US20240010751A1 - Multispecific binding agents and uses thereof - Google Patents

Multispecific binding agents and uses thereof Download PDF

Info

Publication number
US20240010751A1
US20240010751A1 US18/018,864 US202118018864A US2024010751A1 US 20240010751 A1 US20240010751 A1 US 20240010751A1 US 202118018864 A US202118018864 A US 202118018864A US 2024010751 A1 US2024010751 A1 US 2024010751A1
Authority
US
United States
Prior art keywords
seq
amino acid
acid sequence
cdr2
fragment
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
US18/018,864
Other languages
English (en)
Inventor
Bryan Glaser
Bonnie HAMMER
Seema Kantak
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Exelixis Inc
Original Assignee
Exelixis Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Exelixis Inc filed Critical Exelixis Inc
Priority to US18/018,864 priority Critical patent/US20240010751A1/en
Publication of US20240010751A1 publication Critical patent/US20240010751A1/en
Assigned to EXELIXIS, INC. reassignment EXELIXIS, INC. ASSIGNMENT OF ASSIGNOR'S INTEREST Assignors: KANTAK, SEEMA
Assigned to Invenra Inc. reassignment Invenra Inc. ASSIGNMENT OF ASSIGNOR'S INTEREST Assignors: GLASER, BRYAN, HAMMER, Bonnie
Assigned to EXELIXIS, INC. reassignment EXELIXIS, INC. ASSIGNMENT OF ASSIGNOR'S INTEREST Assignors: Invenra Inc.
Pending legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/46Hybrid immunoglobulins
    • C07K16/468Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2827Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/40Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/71Decreased effector function due to an Fc-modification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding

Definitions

  • the present disclosure relates generally to multispecific binding agents, such as bispecific antibodies, that have a first binding domain that binds to CD47, including human CD47, and one or more additional binding domains that bind to one or more targets that are not CD47, such as PD-L1, and methods of their use.
  • multispecific binding agents such as bispecific antibodies, that have a first binding domain that binds to CD47, including human CD47, and one or more additional binding domains that bind to one or more targets that are not CD47, such as PD-L1, and methods of their use.
  • CD47 is a cell surface glycoprotein that functions as a regulator of phagocytosis mediated by cells of the innate immune system.
  • CD47 interacts with multiple ligands, such as integrins, signal regulatory protein alpha (SIRP ⁇ ), signal regulatory protein gamma (SIRP ⁇ ) and thrombospondins.
  • CD47 inhibits phagocytosis by interacting with SIRP ⁇ on the surface of macrophages and dendritic cells, triggering a “don't eat me” signal.
  • CD47 activation or loss of CD47 can result in enhanced proliferation in a cell type dependent manner.
  • astrocytoma cells have been shown to have increased proliferation following activation of CD47 and TSP-1, whereas the normal astroglial cells have not. It has also been proposed that CD47 may facilitate proliferation of cancer cells through a PI3K/Akt pathway.
  • tumor cells use this mechanism to protect themselves from immune attack, resulting in tumor immune evasion.
  • Many cancers overexpress PD-L1, and its overexpression is often associated with poor prognosis.
  • the PD-1/PD-L1 interaction stimulates the downstream signals to suppress T cell activation, resulting in tumor cell survival.
  • the blockade of PD-1 interaction with its ligands has been proposed as an immunotherapeutic method of enhancing T cell immune responses against tumor cells.
  • Current strategies of PD-1/PD-L1 based immunotherapy have shown efficacy in treating some advanced carcinoma, but have limited effects on many solid tumors and on certain PD-L1 functions. Accordingly, there remains an urgent need in the art for agents that can block or prevent PD-1/PD-L1 interaction.
  • compositions comprising a multispecific binding agent described herein.
  • Such compositions include multispecific antibodies (e.g., antibodies, such as bispecific antibodies) that bind to CD47 and one or more additional targets that are not CD47 (e.g., PD-L1), for example, multispecific antibodies that have a first binding domain that binds to CD47, including human CD47, and one or more additional binding domains that bind to one or more targets that are not CD47 (e.g., PD-L1).
  • the present disclosure also provides methods of treating, preventing, or alleviating an immune cell dysfunctional disease, disorder or condition (e.g., a phagocytic cell dysfunctional disease, disorder, or condition or a T cell dysfunctional disease, disorder, or condition), including one or more symptoms of the immunce cell dysfunctional disease, disorder, or condition with a multispecific binding agent or a composition comprising the multispecific binding agent, including a bispecific antibody or composition comprising the bispecific antibody, as described herein.
  • an immune cell dysfunctional disease, disorder or condition e.g., a phagocytic cell dysfunctional disease, disorder, or condition or a T cell dysfunctional disease, disorder, or condition
  • a multispecific binding agent or a composition comprising the multispecific binding agent including a bispecific antibody or composition comprising the bispecific antibody, as described herein.
  • Such compostions include multispecific antibodies (e.g., antibodies, such as bispecific antibodies) that bind to CD47 and one or more additional targets that are not CD47 (e.g., PD-L1), for example, multispecific antibodies that have a first binding domain that binds to CD47, including human CD47, and one or more additional binding domains that bind to one or more targets that are not CD47 (e.g., PD-L1) and compete for the binding of human CD47 with an antibody having a heavy chain variable region and a light chain variable region described herein (e.g., Table 1-3).
  • multispecific antibodies e.g., antibodies, such as bispecific antibodies
  • FIGS. 1 A- 1 D illustrate exemplary results from cell binding assays, further described in Example 3.
  • FIGS. 2 A- 2 E illustrate exemplary results from additional cell binding assays, further described in Example 3.
  • FIG. 3 illustrate exemplary results from CD47/SIRP ⁇ inhibiting assays, further described in Example 4.
  • FIG. 4 illustrate exemplary results from PD-L1/PD-1 inhibiting assays, further described in Example 4.
  • FIGS. 5 A- 5 G illustrate exemplary results from phagocytosis assays, further described in Example 5.
  • FIGS. 6 A- 6 G illustrate exemplary results from additional phagocytosis assays, further described in Example 5.
  • FIG. 7 illustrates exemplary results from in vivo animal studies related to tumor volume, further described in Example 7.
  • FIG. 8 illustrates exemplary results from in vivo animal studies related to body weight, further described in Example 7.
  • FIGS. 9 A- 9 E illustrate exemplary results from in vivo animal studies related to blood parameters, further described in Example 7.
  • FIGS. 10 A- 10 G illustrate exemplary results from in vivo animal studies related to additional blood parameters, further described in Example 7.
  • FIG. 11 illustrates exemplary results from in vivo animal studies related to antibody concentrations in blood, further described in Example 7.
  • FIGS. 12 A- 12 E illustrate exemplary results from additional in vivo animal studies related to tumor volume and body weight, further described in Example 7.
  • FIGS. 13 A- 13 D illustrate exemplary results from additional in vivo animal studies related to tumor infiltrating leukocytes, further described in Example 7.
  • FIG. 14 illustrates exemplary results from additional in vivo animal studies related to antibody concentrations in blood, further described in Example 7.
  • FIGS. 15 A- 15 H illustrate exemplary results from additional in vivo animal studies related to tumor volume and body weight, further described in Example 7.
  • FIGS. 16 A- 16 B illustrate exemplary results from additional in vivo animal studies related to tumor volume and body weight, further described in Example 7.
  • FIG. 17 illustrates exemplary results from additional in vivo animal studies related to macrophage infiltration into tumors, further described in Example 7.
  • FIGS. 18 A- 18 B illustrate exemplary results from additional in vivo animal studies related to tumor volume and body weight, further described in Example 7.
  • FIGS. 19 A- 19 C illustrate exemplary results from SEC chromatography, further described in Example 8.
  • FIGS. 20 A- 20 D illustrate exemplary results from HIC chromatography, further described in in Example 8.
  • FIGS. 21 A- 21 D illustrate exemplary results from SMAC chromatography, further described in Example 8.
  • FIGS. 22 A- 22 B show a sequence alignment of heavy chain variable regions and light chain variable regions of C40, C56, and C59, including consensus sequences for VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3. Boundaries of CDRs are indicated by Kabat, AbM, Chothia, Contact, IMGT and AHon numbering.
  • FIGS. 23 A- 23 B show a sequence alignment of heavy chain variable regions and light chain variable regions of P22, P24, and P31.2, including consensus sequences for VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3. Boundaries of CDRs are indicated by Kabat, AbM, Chothia, Contact, and IMGT numbering.
  • Such multispecific binding agents are useful in compositions and in methods of treating, preventing, or alleviating an immune cell dysfunctional disease, disorder or condition (e.g., a phagocytic cell dysfunctional disease, disorder, or condition or a T cell dysfunctional disease, disorder, or condition), including one or more symptoms of the disease, disorder, or condition.
  • an immune cell dysfunctional disease, disorder or condition e.g., a phagocytic cell dysfunctional disease, disorder, or condition or a T cell dysfunctional disease, disorder, or condition
  • Phagocytic cell dysfunctional diseases, disorders, and conditions include tumor immunity and associated cancers, including, but not limited to, any cancer wherein the tumor cells express or overexpress CD47.
  • T cell dysfunctional diseases, disorders, and conditions include tumor immunity and associated cancers, including, but not limited to, any cancer wherein the tumor cells express or overexpress PD-L1.
  • Multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding antibodies e.g., bispecific antibodies
  • Multispecific binding agents are useful in compositions and in methods for enhancing phagocytic cell function and T cell function, including the upregulation of cell-mediated immune responses.
  • CD47 encompasses “full-length,” unprocessed CD47, as well as any form of CD47 or any fragment thereof that results from processing in the cell, including the four known alternatively spliced isoforms of CD47 that differ in the length of the intracellular tail.
  • the term CD47 also encompasses naturally occurring variants of CD47, such as SNP variants, splice variants and allelic variants.
  • CD47 is known in the art to interact with SIRP ⁇ and this interaction leads to cell signaling that includes, among other things, inhibition of phagocytosis by macrophages.
  • CD47 polypeptides that are also encompassed by the term CD47 include fragments, derivatives (e.g., substitution, deletion, truncations, and insertion variants), fusion polypeptides, and interspecies homologs that retain CD47 activity and/or are sufficient to generate an anti-CD47 immune response.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • An epitope may be part of a larger CD47 antigen, which may be part of a larger CD47 polypeptide fragment, which, in turn, may be part of a larger CD47 polypeptide.
  • CD47 may exist in a native or denatured form.
  • CD47 polypeptides described herein may be isolated from a variety of sources, such as from human tissue types or from another source, or prepared by recombinant or synthetic methods.
  • a CD47 polypeptide may comprise a polypeptide having the same amino acid sequence as a corresponding CD47 polypeptide derived from nature. Orthologs to the CD47 polypeptide are also well known in the art.
  • PD-L1 polypeptides that are also encompassed by the term PD-L1 include fragments, derivatives (e.g., substitution, deletion, truncations, and insertion variants), fusion polypeptides, and interspecies homologs that retain PD-L1 activity and/or are sufficient to generate an anti-PD-L1 immune response.
  • a PD-L1 binding agent e.g., an antibody
  • a PD-L1 binding agent described herein can bind to a PD-L1 polypeptide, a PD-L1 polypeptide fragment, a PD-L1 antigen, and/or a PD-L1 epitope.
  • An epitope may be part of a larger PD-L1 antigen, which may be part of a larger PD-L1 polypeptide fragment, which, in turn, may be part of a larger PD-L1 polypeptide.
  • PD-L1 may exist in a native or denatured form.
  • PD-L1 polypeptides described herein may be isolated from a variety of sources, such as from human tissue types or from another source, or prepared by recombinant or synthetic methods.
  • a PD-L1 polypeptide may comprise a polypeptide having the same amino acid sequence as a corresponding PD-L1 polypeptide derived from nature. Orthologs to the PD-L1 polypeptide are also well known in the art.
  • PD-1 Programmed Cell Death-1
  • PD-1 receptor refers to a polypeptide (“polypeptide” and “protein” are used interchangeably herein) or any native PD-1 from any vertebrate source, including mammals such as primates (e.g., humans, cynomolgus monkey (cyno)), dogs, and rodents (e.g., mice and rats), unless otherwise indicated.
  • PD-1 also known as CD279 (cluster of differentiation 279), is an immunoinhibitory receptor belonging to the CD28 family. PD-1 is expressed predominantly on previously activated T cells in vivo, and binds to two ligands, PD-L1 and PD-L2.
  • PD-1 belongs to the immunoglobulin superfamily and consist of two extracellular Ig domains, an N-terminal V domain, and a C-terminal constant domain.
  • PD-1 contains two cytoplasmic tyrosine-based signaling motifs, an immunoreceptor tyrosine-based inhibition motif (ITIM) and an immunoreceptor tyrosine-based switch motif (ITSM).
  • ITIM immunoreceptor tyrosine-based inhibition motif
  • ITSM immunoreceptor tyrosine-based switch motif
  • the term PD-1 encompasses “full-length,” PD-1, as well as any form of PD-1 or any fragment thereof that results from processing in the cell.
  • the term PD-1 also encompasses naturally occurring variants of PD-1, such as SNP variants, splice variants and allelic variants.
  • Non-limiting examples of antibody fragments include antigen-binding regions and/or effector regions of the antibody, e.g., Fab, Fab′, F(ab′)2, Fv, scFv, (scFv)2, single chain antibody molecule, dual variable region antibody, single variable region antibody, linear antibody, V region, a multispecific antibody formed from antibody fragments, F(ab)2, Fd, Fc, diabody, di-diabody, disulfide-linked Fvs (dsFv), single-domain antibody (e.g., nanobody) or other fragments (e.g., fragments consisting of the variable regions of the heavy and light chains that are non-covalently coupled).
  • variable (V) region domain may be any suitable arrangement of immunoglobulin heavy (VH) and/or light (VL) chain variable domains.
  • the present disclosure also includes tetrameric antibodies comprising two heavy chain and two light chain molecules, an antibody light chain monomer, and an antibody heavy chain monomer.
  • the V region domain may be dimeric and contain VH-VH, VH-VL, or VL-VL dimers that bind CD47.
  • the VH and VL chains may be covalently coupled either directly or through a linker to form a single chain Fv (scFv).
  • scFv proteins are referred to herein as included in the category “antibody fragments.”
  • Another form of an antibody fragment is a peptide comprising one or more complementarity determining regions (CDRs) of an antibody.
  • CDRs also termed “minimal recognition units” or “hypervariable region” can be obtained by constructing polynucleotides that encode the CDR of interest.
  • Antibody fragments may be incorporated into single domain antibodies, maxibodies, minibodies, intrabodies, diabodies, triabodies, tetrabodies, variable domains of new antigen receptors (v-NAR), and bis-single chain Fv regions (see, e.g., Hollinger and Hudson, Nature Biotechnology, 23(9):1126-1136, 2005).
  • the binding agent in some embodiments, contains a light chain and/or a heavy chain constant region, such as one or more constant regions, including one or more IgG1, IgG2, IgG3 and/or IgG4 constant regions.
  • antibodies can include epitope-binding fragments of any of the above.
  • the antibodies described herein can be of any class (e.g., IgG, IgE, IgM, IgD, and IgA) or any subclass (e.g., IgG1, IgG2, IgG3, IgG4, IgA1, and IgA2) of immunoglobulin molecule.
  • Antibodies may be agonistic antibodies or antagonistic antibodies.
  • binding agent e.g., an antibody
  • a binding agent that has one or more binding sites each of which bind to the same epitope of the same antigen.
  • multispecific when used in reference to a binding agent (e.g., an antibody) means that the binding agent has binding specificities for at least two different antigens or at least two different epitopes on the same antigen (e.g., a bispecific antibody directed to CD47 with a first binding site for a first epitope of a CD47, and a second binding site for a second epitope of CD47).
  • a binding agent e.g., an antibody
  • bispecific when used in reference to a binding agent (e.g., an antibody) means that the binding agent is able to specifically bind to two distinct antigenic determinants, for example, two binding sites each formed by a pair of an antibody heavy chain variable domain (VH) and an antibody light chain variable domain (VL) binding to different antigens or to different epitopes on the same antigen.
  • a bispecific binding agent may have a 1+1 format.
  • bispecific binding agent (e.g., an antibody) formats may be 2+1 or 1+2 formats (comprising two binding sites for a first antigen or epitope and one binding site for a second antigen or epitope) or 2+2 formats (comprising two binding sites for a first antigen or epitope and two binding sites for a second antigen or epitope).
  • a bispecific binding agent e.g., an antibody
  • comprises two antigen binding sites each may bind to a different antigenic determinant.
  • Such a bispecific binding agent (e.g., an antibody) may bind to two different epitopes on the same antigen (e.g., epitopes on CD47).
  • nucleic acids or polypeptides refer to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned (introducing gaps, if necessary) for maximum correspondence, not considering any conservative amino acid substitutions as part of the sequence identity.
  • the percent identity can be measured using sequence comparison software or algorithms or by visual inspection.
  • Various algorithms and software that can be used to obtain alignments of amino acid or nucleotide sequences are well-known in the art. These include, but are not limited to, BLAST, ALIGN, Megalign, BestFit, GCG Wisconsin Package, and variants thereof.
  • two nucleic acids or polypeptides are substantially identical, meaning they have at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, and in some embodiments at least 95%, 96%, 97%, 98%, 99% nucleotide or amino acid residue identity, when compared and aligned for maximum correspondence, as measured using a sequence comparison algorithm or by visual inspection.
  • identity exists over a region of the amino acid sequences that is at least about 10 residues, at least about 20 residues, at least about 40-60 residues, at least about 60-80 residues in length or any integral value there between.
  • identity exists over a longer region than 60-80 residues, such as at least about 80-100 residues, and in some embodiments the sequences are substantially identical over the full length of the sequences being compared, such as the coding region of a target protein or an antibody. In some embodiments, identity exists over a region of the nucleotide sequences that is at least about 10 bases, at least about 20 bases, at least about 40-60 bases, at least about 60-80 bases in length or any integral value there between.
  • identity exists over a longer region than 60-80 bases, such as at least about 80-1000 bases or more, and in some embodiments the sequences are substantially identical over the full length of the sequences being compared, such as a nucleotide sequence encoding a protein of interest.
  • a “conservative amino acid substitution” is one in which one amino acid ‘residue is replaced with another amino acid residue having a side chain with similar chemical characteristics.
  • Families of amino acid residues having similar side chains have been generally defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, hist
  • substitution of a phenylalanine for a tyrosine is a conservative substitution.
  • conservative substitutions in the sequences of the polypeptides, soluble proteins, and/or antibodies of the disclosure do not abrogate the binding of the polypeptide, soluble protein, or antibody containing the amino acid sequence, to the target binding site.
  • Methods of identifying amino acid conservative substitutions which do not eliminate binding are well-known in the art.
  • polypeptide refers to polymers of amino acids of any length.
  • the polymer can be linear or branched, it can comprise modified amino acids, and it can include (e.g., be interrupted by) non-amino acids.
  • the terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as linkage to or conjugation with (directly or indirectly) a moiety such as a labeling component.
  • polypeptides containing one or more analogs of an amino acid including, for example, unnatural amino acids
  • the polypeptides of this disclosure can be based upon antibodies or other members of the immunoglobulin superfamily, in some embodiments, the polypeptides can occur as single chains.
  • an “antigen” is a moiety or molecule that contains an epitope to which a binding agent (e.g., an antibody, such as a bispecific antibody) can bind.
  • a binding agent e.g., an antibody, such as a bispecific antibody
  • an antigen can be bound by an antibody.
  • the antigen, to which a binding agent (e.g., an antibody, such as a bispecific antibody) described herein binds is CD47 (e.g., human CD47), or a fragment thereof.
  • an “epitope” is a term in the art and refers to a localized region of an antigen to which an antibody can bind.
  • An epitope can be a linear epitope or a conformational, non-linear, or discontinuous, epitope.
  • an epitope can be contiguous amino acids of the polypeptide (a “linear” epitope) or an epitope can comprise amino acids from two or more non-contiguous regions of the polypeptide (a “conformational,” “non-linear” or “discontinuous” epitope), e.g., human CD47.
  • a linear epitope may or may not be dependent on secondary, tertiary, or quaternary structure.
  • an antibody binds to a group of amino acids regardless of whether they are folded in a natural three dimensional protein structure.
  • an antibody requires amino acid residues making up the epitope to exhibit a particular conformation (e.g., bend, twist, turn or fold) in order to recognize and bind the epitope.
  • an antibody binds “an epitope” or “essentially the same epitope” or “the same epitope” as a reference antibody, when the two antibodies recognize identical, overlapping or adjacent epitopes in a three-dimensional space.
  • the most widely used and rapid methods for determining whether two antibodies bind to identical, overlapping or adjacent epitopes in a three-dimensional space are competition assays, which can be configured in a number of different formats, for example, using either labeled antigen or labeled antibody.
  • the antigen is immobilized on a 96-well plate, or expressed on a cell surface, and the ability of unlabeled antibodies to block the binding of labeled antibodies is measured using radioactive, fluorescent or enzyme labels.
  • Epitope binning is the process of grouping antibodies based on the epitopes they recognize. More particularly, epitope binning comprises methods and systems for discriminating the epitope recognition properties of different antibodies, using competition assays combined with computational processes for clustering antibodies based on their epitope recognition properties and identifying antibodies having distinct binding specificities.
  • the terms “specifically binds,” “specifically recognizes,” “immunospecifically binds,” “selectively binds,” “immunospecifically recognizes” and “immunospecific” are analogous terms in the context of antibodies and refer to molecules that bind to an antigen (e.g., epitope) as such binding is understood by one skilled in the art.
  • “specifically binds” means, for instance that a polypeptide or molecule interacts more frequently, more rapidly, with greater duration, with greater affinity, or with some combination of the above to the epitope, protein, or target molecule than with alternative substances, including related and unrelated proteins.
  • a molecule that specifically binds to an antigen may bind to other peptides or polypeptides, generally with lower affinity as determined by, e.g., immunoassays, BiacoreTM, KinExA 3000 instrument (Sapidyne Instruments, Boise, ID), or other assays known in the art.
  • an antibody or antigen binding domain binds to or specifically binds to an antigen when it binds to an antigen with higher affinity than to any cross-reactive antigen as determined using experimental techniques, such as radioimmunoassays (RIA) and enzyme linked immunosorbent assays (ELISAs).
  • “specifically binds” means that a polypeptide or molecule binds a target with a KD of at least about 0.1 ⁇ M or less, at least about 0.01 ⁇ M or less, or at least about 1 nM or less. Because of the sequence identity between homologous proteins in different species, specific binding can include a polypeptide or molecule that recognizes a protein or target in more than one species. Likewise, because of homology within certain regions of polypeptide sequences of different proteins, specific binding can include a polypeptide or molecule that recognizes more than one protein or target. It is understood that, in some embodiments, a polypeptide or molecule that specifically binds a first target may or may not specifically bind a second target.
  • telomere binding does not necessarily require (although it can include) exclusive binding, e.g., binding to a single target.
  • a polypeptide or molecule can, in some embodiments, specifically bind more than one target.
  • multiple targets can be bound by the same antigen-binding site on the polypeptide or molecule.
  • an antibody can, in certain instances, comprise two identical antigen-binding sites, each of which specifically binds the same epitope on two or more proteins.
  • an antibody can be bispecific and comprise at least two antigen-binding sites with differing specificities. Generally, but not necessarily, reference to “binding” means “specific binding”.
  • Binding affinity generally refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (e.g., a binding protein such as an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, “binding affinity” refers to intrinsic binding affinity which reflects a 1:1 interaction between members of a binding pair (e.g., antibody and antigen).
  • the affinity of a binding molecule X for its binding partner Y can generally be represented by the dissociation constant (K D ). Affinity can be measured by common methods known in the art, including those described herein.
  • KD binding affinity
  • KD value may be measured by assays known in the art, for example by a binding assay.
  • the K D values reported herein were determined by biolayer interferometry (BLI) using, for example, the OctetQK384 system (ForteBio, Menlo Park, CA).
  • the K D may be also be measured in a radiolabeled antigen binding assay (RIA), for example, performed with the Fab version of an antibody of interest and its antigen (Chen, et al., (1999) J. Mol Biol 293:865-881) or using surface plasmon resonance (SPR) assays by Biacore, using, for example, a BIAcoreTM-2000 or a BIAcoreTM-3000 BIAcore, Inc., Piscataway, NJ).
  • RIA radiolabeled antigen binding assay
  • an “on-rate” or “rate of association” or “association rate” or “k on ,” as well as an “off-rate” or “rate of dissociation” or “dissociation rate” or “k off ,” may also be determined with the same SPR or BLI techniques described above using, for example, the OctetQK384 system (ForteBio, Menlo Park, CA) or a BIAcoreTM-2000 or a BIAcoreTM-3000 (BIAcore, Inc., Piscataway, NJ), respectively.
  • Compet when used in the context of multispecific binding agents (e.g., antibodies, such as bispecific antibodies) means binding agents that compete for the same epitope or binding site on a target, which includes competition between such binding agents as determined by an assay in which the binding agent under study prevents or inhibits the specific binding of a reference molecule (e.g., a reference ligand, or reference antigen binding protein, such as a reference antibody) to a common antigen (e.g., CD47).
