使用 | |
AU2021266688A1 (en) | Canine PD-1-binding polypeptides and uses thereof | |
EP3353205B1 (en) | Anti-mullerian hormone (amh) neutralizing antibodies and uses thereof | |
AU2022211109A1 (en) | Methods of cancer treatment using anti-tigit antibodies in combination with anti-pd1 antibodies | |
EP2985292A1 (en) | Epidermal growth factor receptor antibody | |
EP3368573A1 (en) | Anti-nrg1 (heregulin) antibodies and uses thereof | |
JP6357113B2 (ja) | ヒトnrg1タンパク質に対する抗体 | |
CN119698295A (zh) | 使用抗tigit抗体的癌症治疗方法 | |
NZ625046B2 (en) | Binding molecules specific for her3 and uses thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: INSTITUT NATIONAL DE LA SANTE ET DE LA RECHERCHE M Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:KHARRAT, ABDELHAKIM;DUBREUIL, OLIVIER;LAZREK, YASSAMINE;AND OTHERS;SIGNING DATES FROM 20131201 TO 20140120;REEL/FRAME:032107/0417 |
|
AS | Assignment |
Owner name: GAMAMABS PHARMA SA, FRANCE Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:INSTITUT NATIONAL DE LA SANTE ET DE LA RECHERCHE MEDICALE (INSERM);REEL/FRAME:037416/0049 Effective date: 20151215 Owner name: INSTITUT NATIONAL DE LA SANTE ET DE LA RECHERCHE M Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:INSTITUT NATIONAL DE LA SANTE ET DE LA RECHERCHE MEDICALE (INSERM);REEL/FRAME:037416/0049 Effective date: 20151215 |
|
STCF | Information on status: patent grant |
Free format text: PATENTED CASE |
|
MAFP | Maintenance fee payment |
Free format text: PAYMENT OF MAINTENANCE FEE, 4TH YEAR, LARGE ENTITY (ORIGINAL EVENT CODE: M1551); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY Year of fee payment: 4 |
|
MAFP | Maintenance fee payment |
Free format text: PAYMENT OF MAINTENANCE FEE, 8TH YEAR, LARGE ENTITY (ORIGINAL EVENT CODE: M1552); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY Year of fee payment: 8 |