  • a reference molecule e.g., a reference ligand, or reference antigen binding protein, such as a reference antibody
  • a common antigen e.g., CD47
  • Numerous types of competitive binding assays can be used to determine if a test binding agent competes with a reference molecule for binding to CD47 (e.g., human CD47).
  • assays examples include solid phase direct or indirect radioimmunoassay (RIA), solid phase direct or indirect enzyme immunoassay (EIA), sandwich competition assay (see, e.g., Stahli et al., (1983) Methods in Enzymology 9:242-253); solid phase direct biotin-avidin EIA (see, e.g., Kirkland et al., (1986) J. Immunol.
  • RIA solid phase direct or indirect radioimmunoassay
  • EIA enzyme immunoassay
  • sandwich competition assay see, e.g., Stahli et al., (1983) Methods in Enzymology 9:242-253
  • solid phase direct biotin-avidin EIA see, e.g., Kirkland et al., (1986) J. Immunol.
  • solid phase direct labeled assay solid phase direct labeled sandwich assay (see, e.g., Harlow and Lane, (1988) Antibodies, A Laboratory Manual, Cold Spring Harbor Press); solid phase direct label RIA using 1-125 label (see, e.g., Morel et al., (1988) Molec. Immunol. 25:7-15); solid phase direct biotin-avidin EIA (see, e.g., Cheung, et al., (1990) Virology 176:546-552); and direct labeled RIA (Moldenhauer et al., (1990) Scand. J. Immunol. 32:77-82).
  • such an assay involves the use of a purified antigen (e.g., CD47, such as human CD47) bound to a solid surface or cells bearing either of an unlabelled test antigen binding protein (e.g., test CD47 antibody) or a labeled reference antigen binding protein (e.g., reference CD47 antibody).
  • a purified antigen e.g., CD47, such as human CD47
  • an unlabelled test antigen binding protein e.g., test CD47 antibody
  • a labeled reference antigen binding protein e.g., reference CD47 antibody
  • Antibodies identified by competition assay include antibodies binding to the same epitope as the reference antibody and/or antibodies binding to an adjacent epitope sufficiently proximal to the epitope bound by the reference for antibodies steric hindrance to occur (e.g., similar epitope or overlapping epitope).
  • a competing antibody when it is present in excess, it will inhibit specific binding of a reference antibody to a common antigen by at least 20%, for example, at least 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70% or 75%. In some instance, binding is inhibited by at least 80%, 85%, 90%, 95%, 96% or 97%, 98%, 99% or more.
  • the term “constant region” or “constant domain” is a well-known antibody term of art and refers to an antibody portion, e.g., for example, a carboxyl terminal portion of a light and/or heavy chain which is not directly involved in binding of an antibody to antigen but which can exhibit various effector functions, such as interaction with the Fc receptor.
  • the term include the portion of an immunoglobulin molecule having a generally more conserved amino acid sequence relative to an immunoglobulin variable domain.
  • Antibody effector functions refer to those biological activities attributable to the Fc region (e.g., a native sequence Fc region or amino acid sequence variant Fc region) of an antibody, and vary with the antibody isotype. Examples of antibody effector functions include: C1q binding and complement dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g., B cell receptor); and B cell activation.
  • Fc region herein is used to define a C-terminal region of an immunoglobulin heavy chain, including, for example, native sequence Fc regions, recombinant Fc regions, and variant Fc regions. Although the boundaries of the Fc region of an immunoglobulin heavy chain might vary, the human IgG heavy chain Fc region is often defined to stretch from an amino acid residue at position Cys226 (according to the EU numbering system), or from Pro230 (according to the EU numbering system), to the carboxyl-terminus thereof.
  • the C-terminal lysine (residue 447 according to the EU numbering system) of the Fc region may be removed, for example, during production or purification of the antibody, or by recombinantly engineering the nucleic acid encoding a heavy chain of the antibody.
  • a “functional Fc region” possesses an “effector function” of a native sequence Fc region.
  • effector functions include C1q binding; complement dependent cytotoxicity (CDC); Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g., B cell receptor; BCR), etc.
  • Such effector functions generally require the Fc region to be combined with a binding region or binding domain (e.g., an antibody variable region or domain) and can be assessed using various assays as disclosed.
  • a “native sequence Fc region” comprises an amino acid sequence identical to the amino acid sequence of an Fc region found in nature, and not manipulated, modified, and/or changed (e.g., isolated, purified, selected, including or combining with other sequences such as variable region sequences) by a human.
  • Native sequence human Fc regions include a native sequence human IgG1 Fc region (non-A and A allotypes); native sequence human IgG2 Fc region; native sequence human IgG3 Fc region; and native sequence human IgG4 Fc region as well as naturally occurring variants thereof.
  • a “variant Fc region” comprises an amino acid sequence which differs from that of a native sequence Fc region by virtue of at least one amino acid modification, (e.g., substituting, addition, or deletion) preferably one or more amino acid substitution(s).
  • the variant Fc region has at least one amino acid substitution compared to a native sequence Fc region or to the Fc region of a parent polypeptide, for example, from about one to about ten amino acid substitutions, and preferably from about one to about five amino acid substitutions in a native sequence Fc region or in the Fc region of the parent polypeptide.
  • the term “heavy chain” when used in reference to an antibody refers to a polypeptide chain of about 50-70 kDa, wherein the amino-terminal portion includes a variable region of about 120 to 130 or more amino acids, and a carboxy-terminal portion includes one or more constant regions.
  • the “heavy chain” can refer to any distinct types, e.g., for example, alpha (a), delta (6), epsilon (c), gamma ( ⁇ ) and mu (p), based on the amino acid sequence of the constant domain, which give rise to IgA, IgD, IgE, IgG and IgM classes of antibodies, respectively, including subclasses of IgG, e.g., IgG1, IgG2, IgG3 and IgG4.
  • the term “light chain” when used in reference to an antibody can refer to a polypeptide chain of about 25 kDa, wherein the amino-terminal portion includes a variable region of about 100 to about 110 or more amino acids, and a carboxy-terminal portion includes a constant region.
  • the approximate length of a light chain is 211 to 217 amino acids.
  • Light chain amino acid sequences are well known in the art.
  • antigen binding fragment refers to that portion of an antibody, which comprises the amino acid residues that interact with an antigen and confer on the binding fragment, domain, or region its specificity and affinity for the antigen (e.g., the CDRs).
  • Antigen binding fragment as used herein include “antibody fragment,” which comprise a portion of an antibody including one or more CDRs, such as the antigen binding or variable region of the antibody.
  • Antibodies described herein include, but are not limited to, synthetic antibodies, monoclonal antibodies, recombinantly produced antibodies, multispecific antibodies (e.g., including bispecific antibodies), human antibodies, humanized antibodies, chimeric antibodies, intrabodies, single-chain Fvs (scFv) (e.g., including monospecific, bispecific, etc.), camelized antibodies, Fab fragments, F(ab′) fragments, disulfide-linked Fvs (sdFv), anti-idiotypic (anti-Id) antibodies, and epitope-binding fragments of any of the above.
  • synthetic antibodies e.g., monoclonal antibodies, recombinantly produced antibodies, multispecific antibodies (e.g., including bispecific antibodies), human antibodies, humanized antibodies, chimeric antibodies, intrabodies, single-chain Fvs (scFv) (e.g., including monospecific, bispecific, etc.), camelized antibodies, Fab fragments, F(ab′) fragments,
  • antibodies described herein include immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, including molecules that contain one or more antigen binding domains that bind to a CD47 antigen and one or more antigen binding domains that bind to one or more targets other than CD47 (e.g., PD-L1).
  • Antibodies can be of any type (e.g., IgG, IgE, IgM, IgD, IgA or IgY), any class, (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 or IgA2), or any subclass (e.g., IgG2a or IgG2b) of immunoglobulin molecule.
  • antibodies described herein are IgG antibodies (e.g., human IgG), or a class (e.g., human IgG1, IgG2, IgG3 or IgG4) or subclass thereof.
  • an antibody is a 4-chain antibody unit comprising two heavy (H) chain/light (L) chain pairs, wherein the amino acid sequences of the H chains are identical and the amino acid sequences of the L chains are identical.
  • the H and L chains comprise constant regions, for example, human constant regions.
  • the L chain constant region of such antibodies is a kappa or lambda light chain constant region, for example, a human kappa or lambda light chain constant region.
  • the H chain constant region of such antibodies comprise a gamma heavy chain constant region, for example, a human gamma heavy chain constant region.
  • such antibodies comprise IgG constant regions, for example, human IgG constant regions (e.g., IgG1, IgG2, IgG3, and/or IgG4 constant regions).
  • An antibody or fragment thereof may preferentially bind to CD47, such as human CD47, meaning that the antibody or fragment thereof binds CD47 with greater affinity than it binds to an unrelated control protein and/or binds human CD47 with greater affinity than it binds to an unrelated control protein.
  • the antibody or fragment thereof may specifically recognize and bind CD47 or a portion thereof. “Specific binding” means that the antibody or fragment thereof binds to CD47 with an affinity that is at least 5, 10, 15, 20, 25, 50, 100, 250, 500, 1000, or 10,000 times greater than the affinity for an unrelated control protein (e.g., hen egg white lysozyme).
  • the antibody or fragment thereof may bind CD47 substantially exclusively (e.g., is able to distinguish CD47 from other known polypeptides, for example, by virtue of measurable differences in binding affinity).
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • CD47 sequences other than human CD47 sequences e.g., cynomolgous CD47 sequences.
  • variable region refers to a portion of the light or heavy chains of an antibody that is generally located at the amino-terminal of the light or heavy chain and has a length of about 120 to 130 amino acids in the heavy chain and about 100 to 110 amino acids in the light chain, and are used in the binding and specificity of each particular antibody for its particular antigen.
  • the variable region of the heavy chain may be referred to as “VH.”
  • the variable region of the light chain may be referred to as “VL.”
  • variable refers to the fact that certain segments of the variable regions differ extensively in sequence among antibodies. The V region mediates antigen binding and defines specificity of a particular antibody for its particular antigen.
  • variable regions consist of less variable (e.g., relatively invariant) stretches called framework regions (FRs) of about 15-30 amino acids separated by shorter regions of greater variability (e.g., extreme variability) called “hypervariable regions” or alternatively called “complementarity determining regions.”
  • FRs framework regions
  • hypervariable regions or alternatively called “complementarity determining regions.”
  • the variable regions of heavy and light chains each comprise four FRs (FR1, FR2, FR3 and FR4), largely adopting a 13 sheet configuration, connected by three hypervariable regions, which form loops connecting, and in some cases forming part of, the ⁇ sheet structure.
  • the hypervariable regions in each chain are held together in close proximity by the FRs and, with the hypervariable regions from the other chain, contribute to the formation of the antigen-binding site of antibodies (see, e.g., Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, M D, 1991)).
  • the constant regions are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody dependent cellular cytotoxicity (ADCC) and complement dependent cytotoxicity (CDC).
  • the variable regions differ extensively in sequence between different antibodies. The variability in sequence is concentrated in the CDRs while the less variable portions in the variable region are referred to as framework regions (FR).
  • the CDRs of the light and heavy chains are primarily responsible for the interaction of the antibody with antigen.
  • the variable region is a human variable region.
  • hypervariable region refers to the regions of an antibody variable region that are hypervariable in sequence and/or form structurally defined loops.
  • antibodies comprise six hypervariable regions; three in the VH (H1, H2, H3), and three in the VL (L1, L2, L3).
  • a number of hypervariable region delineations are in use and are encompassed herein.
  • the Kabat CDRs are based on sequence variability and are the most commonly used (see, e.g., Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD.
  • Chothia refers instead to the location of the structural loops (see, e.g., Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987)).
  • the end of the Chothia CDR-H1 loop when numbered using the Kabat numbering convention varies between H32 and H34 depending on the length of the loop (this is because the Kabat numbering scheme places the insertions at H35A and H35B; if neither 35A nor 35B is present, the loop ends at 32; if only 35A is present, the loop ends at 33; if both 35A and 35B are present, the loop ends at 34).
  • the AbM hypervariable regions represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular's AbM antibody modeling software (see, e.g., Martin, in Antibody Engineering, Vol. 2, Chapter 3, Springer Verlag).
  • the “contact” hypervariable regions are based on an analysis of the available complex crystal structures. The residues from each of these hypervariable regions or CDRs are noted below.
  • IMGT ImMunoGeneTics
  • IG immunoglobulins
  • TR T cell receptors
  • MHC major histocompatibility complex
  • Hypervariable regions may comprise “extended hypervariable regions” as follows: 24-36 or 24-34 (L1), 46-56 or 50-56 (L2) and 89-97 or 89-96 (L3) in the VL and 26-35 or 26-35A (H1), 50-65 or 49-65 (H2) and 93-102, 94-102, or 95-102 (H3) in the VH.
  • L1 24-36 or 24-34
  • H2 46-56 or 50-56
  • L3 89-97 or 89-96
  • H1 48-65 or 49-65
  • CDR complementarity determining region
  • vector refers to a substance that is used to carry or include a nucleic acid sequences, including for example, in order to introduce a nucleic acid sequence into a host cell.
  • Vectors applicable for use include, for example, expression vectors, plasmids, phage vectors, viral vectors, episomes and artificial chromosomes, which can include selection sequences or markers operable for stable integration into a host cell's chromosome.
  • the vectors can include one or more selectable marker genes and appropriate expression control sequences. Selectable marker genes that can be included, for example, provide resistance to antibiotics or toxins, complement auxotrophic deficiencies, or supply critical nutrients not in the culture media.
  • Expression control sequences can include constitutive and inducible promoters, transcription enhancers, transcription terminators, and the like which are well known in the art.
  • two or more nucleic acid molecules are to be co-expressed (e.g. both an antibody heavy and light chain or an antibody VH and VL) both nucleic acid molecules can be inserted, for example, into a single expression vector or in separate expression vectors.
  • the encoding nucleic acids can be operationally linked to one common expression control sequence or linked to different expression control sequences, such as one inducible promoter and one constitutive promoter.
  • the introduction of nucleic acid molecules into a host cell can be confirmed using methods well known in the art.
  • an “immune cell dysfunctional disease” and “immune cell dysfunctional disorder” and “immune cell dysfunctional condition” are used interchangeably and refer to any disease, disorder or condition that is completely or partially caused by or is the result of improper signaling to an immune cell and/or alternatively any disease, disorder, or condition in which it is desirable to inhibit the in vivo effects of the interaction of an immune cell receptor (e.g., SIRP ⁇ or PD-1) with its ligand (e.g., CD47 or PD-L1).
  • An immune cell dysfunctional disease includes a phagocytic cell dysfunctional disease and a T cell dysfunctional disease.
  • a “phagocytic cell dysfunctional disease” and “phagocytic cell dysfunctional disorder” and “phagocytic cell dysfunctional condition” are used interchangeably and refer to any disease, disorder or condition that is completely or partially caused by or is the result of CD47 or the interaction of CD47 with SIRP ⁇ and/or alternatively any disease, disorder, or condition in which it is desirable to inhibit the in vivo effects of the interaction of CD47 with SIRP ⁇ .
  • a phagocytic cell dysfunctional disease includes a disease, disorder or condition that is characterized by or associated with decreased phagocytic activity of immune cells (e.g., neutrophils, macrophages, dendritic cells, B lymphocytes).
  • a phagocytic cell dysfunctional disease is a disease, disorder or condition that is specifically associated with inappropriate increased signaling through SIRP ⁇ .
  • a phagocytic cell dysfunctional disease is one in which phagocytic cells (e.g., macrophages) have decreased ability to ingest or engulf other cells (e.g., a tumor cell) or particles.
  • the decreased ability to ingest or engulf other cells or particles results in ineffective control of a pathogen or tumor, including but not limited to tumors expressing CD47.
  • phagocytic cell dysfunctional disease characterized by phagocytic cell dysfunction include unresolved acute infection, chronic infection and tumor immunity (e.g., any cancers, including but not limited to cancers that express or overexpress CD47).
  • T cell dysfunctional disease and “T cell dysfunctional disorder” and “T cell dysfunctional condition” are used interchangeably and refer to any disease, disorder or condition of T cells characterized by decreased responsiveness to antigenic stimulation.
  • a T cell dysfunctional disease includes a disease, disorder or condition that is completely or partially caused by or is the result of PD-L1 or the interaction of PD-L1 with PD-1 and/or alternatively any disease, disorder, or condition in which it is desirable to inhibit the in vivo effects of the interaction of PD-L1 with PD-1.
  • a T cell dysfunctional disease is a disease, disorder or condition that is specifically associated with inappropriate increased signaling through PD-1.
  • a T cell dysfunctional disease is one in which T cells are anergic or have decreased ability to secrete cytokines, proliferate, or execute cytolytic activity.
  • the decreased responsiveness results in ineffective control of a pathogen or tumor, including but not limited to tumors expressing PD-L1.
  • T cell dysfunctional disease characterized by T cell dysfunction include unresolved acute infection, chronic infection and tumor immunity (e.g., from any cancers, including but not limited to cancers that express or overexpress PD-L1).
  • Tumor immunity refers to the process in which tumors evade immune recognition and clearance. Thus, as a therapeutic concept, tumor immunity is “treated” when such evasion is attenuated and the tumors are recognized and attacked by the immunce system. Examples of tumor recognition include tumor binding, tumor strinkage and tumor clearance.
  • Enhancing T cell function means to induce, cause or stimulate a T cell to have a sustained or increased biological function, or renew or reactivate exhausted or inactive T cells.
  • enhancing T cell function include: increased secretion of cytokines (e.g., TNF ⁇ , IFN ⁇ ) from CD8 + T cells, increased proliferation, increased antigen responsiveness (e.g., tumor cell removal) relative to such levels before the intervention.
  • the level of enhancement is as least 50%, alternatively 60%, 70%, 80%, 90%, 100%, 120%, 150%, 200%. The manner of measuring this enhancement is known to one of ordinary skill in the art.
  • an “effective amount” is generally an amount sufficient to reduce the severity and/or frequency of symptoms, eliminate the symptoms and/or underlying cause, prevent the occurrence of symptoms and/or their underlying cause, and/or improve or remediate the damage that results from or is associated with a disease, disorder, or condition.
  • the effective amount is a therapeutically effective amount or a prophylactically effective amount.
  • therapeutically effective amount refers to the amount of an agent (e.g., an antibody described herein or any other agent described herein) that is sufficient to reduce and/or ameliorate the severity and/or duration of a given disease, disorder or condition, and/or a symptom related thereto.
  • a therapeutically effective amount of an agent, including a therapeutic agent can be an amount necessary for (i) reduction or amelioration of the advancement or progression of a given disease, disorder, or condition, (ii) reduction or amelioration of the recurrence, development or onset of a given disease, disorder or conditions, and/or (iii) to improve or enhance the prophylactic or therapeutic effect of another therapy (e.g., a therapy other than the administration of an antibody described herein).
  • another therapy e.g., a therapy other than the administration of an antibody described herein.
  • a “therapeutically effective amount” of a substance/molecule/agent of the present disclosure may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the substance/molecule/agent, to elicit a desired response in the individual.
  • a therapeutically effective amount encompasses an amount in which any toxic or detrimental effects of the substance/molecule/agent are outweighed by the therapeutically beneficial effects.
  • the term “therapeutically effective amount” refers to an amount of an antibody or other agent (e.g., or drug) effective to “treat” a disease, disorder, or condition, in a subject or mammal.
  • a “prophylactically effective amount” is an amount of a pharmaceutical composition that, when administered to a subject, will have the intended prophylactic effect, e.g., preventing or delaying the onset (or reoccurrence) of a disease, disorder or condition, or reducing the likelihood of the onset (or reoccurrence) of a disease, disorder, or condition or associated symptom(s).
  • the full therapeutic or prophylactic effect does not necessarily occur by administration of one dose, and may occur only after administration of a series of doses.
  • a therapeutically or prophylactically effective amount may be administered in one or more administrations.
  • pharmaceutically acceptable means being approved by a regulatory agency of the Federal or a state government, or listed in the U.S. Pharmacopeia, European Pharmacopeia or other generally recognized Pharmacopeia for use in animals, and more particularly in humans.
  • Carriers as used herein include carriers, excipients, or stabilizers that are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed. Often the carrier is an aqueous pH buffered solution.
  • carriers include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid; low molecular weight ((e.g., less than about amino acid residues) polypeptide; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and/or nonionic surfactants such as TWEENTM, poly
  • carrier can also refer to a diluent, adjuvant (e.g., Freund's adjuvant (complete or incomplete)), excipient, or vehicle with which the therapeutic is administered.
  • adjuvant e.g., Freund's adjuvant (complete or incomplete)
  • excipient or vehicle with which the therapeutic is administered.
  • Such carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water is an exemplary carrier when a composition (e.g., a pharmaceutical composition) is administered intravenously.
  • Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions.
  • Suitable excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like.
  • the composition if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents.
  • Compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations and the like.
  • compositions can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc. Examples of suitable carriers are described in Remington's Pharmaceutical Sciences (1990) Mack Publishing Co., Easton, PA.
  • Compositions, including pharmaceutical compounds may contain a prophylactically or therapeutically effective amount of a multispecific binding agent (e.g., an antibody, such as a bispecific antibody), for example, in isolated or purified form, together with a suitable amount of carrier so as to provide the form for proper administration to the subject (e.g., patient).
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • the present disclosure provides multispecific binding agents that can be used herein as therapeutic agents.
  • agents include multispecific antibodies (e.g., antibodies, such as bispecific antibodies) comprising a first binding domain that binds to CD47, including human CD47, and a second binding domain that binds one or more additional targets that are not CD47 (e.g., PD-L1).
  • multispecific antibodies e.g., antibodies, such as bispecific antibodies
  • Exemplary antibodies include humanized, human, bispecific, and heteroconjugate antibodies, as well as variants thereof having increased or decreased affinity or other properties.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • a first binding domain that binds to CD47 including a CD47 polypeptide, a CD47 polypeptide fragment, a CD47 peptide or a CD47 epitope.
  • the multispecific binding agents are human or humanized antibodies (e.g., comprising human constant regions) comprising a first binding domain that binds CD47, including a CD47 polypeptide, a CD47 polypeptide fragment, a CD47 peptide or a CD27 epitope.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent can bind to CD47 expressed on the surface of a mammalian (e.g., human) cell, including a CD47 expressing tumor cell.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • multispecific binding agents comprising a second binding domain that bind to PD-L1, including a PD-L1 polypeptide, a PD-L1 polypeptide fragment, a PD-L1 peptide or a PD-L1 epitope.
  • the multispecific binding agents are humanized antibodies (e.g., comprising human constant regions) comprising a second binding domain that binds PD-L1, including a PD-L1 polypeptide, a PD-L1 polypeptide fragment, a PD-L1 peptide or a PD-L1 epitope.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent can bind to PD-L1 expressed on the surface of a mammalian (e.g., human) cell, including a PD-L1 expressing antigen presenting cells and tumor cells.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • PD-L1 is a human PD-L1.
  • a multispecific binding agent is a multispecific binding agent that binds to human PD-L1 (e.g., an antibody that binds to human PD-L1).
  • An exemplary amino acid sequence of human PD-L1 is described herein.
  • the multispecific binding agents (e.g., antibodies, such as bispecific antibodies) described herein compete for the binding to CD47, such as human CD47, with a binding agent (e.g., an antibody, such as a bispecific antibody) that comprises a VH region, VL region, VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and/or VL CDR3 of any one of the antibodies described herein, such as an amino acid sequence of a VH region, VL region, VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and/or VL CDR3 depicted in Tables 1-3.
  • a binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • an binding agent e.g., an antibody, such as a bispecific antibody
  • CD47 such as human CD47
  • an binding agent e.g., an antibody, such as a bispecific antibody
  • an antibody that comprises one, two, and/or three VH CDRs and/or one, two, and/or three VL CDRs from: (a) the antibody designated C40; (b) the antibody designated C56; or (c) the antibody designated C59, as shown in Tables 1-3.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a binding agent e.g., an antibody, such as a bispecific antibody
  • CD47 such as human CD47
  • a binding agent e.g., an antibody, such as a bispecific antibody
  • a binding agent that comprises one, two, and/or three VH CDRs and one, two, and/or three VL CDRs from: (a) the antibody designated C40; (b) the antibody designated C56; or (c) the antibody designated C59, as shown in Tables 1-3.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a binding agent e.g., an antibody, such as a bispecific antibody
  • CD47 such as human CD47
  • a binding agent e.g., an antibody, such as a bispecific antibody
  • a VH region and VL region from: (a) the antibody designated C40; (b) the antibody designated C56; or (c) the antibody designated C59, as shown in Tables 1-3.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a binding agent e.g., an antibody, such as a bispecific antibody
  • a binding agent that comprises: (a) a VH region comprising the amino acid sequence of SEQ ID NO:25 and a VL region comprising the amino acid sequence of SEQ ID NO:26; (b) a VH region comprising the amino acid sequence of SEQ ID NO:51 and a VL region comprising the amino acid sequence of SEQ ID NO:52; or (c) a VH region comprising the amino acid sequence of SEQ ID NO:77 and a VL region comprising the amino acid sequence of SEQ ID NO:78.
  • the multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • the multispecific binding agents described herein comprise a VH region, VL region, VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and/or VL CDR3 of any one of the antibodies described herein, such as an amino acid sequence of a VH region, VL region, VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and/or VL CDR3 depicted in Tables 1-6.
  • the multispecific binding agent (e.g., an antibody, such as a bispecific antibody) described herein comprises a second binding domain that comprises one, two, and/or three heavy chain CDRs and/or one, two, and/or three light chain CDRs from: (a) the antibody designated P22; (b) the antibody designated P24; or (c) the antibody designated P31.2, as shown in Tables 4-6.
  • the multispecific binding agent (e.g., an antibody, such as a bispecific antibody) described herein comprises a first binding domain that comprises one, two, and/or three heavy chain CDRs and/or one, two, and/or three light chain CDRs from: (a) the antibody designated C40; (b) the antibody designated C56; or (c) the antibody designated C59, as shown in Tables 1-3, and a second binding domain that comprises one, two, and/or three heavy chain CDRs and/or one, two, and/or three light chain CDRs from: (a) the antibody designated P22; (b) the antibody designated P24; or (c) the antibody designated P31.2, as shown in Tables 4-6.
  • a first binding domain that comprises one, two, and/or three heavy chain CDRs and/or one, two, and/or three light chain CDRs from: (a) the antibody designated C40; (b) the antibody designated C56; or (c) the antibody designated C59, as shown in Tables 1-3
  • the multispecific binding agent (e.g., an antibody, such as a bispecific antibody) described herein comprises a first binding domain that comprises one, two, and/or three heavy chain CDRs and one, two, and/or three light chain CDRs from: (a) the antibody designated C40; (b) the antibody designated C56; or (c) the antibody designated C59, as shown in Tables 1-3, and a second binding domain that comprises one, two, and/or three heavy chain CDRs and one, two, and/or three light chain CDRs from: (a) the antibody designated P22; (b) the antibody designated P24; or (c) the antibody designated P31.2, as shown in Tables 4-6.
  • a first binding domain that comprises one, two, and/or three heavy chain CDRs and one, two, and/or three light chain CDRs from: (a) the antibody designated C40; (b) the antibody designated C56; or (c) the antibody designated C59, as shown in Tables 1-3
  • a second binding domain that comprises
  • a multispecific binding agent (e.g., an antibody, such as a bispecific antibody) comprises a first binding domain that binds to CD47 and comprises a VH region, which comprises VH CDR1, VH CDR2, and/or VH CDR3, and a VL region, which comprises VL CDR1, VL CDR2, and/or VL CDR3, of any one of the binding agents described in Table 1, Table 2, and Table 3, and a second binding domain that binds to PD-L1 and comprises a VH region, which comprises VH CDR1, VH CDR2, and/or VH CDR3, and a VL region, which comprises VL CDR1, VL CDR2, and/or VL CDR3, of any one of the binding agents described in Table 4, Table 5 and Table 6.
  • a first binding domain that binds to CD47 and comprises a VH region, which comprises VH CDR1, VH CDR2, and/or VH CDR3, and a VL region, which comprises VL CDR1, VL CDR
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent described herein comprises a first binding domain that comprises one, two, and/or three heavy chain CDRs and/or one, two, and/or three light chain CDRs from Table 1.
  • the multispecific binding agent described herein comprises a first binding domain that comprises one, two, and/or three heavy chain CDRs and/or one, two, and/or three light chain CDRs from Table 2.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a first binding domain that comprises one, two, and/or three heavy chain CDRs and/or one, two, and/or three light chain CDRs from Table 3.
  • the multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • comprises a second binding domain that comprises one, two, and/or three heavy chain CDRs and/or one, two, and/or three light chain CDRs from Table 4.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent described herein comprises a second binding domain that comprises one, two, and/or three heavy chain CDRs and/or one, two, and/or three light chain CDRs from Table 5.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent described herein is bispecific and comprises a first binding domain that comprises one, two, and/or three heavy chain CDRs and/or one, two, and/or three light chain CDRs from Table 1, Table 2, or Table 3 and a second binding domain that comprises one, two, and/or three heavy chain CDRs and/or one, two, and/or three light chain CDRs from a binding agent that binds to a second target antigen that is not CD47.
  • the antibody designated C40 comprises a VH sequence that is SEQ ID NO:25 and a VL sequence that is SEQ ID NO:26.
  • the antibody designated C56 comprises a VH sequence that is SEQ ID NO:51 and a VL sequence that is SEQ ID NO:52.
  • the antibody designated P22 comprises a VH sequence that is SEQ ID NO:103 and a VL sequence that is SEQ ID NO:104.
  • the antibody designated P31.2 comprises a VH sequence that is SEQ ID NO:155 and a VL sequence that is SEQ ID NO:156.
  • a multispecific binding agent that binds to CD47 comprises (i) a VH domain wherein the VH domain comprises a VH sequence that is SEQ ID NO:26 (C40 VH), SEQ ID NO:51 (C56 VH), or SEQ ID NO:77 (C59 VH) and (ii) a VL domain wherein the VL domain comprises a VL sequence that is SEQ ID NO:26 (C40 VL), SEQ ID NO:52 (C56 VL), or SEQ ID NO:78 (C59 VL).
  • VH and VL domains were used to construct bispecific binding agents (e.g., antibodies) each with a first binding domain that bind to CD47, including wherein the first binding domain comprises (i) the C40 VH and C40 VL domains, (ii) the C56 VH and C56 VL domains, or (iii) the C59 VH and C59 VL domains.
  • bispecific binding agents e.g., antibodies
  • a multispecific binding agent that binds to PD-L1 comprises (i) a VH domain wherein the VH domain comprises a VH sequence that is SEQ ID NO:103 (P22 VH), SEQ ID NO:129 (P24 VH), or SEQ ID NO:155 (P31.2 VH) and (ii) a VL domain wherein the VL domain comprises a VL sequence that is SEQ ID NO:104 (P22 VL), SEQ ID NO:130 (P24 VL), or SEQ ID NO:156 (P31.2 VL).
  • VH and VL domains were used to construct bispecific binding agents (e.g., antibodies) each with a first binding domain that bind to PD-L1, including wherein the first binding domain comprises (i) the P22 VH and P22 VL domains, (ii) the P24 VH and P24 VL domains, or (iii) the P31.2 VH and P31.2 VL domains.
  • bispecific binding agents e.g., antibodies
  • VH and VL domains were used to construct bispecific antibodies comprising four polypeptide chains, wherein (i) polypeptide chain 1 comprises a VL domain (e.g., C40 VL, C56 VL, or C59 VL), polypeptide chain 2 comprises a VH domain (e.g., C40 VH, C56 VH, or C59 VH), wherein the VL and VH domains form a first binding domain that binds to CD47, and (ii) polypeptide chain 3 comprises a VL domain (e.g., P22 VL, P24 VL, or P31.2 VL), polypeptide chain 4 comprises a VH domain (e.g., P22 VH, P24 VH, or P31.2 VH), wherein the VL and VH domains form a second binding domain that binds to PD-L1.
  • polypeptide chain 1 comprises a VL domain (e.g., C40 VL, C56 VL, or C59 VL)
  • a CD47xPD-L1 binding agent e.g., an antibody
  • BC1 B-Body format Such a four polypeptide chain format is designated as a BC1 B-Body format:
  • Domain A Target 1 (e.g., CD47)
  • VL Domain B CH3 (T366K; 445K, 446S, 447C tripeptide insertion)
  • Domain F Target 1 (e.g., CD47)
  • VH Domain G CH3 (L351D; 445G, 446E, 447C tripeptide insertion)
  • Domain H Target 2 (e.g., PD-L1)
  • Domain L Target 2 (e.g., PD-L1)
  • VH Domain M CH1.
  • the first polypeptide chain has the sequence SEQ ID NO:157
  • the second polypeptide chain has the sequence SEQ ID NO:158
  • the third polypeptide chain has the sequence SEQ ID NO:159
  • the fourth polypeptide chain has the sequence SEQ ID NO:160.
  • the first polypeptide chain has the sequence SEQ ID NO:169
  • the third polypeptide chain has the sequence SEQ ID NO:170.
  • the first polypeptide chain has the sequence SEQ ID NO:157
  • the second polypeptide chain has the sequence SEQ ID NO:158
  • the third polypeptide chain has the sequence SEQ ID NO:161
  • the fourth polypeptide chain has the sequence SEQ ID NO:162.
  • the first polypeptide chain has the sequence SEQ ID NO:169
  • the third polypeptide chain has the sequence SEQ ID NO:171.
  • the first polypeptide chain has the sequence SEQ ID NO:157
  • the second polypeptide chain has the sequence SEQ ID NO:158
  • the third polypeptide chain has the sequence SEQ ID NO:163
  • the fourth polypeptide chain has the sequence SEQ ID NO:164.
  • the first polypeptide chain has the sequence SEQ ID NO:169
  • the third polypeptide chain has the sequence SEQ ID NO:172.
  • the first polypeptide chain has the sequence SEQ ID NO:165
  • the second polypeptide chain has the sequence SEQ ID NO:166
  • the third polypeptide chain has the sequence SEQ ID NO:159
  • the fourth polypeptide chain has the sequence SEQ ID NO:160.
  • the first polypeptide chain has the sequence SEQ ID NO:173
  • the third polypeptide chain has the sequence SEQ ID NO:170.
  • the first polypeptide chain has the sequence SEQ ID NO:165
  • the second polypeptide chain has the sequence SEQ ID NO:166
  • the third polypeptide chain has the sequence SEQ ID NO:161
  • the fourth polypeptide chain has the sequence SEQ ID NO:162.
  • the first polypeptide chain has the sequence SEQ ID NO:173
  • the third polypeptide chain has the sequence SEQ ID NO:171.
  • the first polypeptide chain has the sequence SEQ ID NO:165
  • the second polypeptide chain has the sequence SEQ ID NO:166
  • the third polypeptide chain has the sequence SEQ ID NO:163
  • the fourth polypeptide chain has the sequence SEQ ID NO:164.
  • the first polypeptide chain has the sequence SEQ ID NO:173
  • the third polypeptide chain has the sequence SEQ ID NO:172.
  • the first polypeptide chain has the sequence SEQ ID NO:167
  • the second polypeptide chain has the sequence SEQ ID NO:168
  • the third polypeptide chain has the sequence SEQ ID NO:159
  • the fourth polypeptide chain has the sequence SEQ ID NO:160.
  • the first polypeptide chain has the sequence SEQ ID NO:174
  • the third polypeptide chain has the sequence SEQ ID NO:170.
  • the first polypeptide chain has the sequence SEQ ID NO:167
  • the second polypeptide chain has the sequence SEQ ID NO:168
  • the third polypeptide chain has the sequence SEQ ID NO:161
  • the fourth polypeptide chain has the sequence SEQ ID NO:162.
  • the first polypeptide chain has the sequence SEQ ID NO:174
  • the third polypeptide chain has the sequence SEQ ID NO:171.
  • the first polypeptide chain has the sequence SEQ ID NO:167
  • the second polypeptide chain has the sequence SEQ ID NO:168
  • the third polypeptide chain has the sequence SEQ ID NO:163
  • the fourth polypeptide chain has the sequence SEQ ID NO:164.
  • the first polypeptide chain has the sequence SEQ ID NO:174
  • the third polypeptide chain has the sequence SEQ ID NO:172.
  • a CD47xPD-L1 binding agent e.g., an antibody
  • Such a four polypeptide chain format is designated as a BC44 B-Body format:
  • first polypeptide chain Domain A Target 1 (e.g., CD47)
  • VL Domain B CH3 (P343V; Y349C; 445P, 446G, 447K insertion)
  • second polypeptide chain Domain F Target 1 (e.g., CD47)
  • VH Domain G CH3 (S354C; 445P, 446G, 447K insertion)
  • third polypeptide chain Domain H Target 2 (e.g., PD-L1)
  • VL Domain I CL (Kappa)
  • fourth polypeptide chain Domain L Target 2 (e.g., PD-L1)
  • VH Domain M CH1 >BC44 chain 1 Domain arrangement: A- B— Hinge- D- E VL— CH3—
  • the first polypeptide chain has the sequence SEQ ID NO:175, the second polypeptide chain has the sequence SEQ ID NO:176, the third polypeptide chain has the sequence SEQ ID NO:159, and the fourth polypeptide chain has the sequence SEQ ID NO:160.
  • the first polypeptide chain has the sequence SEQ ID NO:181, and the third polypeptide chain has the sequence SEQ ID NO:170.
  • the first polypeptide chain has the sequence SEQ ID NO:175, the second polypeptide chain has the sequence SEQ ID NO:176, the third polypeptide chain has the sequence SEQ ID NO:161, and the fourth polypeptide chain has the sequence SEQ ID NO:162.
  • the first polypeptide chain has the sequence SEQ ID NO:181, and the third polypeptide chain has the sequence SEQ ID NO:171.
  • the first polypeptide chain has the sequence SEQ ID NO:175, the second polypeptide chain has the sequence SEQ ID NO:176, the third polypeptide chain has the sequence SEQ ID NO:163, and the fourth polypeptide chain has the sequence SEQ ID NO:164.
  • the first polypeptide chain has the sequence SEQ ID NO:181, and the third polypeptide chain has the sequence SEQ ID NO:172.
  • the first polypeptide chain has the sequence SEQ ID NO:177
  • the second polypeptide chain has the sequence SEQ ID NO:178
  • the third polypeptide chain has the sequence SEQ ID NO:159
  • the fourth polypeptide chain has the sequence SEQ ID NO:160.
  • the first polypeptide chain has the sequence SEQ ID NO:182
  • the third polypeptide chain has the sequence SEQ ID NO:170.
  • the first polypeptide chain has the sequence SEQ ID NO:177
  • the second polypeptide chain has the sequence SEQ ID NO:178
  • the third polypeptide chain has the sequence SEQ ID NO:161
  • the fourth polypeptide chain has the sequence SEQ ID NO:162.
  • the first polypeptide chain has the sequence SEQ ID NO:182
  • the third polypeptide chain has the sequence SEQ ID NO:171.
  • the first polypeptide chain has the sequence SEQ ID NO:177
  • the second polypeptide chain has the sequence SEQ ID NO:178
  • the third polypeptide chain has the sequence SEQ ID NO:163
  • the fourth polypeptide chain has the sequence SEQ ID NO:164.
  • the first polypeptide chain has the sequence SEQ ID NO:182
  • the third polypeptide chain has the sequence SEQ ID NO:172.
  • the first polypeptide chain has the sequence SEQ ID NO:179
  • the second polypeptide chain has the sequence SEQ ID NO:180
  • the third polypeptide chain has the sequence SEQ ID NO:159
  • the fourth polypeptide chain has the sequence SEQ ID NO:160.
  • the first polypeptide chain has the sequence SEQ ID NO:183
  • the third polypeptide chain has the sequence SEQ ID NO:170.
  • the first polypeptide chain has the sequence SEQ ID NO:179
  • the second polypeptide chain has the sequence SEQ ID NO:180
  • the third polypeptide chain has the sequence SEQ ID NO:161
  • the fourth polypeptide chain has the sequence SEQ ID NO:162.
  • the first polypeptide chain has the sequence SEQ ID NO:183
  • the third polypeptide chain has the sequence SEQ ID NO:171.
  • the first polypeptide chain has the sequence SEQ ID NO:179
  • the second polypeptide chain has the sequence SEQ ID NO:180
  • the third polypeptide chain has the sequence SEQ ID NO:163
  • the fourth polypeptide chain has the sequence SEQ ID NO:164.
  • the first polypeptide chain has the sequence SEQ ID NO:183
  • the third polypeptide chain has the sequence SEQ ID NO:172.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents comprise a first binding domain that binds to CD47, including human CD47, and a second binding domain that binds to one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), wherein the first binding domain and/or the second binding domain comprise a VH region or VH domain.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents comprise a first binding domain that binds to CD47, including human CD47, and a second binding domain that binds to one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), wherein the first binding domain and/or the second binding domain comprise a VL region or VL domain.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents comprise a first binding domain that binds to CD47, including human CD47, and a second binding domain that binds to one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), wherein the first binding domain and/or the second binding domain have a combination of (i) a VH domain or VH region; and/or (ii) a VL domain or VL region.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents have a combination of (i) a VH domain or VH region; and (ii) a VL domain or VL region.
  • an exemplary bispecific IgG antibody comprises (i) a heavy chain having a combination of a VH domain or VH region as described herein; and one or more heavy chain constant domains or constant regions (e.g., CH1, Hinge, CH2, and CH3), and (ii) a light chain having a combination of a VL domain or VL region as described herein and a light chain constant domain or constant region (CL).
  • An exemplary IgG heavy chain comprises any VH domain as described herein and the following CH1, Hinge, CH2, and CH3 amino acid sequence:
  • IgG heavy chain comprises any VH domain as described herein and the following CH1, Hinge, CH2, and CH3 amino acid sequence:
  • An exemplary light chain (e.g., for pairing with an IgG heavy chain) comprises any VL domain as described herein and the following CL amino acid sequence:
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents comprise a first binding domain that binds to CD47, including human CD47, and second binding domain that binds one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), wherein the first binding domain comprises one or more CDRs, including six CDRs, for example, VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and/or VL CDR3 identified in Table 1.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents comprise a first binding domain that binds to CD47, including human CD47, and a second binding domain that binds one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), wherein the first binding domain comprises one or more, including six CDRs, for example, VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and/or VL CDR3 identified in Table 2.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents comprise a first binding domain that binds to CD47, including human CD47, and a second binding domain that binds one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), wherein the first binding domain comprises one or more, including six CDRs, for example, VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and/or VL CDR3 identified in Table 3.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents comprise a first binding domain that binds to CD47, including human CD47, and a second binding domain that binds one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), wherein the first binding domain comprises one or more, including six CDRs, for example, VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and/or VL CDR3 identified in Tables 1, 2 and/or 3.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1) described herein comprise a first binding domain comprising one or more CDRs, including three VH CDRs, for example, VH CDR1, VH CDR2, VH CDR3, listed in Table 1.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents that bind to CD47, including human CD47, and one or more targets that are not CD47 e.g., PD-L1, including human PD-L1
  • PD-L1, including human PD-L1 described herein comprise a first binding domain comprising one or more CDRs, including three CDRs, for example, VL CDR1, VL CDR2, and/or VL CDR3, listed in Table 1.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents that bind to CD47, including human CD47, and one or more targets that are not CD47 e.g., PD-L1, including human PD-L1
  • PD-L1, including human PD-L1 comprise a first binding domain comprising one or more CDRs, including three VH CDRs, for example, VH CDR1, VH CDR2, VH CDR3, listed in Table 1 and one or more CDRs, including three VL CDRs, for example, VL CDR1, VL CDR2, and/or VL CDR3, listed in Table 1.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1) described herein comprise a first binding domain comprising one or more CDRs, including three VH CDRs, for example, VH CDR1, VH CDR2, VH CDR3, listed in Table 2.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents that bind to CD47, including human CD47, and one or more targets that are not CD47 e.g., PD-L1, including human PD-L1
  • PD-L1, including human PD-L1 comprise a first binding domain comprising one or more CDRs, including three VH CDRs, for example, VH CDR1, VH CDR2, VH CDR3, listed in Table 2 and one or more CDRs, including three VL CDRs, for example, VL CDR1, VL CDR2, and/or VL CDR3, listed in Table 2.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1) described herein comprise a first binding domain comprising one or more CDRs, including three VH CDRs, for example, VH CDR1, VH CDR2, VH CDR3, listed in Table 3.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents that bind to CD47, including human CD47, and one or more targets that are not CD47 e.g., PD-L1, including human PD-L1
  • PD-L1, including human PD-L1 described herein comprise a first binding domain comprising one or more CDRs, including three CDRs, for example, VL CDR1, VL CDR2, and/or VL CDR3, listed in Table 3.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents that bind to CD47, including human CD47, and one or more targets that are not CD47 e.g., PD-L1, including human PD-L1
  • PD-L1, including human PD-L1 described herein comprise a first binding domain comprising one or more CDRs, including three VH CDRs, for example, VH CDR1, VH CDR2, VH CDR3, listed in Table 3 and one or more CDRs, including three VL CDRs, for example, VL CDR1, VL CDR2, and/or VL CDR3, listed in Table 3.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agent that binds to CD47, including human CD47, and PD-L1, including human PD-L1, described herein comprise a second binding domain comprising one or more CDRs, including three VH CDRs, for example, VH CDR1, VH CDR2, VH CDR3, listed in Table 4.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents that bind to CD47, including human CD47, and PD-L1, including human PD-L1, described herein comprise a second binding domain comprising one or more CDRs, including three CDRs, for example, VL CDR1, VL CDR2, and/or VL CDR3, listed in Table 4.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents that bind to CD47, including human CD47, and PD-L1, including human PD-L1, described herein comprise a second binding domain comprising one or more CDRs, including three VH CDRs, for example, VH CDR1, VH CDR2, VH CDR3, listed in Table 4 and one or more CDRs, including three VL CDRs, for example, VL CDR1, VL CDR2, and/or VL CDR3, listed in Table 4.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agent that binds to CD47, including human CD47, and PD-L1, including human PD-L1, described herein comprise a second binding domain comprising one or more CDRs, including three VH CDRs, for example, VH CDR1, VH CDR2, VH CDR3, listed in Table 5.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents that bind to CD47, including human CD47, and PD-L1, including human PD-L1, described herein comprise a second binding domain comprising one or more CDRs, including three CDRs, for example, VL CDR1, VL CDR2, and/or VL CDR3, listed in Table 5.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents that bind to CD47, including human CD47, and PD-L1, including human PD-L1, described herein comprise a second binding domain comprising one or more CDRs, including three VH CDRs, for example, VH CDR1, VH CDR2, VH CDR3, listed in Table 5 and one or more CDRs, including three VL CDRs, for example, VL CDR1, VL CDR2, and/or VL CDR3, listed in Table 5.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agent that binds to CD47, including human CD47, and PD-L1, including human PD-L1, described herein comprise a second binding domain comprising one or more CDRs, including three VH CDRs, for example, VH CDR1, VH CDR2, VH CDR3, listed in Table 6.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents that bind to CD47, including human CD47, and PD-L1, including human PD-L1, described herein comprise a second binding domain comprising one or more CDRs, including three CDRs, for example, VL CDR1, VL CDR2, and/or VL CDR3, listed in Table 6.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents that bind to CD47, including human CD47, and PD-L1, including human PD-L1, described herein comprise a second binding domain comprising one or more CDRs, including three VH CDRs, for example, VH CDR1, VH CDR2, VH CDR3, listed in Table 6 and one or more CDRs, including three VL CDRs, for example, VL CDR1, VL CDR2, and/or VL CDR3, listed in Table 6.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent comprises a first binding domain that binds to CD47 and comprises one or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-24, 27-50, and 53-76.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody described herein comprises a first binding domain that binds to CD47 and comprises two or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-24, 27-50, and 53-76.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent comprises a first binding domain that binds to CD47 and comprises three or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-24, 27-50, and 53-76.
  • the multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • the multispecific binding agent comprises a second binding domain that binds to PD-L1 and comprises one or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 79-102, 105-128, and 131-154.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a second binding domain that binds to PD-L1 and comprises two or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 79-102, 105-128, and 131-154.
  • CDRs complementarity determining regions
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a second binding domain that binds to PD-L1 and comprises three or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 79-102, 105-128, and 131-154.
  • CDRs complementarity determining regions
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent comprises a first binding domain that binds to CD47 and comprises a VH with one or more (e.g., one, two or three) VH CDRs listed in Tables 1-3.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • the multispecific binding agent (e.g., an antibody, such as a bispecific antibody) described herein comprises a first binding domain that binds to CD47 and comprises one or more (e.g., one, two or three) VH CDRs listed in Tables 1-3 and one or more VL CDRs listed in Tables 1-3.
  • a multispecific binding agent (e.g., an antibody, such as a bispecific antibody) described herein comprises a first binding domain that binds to CD47 and comprises a VH CDR1 having the amino acid sequence of any one of SEQ ID NOS: 1, 7, 12, 13, 18, 27, 33, 38, 39, 44, 53, 59, 64, 65, and 70.
  • a multispecific binding agent (e.g., an antibody, such as a bispecific antibody) described herein comprises a first binding domain that binds to CD47 and comprises a VH CDR2 having the amino acid sequence of any one of SEQ ID NOS: 2, 8, 14, 19, 24, 28, 34, 40, 45, 50, 54, 60, 66, 71, and 76.
  • a multispecific binding agent (e.g., an antibody, such as a bispecific antibody) described herein a first binding domain that binds to CD47 and comprises a VH CDR3 having the amino acid sequence of any one of SEQ ID NOS: 3, 9, 15, 20, 29, 35, 41, 46, 55, 61, 67, and 72.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent described herein comprises a first binding domain that binds to CD47 and comprises a VH CDR1 and/or a VH CDR2 and/or a VH CDR3 independently selected from a VH CDR1, VH CDR2, VH CDR3 as depicted in any one of the amino acid sequences depicted in Table 1-3.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent comprises a first binding domain that binds to CD47 and comprises a VL CDR1 having the amino acid sequence of any one of SEQ ID NOS: 4, 10, 16, 21, 30, 36, 42, 47, 56, 62, 68, and 73.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody described herein comprises a first binding domain that binds to CD47 and comprises a VL CDR2 having the amino acid sequence of any one of SEQ ID NOS: 5, 11, 22, 31, 37, 48, 57, 63, and 74.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a first binding domain that binds to CD47 and comprises a VL CDR3 having the amino acid sequence of any one of SEQ ID NOS: 6, 17, 23, 32, 43, 49, 58, 69, and 75.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent described herein comprises a first binding domain that binds to CD47 and comprises a VL CDR1 and/or a VL CDR2 and/or a VL CDR3 independently selected from a VL CDR1, VL CDR2, VL CDR3 as depicted in any one of the amino acid sequences depicted in Tables 1-3.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent comprises a second binding domain that binds to PD-L1 and comprises a VH with one or more (e.g., one, two or three) VH CDRs listed in Tables 4-6.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • the multispecific binding agent (e.g., an antibody, such as a bispecific antibody) described herein comprises a second binding domain that binds to PD-L1 and comprises one or more (e.g., one, two or three) VH CDRs listed in Tables 4-6 and one or more VL CDRs listed in Tables 4-6.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a second binding domain that binds to PD-L1 and comprises a VH CDR1 having the amino acid sequence of any one of SEQ ID NOS: 79, 85, 90, 91, 96, 105, 11, 116, 117, 122, 131, 137, 142, 143, and 148.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a second binding domain that binds to PD-L1 and comprises a VH CDR2 having the amino acid sequence of any one of SEQ ID NOS: 80, 86, 92, 97, 102, 106, 112, 118, 123, 128, 132, 138, 44, 149, and 154.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a second binding domain that binds to PD-L1 and comprises a VH CDR3 having the amino acid sequence of any one of SEQ ID NOS: 81, 87, 93, 98, 107, 113, 119, 124, 133, 139, 145, and 150.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a second binding domain that binds to PD-L1 and comprises a VH CDR1 and/or a VH CDR2 and/or a VH CDR3 independently selected from a VH CDR1, VH CDR2, VH CDR3 as depicted in any one of the amino acid sequences depicted in Table 4-6.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent comprises a second binding domain that binds to PD-L1 and comprises a VL CDR1 having the amino acid sequence of any one of SEQ ID NOS: 82, 88, 94, 99, 108, 114, 120, 125, 134, 140, 146, and 151.
  • a multispecific binding agent (e.g., an antibody, such as a bispecific antibody) described herein comprises a second binding domain that binds to PD-L1 and comprises a VL CDR2 having the amino acid sequence of any one of SEQ ID NOS: 83, 89, 100, 109, 115, 126, 135, 141, and 152.
  • a multispecific binding agent (e.g., an antibody, such as a bispecific antibody) described herein comprises a second binding domain that binds to PD-L1 and comprises a VL CDR3 having the amino acid sequence of any one of SEQ ID NOS: 84, 95, 101, 110, 121, 127, 136, 147, and 153.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent described herein comprises a second binding domain that binds to PD-L1 and comprises a VL CDR1 and/or a VL CDR2 and/or a VL CDR3 independently selected from a VL CDR1, VL CDR2, VL CDR3 as depicted in any one of the amino acid sequences depicted in Tables 4-6.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent comprises a first binding domain that binds to CD47 and comprises a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence of selected from the group consisting of: (i) SEQ ID NO:1, 27, or 53, (ii) SEQ ID NO:7, 33, or 59, (iii) SEQ ID NO:12, 38, or 64, (iv) SEQ ID NO:13, 39, or 65, and (v) SEQ ID NO:18, 44, or 70; (2) a VH CDR2 having an amino acid sequence of selected from the group consisting of: (i) SEQ ID NO:2, 28, or 54, (ii) SEQ ID NO:8, 34, or 60, (iii) SEQ ID NO:14, 40, or 66, (iv) SEQ ID NO:19, 45, or 71, and (v) SEQ ID NO:24
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent comprises a first binding domain that binds to CD47 and comprises a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence of selected from the group consisting of: (i) SEQ ID NO:1, 27, or 53, (ii) SEQ ID NO:7, 33, or 59, (iii) SEQ ID NO:12, 38, or 64, (iv) SEQ ID NO:13, 39, or 65, and (v) SEQ ID NO:18, 44, or 70; (2) a VH CDR2 having an amino acid sequence of selected from the group consisting of: (i) SEQ ID NO:2, 28, or 54, (ii) SEQ ID NO:8, 34, or 60, (iii) SEQ ID NO:14, 40, or 66, (iv) SEQ ID NO:19, 45, or 71, and (v) SEQ ID NO:24
  • a multispecific binding agent (e.g., an antibody, such as a bispecific antibody) described herein comprises a first binding domain that binds to CD47 and comprises a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence of selected from the group consisting of: (i) SEQ ID NO:4, 30, or 56, (ii) SEQ ID NO:10, 36, or 62, (iii) SEQ ID NO:16, 42, or 68, and (iv) SEQ ID NO:21, 47, or 73; (2) a VL CDR2 having an amino acid sequence of selected from the group consisting of: (i) SEQ ID NO:5, 31, or 57, (ii) SEQ ID NO:11, 37, or 63, and (iii) SEQ ID NO:22, 48, or 74; and (3) a VL CDR3 having an amino acid sequence of selected from the group consisting of: (i) SEQ ID NO:6, 32, or
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a second binding domain that binds to PD-L1 and comprises (a) a heavy chain variable (VH) region comprising (1) a VH CDR1 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO:79, 105, or 131 (ii) SEQ ID NO:85, 111, or 137 (iii) SEQ ID NO:90, 116, or 142, (iv) SEQ ID NO:91, 117, or 143 (v) SEQ ID NO:96, 122, or 148; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO:80, 106, or 132, (ii) SEQ ID NO:86, 112, or 138, (iii) SEQ ID NO:92, 118, or 144, (iv) SEQ ID NO:97
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent comprises a second binding domain that binds to PD-L1 and comprises a heavy chain variable (VH) region comprising (1) a VH CDR1 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO:79, 105, or 131 (ii) SEQ ID NO:85, 11,1 or 137 (iii) SEQ ID NO:90, 116, or 142, (iv) SEQ ID NO:91, 117, or 143 (v) SEQ ID NO:96, 122, or 148; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO:80, 106, or 132, (ii) SEQ ID NO:86, 112, or 138, (iii) SEQ ID NO:92, 118, or 144, (iv) SEQ ID NO:97, 123,
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a second binding domain that binds to PD-L1 and comprises a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO:82, 108, or 134, (ii) SEQ ID NO:88, 114, or 140, (iii) SEQ ID NO:94, 120, or 146, (iv) SEQ ID NO:99, 125, or 151; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO:83, 109, or 135, (ii) SEQ ID NO:89, 115 or 141, (iii) SEQ ID NO:100, 126, or 152; (3) a VL CDR3 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO:
  • multispecific binding agents comprising a first binding domain that binds to CD47 and comprises one or more (e.g., one, two or three) VH CDRs and one or more (e.g., one, two or three) VL CDRs listed in Tables 1-3.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a VH CDR1 SEQ ID NOS: 1, 7, 12, 13, 18, 27, 33, 38, 39, 44, 53, 59, 64, 65, and 70
  • a VL CDR1 SEQ ID NOS: 4, 10, 16, 21, 30, 36, 42, 47, 56, 62, 68, and 73
  • a VH CDR1 SEQ ID NOS: 1, 7, 12, 13, 18, 27, 33, 38, 39, 44, 53, 59, 64, 65, and 70
  • a VL CDR2 SEQ ID NOS: 5, 11, 22, 31, 37, 48, 57, 63, and 74
  • a VH CDR1 SEQ ID NOS: 1, 7, 12, 13, 18, 27, 33, 38, 39, 44, 53, 59, 64, 65, and 70
  • a VL CDR3 SEQ ID NOS: 6, 17, 23, 32, 43, 49, 58, 69, and
  • multispecific binding agents comprising a second binding domain that binds to PD-L1 and comprises one or more (e.g., one, two or three) VH CDRs and one or more (e.g., one, two or three) VL CDRs listed in Tables 4-6.
  • a multispecific binding agent e.g., an antibody
  • a VH CDR1 (SEQ ID NOS: 79, 85, 90, 91, 96, 105, 11, 116, 117, 122, 131, 137, 142, 143, or 148) and a VL CDR1 (SEQ ID NOS: 82, 88, 94, 99, 108, 114, 120, 125, 134, 140, 146, or 151); a VH CDR1 (SEQ ID NOS: 79, 85, 90, 91, 96, 105, 11, 116, 117, 122, 131, 137, 142, 143, or 148) and a VL CDR2 (SEQ ID NOS: 83, 89, 100, 109, 115, 126, 135, 141, or 152); a VH CDR1 (SEQ ID NOS: 79, 85, 90, 91, 96, 105,
  • the multispecific antibody comprises a second binding domain that binds to PD-L1.
  • the multispecific antibody or fragment is a bispecific antibody.
  • the second binding domain comprises: (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO:79, 105, or 131, (ii) SEQ ID NO:85, 111, or 137, (iii) SEQ ID NO:90, 116, or 142, (iv) SEQ ID NO:91, 117, or 143, and (v) SEQ ID NO:96, 122, or 148; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of:(i) SEQ ID NO:80, 106, or 132, (ii) SEQ ID NO:86, 112, or 138, (iii) SEQ ID NO:92, 118, or 144,
  • a multispecific antibody or fragment thereof with a first binding domain that binds to CD47 wherein the first binding domain comprises a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO:1, 27, or 53, (ii) SEQ ID NO:7, 33, or 59, (iii) SEQ ID NO:12, 38, or 64, (iv) SEQ ID NO:13, 39, or 65, and (v) SEQ ID NO:18, 44, or 70; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO:2, 28, or 54, (ii) SEQ ID NO:8, 34, or 60, (iii) SEQ ID NO:14, 40, or 66, (iv) SEQ ID NO:19, 45, or 71, and (v) SEQ ID NO:24, 50, or 76; and (3) a VH CDR1 having an amino
  • the multispecific antibody comprises a second binding domain that binds to PD-L1.
  • the multispecific antibody or fragment thereof of is a bispecific antibody.
  • the second binding domain comprises: (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO:79, 105, or 131, (ii) SEQ ID NO:85, 111, or 137, (iii) SEQ ID NO:90, 116, or 142, (iv) SEQ ID NO:91, 117, or 143, and (v) SEQ ID NO:96, 122, or 148; (2) a V H CDR2 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO:80, 106, or 132, (ii) SEQ ID NO:86, 112, or 138, (iii) SEQ ID NO:92, 118, or
  • a multispecific antibody or fragment thereof with a first binding domain that binds to CD47 wherein the first binding domain comprises a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO:4, 30, or 56, (ii) SEQ ID NO:10, 36, or 62, (iii) SEQ ID NO:16, 42, or 68, and (iv) SEQ ID NO:21, 47, or 73; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO:5, 31, or 57, (ii) SEQ ID NO:11, 37, or 63, and (iii) SEQ ID NO:22, 48, or 74; (3) a VL CDR3 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO:6, 32, or 58, (ii) SEQ ID NO:17
  • the multispecific antibody comprises a second binding domain that binds to PD-L1.
  • the multispecific antibody or fragment thereof is a bispecific antibody.
  • the second binding domain comprises: (a) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO:82, 108, or 134, (ii) SEQ ID NO:88, 114, or 140, (iii) SEQ ID NO:94, 120, or 146, and (iv) SEQ ID NO:99, 125, or 151; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO:83, 109, or 135, (ii) SEQ ID NO:89, 115, or 141, and (iii) SEQ ID NO:100, 126, or 152; and (3) a VL CDR3 having an amino acid sequence selected from the group consisting of: (i) SEQ
  • a multispecific antibody or fragment thereof with a first binding domain that binds to CD47 wherein the first binding domain comprises all three heavy chain complementarity determining regions (CDRs) or all three light chain CDRs from: the antibody designated C40 that comprises a VH sequence that is SEQ ID NO:25 and a VL sequence that is SEQ ID NO:26; the antibody designated C56 that comprises a VH sequence that is SEQ ID NO:51 and a VL sequence that is SEQ ID NO:52; or the antibody designated C59 that comprises a VH sequence that is SEQ ID NO:77 and a VL sequence that is SEQ ID NO:78.
  • CDRs heavy chain complementarity determining regions
  • the multispecific antibody comprises a second binding domain that binds to PD-L1.
  • the multispecific antibody is a bispecific antibody.
  • the second binding domain comprises all three heavy chain complementarity determining regions (CDRs) or all three light chain CDRs from: the antibody designated P22 that comprises a VH sequence that is SEQ ID NO:103 and a VL sequence that is SEQ ID NO:104; the antibody designated P24 that comprises a VH sequence that is SEQ ID NO:129 and a VL sequence that is SEQ ID NO:130; or the antibody designated P31.2 that comprises a VH sequence that is SEQ ID NO:155 and a VL sequence that is SEQ ID NO:156.
  • CDRs heavy chain complementarity determining regions
  • the multispecific antibody comprises a second binding domain that binds to PD-L1.
  • the multispecific antibody or fragment thereof of is a bispecific antibody.
  • the second binding domain comprises all three heavy chain CDRs and all three light chain CDRs from the antibody designated P22.
  • the second binding domain comprises all three heavy chain CDRs and all three light chain CDRs from the antibody designated P24.
  • the second binding domain comprises all three heavy chain CDRs and all three light chain CDRs from the antibody designated P31.2.
  • the first binding domain comprises: (a) a heavy chain variable (V H ) region comprising a V H CDR1, a V H CDR2, and a V H CDR3 amino acid sequence depicted in Tables 1-3; and (b) a light chain variable (V L ) region comprising a V L CDR1, a V L CDR2, and a V L CDR3 amino acid sequence depicted in Tables 1-3.
  • the multispecific antibody comprises a second binding domain that binds to PD-L1.
  • the multispecific antibody or fragment thereof is a bispecific antibody.
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising a V H CDR1, a V H CDR2, and a V H CDR3 amino acid sequence depicted in Tables 4-6; and/or (b) a light chain variable (V L ) region comprising a V L CDR1, a V L CDR2, and a V L CDR3 amino acid sequence depicted in Tables 4-6.
  • the first binding domain comprises a heavy chain variable (V H ) region comprising a V H CDR1, a V H CDR2, and a V H CDR3 amino acid sequence depicted in Tables 1-3.
  • the multispecific antibody comprises a second binding domain that binds to PD-L1.
  • the multispecific antibody or fragment thereof is a bispecific antibody.
  • the second binding domain comprises a heavy chain variable (V H ) region comprising a V H CDR1, a V H CDR2, and a V H CDR3 amino acid sequence depicted in Tables 4-6.
  • the first binding domain comprises a light chain variable (V L ) region comprising a V L CDR1, a V L CDR2, and a V L CDR3 amino acid sequence depicted in Tables 1-3.
  • the multispecific antibody comprises a second binding domain that binds to PD-L1.
  • the multispecific antibody or fragment thereof is a bispecific antibody.
  • the second binding domain comprises a light chain variable (V L ) region comprising a V L CDR1, a V L CDR2, and a V L CDR3 amino acid sequence depicted in Tables 4-6
  • a multispecific antibody or fragment thereof with a first binding domain that binds to CD47 wherein the first binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1, 7, 12, 13, and 18; (2) a V H CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:2, 8, 14, 19 and 24; and (3) a V H CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21; (2) a V L CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:5, 11, and 22; and (3) a V L CDR3 having an amino acid sequence selected from the group consisting of SEQ ID
  • the multispecific antibody comprises a second binding domain that binds to PD-L1.
  • the first binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:1; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:2; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:5; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:6.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:79; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:80; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:81; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:82; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:83; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:84.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:105; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:106; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:107; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:108; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:109; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:110.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:131; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:132; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:133; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:134; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:135; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:136.
  • V H heavy chain variable
  • V L light chain variable
  • the first binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:7; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:8; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:10; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:11; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:6.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:85; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:86; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:87; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:88; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:89; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:84.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:111; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:112; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:113; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:114; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:115; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:110.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:137; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:138; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:139; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:140; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:141; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:136.
  • V H heavy chain variable
  • V L light chain variable
  • the first binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:12; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:2; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:5; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:6.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:90; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:80; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:81; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:82; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:83; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:84.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:116; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:106; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:107; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:108; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:109; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:110.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:142; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:132; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:133; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:134; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:135; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:136.
  • V H heavy chain variable
  • V L light chain variable
  • first binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:13; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:14; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:15; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:16; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:11; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:17.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:91; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:92; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:93; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:94; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:89; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:95.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:117; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:118; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:119; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:120; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:115; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:128.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:143; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:144; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:145; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:146; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:141; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:147.
  • V H heavy chain variable
  • V L light chain variable
  • first binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:18; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:19; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:21; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:22; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:23.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:96; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:97; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:98; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:99; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:100; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:101.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:122; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:123; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:124; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:125; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:126; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:127.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:148; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:149; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:150; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:151; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:152; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:153.
  • V H heavy chain variable
  • V L light chain variable
  • the first binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:1; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:24; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:5; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:6.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:79; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:102; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:81; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:82; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:83; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:84.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:105; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:128; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:107; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:108; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:109; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:110.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:131; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:154; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:133; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:134; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:135; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:136.
  • a multispecific antibody or fragment thereof described above is a bispecific antibody.
  • a multispecific antibody or fragment thereof with a first binding domain that binds to CD47 wherein the first binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:27, 33, 38, 39, and 44; (2) a V H CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:28, 34, 40, 45, and 50; and (3) a V H CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:29, 35, 41, and 46; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:30, 36, 42, and 47; (2) a V L CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:31, 37, and 48 and (3) a V L CDR3
  • the multispecific antibody comprises a second binding domain that binds to PD-L1.
  • the first binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:27; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:28; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:29; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:30; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:31; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:32.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:79; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:80; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:81; and (b) a light chain variable (V L ) region comprising: 1) a V L CDR1 having the amino acid sequence of SEQ ID NO:82; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:83; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:84.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:105; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:106; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:107; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:108; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:109; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:110.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:131; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:132; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:133; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:134; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:135; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:136.
  • V H heavy chain variable
  • V L light chain variable
  • the first binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:33; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:34; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:35; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:36; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:37; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:32.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:79; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:80; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:81; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:82; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:83; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:84.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising:(1) a V H CDR1 having the amino acid sequence of SEQ ID NO:105; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:106; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:107; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:108; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:109; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:110.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:131; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:132; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:133; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:134; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:135; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:136.
  • V H heavy chain variable
  • V L light chain variable
  • the first binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:38; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:28; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:29; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:30; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:31; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:32.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:79; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:80; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:81; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:82; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:83; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:84.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:105; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:106; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:107; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:108; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:109; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:110.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:131; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:132; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:133; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:134; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:135; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:136.
  • V H heavy chain variable
  • V L light chain variable
  • the first binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:39; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:41; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:42; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:37; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:43.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:79; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:80; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:81; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:82; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:83; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:84.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:105; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:106; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:107; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:108; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:109; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:110.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:131; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:132; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:133; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:134; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:135; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:136.
  • V H heavy chain variable
  • V L light chain variable
  • the first binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:44; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:45; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:46; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:47; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:48; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:49.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:79; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:80; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:81; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:82; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:83; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:84.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:105; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:106; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:107; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:108; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:109; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:110.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:131; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:132; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:133; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:134; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:135; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:136.
  • V H heavy chain variable
  • V L light chain variable
  • the first binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:27; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:50; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:29; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:30; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:31; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:32.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:79; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:80; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:81; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:82; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:83; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:84.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:105; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:106; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:107; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:108; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:109; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:110.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:131; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:132; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:133; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:134; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:135; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:136.
  • a multispecific antibody or fragment thereof described above is a bispecific antibody.
  • a multispecific antibody or fragment thereof with a first binding domain that binds to CD47 wherein the first binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:53, 59, 64, 65, and 70; (2) a V H CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:54, 60, 66, 71, and 76; and (3) a V H CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:55, 61, 67, and 72; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:56, 62, 68, and 73; (2) a V L CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:57, 63, and
  • the multispecific antibody comprises a second binding domain that binds to PD-L1.
  • the first binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:54; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:55; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:56; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:57; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:58.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:79; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:80; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:81; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:82; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:83; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:84.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:105; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:106; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:107; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:108; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:109; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:110.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:131; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:132; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:133; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:134; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:135; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:136.
  • V H heavy chain variable
  • V L light chain variable
  • the first binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:59; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:60; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:61; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:62; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:63; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:58.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:79; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:80; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:81; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:82; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:83; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:84.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:105; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:106; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:107; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:108; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:109; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:110.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:131; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:132; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:133; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:134; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:135; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:136.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:79; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:80; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:81; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:82; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:83; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:84.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:105; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:106; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:107; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:108; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:109; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:110.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:131; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:132; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:133; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:134; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:135; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:136.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:105; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:106; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:107; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:108; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:109; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:110.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:131; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:132; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:133; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:134; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:135; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:136.
  • V H heavy chain variable
  • V L light chain variable
  • the first binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:70; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:71; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:72; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:73; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:74; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:75.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:79; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:80; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:81; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:82; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:83; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:84.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:105; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:106; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:107; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:108; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:109; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:110.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:131; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:132; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:133; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:134; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:135; and
  • the first binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:76; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:55; and (b) a light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:79; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:80; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:81; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:82; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:83; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:84.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:105; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:106; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:107; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:108; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:109; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:110.
  • V H heavy chain variable
  • V L light chain variable
  • the second binding domain comprises: (a) a heavy chain variable (V H ) region comprising: (1) a V H CDR1 having the amino acid sequence of SEQ ID NO:131; (2) a V H CDR2 having the amino acid sequence of SEQ ID NO:132; and (3) a V H CDR3 having the amino acid sequence of SEQ ID NO:133; and (b) a light chain variable (V L ) region comprising: (1) a V L CDR1 having the amino acid sequence of SEQ ID NO:134; (2) a V L CDR2 having the amino acid sequence of SEQ ID NO:135; and (3) a V L CDR3 having the amino acid sequence of SEQ ID NO:136.
  • a multispecific antibody or fragment thereof described above is a bispecific antibody.
  • V H region and/or V L region described herein further comprises human framework sequences.
  • the V H region and/or V L region further comprises a framework 1 (FR1), a framework 2 (FR2), a framework 3 (FR3) and/or a framework 4 (FR4) sequence.
  • the multispecific antibody described herein is a monoclonal antibody. In some embodiments, the monoclonal antibody is a humanized, human or chimeric antibody. In some embodiments, the multispecific antibody described herein is a Fab, Fab′, F(ab′)2, Fv, scFv, (scFv)2, single chain antibody molecule, dual variable region antibody, single variable region antibody, linear antibody, V region, or a multispecific antibody formed from antibody fragments. In some embodiments, the multispecific antibody described herein is a recombinant antibody, which is optionally a humanized, human or chimeric antibody
  • the CDRs disclosed herein for the first binding domain that binds to CD47 include consensus sequences derived from groups of related antibodies (see, e.g., Tables 1-3).
  • a “consensus sequence” refers to amino acid sequences having conserved amino acids common among a number of sequences and variable amino acids that vary within a given amino acid sequences.
  • the CDR consensus sequences provided include CDRs corresponding to CDRH1, CDRH2, CDRH3, CDRL1, CDRL2 and/or CDRL3.
  • Consensus sequences of CDRs of multispecific binding agents e.g., antibodies, such as bispecific antibodies for the first binding domain that binds to CD47 are shown in FIGS. 16 A and 16 B .
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a first binding domain that binds to CD47 and comprises (a) a heavy chain variable (VH) region comprising: (1) a V H CDR1 having the amino acid sequence GFTFX 1 X 2 YYIH (SEQ ID NO:194), wherein X 1 and X 2 are each independently a naturally occurring amino acid; (2) a VH CDR2 having the amino acid sequence of X 1 IDX 2 X 3 X 4 X 5 X 6 TX 7 YADSVKG (SEQ ID NO:195), wherein X 1 , X 2 , X 3 X 4 , X 5 , X 6 , and X 7 are each independently a naturally occurring amino acid; and (3) a VH CDR3 having the amino acid of GGX 1 X 2 AX 3 DY (SEQ ID NO:196), wherein X 1 , X 2
  • the VH CDR1 of a multispecific binding agent described herein has the amino acid sequence of GFTFX 1 X 2 YYIH (SEQ ID NO:216), wherein X 1 is a S or T, and X 2 is a Y or S.
  • the VH CDR2 of a multispecific binding agent described herein has the amino acid sequence of X 1 IDX 2 X 3 X 4 X 5 X 6 TX 7 YADSVKG (SEQ ID NO:206), wherein X 1 is a W, F or Y, X 2 is a P or S, X 3 is a Y or K, X 4 is a G, S or H, X 5 is a H or G, X 6 is a S or T, and X 7 is a T, E or Q.
  • the VH CDR3 of a multispecific binding agent described herein has the amino acid sequence of GGX 1 X 2 AX 3 DY (SEQ ID NO:207), wherein X 1 is a R or L, X 2 is a G, Y or S, and X 3 is a M or L.
  • the VL CDR1 of a multispecific binding agent described herein has the amino acid sequence of RASQSVSSAVA (SEQ ID NO:197).
  • the VL CDR2 of a multispecific binding agent described herein has the amino acid sequence of SASSLYS (SEQ ID NO:198).
  • the VL CDR3 of a multispecific binding agent described herein has the amino acid sequence of QQX 1 X 2 X 3 X 4 LX 5 T (SEQ ID NO:208), wherein X 1 is a R or G, X 2 is Y, R or T, X 3 is a S or T, X 4 is a S or D, and X 5 is a L or R.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent described herein comprises a second binding domain that binds to PD-L1 and comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence GFTFX 1 X 2 YYIH (SEQ ID NO:200), wherein X 1 and X 2 are each independently a naturally occurring amino acid; (2) a VH CDR2 having the amino acid sequence of X 1 IX 2 X 3 X 4 GX 5 X 6 TX 7 YADSVKG (SEQ ID NO:201), wherein X 1 , X 2 , X 3 , X 4 , X 5
  • the VH CDR1 of a multispecific binding agent described herein has the amino acid sequence of GFTFX 1 X 2 YYIH (SEQ ID NO:217), wherein X 1 is a D or S, X 2 is a Q or S.
  • the VH CDR2 of a multispecific binding agent described herein has the amino acid sequence of X 1 IX 2 X 3 X 4 GX 5 X 6 TX 7 YADSVKG (SEQ ID NO:209), wherein X 1 is a E, W, or T, X 2 is a Y, T, or S, X 3 is a P or S, X 4 is a A, H, or G, X 5 is a S, Y, or G, X 6 is a Y, S, or F, and X 7 is Y or K.
  • the VH CDR3 of a multispecific binding agent described herein has the amino acid sequence of X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 LDY (SEQ ID NO:210), wherein X 1 is a G or D, X 2 is a P, S, or Y, X 3 is a Y, V, or T, X 4 is a S, I, or L, X 5 is a V, Y, or T, X 6 is a R, G or P, X 7 is a Y or V (or not present), and X 8 is an A (or not present).
  • the VL CDR1 of a multispecific binding agent described herein has the amino acid sequence of RASQSVSSAVA (SEQ ID NO:197). In some embodiments, the VL CDR2 of a multispecific binding agent described herein has the amino acid sequence of SASSLYS (SEQ ID NO:198).
  • the VL CDR3 of a multispecific binding agent described herein has the amino acid sequence of QQX 1 X 2 X 3 X 4 PX 5 T (SEQ ID NO:211), wherein X 1 is a V, Y, or F, X 2 is a S, Y, or G, X 3 is a Y, T, or A, X 4 is a S or E, and X 5 is a Y or I.
  • described herein is a binding agent that binds to essentially the same epitope as an antibody or fragment thereof of any one of the antibodies described herein. In some embodiments, described hereins is a binding agent that competes for binding to human PD-L1 with an antibody or fragment thereof of any one described herein. In some embodiments, the binding agent is an antibody or fragment thereof.
  • the CDRs of a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 can be determined according to the Kabat system (Kabat et al. (1971) Ann. NY Acad. Sci. 190:382-391 and, Kabat et al. (1991) Sequences of Proteins of Immunological Interest , Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242).
  • the CDRs of a multispecific binding agent can be determined according to the Chothia system, which will be referred to herein as the “Chothia CDRs” (see, e.g., Chothia and Lesk, 1987, J. Mol. Biol., 196:901-917; Al-Lazikani et al., 1997, J. Mol. Biol., 273:927-948; Chothia et al., 1992, J. Mol. Biol., 227:799-817; Tramontano A et al., 1990, J. Mol. Biol. 215(1):175-82; and U.S. Pat. No. 7,709,226).
  • Chothia CDRs see, e.g., Chothia and Lesk, 1987, J. Mol. Biol., 196:901-917; Al-Lazikani et al., 1997, J. Mol. Biol., 273:927-948; Chothia et al.,
  • the CDRs of a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 can be determined according to the ImMunoGeneTics (IMGT) system, for example, as described in Lefranc, M.-P., 1999, The Immunologist, 7:132-136 and Lefranc, M.-P. et al., 1999, Nucleic Acids Res., 27:209-212 (“IMGT CDRs”).
  • IMGT CDRs ImMunoGeneTics
  • the CDRs of a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 can be determined according to the AbM system, which will be referred to herein as the “AbM CDRs,” for example as described in MacCallum et al., 1996, J. Mol. Biol., 262:732-745.
  • the CDRs of a multispecific binding agent can be determined according to the Contact system, which will be referred to herein as the “Contact CDRs” (see, e.g., MacCallum R M et al., 1996, J Mol Biol 5: 732-745).
  • the Contact CDRs are based on an analysis of the available complex crystal structures.
  • the position of one or more CDRs along the VH (e.g., CDR1, CDR2, or CDR3) and/or VL (e.g., CDR1, CDR2, or CDR3) region of a first binding domain of a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • PD-L1, including human PD-L1 e.g., PD-L1, including human PD-L1
  • PD-L1, including human PD-L1 e.g., PD-L1, including human PD-L1
  • the position defining a CDR of any of Table 1, 2 or 3 may vary by shifting the N-terminal and/or C-terminal boundary of the CDR by one, two, three, four, five, or six amino acids, relative to the current CDR position, so long as binding to CD47 (e.g., human CD47) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
  • CD47 e.g., human CD47
  • the length of one or more CDRs along the VH (e.g., CDR1, CDR2, or CDR3) and/or VL (e.g., CDR1, CDR2, or CDR3) region of a first binding domain of a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a VH and/or VL CDR1, CDR2, and/or CDR3 described herein may be one, two, three, four, five or more amino acids shorter than one or more of the CDRs described by SEQ ID NOS: 1-24, 27-50, or 53-76, so long as binding to CD47 (e.g., human CD47) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
  • CD47 e.g., human CD47
  • VH and/or VL CDR1, CDR2, and/or CDR3 described herein may be one, two, three, four, five or more amino acids longer than one or more of the CDRs described by SEQ ID NOS: 1-24, 27-50, or 53-76, so long as binding to CD47 (e.g., human CD47) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
  • CD47 e.g., human CD47
  • the amino terminus of a VH and/or VL CDR1, CDR2, and/or CDR3 of a first binding domain described herein may be extended by one, two, three, four, five or more amino acids compared to one or more of the CDRs described by SEQ ID NOS: 1-24, 27-50, or 53-76, so long as binding to CD47 (e.g., human CD47) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
  • CD47 e.g., human CD47
  • the carboxy terminus of a V H and/or VL CDR1, CDR2, and/or CDR3 of a first binding domain described herein may be extended by one, two, three, four, five or more amino acids compared to one or more of the CDRs described by SEQ ID NOS: 1-24, 27-50, or 53-76, so long as binding to CD47 (e.g., human CD47) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
  • CD47 e.g., human CD47
  • the amino terminus of a VH and/or VL CDR1, CDR2, and/or CDR3 of a first binding domain described herein may be shortened by one, two, three, four, five or more amino acids compared to one or more of the CDRs described by SEQ ID NOS: 1-24, 27-50, or 53-76, so long as binding to CD47 (e.g., human CD47) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
  • CD47 e.g., human CD47
  • the carboxy terminus of a VH and/or VL CDR1, CDR2, and/or CDR3 of a first binding domain described herein may be shortened by one, two, three, four, five or more amino acids compared to one or more of the CDRs described by SEQ ID NOS: 1-24, 27-50, or 53-76, so long as binding to CD47 (e.g., human CD47) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%). Any method known in the art can be used to ascertain whether binding to CD47 (e.g., human CD47) is maintained, for example, the binding assays and conditions described in the “Examples” section described herein.
  • the position of one or more CDRs along the VH (e.g., CDR1, CDR2, or CDR3) and/or VL (e.g., CDR1, CDR2, or CDR3) region of a second binding domain of a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • PD-L1, including human PD-L1 described herein may vary by one, two, three, four, five, or six amino acid positions so long as binding to PD-L1 (e.g., human PD-L1) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
  • the position defining a CDR of any of Table 4, 5 or 6 may vary by shifting the N-terminal and/or C-terminal boundary of the CDR by one, two, three, four, five, or six amino acids, relative to the current CDR position, so long as binding to PD-L1 (e.g., human PD-L1) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
  • PD-L1 e.g., human PD-L1
  • substantially maintained for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
  • the length of one or more CDRs along the VH (e.g., CDR1, CDR2, or CDR3) and/or VL (e.g., CDR1, CDR2, or CDR3) region of a second binding domain of a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • PD-L1, including human PD-L1 described herein may vary (e.g., be shorter or longer) by one, two, three, four, five, or more amino acids, so long as binding to PD-L1 (e.g., human PD-L1) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
  • a VH and/or VL CDR1, CDR2, and/or CDR3 described herein may be one, two, three, four, five or more amino acids shorter than one or more of the CDRs described by SEQ ID NOS: 79-102, 105-128, or 131-154, so long as binding to PD-L1 (e.g., human PD-L1) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
  • PD-L1 e.g., human PD-L1
  • VH and/or VL CDR1, CDR2, and/or CDR3 described herein may be one, two, three, four, five or more amino acids longer than one or more of the CDRs described by SEQ ID NOS: 79-102, 105-128, or 131-154, so long as binding to PD-L1 (e.g., human PD-L1) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
  • PD-L1 e.g., human PD-L1
  • the amino terminus of a VH and/or VL CDR1, CDR2, and/or CDR3 of a second binding domain described herein may be extended by one, two, three, four, five or more amino acids compared to one or more of the CDRs described by SEQ ID NOS: 79-102, 105-128, or 131-154, so long as binding to PD-L1 (e.g., human PD-L1) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
  • PD-L1 e.g., human PD-L1
  • the carboxy terminus of a VH and/or VL CDR1, CDR2, and/or CDR3 of a second binding domain described herein may be extended by one, two, three, four, five or more amino acids compared to one or more of the CDRs described by SEQ ID NOS: 79-102, 105-128, or 131-154, so long as binding to PD-L1 (e.g., human PD-L1) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
  • PD-L1 e.g., human PD-L1
  • the amino terminus of a V H and/or VL CDR1, CDR2, and/or CDR3 of a second binding domain described herein may be shortened by one, two, three, four, five or more amino acids compared to one or more of the CDRs described by SEQ ID NOS: 79-102, 105-128, or 131-154, so long as binding to PD-L1 (e.g., human PD-L1) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
  • PD-L1 e.g., human PD-L1
  • the carboxy terminus of a VH and/or VL CDR1, CDR2, and/or CDR3 of a second binding domain described herein may be shortened by one, two, three, four, five or more amino acids compared to one or more of the CDRs described by SEQ ID NOS: 79-102, 105-128, or 131-154, so long as binding to PD-L1 (e.g., human PD-L1) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%). Any method known in the art can be used to ascertain whether binding to PD-L1 (e.g., human PD-L1) is maintained, for example, the binding assays and conditions described in the “Examples” section described herein.
  • PD-L1 e.g., human PD-L1
  • the multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • including multispecific binding agents that bind to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), presented herein that bind to CD47 comprise conservative sequence modifications.
  • conservative sequence modifications include conservative amino acid substitutions that include ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
  • Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
  • basic side chains e.g., lysine, arginine, histidine
  • acidic side chains e.g.
  • a predicted nonessential amino acid residue in a CD47 or PD-L1 is replaced with another amino acid residue from the same side chain family.
  • Methods of identifying nucleotide and amino acid conservative substitutions which do not eliminate antigen binding are well-known in the art (see, e.g., Brummell et al., Biochem. 32:1180-1187 (1993); Kobayashi et al. Protein Eng. 12(10):879-884 (1999); and Burks et al. Proc. Natl. Acad. Sci. USA 94:412-417 (1997)).
  • the conservative sequence modifications described herein modify the amino acid sequences of the multispecific binding agents (e.g., antibodies, such as bispecific antibodies), including multispecific binding agents that bind to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), by 50%, or 55%, or 60%, or 65%, or 70%, or 75%, or 80%, or 85%, or 90%, or 95%, or 98%, or 99%.
  • the nucleotide and amino acid sequence modifications refer to at most 1, 2, 3, 4, 5, or 6 amino acid substitutions to the CDRs described in Table 1, Table 2, Table 3, Table 4, Table 5, or Table 6.
  • each such CDR may contain up to 5 conservative amino acid substitutions, for example up to (not more than) 4 conservative amino acid substitutions, for example up to (not more than) 3 conservative amino acid substitutions, for example up to (not more than) 2 conservative amino acid substitutions, or no more than 1 conservative amino acid substitution.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents that bind to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1) with a masking moiety and/or cleavable moiety in which one or more of the CD47 and/or other target binding domains of the multispecific binding agent (e.g., an antibody) are masked (e.g., via a masking moiety) and/or activatable (e.g., via a cleavable moiety).
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • SAFE body masking technology see, e.g., US Patent Application Publication No. 2019/0241886) and Probody masking technology (see, e.g., US Patent Application Publication No. 2015/0079088).
  • Such technologies can be used to generate a multispecific binding agent (e.g., an antibody, such as a bispecific antibody) that is masked and/or activatable.
  • Such masked and/or activatable multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents that bind to CD47, including human CD47, and one or more targets that are not CD47 are useful for the preparation of conjugates, including immunoconjugates, antibody-drug conjugates (ADCs), masked ADCs and activatable antibody-drug conjugates (AADCs), comprising any one of the multispecific binding agents (e.g., antibodies, such as bispecific antibodies), including multispecific binding agents that bind to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), such as human CD47 binding agents, of the present disclosure, including those directly or indirectly linked another agent such as a drug.
  • ADCs antibody-drug conjugates
  • AADCs activatable antibody-drug conjugates
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a moiety with effector function such as cytotoxic activity (e.g., a chemotherapeutic moiety or a radioisotope) or immune recruitment activity.
  • Moieties that are linked or conjugated (directly or indirectly) include drugs that are cytotoxic (e.g., toxins such as aurostatins) or non-cytotoxic (e.g., signal transduction modulators such as kinases or masking moieties that mask one or more binding domains of a multispecific binding agent (e.g., an antibody, such as a bispecific antibody), or cleavable moieties that allow for activating a multispecific binding agent by cleaving of a cleavable moiety to unmask one or more binding domains of a multispecific binding agent (e.g., an antibody, such as a bispecific antibody) in the tumor microenvironment) in the form of masked conjugates.
  • drugs that are cytotoxic e.g., toxins such as aurostatins
  • non-cytotoxic e.g., signal transduction modulators such as kinases or masking moieties that mask one or more binding domains of a multispecific binding agent (e.
  • Moieties that promote immune recruitment can include other antigen-binding agents, such as viral proteins that bind selectively to cells of the innate immune system.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a moiety that facilitates isolation from a mixture e.g., a tag
  • reporter activity e.g., a detection label or reporter protein
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents that bind to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1) described herein may be linked or conjugated (directly or indirectly) to a polypeptide, which can result in the generation of an activatable antibody.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • the agent is a drug, resulting in an ADC or an AADC when the antibody of the ADC comprises a masking moiety and a cleavable moiety.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents that bind to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1) described herein are conjugated or recombinantly linked (directly or indirectly) to a therapeutic agent (e.g., a cytotoxic agent) or to a diagnostic or detectable agent.
  • a therapeutic agent e.g., a cytotoxic agent
  • the conjugated or recombinantly linked antibodies, including masked or activatable conjugates can be useful, for example, for treating or preventing a disease or disorder such as an immune cell dysfunctional disease, disorder or condition.
  • the conjugated or recombinantly linked multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents that bind to CD47, including human CD47, and one or more targets that are not CD47 e.g., PD-L1, including human PD-L1, including masked or activatable conjugates
  • targets that are not CD47 e.g., PD-L1, including human PD-L1
  • masked or activatable conjugates can be useful, for example, for monitoring or prognosing the onset, development, progression, and/or severity of an immunce cell dysfunctional disease.
  • Such diagnosis and detection can be accomplished, for example, by coupling the multispecific binding agent (e.g., an antibody, such as a bispecific antibody) to detectable substances including, for example: enzymes, including, but not limited to, horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase; prosthetic groups, including, but not limited to, streptavidin/biotin or avidin/biotin; fluorescent materials, including, but not limited to, umbelliferone, fluorescein, fluorescein isothiocynate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride, or phycoerythrin; luminescent materials, including, but not limited to, luminol; bioluminescent materials, including, but not limited to, luciferase, luciferin, or aequorin; chemiluminescent material, including, but not limited
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • a heterologous protein or polypeptide or fragment thereof, for example, to a polypeptide (e.g., of about 10, about 20, about 30, about 40, about 50, about 60, about 70, about 80, about 90, or about 100 amino acids) to generate fusion proteins, as well as uses thereof.
  • fusion proteins comprising an antigen-binding fragment of a multispecific binding agent (e.g., an antibody, such as a bispecific antibody), including a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), described herein (e.g., comprising CDR1, CDR2, and/or CDR3 of VH and/or VL) and a heterologous protein, polypeptide, or peptide.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • the heterologous protein, polypeptide, or peptide that a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a particular cell e.g., a CD47 expressing cell and/or PD-L1 expressing cell, including a tumor cell.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents that bind to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), described herein can be linked (directly or indirectly) to marker or “tag” sequences, such as a peptide, to facilitate purification.
  • the marker or tag amino acid sequence is a hexa-histidine peptide, such as the tag provided in a pQE vector (see, e.g., QIAGEN, Inc.), among others, many of which are commercially available. For example, as described in Gentz et al., 1989, Proc. Natl.
  • hexa-histidine provides for convenient purification of a fusion protein.
  • Other peptide tags useful for purification include, but are not limited to, the hemagglutinin (“HA”) tag, which corresponds to an epitope derived from the influenza hemagglutinin protein (Wilson et al., 1984, Cell 37:767-78), and the “FLAG” tag.
  • a multispecific binding agent (e.g., an antibody) described herein is a fusion protein.
  • fusion protein refers to a polypeptide that comprises an amino acid sequence of a binding agent (e.g., an antibody) and an amino acid sequence of a heterologous polypeptide or protein (e.g., a polypeptide or protein not normally a part of the antibody (e.g., a non-CD47 binding antibody or a non-PD-L1 binding antibody)).
  • the fusion protein retains the biological activity of a multispecific binding agent.
  • the fusion protein comprises a first binding domain that comprises CD47 antibody VH region, VL region, VH CDR (one, two or three VH CDRs), and/or VL CDR (one, two or three VL CDRs), wherein the fusion protein binds to a CD47 epitope, a CD47 fragment and/or a CD47 polypeptide.
  • the fusion protein comprises a second binding domain that comprises PD-L1 antibody VH region, VL region, VH CDR (one, two or three VH CDRs), and/or VL CDR (one, two or three VL CDRs), wherein the fusion protein binds to a PD-L1 epitope, a PD-L1 fragment and/or a PD-L1 polypeptide.
  • Fusion proteins may be generated, for example, through the techniques of gene-shuffling, motif-shuffling, exon-shuffling, and/or codon-shuffling (collectively referred to as “DNA shuffling”).
  • DNA shuffling may be employed to alter the activities of the multispecific binding agents (e.g., antibodies, such as bispecific antibodies), including multispecific binding agents that bind to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), as described herein, including, for example, multispecific binding agents with higher affinities and lower dissociation rates (see, e.g., U.S. Pat. Nos.
  • multispecific binding agents including multispecific binding agents that bind to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), may be altered by being subjected to random mutagenesis by error-prone PCR, random nucleotide insertion, or other methods prior to recombination.
  • a polynucleotide encoding a multispecific binding agent described herein may be recombined with one or more components, motifs, sections, parts, domains, fragments, etc. of one or more heterologous molecules.
  • Multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents that bind to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), described herein may also be attached to solid supports, which are useful for immunoassays or purification of the target antigen.
  • solid supports include, but are not limited to, glass, cellulose, polyacrylamide, nylon, polystyrene, polyvinyl chloride, or polypropylene.
  • Multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents that bind to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), described herein can also be linked or conjugated (directly or indirectly) to a second antibody to form an antibody heteroconjugate.
  • linker may be a “cleavable moiety” facilitating release of the linked or conjugated agent in a cell, but non-cleavable linkers are also contemplated herein.
  • Linkers for use in conjugates (e.g., antibody-drug conjugates) of the present disclosure include, without limitation, acid labile linkers (e.g., hydrazone linkers), disulfide-containing linkers, peptidase-sensitive linkers (e.g., peptide linkers comprising amino acids, for example, valine and/or citrulline such as citrulline-valine or phenylalanine-lysine), photolabile linkers, dimethyl linkers, thioether linkers, or hydrophilic linkers designed to evade multidrug transporter-mediated resistance.
  • acid labile linkers e.g., hydrazone linkers
  • disulfide-containing linkers e.g., peptidase-sensitive linkers
  • Conjugates of an antibody and agent may be made using a variety of bifunctional protein coupling agents such as BMPS, EMCS, GMBS, HBVS, LC-SMCC, MBS, MPBH, SBAP, SIA, STAB, SMCC, SMPB, SMPH, sulfo-EMCS, sulfo-GMBS, sulfo-KMUS, sulfo-MBS, sulfo-SIAB, sulfo-SMCC, sulfo-SMPB, and SVSB (succinimidyl-(4-vinylsulfone)benzoate).
  • bifunctional protein coupling agents such as BMPS, EMCS, GMBS, HBVS, LC-SMCC, MBS, MPBH, SBAP, SIA, STAB, SMCC, SMPB, SMPH, sulfo-EMCS, sulfo-GMBS, sulfo-KMUS, sul
  • conjugates of antibodies and agents including wherein the agent is a drug for the preparation of an ADC or an AADC, may be prepared using any suitable methods as disclosed in the art (see, e.g., Bioconjugate Techniques (Hermanson ed., 2d ed. 2008)).
  • thiomabs comprising cysteine substitutions at positions on the heavy and light chains that provide reactive thiol groups and do not disrupt immunoglobulin folding and assembly or alter antigen binding (see, e.g., Junutula et al., 2008, J. Immunol. Meth. 332: 41-52; and Junutula et al., 2008, Nature Biotechnol. 26:925-32).
  • selenocysteine is cotranslationally inserted into an antibody sequence by recoding the stop codon UGA from termination to selenocysteine insertion, allowing site specific covalent conjugation at the nucleophilic selenol group of selenocysteine in the presence of the other natural amino acids (see, e.g., Hofer et al., 2008, Proc. Natl. Acad. Sci. USA 105:12451-56; and Hofer et al., 2009, Biochemistry 48(50):12047-57).
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 e.g., PD-L1, including human PD-L1, described herein is conjugated to a cytotoxic agent.
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 e.g., PD-L1, including human PD-L1
  • PD-L1, including human PD-L1 targets that are not CD47
  • cytotoxic agent(s) disclosed herein or known in the art in order to generate an ADC or an AADC.
  • the cytotoxic agent is a chemotherapeutic agent including, but not limited to, methotrexate, adriamycin, doxorubicin, melphalan, mitomycin C, chlorambucil, daunorubicin or other intercalating agents.
  • the cytotoxic agent is an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof, including, but not limited to, diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain, ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAP I, PAPII, and PAP-S), Momordica charantia inhibitor, curcin, crotin, Sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes.
  • diphtheria A chain nonbinding active fragments of diphtheria toxin
  • exotoxin A chain ricin A chain
  • abrin A chain abrin A chain
  • modeccin A chain alpha-
  • the cytotoxic agent is a radioisotope to produce a radioconjugate or a radioconjugated agent.
  • a variety of radionuclides are available for the production of radioconjugated agents including, but not limited to, 90Y, 125I, 131I, 123I, 111In, 131I n, 105Rh, 153Sm, 67Cu, 67Ga, 166Ho, 177Lu, 186Re, 188Re, and 212Bi.
  • Conjugates of a polypeptide or molecule and one or more small molecule toxins such as a calicheamicin, maytansinoids, a trichothene, and CC1065, and the derivatives of these toxins that have toxin activity, can also be used.
  • Conjugates of a polypeptide or molecule and cytotoxic agent are made using a variety of bifunctional protein-coupling agents such as N-succinimidyl-3-(2-pyridyidithiol) propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCL), active esters (such as disuccinimidyl suberate), aldehydes (such as glutareldehyde), bis-azido compounds (such as bis(p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as toluene 2,6-diisocyanate), and bis-active fluorine compounds (such as 1,5-difluoro-2,4-dinitrobenzene).
  • SPDP N-succin
  • a multispecific binding agent e.g., an antibody, such as a bispecific antibody
  • a drug such as a signal transduction modulator, a pro-apoptotic agent, a mitotic inhibitor, an anti-tumor antibiotic, an immunomodulating agent, a nucleic acid for gene therapy, an alkylating agent, an anti-angiogenic agent, an anti-metabolite, a boron-containing agent, a chemoprotective agent, a hormone agent, an anti-hormone agent, a corticosteroid, a photoactive therapeutic agent, an oligonucleotide, a radionuclide agent, a radiosensitizer, a topoisomerase inhibitor, and a tyrosine kinase inhibitor
  • a drug such as a signal transduction modulator, a pro-apoptotic agent, a mitotic inhibitor, an anti-tumor antibiotic, an immunomodulating agent, a nucleic acid for gene therapy, an alkyl
  • the mitotic inhibitor is a dolastatin, an auristatin, a maytansinoid, and a plant alkaloid.
  • the drug is a dolastatin, an auristatin, a maytansinoid, and a plant alkaloid.
  • An example of an auristatin is monomethylaurisatin F (MMAF) or monomethyauristatin E (MMAE).
  • MMAF monomethylaurisatin F
  • MMAE monomethyauristatin E
  • examples of maytansinoids include, but are not limited to, DM1, DM2, DM3, and DM4.
  • the anti-tumor antibiotic is selected from the group consisting of an actinomycine, an anthracycline, a calicheamicin, and a duocarmycin.
  • the actinomycine is a pyrrolobenzodiazepine (PBD).
  • Multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents that bind to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), described herein may be monospecific, bispecific, trispecific or of greater multispecificity.
  • Such agents may include antibodies.
  • Multispecific antibodies, such as bispecific antibodies are monoclonal antibodies that have binding specificities for at least two different targets (e.g., antigens) or two different epitopes on the same target (e.g., a bispecific antibody directed to CD47 with a first binding domain for a first epitope of a CD47, and a second binding domain for a second epitope of CD47).
  • the first binding domain of multispecific (e.g., bispecific) antibodies described herein can be constructed based on the sequences of the antibodies described herein, e.g., the CDR sequences listed in Table 1, Table 2, and Table 3.
  • the second binding domain of multispecific (e.g., bispecific) antibodies described herein can be constructed based on the sequences of the antibodies described herein, e.g., the CDR sequences listed in Table 4, Table 5, and Table 6.
  • the multispecific antibodies described herein are bispecific antibodies.
  • bispecific antibodies are mouse, chimeric, human or humanized antibodies.
  • one of the binding specificities of the multispecific antibody is for CD47 and the other is for any other target (e.g., antigen).
  • a multispecific (e.g., bispecific) antibody can comprise more than one target binding domain, in which different domains are specific for different targets (e.g., a first binding domain that binds CD47 and a second binding domain that binds another target (e.g., antigen), such as an immune check point regulator (e.g., a negative checkpoint regulator).
  • a multispecific (e.g., bispecific) antibody can bind more than one (e.g., two or more) epitopes on the same target (e.g., antigen).
  • one of the binding specificities is for CD47 and the other is for any other target (e.g., antigen).
  • one of the binding specificities is CD47 and the other is for one or more of Cytotoxic T-lymphocyte antigen-4 (CTLA-4), CD80, CD86, Programmed cell death 1 (PD-1), Programmed cell death ligand 1 (PD-L1), Programmed cell death ligand 2 (PD-L2), Lymphocyte activation gene-3 (LAG-3; also known as CD223), Galectin-3, B and T lymphocyte attenuator (BTLA), T-cell membrane protein 3 (TIM3), Galectin-9 (GAL9), B7-H1, B7-H3, B7-H4, T-Cell immunoreceptor with Ig and ITIM domains (TIGIT/Vstm3/WUCAMNSIG9), V-domain Ig suppressor of T-Cell activation (VISTA), Glucocorticoid-induced tumor necrosis factor receptor-related (CTLA-4), CD80,
  • multispecific antibodies are known in the art, such as, by co-expression of two immunoglobulin heavy chain-light chain pairs, where the two heavy chains have different specificities (see, e.g., Milstein and Cuello, 1983, Nature 305:537-40).
  • multispecific antibodies e.g., bispecific antibodies
  • Bispecific Antibodies Kontermann ed., 2011.
  • bispecific antibody molecules can be classified into different structural groups: (i) bispecific immunoglobulin G (BsIgG); (ii) IgG appended with an additional antigen-binding moiety; (iii) bispecific antibody fragments; (iv) bispecific fusion proteins; and (v) bispecific antibody conjugates.
  • BsIgG formats can include crossMab, DAF (two-in-one), DAF (four-in-one), DutaMab, DT-IgG, knobs-in-holes common LC, knobs-in-holes assembly, charge pair, Fab-arm exchange, SEEDbody, triomab, LUZ-Y, Fcab, KA-body, orthogonal Fab.
  • BsIgG comprises heavy chains that are engineered for heterodimerization.
  • heavy chains can be engineered for heterodimerization using a “knobs-into-holes” strategy, a SEED platform, a common heavy chain (e.g., in KA-bodies), and use of heterodimeric Fc regions.
  • Strategies are known in the art to avoid heavy chain pairing of homodimers in BsIgG, including knobs-into-holes, duobody, azymetric, charge pair, HA-TF, SEEDbody, and differential protein A affinity.
  • bispecific antibody format is IgG appended with an additional antigen-binding moiety.
  • monospecific IgG can be engineered to have bispecificity by appending an additional antigen-binding unit onto the monospecific IgG, e.g., at the N- or C-terminus of either the heavy or light chain.
  • additional antigen-binding units include single domain antibodies (e.g., variable heavy chain or variable light chain), engineered protein scaffolds, and paired antibody variable domains (e.g., single chain variable fragments or variable fragments).
  • Non-limiting examples of appended IgG formats include dual variable domain IgG (DVD-Ig), IgG(H)-scFv, scFv-(H)IgG, IgG(L)-scFv, scFv-(L)IgG, IgG(L,H)-Fv, IgG(H)-V, V(H)—IgG, IgG(L)-V, V(L)-IgG, KIH IgG-scFab, 2scFv-IgG, IgG-2scFv, scFv4-Ig, zybody, and DVI-IgG (four-in-one). See Spiess et al. Mol.
  • an exemplary antibody format is a B-Body format for monospecific or multispecific (e.g., bispecific antibodies) as described in e.g. International Patent Application Publication No. WO 2018/075692 and US Patent Application Publication No. 2018/0118811.
  • Bispecific antibody fragments are a format of bispecific antibody molecules that lack some or all of the antibody constant domains. For example, some BsAb lack an Fc region.
  • bispecific antibody fragments include heavy and light chain regions that are connected by a peptide linker that permits efficient expression of the BsAb in a single host cell.
  • bispecific antibody fragments include, but are not limited to, nanobody, nanobody-HAS, BiTE, Diabody, DART, TandAb, scDiabody, scDiabody-CH3, Diabody-CH3, triple body, miniantibody, minibody, TriBi minibody, scFv-CH3 KIH, Fab-scFv, scFv-CH-CL-scFv, F(ab′)2, F(ab′)2-scFv2, scFv-KIH, Fab-scFv-Fc, tetravalent HCAb, scDiabody-Fc, Diabody-Fc, tandem scFv-Fc, and intrabody.
  • Bispecific fusion proteins include antibody fragments linked to other proteins.
  • bispecific fusion proteins can be linked to other proteins to add additional specificity and/or functionality.
  • the dock-and-lock (DNL) method can be used to generate bispecific antibody molecules with higher valency.
  • bispecific antibody fusions to albumin binding proteins or human serum albumin can be extend the serum half-life of antibody fragments.
  • chemical conjugation e.g., chemical conjugation of antibodies and/or antibody fragments, can be used to create BsAb molecules.
  • An exemplary bispecific antibody conjugate includes the CovX-body format, in which a low molecular weight drug is conjugated site-specifically to a single reactive lysine in each Fab arm or an antibody or fragment thereof. In embodiments, the conjugation improves the serum half-life.
  • multispecific antibodies including bispecific antibodies
  • multispecific antibodies can be produced by separate expression of the component antibodies in different host cells and subsequent purification/assembly or by expression of the component antibodies in a single host cell.
  • Purification of multispecific (e.g., bispecific) antibody molecules can be performed by various methods known in the art, including affinity chromatography.
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • multispecific binding agents that bind to CD47, including human CD47, and one or more targets that are not CD47 e.g., PD-L1, including human PD-L1
  • targets that are not CD47 e.g., PD-L1, including human PD-L1
  • a multispecific (e.g., bispecific) antibody disclosed herein comprises a CD47 binding domain and one or more additional binding domains that bind to one or more targets that are not CD47.
  • a multispecific (e.g., bispecific) antibody disclosed herein comprises a CD47 binding domain that comprises the VH and/or VL amino acid sequences of Table 1.
  • a multispecific (e.g., bispecific) antibody disclosed herein comprises a CD47 binding domain that comprises the VH and/or VL amino acid sequences of Table 2.
  • a multispecific (e.g., bispecific) antibody disclosed herein comprises a CD47 binding domain that comprises the VH and/or VL amino acid sequences of Table 3.
  • described herein is a multispecific (e.g., bispecific) antibody comprising a binding domain which binds to CD47 that comprises VH and V L CDRs as set forth in Table 1.
  • a multispecific (e.g., bispecific) antibody comprising a binding domain which binds to CD47 that comprises VH and VL CDRs as set for in Table 2.
  • a multispecific (e.g., bispecific) antibody comprising a binding domain which binds to CD47 that comprises VH and VL CDRs as set for in Table 3.
  • a multispecific (e.g., bispecific) antibody disclosed herein comprises a CD47 binding domain and PD-L1 binding domain.
  • a multispecific (e.g., bispecific) antibody disclosed herein comprises a CD47 binding domain that comprises the VH and/or VL amino acid sequences of Table 1 and a PD-L1 binding domain that comprises the VH and/or VL amino acid sequences of Table 4.
  • a multispecific (e.g., bispecific) antibody disclosed herein comprises a CD47 binding domain that comprises the VH and/or VL amino acid sequences of Table 1 and a PD-L1 binding domain that comprises the VH and/or VL amino acid sequences of Table 5.
  • a multispecific (e.g., bispecific) antibody disclosed herein comprises a CD47 binding domain that comprises the VH and/or VL amino acid sequences of Table 1 and a PD-L1 binding domain that comprises the VH and/or VL amino acid sequences of Table 6.
  • a multispecific (e.g., bispecific) antibody disclosed herein comprises a CD47 binding domain that comprises the VH and/or VL amino acid sequences of Table 2 and a PD-L1 binding domain that comprises the VH and/or VL amino acid sequences of Table 4.
  • a multispecific (e.g., bispecific) antibody disclosed herein comprises a CD47 binding domain that comprises the VH and/or VL amino acid sequences of Table 2 and a PD-L1 binding domain that comprises the VH and/or VL amino acid sequences of Table 5.
  • a multispecific (e.g., bispecific) antibody disclosed herein comprises a CD47 binding domain that comprises the VH and/or VL amino acid sequences of Table 2 and a PD-L1 binding domain that comprises the VH and/or VL amino acid sequences of Table 6.
  • a multispecific (e.g., bispecific) antibody disclosed herein comprises a CD47 binding domain that comprises the VH and/or VL amino acid sequences of Table 3 and a PD-L1 binding domain that comprises the VH and/or VL amino acid sequences of Table 4.
  • a multispecific (e.g., bispecific) antibody disclosed herein comprises a CD47 binding domain that comprises the VH and/or VL amino acid sequences of Table 3 and a PD-L1 binding domain that comprises the VH and/or VL amino acid sequences of Table 5.
  • a multispecific (e.g., bispecific) antibody disclosed herein comprises a CD47 binding domain that comprises the VH and/or VL amino acid sequences of Table 3 and a PD-L1 binding domain that comprises the VH and/or VL amino acid sequences of Table 6.
  • a multispecific (e.g., bispecific) antibody disclosed herein comprises a CD47 binding domain that comprises the VH and VL amino acid sequences of Table 1 and a PD-L1 binding domain that comprises the VH and VL amino acid sequences of Table 4.
  • a multispecific (e.g., bispecific) antibody disclosed herein comprises a CD47 binding domain that comprises the VH and VL amino acid sequences of Table 1 and a PD-L1 binding domain that comprises the VH and VL amino acid sequences of Table 5.
  • a multispecific (e.g., bispecific) antibody disclosed herein comprises a CD47 binding domain that comprises the VH and VL amino acid sequences of Table 1 and a PD-L1 binding domain that comprises the VH and VL amino acid sequences of Table 6.
  • a multispecific (e.g., bispecific) antibody disclosed herein comprises a CD47 binding domain that comprises the VH and VL amino acid sequences of Table 2 and a PD-L1 binding domain that comprises the VH and VL amino acid sequences of Table 4.
  • a multispecific (e.g., bispecific) antibody disclosed herein comprises a CD47 binding domain that comprises the VH and VL amino acid sequences of Table 2 and a PD-L1 binding domain that comprises the VH and VL amino acid sequences of Table 5.
  • a multispecific (e.g., bispecific) antibody disclosed herein comprises a CD47 binding domain that comprises the VH and VL amino acid sequences of Table 2 and a PD-L1 binding domain that comprises the VH and VL amino acid sequences of Table 6.
  • a multispecific (e.g., bispecific) antibody disclosed herein comprises a CD47 binding domain that comprises the VH and VL amino acid sequences of Table 3 and a PD-L1 binding domain that comprises the VH and V L amino acid sequences of Table 4.
  • a multispecific (e.g., bispecific) antibody disclosed herein comprises a CD47 binding domain that comprises the VH and VL amino acid sequences of Table 3 and a PD-L1 binding domain that comprises the VH and VL amino acid sequences of Table 5.
  • a multispecific (e.g., bispecific) antibody disclosed herein comprises a CD47 binding domain that comprises the VH and VL amino acid sequences of Table 3 and a PD-L1 binding domain that comprises the VH and VL amino acid sequences of Table 6.
  • Antibodies that bind CD47 and/or PD-L1 may be obtained by any suitable method, such as (but not limited to) immunization with whole tumor cells comprising CD47 and/or PD-L1 and collection of antibodies, recombinant techniques, or screening libraries of antibodies or antibody fragments using CD47 extracellular domain epitopes or PD-L1 extracellular domain epitopes.
  • Monoclonal antibodies may be generated using a variety of known techniques (see, for example, Coligan et al.
  • One exemplary technique for generating monoclonal antibodies comprises immunizing an animal with a human CD47 antigen and generating a hybridoma from spleen cells taken from the animal.
  • a hybridoma may produce a monoclonal antibody or antibody fragment that binds CD47.
  • One exemplary technique for generating monoclonal antibodies comprises immunizing an animal with a human PD-L1 antigen and generating a hybridoma from spleen cells taken from the animal.
  • a hybridoma may produce a monoclonal antibody or antibody fragment that binds PD-L1.
  • monoclonal antibodies or antibody fragments can be isolated from antibody phage libraries generated using the techniques described in, for example, Antibody Phage Display: Methods and Protocols , P.M. O'Brien and R. Aitken, eds, Humana Press, Totawa N.J., 2002.
  • synthetic antibody clones are selected by screening phage libraries containing phage that display various fragments of antibody variable region (Fv) fused to phage coat protein. Such phage libraries are screened for against the desired antigen. Clones expressing Fv fragments capable of binding to the desired antigen are adsorbed to the antigen and thus separated from the non-binding clones in the library. The binding clones are then eluted from the antigen, and can be further enriched by additional cycles of antigen adsorption/elution.
  • Fv antibody variable region
  • Variable domains can be displayed functionally on phage, either as single-chain Fv (scFv) fragments, in which VH and VL are covalently linked through a short, flexible peptide, or as Fab fragments, in which they are each fused to a constant domain and interact non-covalently, as described, for example, in Winter et al., Ann. Rev. Immunol., 12: 433-455 (1994).
  • scFv single-chain Fv
  • Repertoires of VH and VL genes can be separately cloned by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which can then be searched for antigen-binding clones as described in Winter et al., supra.
  • Libraries from immunized sources provide high-affinity antibodies to the immunogen without the requirement of constructing hybridomas.
  • the naive repertoire can be cloned to provide a single source of human antibodies to a wide range of non-self and also self antigens without any immunization as described by Griffiths et al., EMBO J, 12: 725-734 (1993).
  • naive libraries can also be made synthetically by cloning the unrearranged V-gene segments from stem cells, and using PCR primers containing random sequence to encode the highly variable CDR3 regions and to accomplish rearrangement in vitro as described, for example, by Hoogenboom and Winter, J. Mol. Biol., 227: 381-388 (1992).
  • CD47 e.g., a CD47 polypeptide, fragment or epitope
  • PD-L1 e.g., a PD-L1 polypeptide, fragment or epitope
  • CD47 e.g., a CD47 polypeptide, fragment or epitope
  • PD-L1 e.g., a PD-L1 polypeptide, fragment or epitope
  • CD47 e.g., a CD47 polypeptide, fragment or epitope
  • PD-L1 e.g., a PD-L1 polypeptide, fragment or epitope
  • Multispecific binding agents can be obtained by designing a suitable antigen screening procedure to select for the phage clone of interest followed by construction of a full length multispecific binding agent (e.g., an antibody) clone using VH and/or VL sequences (e.g., the Fv sequences), or various CDR sequences from VH and VL sequences, from the phage clone of interest and suitable constant region (e.g., Fc) sequences described in Kabat et al., Sequences of Proteins of Immunological Interest , Fifth Edition, NIH Publication 91-3242, Bethesda MD (1991), vols. 1-3.
  • VH and/or VL sequences e.g., the Fv sequences
  • suitable constant region e.g., Fc
  • human antibodies that bind CD47 and/or PD-L1 may be generated by any of a number of techniques including, but not limited to, Epstein Barr Virus (EBV) transformation of human peripheral blood cells (e.g., containing B lymphocytes), in vitro immunization of human B cells, fusion of spleen cells from immunized transgenic mice carrying inserted human immunoglobulin genes, isolation from human immunoglobulin V region phage libraries, or other procedures as known in the art and based on the disclosure herein.
  • EBV Epstein Barr Virus
  • human antibodies that bind CD47 and/or PD-L1 may be obtained from transgenic animals that have been engineered to produce specific human antibodies in response to antigenic challenge.
  • International Patent Publication No. WO 98/24893 discloses transgenic animals having a human Ig locus, wherein the animals do not produce functional endogenous immunoglobulins due to the inactivation of endogenous heavy and light chain loci.
  • WO 96/30498 discloses the use of the Cre/Lox system to modify the immunoglobulin locus in a mammal, such as to replace all or a portion of the constant or variable region to form a modified antibody molecule.
  • International Patent Publication No. WO 94/02602 discloses non-human mammalian hosts having inactivated endogenous Ig loci and functional human Ig loci.
  • U.S. Pat. No. 5,939,598 discloses methods of making transgenic mice in which the mice lack endogenous heavy chains, and express an exogenous immunoglobulin locus comprising one or more xenogeneic constant regions.
  • an immune response can be produced to a selected antigenic molecule, and antibody producing cells can be removed from the animal and used to produce hybridomas that secrete human-derived monoclonal antibodies.
  • Immunization protocols, adjuvants, and the like are known in the art, and are used in immunization of, for example, a transgenic mouse as described in International Patent Publication No. WO 96/33735.
  • the monoclonal antibodies can be tested for the ability to inhibit or neutralize the biological activity or physiological effect of the corresponding protein.
  • Humanized antibodies that bind CD47, including human CD47, and one or more targets that are not CD47 (e.g, PD-L1, including human PD-L1).
  • Humanized antibodies of the present disclosure may comprise a first binding domain that binds to CD47 and comprises one or more CDRs as shown in Tables 1-3.
  • Humanized antibodies of the present disclosure may comprise a second binding domain that binds to PD-L1 and comprises one or more CDRs as shown in Tables 4-6.
  • Various methods for humanizing non-human antibodies are known in the art. For example, a humanized antibody can have one or more amino acid residues introduced into it from a source that is non-human.
  • the humanized antibodies are constructed by CDR grafting, in which the amino acid sequences of the six complementarity determining regions (CDRs) of the parent non-human antibody (e.g., rodent) are grafted onto a human antibody framework.
  • CDRs complementarity determining regions
  • Padlan et al. FASEB J. 9:133-139, 1995
  • SDRs specificity determining residues
  • SDR grafting only the SDR residues are grafted onto the human antibody framework (see, e.g., Kashmiri et al., Methods 36: 25-34, 2005).
  • variable domains both light and heavy
  • sequence of the variable domain of a non-human (e.g., rodent) antibody is screened against the entire library of known human variable-domain sequences.
  • the human sequence which is closest to that of the rodent may be selected as the human framework for the humanized antibody (Sims et al. (1993) J. Immunol. 151:2296; Chothia et al. (1987) J. Mol. Biol. 196:901.
  • Another method uses a particular framework derived from the consensus sequence of all human antibodies of a particular subgroup of light or heavy chains.
  • the same framework may be used for several different humanized antibodies (Carter et al. (1992) Proc. Natl. Acad. Sci. USA, 89:4285; Presta et al. (1993) J. Immunol., 151:2623.
  • the framework is derived from the consensus sequences of the most abundant human subclasses, V L 6 subgroup I (V L 6I) and V H subgroup III (V H III).
  • human germ line genes are used at the source of the framework regions.
  • FR homology is irrelevant.
  • the method consists of comparison of the non-human sequence with the functional human germ line gene repertoire. Those genes encoding the same or closely related canonical structures to the murine sequences are then selected. Next, within the genes sharing the canonical structures with the non-human antibody, those with highest homology within the CDRs are chosen as FR donors. Finally, the non-human CDRs are grafted onto these FRs (see, e.g., Tan et al., J. Immunol. 169: 1119-1125, 2002).
  • humanized antibodies are prepared by a process of analysis of the parental sequences and various conceptual humanized products using three-dimensional models of the parental and humanized sequences.
  • Three-dimensional immunoglobulin models are commonly available and are familiar to those skilled in the art.
  • Computer programs are available which illustrate and display probable three-dimensional conformational structures of selected candidate immunoglobulin sequences. These include, for example, WAM (Whitelegg and Rees, Protein Eng. 13: 819-824, 2000), Modeller (Sali and Blundell, J. Mol. Biol.
  • FR residues can be selected and combined from the recipient and import sequences so that the desired antibody characteristic, such as increased affinity for the target antigen(s), is achieved.
  • the hypervariable region residues are directly and most substantially involved in influencing antigen binding.
  • HSC Human String Content
  • Antibody variants may be isolated from phage, ribosome and yeast display libraries as well as by bacterial colony screening (see, e.g., Hoogenboom, Nat. Biotechnol. 23: 1105-1116, 2005; Dufner et al., Trends Biotechnol. 24: 523-529, 2006; Feldhaus et al., Nat. Biotechnol. 21: 163-70, 2003; Schlapschy et al., Protein Eng. Des. Sel. 17: 847-60, 2004).
  • residues to be substituted may include some or all of the “Vernier” residues identified as potentially contributing to CDR structure (see, e.g., Foote and Winter, J. Mol. Biol. 224: 487-499, 1992), or from the more limited set of target residues identified by Baca et al. ( J. Biol. Chem. 272: 10678-10684, 1997).
  • FR shuffling whole FRs are combined with the non-human CDRs instead of creating combinatorial libraries of selected residue variants (see, e.g., Dall'Acqua et al., Methods 36: 43-60, 2005).
  • the libraries may be screened for binding in a two-step selection process, first humanizing VL, followed by VH.
  • a one-step FR shuffling process may be used.
  • Such a process has been shown to be more efficient than the two-step screening, as the resulting antibodies exhibited improved biochemical and physico-chemical properties including enhanced expression, increased affinity and thermal stability (see, e.g., Damschroder et al., Mol. Immunol. 44: 3049-60, 2007).
  • the “humaneering” method is based on experimental identification of essential minimum specificity determinants (MSDs) and is based on sequential replacement of non-human fragments into libraries of human FRs and assessment of binding. It begins with regions of the CDR3 of non-human VH and VL chains and progressively replaces other regions of the non-human antibody into the human FRs, including the CDR1 and CDR2 of both VH and VL. This methodology typically results in epitope retention and identification of antibodies from multiple sub-classes with distinct human V-segment CDRs. Humaneering allows for isolation of antibodies that are 91-96% homologous to human germ line gene antibodies. (see, e.g., Alfenito, Cambridge Healthtech Institute's Third Annual PEGS, The Protein Engineering Summit, 2007).
  • the “human engineering” method involves altering an non-human antibody or antibody fragment, such as a mouse or chimeric antibody or antibody fragment, by making specific changes to the amino acid sequence of the antibody so as to produce a modified antibody with reduced immunogenicity in a human that nonetheless retains the desirable binding properties of the original non-human antibodies.
  • the technique involves classifying amino acid residues of a non-human (e.g., mouse) antibody as “low risk”, “moderate risk”, or “high risk” residues. The classification is performed using a global risk/reward calculation that evaluates the predicted benefits of making particular substitution (e.g., for immunogenicity in humans) against the risk that the substitution will affect the resulting antibody's folding and/or are substituted with human residues.
  • the particular human amino acid residue to be substituted at a given position (e.g., low or moderate risk) of a non-human (e.g., mouse) antibody sequence can be selected by aligning an amino acid sequence from the non-human antibody's variable regions with the corresponding region of a specific or consensus human antibody sequence.
  • the amino acid residues at low or moderate risk positions in the non-human sequence can be substituted for the corresponding residues in the human antibody sequence according to the alignment.
  • a multispecific binding agent described herein comprises a non-antibody protein scaffold.
  • a non-antibody protein scaffold include a fibronectin scaffold, an anticalin, an adnectin, an affibody, a DARPin, a fynomer, an affitin, an affilin, an avimer, a cysteine-rich knottin peptide, or an engineered Kunitz-type inhibitor.
  • non-antibody protein scaffolds are well known in the art, any one of which can be used to generate a multispecific binding agent comprising a non-antibody protein scaffold (see, e.g., Simeon and Chen, Protein Cell, 9(1):3-14 (2016); Yang et al., Annu Rev Anal Chem (Palo Alto Calif). 10(1):293-320 (2017)).
  • an isolated cell may produce a multispecific binding agent (e.g., antibody or antibody fragment).
  • a cell e.g., an isolated cell
  • a cell may produce an antibody or fragment thereof comprising a first binding domain comprising a VH and a VL as shown in Table 1, 2, or 3 for C40, C56, or C59, respectively.
  • a cell e.g., an isolated cell
  • polynucleotides described herein may comprise one or more nucleic acid sequences encoding the multispecific binding agent (e.g., antibody or antibody fragment).
  • the polynucleotide is an isolated and/or recombinant polynucleotide.
  • the isolated polynucleotide comprises a nucleotide sequence that encodes an antibody heavy chain variable region (VH) and/or an antibody light chain variable region (VL), wherein the VH and the V L comprise complementarity determining regions (CDRs) identical to CDRs as shown in Table 1, CDRs as shown in Table 2, or CDRs as shown in Table 3.
  • the isolated polynucleotide comprises a nucleotide sequence that encodes an antibody heavy chain variable region (VH) and/or an antibody light chain variable region (VL), wherein the VH and the VL comprise complementarity determining regions (CDRs) identical to CDRs as shown in Table 4, CDRs as shown in Table 5, or CDRs as shown in Table 6.
  • VH antibody heavy chain variable region
  • VL antibody light chain variable region
  • CDRs complementarity determining regions
  • one or more vectors may comprise one or more polynucleotides for expression of the one or more polynucleotides in a suitable host cell.
  • Such vectors are useful, e.g., for amplifying the polynucleotides in host cells to create useful quantities thereof, and for expressing binding agents, such as antibodies or antibody fragments, using recombinant techniques.
  • one or more vectors are expression vectors wherein one or more polynucleotides are operatively linked to one or more polynucleotides comprising expression control sequences.
  • Autonomously replicating recombinant expression constructs such as plasmid and viral DNA vectors incorporating one or more polynucleotides encoding antibody sequences that bind CD47 are specifically contemplated.
  • Expression control DNA sequences include promoters, enhancers, and operators, and are generally selected based on the expression systems in which the expression construct is to be utilized. Promoter and enhancer sequences are generally selected for the ability to increase gene expression, while operator sequences are generally selected for the ability to regulate gene expression.
  • Expression constructs may also include sequences encoding one or more selectable markers that permit identification of host cells bearing the construct. Expression constructs may also include sequences that facilitate, and preferably promote, homologous recombination in a host cell. In some embodiments, expression constructs of the can also include sequences necessary for replication in a host cell.
  • Exemplary expression control sequences include promoter/enhancer sequences, e.g., cytomegalovirus promoter/enhancer (Lehner et al., J. Clin. Microbiol., 29: 2494-2502, 1991; Boshart et al., Cell, 41: 521-530, 1985); Rous sarcoma virus promoter (Davis et al., Hum. Gene Ther., 4: 151, 1993); Tie promoter (Korhonen et al., Blood, 86(5): 1828-1835, 1995); simian virus 40 promoter; DRA (downregulated in adenoma; Alrefai et al., Am. J. Physiol. Gastrointest.
  • promoter/enhancer sequences e.g., cytomegalovirus promoter/enhancer (Lehner et al., J. Clin. Microbiol., 29: 2494-2502, 1991; Boshart et al.
  • the promoter is an epithelial-specific promoter or endothelial-specific promoter.
  • Polynucleotides may also optionally include a suitable polyadenylation sequence (e.g., the SV40 or human growth hormone gene polyadenylation sequence) operably linked downstream (e.g., 3′) of the polypeptide coding sequence.
  • a suitable polyadenylation sequence e.g., the SV40 or human growth hormone gene polyadenylation sequence
  • operably linked downstream e.g., 3′
  • the one or more polynucleotides also optionally comprise nucleotide sequences encoding secretory signal peptides fused in frame with the polypeptide sequences.
  • the secretory signal peptides direct secretion of the antibody polypeptides by the cells that express the one or more polynucleotides, and are cleaved by the cell from the secreted polypeptides.
  • the one or more polynucleotides may further optionally comprise sequences whose only intended function is to facilitate large scale production of the vector.
  • polynucleotides may further comprise additional sequences to facilitate uptake by host cells and expression of the antibody or fragment thereof (and/or any other peptide).
  • a “naked” transgene encoding an antibody or fragment thereof described herein e.g., a transgene without a viral, liposomal, or other vector to facilitate transfection is employed.
  • Any suitable vectors may be used to introduce one or more polynucleotides that encode an antibody or fragment thereof into the host.
  • Exemplary vectors that have been described include replication deficient retroviral vectors, including but not limited to lentivirus vectors (Kim et al., J. Virol., 72(1): 811-816, 1998; Kingsman & Johnson, Scrip Magazine, October, 1998, pp. 43-46); parvoviral vectors, such as adeno-associated viral (AAV) vectors (U.S. Pat. Nos.
  • AAV adeno-associated viral
  • any of these expression vectors can be prepared using standard recombinant DNA techniques described in, e.g., Sambrook et al., Molecular Cloning, a Laboratory Manual, 2d edition, Cold Spring Harbor Press, Cold Spring Harbor, N.Y. (1989), and Ausubel et al., Current Protocols in Molecular Biology , Greene Publishing Associates and John Wiley & Sons, New York, N.Y. (1994).
  • viral vectors are rendered replication-deficient by, e.g., deleting or disrupting select genes required for viral replication.
  • Non-viral delivery mechanisms contemplated include calcium phosphate precipitation (Graham and Van Der Eb, Virology, 52: 456-467, 1973; Chen and Okayama, Mol. Cell Biol., 7: 2745-2752, 1987; Rippe et al., Mol. Cell Biol., 10: 689-695, 1990) DEAE-dextran (Gopal, Mol. Cell Biol., 5: 1188-1190, 1985), electroporation (Tur-Kaspa et al., Mol. Cell Biol., 6: 716-718, 1986; Potter et al., Proc. Nat. Acad. Sci. USA, 81: 7161-7165, 1984), direct microinjection (Harland and Weintraub, J.
  • an expression vector (or the antibody or fragment thereof discussed herein) may be entrapped in a liposome. See, e.g., Ghosh and Bachhawat, In: Liver diseases, targeted diagnosis and therapy using specific receptors and ligands, Wu G, Wu C ed., New York: Marcel Dekker, pp. 87-104 (1991); Radler et al., Science, 275(5301): 810-814, 1997). Also contemplated are various commercial approaches involving “lipofection” technology.
  • the liposome may be complexed with a hemagglutinating virus (HVJ).
  • HVJ hemagglutinating virus
  • the liposome is complexed or employed in conjunction with nuclear nonhistone chromosomal proteins (HMG-1) (Kato et al., J. Biol. Chem., 266: 3361-3364, 1991).
  • HMG-1 nuclear nonhistone chromosomal proteins
  • the liposome are complexed or employed in conjunction with both HVJ and HMG-1.
  • a multispecific binding agent e.g., an antibody
  • a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 e.g., PD-L1, including human PD-L1
  • PD-L1 e.g., PD-L1
  • PD-L1 e.g., PD-L1
  • PD-L1 e.g., tumor cells
  • a cell may comprise one or more polynucleotides or one or more vectors, e.g., the cell is transformed or transfected with one or more polynucleotides encoding a multispecific binding agent (e.g., an antibody), including a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), or the one or more vectors comprising the one or more polynucleotides.
  • a multispecific binding agent e.g., an antibody
  • targets e.g., PD-L1, including human PD-L1
  • cells express a multispecific binding agent, including a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), having at least 75% identity to the CDRs of C40 (see, e.g., Table 1).
  • cells express a multispecific binding agent, including a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), having at least 75% identity to the CDRs of C56 (see, e.g., Table 2).
  • cells express a multispecific binding agent, including a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), having at least 75% identity to the CDRs of C59 (see, e.g., Table 3).
  • cells express a multispecific binding agent, including a multispecific binding agent that binds to CD47, including human CD47, and PD-L1, including human PD-L1, having at least 75% identity to the CDRs of P22 (see, e.g., Table 4).
  • cells express a multispecific binding agent, including a multispecific binding agent that binds to CD47, including human CD47, and PD-L1, including human PD-L1, having at least 75% identity to the CDRs of P24 (see, e.g., Table 5).
  • cells express a multispecific binding agent, including a multispecific binding agent that binds to CD47, including human CD47, and PD-L1, including human PD-L1, having at least 75% identity to the CDRs of P31.2 (see, e.g., Table 6).
  • the cells may be prokaryotic cells, such as Escherichia coli (see, e.g., Pluckthun et al., Methods Enzymol., 178: 497-515, 1989), or eukaryotic cells, such as an animal cell (e.g., a myeloma cell, Chinese Hamster Ovary (CHO) cell, or hybridoma cell), yeast (e.g., Saccharomyces cerevisiae ), or a plant cell (e.g., a tobacco, corn, soybean, or rice cell).
  • prokaryotic cells such as Escherichia coli (see, e.g., Pluckthun et al., Methods Enzymol., 178: 497-515, 1989)
  • eukaryotic cells such as an animal cell (e.g., a myeloma cell, Chinese Hamster Ovary (CHO) cell, or hybridoma cell), yeast (e.g., Saccharomy
  • mammalian host cells may provide for translational modifications (e.g., glycosylation, truncation, lipidation, and phosphorylation) that may be desirable to confer optimal biological activity on recombinant expression products.
  • polypeptides e.g., multispecific binding agents (e.g., antibodies, such as bispecific antibodies), including multispecific binding agents that bind to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1)) may be glycosylated or non-glycosylated and/or have been covalently modified to include one or more water soluble polymer attachments such as polyethylene glycol, polyoxyethylene glycol, or polypropylene glycol.
  • Methods for introducing DNA or RNA into host cells are well known and include transformation, transfection, electroporation, nuclear injection, or fusion with carriers such as liposomes, micelles, ghost cells, and protoplasts.
  • host cells are useful for amplifying polynucleotides and also for expressing polypeptides encoded by the polynucleotides.
  • a process for the production of a multispecific binding agent may comprise culturing a host cell and isolating the multispecific binding agent.
  • Transferring a naked DNA expression construct into cells can be accomplished using particle bombardment, which depends on the ability to accelerate DNA coated microprojectiles to a high velocity allowing them to pierce cell membranes and enter cells without killing them (Klein et al., Nature, 327: 70-73, 1987).
  • particle bombardment depends on the ability to accelerate DNA coated microprojectiles to a high velocity allowing them to pierce cell membranes and enter cells without killing them.
  • Several devices for accelerating small particles have been developed. One such device relies on a high voltage discharge to generate an electrical current, which in turn provides the motive force (Yang et al., Proc. Natl. Acad. Sci USA, 87: 9568-9572, 1990).
  • the microprojectiles used have consisted of biologically inert substances such as tungsten or gold beads.
  • a host cell may be isolated and/or purified.
  • a host cell also may be a cell transformed in vivo to cause transient or permanent expression of the polypeptide in vivo.
  • a host cell may also be an isolated cell transformed ex vivo and introduced post-transformation, e.g., to produce the polypeptide in vivo for therapeutic purposes.
  • the definition of host cell explicitly excludes a transgenic human being.
  • a multispecific binding agent (e.g., an antibody), including a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), is produced using any suitable method, e.g., isolated from an immunized animal, recombinantly or synthetically generated, or genetically-engineered, including as described above.
  • Antibody fragments derived from an antibody are obtained by, e.g., proteolytic hydrolysis of an antibody. For example, papain or pepsin digestion of whole antibodies yields a 5S fragment termed F(ab′)2 or two monovalent Fab fragments and an Fc fragment, respectively.
  • F(ab)2 can be further cleaved using a thiol reducing agent to produce 3.5S Fab monovalent fragments.
  • Methods of generating antibody fragments are further described in, for example, Edelman et al., Methods in Enzymology, 1: 422 Academic Press (1967); Nisonoff et al., Arch. Biochem. Biophys., 89: 230-244, 1960; Porter, Biochem. J., 73: 119-127, 1959; U.S. Pat. No. 4,331,647; and by Andrews, S. M. and Titus, J. A. in Current Protocols in Immunology (Coligan et al., eds), John Wiley & Sons, New York (2003), pages 2.8.1 2.8.10 and 2.10A.1 2.10A.5.
  • a multispecific binding agent (e.g., an antibody), including a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), can be genetically engineered.
  • a multispecific binding agent e.g., an antibody
  • including a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 comprises, for example, a variable region domain generated by recombinant DNA engineering techniques.
  • variable region is optionally modified by insertions, deletions, or changes in the amino acid sequence of the antibody to produce an antibody of interest, including as described above.
  • Polynucleotides encoding complementarity determining regions (CDRs) of interest are prepared, for example, by using polymerase chain reaction to synthesize variable regions using mRNA of antibody producing cells as a template (see, for example, Courtenay Luck, “Genetic Manipulation of Monoclonal Antibodies,” in Monoclonal Antibodies: Production, Engineering and Clinical Application , Ritter et al.
  • Humanized antibodies are antibodies in which CDRs of heavy and light variable chains of non-human immunoglobulins are transferred into a human variable domain. Constant regions need not be present, but if they are, they optionally are substantially identical to human immunoglobulin constant regions, e.g., at least about 85-90%, about 95%, 96%, 97%, 98%, 99% or more identical, in some embodiments. Hence, in some instances, all parts of a humanized immunoglobulin, except possibly the CDRs, are substantially identical to corresponding parts of natural human immunoglobulin sequences.
  • humanized antibodies are human immunoglobulins (e.g., host antibody) in which hypervariable region residues of the host antibody are replaced by hypervariable region residues from a non-human species (donor antibody) such as mouse, rat, rabbit, or a non-human primate having the desired specificity, affinity, and capacity.
  • donor antibody e.g., mouse, rat, rabbit, or a non-human primate having the desired specificity, affinity, and capacity.
  • multispecific binding agents e.g., antibodies
  • multispecific binding agents that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1) described herein are useful in compositions and in methods of treating, preventing, or alleviating an immune cell dysfunctional disease, disorder or condition (e.g., a phagocytic cell dysfunctional disease, disorder, or condition or a T cell dysfunctional disease, disorder or condition), including one or more symptoms of the disease, disorder, or condition.
  • Phagocytic cell dysfunctional diseases, disorders, and conditions include tumor immunity and associated cancers, including, but not limited to, any cancer wherein the tumor cells overexpress CD47.
  • T cell dysfunctional diseases, disorders, and conditions include tumor immunity and associated cancers, including, but not limited to, any cancer wherein the tumor cells express or overexpress PD-L1.
  • Such CD47 and/or PD-L1 expressing tumor cells may help tumor cells escape immune surveillance and clearance (e.g., tumor immunity).
  • multispecific binding agents described herein such as multispecific antibodies (e.g., antibodies, such as bispecific antibodies), that bind to CD47 and one or more additional targets that are not CD47 (e.g., PD-L1), are useful to inhibit SIRP ⁇ signaling and/or PD-1 signaling, enhance phagocytic cell function and/or immune surveillance, and enhance removal of tumor cells.
  • described herein is a method for treating tumor immunity in a subject comprising administering to the subject a multispecific binding agent (e.g., an antibody), including a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), described herein or fragment thereof or a pharmaceutical composition comprising the binding agent (e.g., antibody) described herein.
  • a multispecific binding agent e.g., an antibody
  • a multispecific binding agent that binds to CD47, including human CD47
  • targets that are not CD47 e.g., PD-L1, including human PD-L1
  • a pharmaceutical composition comprising the binding agent (e.g., antibody) described herein.
  • described herein is a method for treating a cancer or a tumor in a subject comprising administering to the subject a multispecific binding agent (e.g., an antibody), including a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), described herein or fragment thereof or a pharmaceutical composition comprising the binding agent (e.g., antibody) described herein.
  • a multispecific binding agent e.g., an antibody
  • a multispecific binding agent that binds to CD47, including human CD47
  • targets that are not CD47 e.g., PD-L1, including human PD-L1
  • a pharmaceutical composition comprising the binding agent (e.g., antibody) described herein.
  • described herein is a method for alleviating one or more symptoms associated with a cancer or a tumor in a subject comprising administering to the subject a multispecific binding agent (e.g., an antibody), including a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), described herein or fragment thereof or a pharmaceutical composition comprising the binding agent (e.g., antibody) described herein.
  • a multispecific binding agent e.g., an antibody
  • described herein is a method for decreasing tumor size in a subject with a tumor comprising administering to the subject a multispecific binding agent (e.g., an antibody), including a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), described herein or fragment thereof or a pharmaceutical composition comprising the binding agent (e.g., an antibody) described herein.
  • a multispecific binding agent e.g., an antibody
  • described herein is a method for enhancing tumor cell removal in a subject with a tumor comprising administering to the subject a multispecific binding agent (e.g., an antibody), including a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), described herein or fragment thereof or a pharmaceutical composition comprising the binding agent (e.g., an antibody) described herein.
  • a multispecific binding agent e.g., an antibody
  • described herein is a method for treating a phagocytic cell dysfunctional disease, disorder or condition in a subject comprising administering to the subject a multispecific binding agent (e.g., an antibody), including a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), described herein or fragment thereof or a pharmaceutical composition comprising the binding agent (e.g., an antibody) described herein.
  • a multispecific binding agent e.g., an antibody
  • described herein is a method for increasing immune cell phagocytosis in a subject comprising administering to the subject a multispecific binding agent (e.g., an antibody), including a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), described herein or fragment thereof or a pharmaceutical composition comprising the binding agent (e.g., an antibody) described herein.
  • the immune cell is a macrophage, a neutrophil, a dendritic cell, or a B lymphocyte.
  • the subject is diagnosed with a cancer or a tumor.
  • described herein is a method for treating a T cell dysfunctional disease, disorder or condition in a subject comprising administering to the subject a multispecific binding agent (e.g., an antibody), including a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), described herein or fragment thereof or a pharmaceutical composition comprising the binding agent (e.g., an antibody) described herein.
  • the T cell dysfunctional disease, disorder or condition is tumor immunity.
  • described herein is a method for enhancing T cell function in a subject comprising administering to the subject a multispecific binding agent (e.g., an antibody), including a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), described herein or fragment thereof or a pharmaceutical composition comprising the binding agent (e.g., an antibody) described herein.
  • the T cell function is secretion of cytokines.
  • the T cell function is removal of tumor cells.
  • the subject is diagnosed with a cancer or a tumor.
  • the subject of a method described above can be administered one or more therapeutic agents described herein in combination with a multispecific binding agent (e.g., an antibody), including a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), described herein or fragment thereof or a pharmaceutical composition comprising the binding agent (e.g., an antibody) described herein.
  • a multispecific binding agent e.g., an antibody
  • the antibody is a human antibody, including, but not limited to, an antibody having variable regions in which both the framework and CDR regions are derived from human germ line immunoglobulin sequences as described, for example, in Kabat et al. (1991) Sequences of proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242. If the antibody contains a constant region, the constant region also preferably is derived from human germline immunoglobulin sequences.
  • Human antibodies may comprise amino acid residues not encoded by human germline immunoglobulin sequences, for example, to enhance the activity of the antibody, but do not comprise CDRs derived from other species (e.g., a mouse CDR placed within a human variable framework region).
  • a multispecific binding agent e.g., an antibody
  • a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 increases phagocytosis and/or enhances phagocytic activity of cells in cell culture.
  • such cell culture may include tumor cells expressing or overexpressing CD47.
  • a multispecific binding agent e.g., an antibody
  • Such cell culture may include tumor cells expressing or overexpressing PD-L1.
  • a multispecific binding agent e.g., an antibody
  • a multispecific binding agent that binds to CD47, including human CD47, and PD-L1, including human PD-L1 increases phagocytosis, enhances phagocytic activity, increases T cell function and/or enhances cytolytic activity of cells in cell culture.
  • Such cell culture may include tumor cells expressing or overexpressing CD47 and PD-L1.
  • Tumor cells include, but are not limited to, breast cancer cells, bladder cancer cells, melanoma cells, prostate cancer cells, mesothelioma cells, lung cancer cells, testicular cancer cells, thyroid cancer cells, squamous cell carcinoma cells, glioblastoma cells, neuroblastoma cells, uterine cancer cells, colorectal cancer cells, and pancreatic cancer cells.
  • the method comprises administering an amount of a multispecific binding agent (e.g., an antibody) such as a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1) described herein effective to inhibit proliferation of the tumor cells.
  • a multispecific binding agent e.g., an antibody
  • targets that are not CD47 e.g., PD-L1, including human PD-L1
  • the method includes administering a multispecific binding agent (e.g., an antibody) that competes for binding with antibody C40, antibody C56, and/or antibody C59 (see, e.g., CDRs and VH/VL of Tables 1, 2 and/or 3), to human CD47 and/or binds the region of a CD47 recognized by antibody C40, antibody C56, and/or antibody C59 (see, e.g., CDRs and VH/VL of Tables 1, 2 and/or 3), resulting in resulting in enhancement of the removal of tumor cells.
  • a multispecific binding agent e.g., an antibody
  • an antibody C59 see, e.g., CDRs and VH/VL of Tables 1, 2 and/or 3
  • the method includes administering a multispecific binding agent (e.g., an antibody) that competes for binding with antibody P22, antibody P24, and/or antibody P31.2 (see, e.g., CDRs and VH/VL of Tables 4, 5 and/or 6), to human PD-L1 and/or binds the region of a PD-L1 recognized by antibody P22, antibody P24, and/or antibody P31.2 (see, e.g., CDRs and VH/VL of Tables 4, 5 and/or 6), resulting in resulting in enhancement of the removal of tumor cells.
  • a multispecific binding agent e.g., an antibody
  • a multispecific binding agent e.g., an antibody
  • a multispecific binding agent e.g., an antibody
  • a multispecific binding agent e.g., an antibody
  • a multispecific binding agent e.g., an antibody
  • a multispecific binding agent e.g., an antibody
  • a method of modulating e.g., inhibiting, reducing, preventing
  • the method comprises administering to the subject a composition comprising a multispecific binding agent (e.g., an antibody) in an amount effective to modulate tumor growth in the subject.
  • a multispecific binding agent e.g., an antibody
  • Tumor refers to any neoplastic cell growth or proliferation, whether malignant or benign, and to all pre-cancerous and cancerous cells and tissues.
  • cancer and “cancerous” refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth.
  • cancers include, but are not limited to: breast cancer, colon cancer, renal cancer, lung cancer, squamous cell myeloid leukemia, hemangiomas, melanomas, astrocytomas, and glioblastomas as well as other cellular-proliferative disease states, including but not limited to: Cardiac: sarcoma (angiosarcoma, fibrosarcoma, rhabdomyosarcoma, liposarcoma), myxoma, rhabdomyoma, fibroma, lipoma and teratoma; Lung: bronchogenic carcinoma (squamous cell, undifferentiated small cell, undifferentiated large cell, adenocarcinoma), alveolar (bronchiolar) carcinoma, bronchial adenoma, sarcoma, lymphoma, chondromatous hanlartoma, inesothelioma; Gastrointestinal: esophagus
  • a method of treating cancer by administering a multispecific binding agent (e.g., an antibody) such as a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1), to a subject in need thereof, alone or in combination with another agent.
  • a multispecific binding agent e.g., an antibody
  • a multispecific binding agent e.g., an antibody
  • targets that are not CD47 e.g., PD-L1, including human PD-L1
  • “Enhancing” tumor cell removal does not require a 100% enhancement of removal. Any enhancement in the rate of removal is contemplated.
  • “modulating” tumor growth refers to reducing the size of the tumor, slowing tumor growth, or inhibiting an increase in the size of an existing tumor. Complete abolition of a tumor is not required; any decrease in tumor size or slowing of tumor growth constitutes a beneficial biological effect in a subject.
  • tumor cell removal may be enhanced by, for example, at least about 5%, at least about 10% or at least about 20% compared to levels of removal observed in the absence of the method (e.g., in a biologically-matched control subject or specimen that is not exposed to the agent of the method).
  • the effect is detected by, for example, a reduction in tumor size, a decrease or maintenance of the levels of tumor markers, or reduction or maintenance of a tumor cell population.
  • removal of tumor cells is enhanced by, for example, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or more (about 100%) compared to the removal of tumor cells in the absence of a multispecific binding agent (e.g., an antibody) of the method.
  • a multispecific binding agent e.g., an antibody
  • multispecific binding agents may be used to alleviate or reduce side effects associated with cancer such as, for example, bone deterioration, vertebral collapse, and paralysis.
  • a multispecific binding agent e.g., an antibody
  • a multispecific binding agent prevents bone deterioration due to bone metastases, wherein tumor cell proliferation is or is not reduced.
  • a multispecific binding agent e.g., an antibody both prevents bone deterioration due to bone metastases and reduces tumor cell proliferation.
  • the effect on tumor cell proliferation depends on the microenvironment of a particular metastasis.
  • proliferation of metastases located in microenvironments with substantial amounts of type 1 collagen may be inhibited.
  • proliferation of metastases located in microenvironments lacking substantial amounts of type 1 collagen may not be inhibited, yet bone deterioration in the vicinity of the metastasis is reduced or prevented.
  • a particular administration regimen of a multispecific binding agent (e.g., an antibody) for a particular subject will depend, in part, upon the agent used, the amount of agent administered, the route of administration, and the cause and extent of any side effects.
  • the amount of agent (e.g., an antibody) administered to a subject should be sufficient to effect the desired response over a reasonable time frame.
  • the amount of a multispecific binding agent (e.g., an antibody) or pharmaceutical composition described herein administered to a subject is an effective amount.
  • the amount of a multispecific binding agent (e.g., an antibody) or pharmaceutical composition described herein administered to a subject is a therapeutically effective amount.
  • the method comprises administering, e.g., from about 0.1 ⁇ g/kg to up to about 100 mg/kg or more.
  • the dosage ranges from about 1 ⁇ g/kg up to about 100 mg/kg; or about 5 ⁇ g/kg up to about 100 mg/kg; or about 10 ⁇ g/kg up to about 100 mg/kg; or about 1 mg/kg up to about 50 mg/kg; or about 2 mg/kg up to about 30 mg/kg; or about 3 mg/kg up to about 25 mg/kg; or about 3 mg/kg up to about 25 mg/kg; or about 5 mg/kg up to about 10 mg/kg; or about 10 mg/kg up to about 20 mg/kg; or about 10 mg/kg up to about 30 mg/kg.
  • Some conditions or disease states require prolonged treatment, which may or may not entail administering doses of multispecific binding agents (e.g., antibodies, such as bispecific antibodies), including multispecific binding agents that bind to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1) (e.g., antibodies, such as bispecific antibodies), over multiple administrations (e.g., every day, three times a week, once a week, once every two weeks, or once every month for a treatment period of three days, seven days, two weeks, three weeks, one month, three months, six months, nine months, 12 months, 15 months, 18 months, 21 months, two years, or more).
  • multispecific binding agents e.g., antibodies, such as bispecific antibodies
  • Suitable routes of administering a composition comprising a multispecific binding agent e.g., an antibody
  • a multispecific binding agent e.g., an antibody
  • a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 e.g., PD-L1, including human PD-L1
  • targets that are not CD47 e.g., PD-L1, including human PD-L1
  • a particular route can provide a more immediate and more effective reaction than another route.
  • a composition comprising a multispecific binding agent (e.g., an antibody) such as a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1) is applied or instilled into body cavities, absorbed through the skin or mucous membranes, ingested, inhaled, and/or introduced into circulation.
  • a multispecific binding agent e.g., an antibody
  • targets that are not CD47 e.g., PD-L1, including human PD-L1
  • a composition comprising a multispecific binding agent (e.g., an antibody) such as a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1)
  • a multispecific binding agent e.g., an antibody
  • a multispecific binding agent that binds to CD47, including human CD47
  • targets that are not CD47 e.g., PD-L1, including human PD-L1
  • a multispecific binding agent e.g., an antibody
  • a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 is administered regionally via intraarterial or intravenous administration feeding the region of interest, e.g., via the hepatic artery for delivery to the liver.
  • a multispecific binding agent e.g., an antibody
  • a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 is administered locally via implantation of a membrane, sponge, or another appropriate material on to which the binding agent has been absorbed or encapsulated.
  • the device is, one aspect, implanted into any suitable tissue or organ, and delivery of a multispecific binding agent (e.g., an antibody) such as a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1) is, for example, via diffusion, timed-release bolus, or continuous administration.
  • a multispecific binding agent e.g., an antibody
  • a multispecific binding agent such as a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1)
  • the multispecific binding agent is administered directly to exposed tissue during tumor resection or other surgical procedures.
  • compositions such as pharmaceutical composition, comprising a multispecific binding agent (e.g., an antibody) such as a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1) and a carrier (e.g., a pharmaceutically acceptable carrier).
  • a multispecific binding agent e.g., an antibody
  • targets e.g., PD-L1, including human PD-L1
  • a carrier e.g., a pharmaceutically acceptable carrier.
  • the particular carrier employed may depend on chemico-physical considerations, such as solubility and lack of reactivity with the binding agent or co-therapy, and by the route of administration.
  • Pharmaceutically acceptable carriers are well-known in the art, examples of which are described herein.
  • Illustrative pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions.
  • injectable formulations are further described in, e.g., Pharmaceutics and Pharmacy Practice , J. B. Lippincott Co., Philadelphia. Pa., Banker and Chalmers. eds., pages 238-250 (1982), and ASHP Handbook on Injectable Drugs , Toissel, 4th ed., pages 622-630 (1986)).
  • a pharmaceutical composition comprising a multispecific binding agent (e.g., an antibody) such as a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1) is, in one aspect, placed within containers, along with packaging material that provides instructions regarding the use of such pharmaceutical compositions.
  • a multispecific binding agent e.g., an antibody
  • targets that are not CD47 e.g., PD-L1, including human PD-L1
  • such instructions include a tangible expression describing the reagent concentration, as well as, in some embodiments, relative amounts of excipient ingredients or diluents (e.g., water, saline or PBS) that may be necessary to reconstitute the pharmaceutical composition.
  • a method described herein further comprises administering one or more additional agents, including therapeutic agents (e.g., combination therapy), which may be present in a composition or may be administered with a multispecific binding agent (e.g., an antibody) such as a multispecific binding agent that binds to CD47, including human CD47, and one or more targets that are not CD47 (e.g., PD-L1, including human PD-L1) or provided in a separate composition using the same or a different route of administration.
  • the one or more additional agents, including therapeutic agents may be administered together or separately (e.g., simultaneously, alternatively, sequentially) with a multispecific binding agent (e.g., an antibody).
  • additional therapeutic agents include, but are not limited to, therapeutic antibodies, immunotherapies, cytotoxic agents, chemotherapeutic agents, and inhibitors.
  • Therapeutic antibodies that can be used include, but are not limited to, trastuzumab; abciximab; daclizumab; BEC2; IMC-C22; vitaxin; Campath 1H/LDP-03; Smart M195; epratuzumab; bectumomab; visilizumab; CM3, a humanized anti-ICAM3 antibody; IDEC-114; ibritumomab tiuxetan; IDEC-131; IDEC-151; IDEC-152; SMART anti-CD3; eculizumab; adalimumab; certolizumab; IDEC-151; MDX-CD4; CD20-sreptdavidin; CDP571; LDP-02; OrthoClone OKT4A; ruplizumab; natalizumab; and lerdelimumab.
  • Immunotherapies that can be used include, but are not limited to, cytokines, such as granulocyte-macrophage colony-stimulating factor (GM-CSF), granulocyte-colony stimulating factor (G-CSF), macrophage inflammatory protein (MIP)-1-alpha, interleukins (including IL-I, IL-2, IL-4, IL-6, IL-7, IL-12, IL-15, IL-18, IL-21, and IL-27), tumor necrosis factors (including TNF-alpha), and interferons (including IFN-alpha, IFN-beta, and IFN-gamma); aluminum hydroxide (alum); Bacille Calmette-Guerin (BCG); Keyhole limpet hemocyanin (KLH); Incomplete Freund's adjuvant (IF A); QS-21; DETOX; Levamisole; and Dinitrophenyl (DNP), and combinations thereof, such as, for example, combinations of, interleukins
  • the immunotherapy includes an immunotherapeutic agent that modulates immune responses, for example, a checkpoint inhibitor or a checkpoint agonist.
  • the immunotherapeutic agent is an antibody modulator that targets PD-1, PD-L1, PD-L2, CEACAM (e g., CEACAM-I, -3 and/or -5), CTLA-4, TIM-3, LAG-3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4, TGF beta, OX40, 41136, LIGHT, CD40, GITR, TGF-beta, TIM-3, SIRP-alpha, VSIG8, BTLA, SIGLEC7, SIGLEC9, ICOS, B7H3, B7H4, FAS, and/or BTNL2 among others known in the art.
  • the immunotherapeutic agent is an agent that increases natural killer (NK) cell activity, inhibits suppression of an immune response, inhibits suppressor cells or suppressor cell activity, inhibits Treg activity
  • the immunotherapeutic agent includes a T cell modulator chosen from an agonist or an activator of a costimulatory molecule.
  • the agonist of the costimulatory molecule is chosen from an agonist (e.g., an agonistic antibody or antigen-binding fragment thereof, or a soluble fusion) of GITR, OX40, ICOS, SLAM (e.g., SLAMF7), HVEM, LIGHT, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CD1 la/CD18), ICOS (CD278), 4-1BB (CD137), CD30, CD40, BAFFR, CD7, NKG2C, NKp80, CD160, B7-H3, or CD83 ligand.
  • the effector cell combination includes a bispecific T cell engager (e.g., a bispecific antibody molecule that binds to CD3 and a tumor antigen (e.g., EGFR, PSCA, PSMA, EpCAM, HER2 among others).
  • a bispecific T cell engager e.g., a bispecific antibody molecule that binds to CD3 and a tumor antigen (e.g., EGFR, PSCA, PSMA, EpCAM, HER2 among others).
  • Cytotoxic agents that can be used include a substance that inhibits or prevents a cellular function and/or causes cell death or destruction.
  • exemplary cytotoxic agents include, but are not limited to, radioactive isotopes (e.g., At211, 1131, 1125, Y90, Re186, Re188, Sm153, Bi212, P32, Pb212 and radioactive isotopes of Lu); growth inhibitory agents; enzymes and fragments thereof such as nucleolytic enzymes; and toxins such as small molecule toxins or enzymatically active toxins of bacterial, fungal, plant or animal origin, including fragments and/or variants thereof.
  • radioactive isotopes e.g., At211, 1131, 1125, Y90, Re186, Re188, Sm153, Bi212, P32, Pb212 and radioactive isotopes of Lu
  • growth inhibitory agents e.g., enzymes and fragments thereof such as nucleolytic enzymes
  • toxins such as
  • exemplary cytotoxic agents can be selected from anti-microtubule agents, platinum coordination complexes, alkylating agents, antibiotic agents, topoisomerase II inhibitors, antimetabolites, topoisomerase I inhibitors, hormones and hormonal analogues, signal transduction pathway inhibitors, non-receptor tyrosine kinase angiogenesis inhibitors, immunotherapeutic agents, proapoptotic agents, inhibitors of LDH-A; inhibitors of fatty acid biosynthesis; cell cycle signaling inhibitors; HDAC inhibitors, proteasome inhibitors; and inhibitors of cancer metabolism.
  • Chemotherapeutic agents that can be used include chemical compounds useful in the treatment of cancer.
  • chemotherapeutic agents include, but are not limited to, erlotinib, bortezomib, disulfiram, epigallocatechin gallate, salinosporamide A, carfilzomib, 17-AAG (geldanamycin), radicicol, lactate dehydrogenase A (LDH-A), fulvestrant, sunitib, letrozole, imatinib mesylate, fmasunate, oxaliplatin, 5-FET (5-fluorouracil), leucovorin, Rapamycin, Lapatinib, Lonafamib (SCH 66336), sorafenib, Bayer Labs), gefitinib, AG1478; alkylating agents such as thiotepa and CYTOXAN®; cyclosphosphamide; alkyl sulfonates such as bus
  • dynemicin including dynemicin A; bisphosphonates, such as clodronate; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antibiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, caminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, doxorubicin, morpholino-doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin and deoxydoxorubicin), epirubicin, esorubicin,
  • Chemotherapeutic agent also includes (i) anti-hormonal agents that act to regulate or inhibit hormone action on tumors such as anti-estrogens and selective estrogen receptor modulators (SERMs), including, for example, tamoxifen (including tamoxifen citrate), raloxifene, droloxifene, iodoxyfene, 4-hydroxytamoxifen, trioxifene, keoxifene, LY117018, onapristone, and toremifme citrate; (ii) aromatase inhibitors that inhibit the enzyme aromatase, which regulates estrogen production in the adrenal glands, such as, for example, 4(5)-imidazoles, aminoglutethimide, megestrol acetate, exemestane, formestanie, fadrozole, vorozole, letrozole, and anastrozole; (iii) anti-androgens such as flutamide, nilutamide, b
  • Chemotherapeutic agents also include antibodies, as described above, including alemtuzumab, bevacizumab; cetuximab; panitumumab, rituximab, pertuzumab, tositumomab, and the antibody drug conjugate, gemtuzumab ozogamicin.
  • Additional humanized monoclonal antibodies with therapeutic potential as agents in combination with the multispecific binding agents include: apolizumab, aselizumab, atlizumab, bapineuzumab, bivatuzumab mertansine, cantuzumab mertansine, cedelizumab, certolizumab pegol, cidfusituzumab, cidtuzumab, daclizumab, eculizumab, efalizumab, epratuzumab, erlizumab, felvizumab, fontolizumab, gemtuzumab ozogamicin, inotuzumab ozogamicin, ipilimumab, labetuzumab, lintuzumab, matuzumab, mepolizumab, motavizumab, motovizumab, natalizumab, n
  • Chemotherapeutic agents also include dexamethasone, interferons, colchicine, metoprine, cyclosporine, amphotericin, metronidazole, alemtuzumab, alitretinoin, allopurinol, amifostine, arsenic trioxide, asparaginase, BCG live, bevacuzimab, bexarotene, cladribine, clofarabine, darbepoetin alfa, denileukin, dexrazoxane, epoetin alfa, elotinib, filgrastim, histrelin acetate, ibritumomab, interferon alfa-2a, interferon alfa-2b, lenalidomide, levamisole, mesna, methoxsalen, nandrolone, nelarabine, nofetumomab, oprelvekin,
  • Chemotherapeutic agents also include hydrocortisone, hydrocortisone acetate, cortisone acetate, tixocortol pivalate, triamcinolone acetonide, triamcinolone alcohol, mometasone, amcinonide, budesonide, desonide, fluocinonide, fluocinolone acetonide, betamethasone, betamethasone sodium phosphate, dexamethasone, dexamethasone sodium phosphate, fluocortolone, hydrocortisone-17-butyrate, hydrocortisone-17-valerate, aclometasone dipropionate, betamethasone valerate, betamethasone dipropionate, prednicarbate, clobetasone-I 7-butyrate, clobetasol-I 7-propionate, fluocortolone caproate, fluocortolone pivalate and fluprednidene a
  • celecoxib or etoricoxib include proteosome inhibitor (e.g. PS341); CCI-779; tipifamib (R11577); orafenib, ABT510; Bc1-2 inhibitor such as oblimersen sodium pixantrone; farnesyltransferase inhibitors such as lonafamib (SCH 6636); and pharmaceutically acceptable salts, acids or derivatives of any of the above; as well as combinations of two or more of the above such as CHOP, an abbreviation for a combined therapy of cyclophosphamide, doxorubicin, vincristine, and prednisolone; and FOLFOX, an abbreviation for a treatment regimen with oxaliplatin combined with 5-FU and leucovorin.
  • Chemotherapeutic agents also include Poly ADP ribose polymerase (PARP) inhibitors: olaparib, rucaprib niraparib, talzoparib
  • Inhibitors that can be used include, but are not limited to, kinase inhibitors such as imatinib, baricitinib gefitinib, erlotinib, sorafenib, dasatinib, sunitinib, lapatinib, nilotinib, pirfenidone, pazopanib, crizotinib, vemurafenib, vandetanib, ruxolitinib, axitinib, bosutinib, regorafenib, tofacitinib, cabozantinib, ponatinib, trametinib, dabrafenib, afatinib, ibrutinib, ceritinib, idelalisib, nintedanib, palbociclib, lenvatinib, cobimetinib, abemaciclib, a
  • a compound as described herein can be used in combination with a HSP90 inhibitor (e.g., XL888), liver X receptor (LXR) modulators, retinoid-related orphan receptor gamma (RORy) modulators, checkpoint inhibitors such as a CK1 inhibitor or aCK1a inhibitor, a Wnt pathway inhibitor (e.g., SST-215), or a mineralocorticoid receptor inhibitor, (e.g., esaxerenone) or XL-888 for the treatment of a disease disclosed herein such as cancer.
  • HSP90 inhibitor e.g., XL888
  • LXR liver X receptor
  • RORy retinoid-related orphan receptor gamma
  • checkpoint inhibitors such as a CK1 inhibitor or aCK1a inhibitor
  • Wnt pathway inhibitor e.g., SST-215
  • mineralocorticoid receptor inhibitor e.g., esaxerenone
  • a multispecific binding agent e.g., an antibody
  • FGFR inhibitor FGFR1, FGFR2, FGFR3 or FGFR4, e.g., pemigatinib
  • an EGFR inhibitor also known as ErB-1 or HER-1; e.g.
  • VEGFR inhibitor or pathway blocker e.g., bevacizumab, pazopanib, sunitinib, sorafenib, axitinib, regorafenib, ponatinib, vandetanib, ramucirumab, lenvatinib, ziv-aflibercept
  • PARP inhibitor e.g.
  • olaparib rucaparib, veliparib or niraparib
  • a JAK inhibitor e.g., ruxolitinib, baricitinib, itacitinib
  • an IDO inhibitor e.g., epacadostat, NLG919, or BMS-986205, MK7162
  • an LSD1 inhibitor e.g., a TDO inhibitor, a PI3K-delta inhibitor (e.g., parsaclisib), a PI3K-gamma inhibitor such as PI3K-gamma selective inhibitor, a Pim inhibitor, a CSF1R inhibitor, a TAM receptor tyrosine kinases (Tyro-3, Axl, and Mer), an adenosine receptor antagonist (e.g., A2a/A2b receptor antagonist), an HPK1 inhibitor, a chemokine receptor inhibitor (e.g.
  • HDAC histone deacetylase inhibitor
  • a multispecific binding agent as disclosed herein can be used in combination with inhibitors of PD-1 or inhibitors of PD-L1, e.g., an anti-PD-1 monoclonal antibody or an anti-PD-L1 monoclonal antibody, for example, nivolumab (Opdivo), pembrolizumab (Keytruda, MK-3475), atezolizumab, avelumab, cemiplimab, spartalizumab, camrelizumab, cetrelimab, toripalimab, sintilimab, AB122, JTX-4014, BGB-108, BCD-100, BAT1306, LZMO09, AK105, HLX10, and TSR-042, AMP-224, AMP-514, PDR001, durvalumab, pidilizumab (Imfinzi®, CT-011), CK-301, BMS 936559, MPDL3280A,
  • a multispecific binding agent as disclosed herein can be used in combination with CTLA-4 inhibitors, e.g., an anti-CTLA-4 antibody, for example, ipilimumab (Yervoy), tremelimumab and AGEN1884, or with phosphatidylserine inhibitors, for example, bavituximab (PGN401), or with antibodies to cytokines (IL-10, TGF-b, and the like), or with bispecific antibodies that bind to PD-L1 and CTLA-4 (e.g., AK104) or PD-1 and CTLA-4, or with other anti-cancer agents such as cemiplimab.
  • CTLA-4 inhibitors e.g., an anti-CTLA-4 antibody, for example, ipilimumab (Yervoy), tremelimumab and AGEN1884, or with phosphatidylserine inhibitors, for example, bavituximab (PGN401), or with antibodies to cytokines (
  • the additional agent may be a pharmaceutically acceptable salt, ester, amide, hydrate, and/or prodrug of any of these therapeutic agents described above or other agents.
  • binders for human CD47 and PD-L1 antibody discovery was conducted by phage display of human Fab libraries was carried out using standard protocols.
  • the extracellular domain of human CD47 was purchased from Acro Biosystems (biotinylated human CD47 His-Avitag Acro Cat No. CD7-H82E9 and human CD47 His-tag Acro Cat No. CD7-5227).
  • the extracellular domain of human PD-L1 was purchased from Acro Biosystems (human PD-L1-His tag Acro Cat. No. PD1H5229, biotinylated human PD-L1-His Avitag Acro Cat. No. PDL-H82E4).
  • the non-biotinylated extracellular domain of CD47 or PD-L1 was biotinylated using EZ-Link NHS-PEG12-Biotin (ThermoScientific Cat. No. 21312) using standard protocol as needed. Phage clones were screened for the ability to bind to biotinylated human CD47 or biotinylated human PD-L1 by phage ELISA using standard protocols. Briefly, Fab-formatted phage libraries were constructed using expression vectors capable of replication and expression in phage (also referred to as a phagemid).
  • Both the heavy chain and the light chain were encoded in the same expression vector, where the heavy chain was fused to a truncated variant of the phage coat protein pill.
  • the light chain and heavy chain-pill fusion were expressed as separate polypeptides and assembled in the bacterial periplasm, where the redox potential enables disulfide bond formation, to form the antigen binding domain (Fab) of the candidate antibody.
  • the library was created using sequences derived from a specific human heavy chain variable domain (VH3-23) and a specific human light chain variable domain (Vk-1). Light chain variable domains within the screened library were generated with diversity was introduced into the VL CDR3 (L3) and where the light chain VL CDR1 (L1) and CDR2 (L2) remained the human germline sequence. For the screened library, all three CDRs of the VH domain were diversified to match the positional amino acid frequency by CDR length found in the human antibody repertoire.
  • phage display heavy chain (SEQ ID NO:204) and light chain (SEQ ID NO:205) scaffolds used in the library are listed below, where a lower case “x” represents CDR amino acids that were varied to create the library, and bold italic represents the CDR sequences that were constant.
  • SEQ ID NO: 204 was EVQLVESGGGLVQPGGSLRLSCAASGFTFS XXXXX WVRQA PGKGLEWVA XXXXXXXXXXXXXXXXX RFTISADTSKNTAY LQMNSLRAEDTAVYYCAR XXXXXXXXXXXXXXXXXXX WGQG TLVT VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG TQTYICNVNHKPSNTKVDKKVEPKSC.
  • SEQ ID NO: 205 was DIQMTQSPSSLSASVGDRVTITC RASQSVSSAVA WYQQKP GKAPKLLIY SASSLYS GVPSRFSGSRSGTDFTLTISSLQP EDFATYYC XXXXXXX FGQGTKVEIKRTVAAPSVFIFPP SDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG LSSPVTKSFNRGEC.
  • Phage panning was performed using standard procedures. Briefly, the first round of phage panning was performed with target immobilized on streptavidin magnetic beads which were subjected to approximately 1 ⁇ 10 12 phages from the prepared library in a volume of 1 mL in PBST-2% BSA. After a one-hour incubation, the bead-bound phage were separated from the supernatant using a magnetic stand. Beads were washed three times to remove non-specifically bound phage and were then added to ER2738 cells (5 mL) at OD600 of approximately 0.6.
  • infected cells were sub-cultured in 25 mL 2xYT+Ampicillin and M13K07 helper phage (final concentration of approximately 1 ⁇ 10 10 pfu/ml) and allowed to grow overnight at 37° C. with vigorous shaking. The next day, phage were prepared using standard procedures by PEG precipitation. Pre-clearance of phage specific to SAV-coated beads was performed prior to panning.
  • the second round of panning was performed using the KingFisher magnetic bead handler with bead-immobilized CD47 or PD-L1 target antigen using standard procedures (round 3:100 nM CD-47 and 50 nM PD-L1, round 4: 50 nM CD-47 and 25 nM PD-L1).
  • 3-4 rounds of phage panning were performed to enrich in phage displaying Fabs specific for the target antigen.
  • Target-specific enrichment was confirmed using polyclonal ELISA and individual clones were isolated and further verified by performing monoclonal phage ELISA. DNA sequencing was used to determine the sequence of the CDRs of isolated Fab clones containing a candidate antibodies.
  • VL and VH domains identified in the phage screen described above were formatted into a bivalent monospecific native human full-length IgG1 architecture and immobilized to a biosensor on an Octet (Pall ForteBio) biolayer interferometer as described in Example 2. Soluble antigens (e.g., CD47 or PD-L1) were then added to the system and binding was measured.
  • Soluble antigens e.g., CD47 or PD-L1
  • VL variable regions of individual clones were formatted into Domain A and/or H, and VH region into Domain F and/or L of a bivalent B-Body in a BC1 format and/or a BC44 format as described herein.
  • Antibodies were affinity purified using anti-IgG10-CH1 resign by batch-mode gravity filtration. Clarified supernatants generated from 500 mL or 1000 mL transfection volumes were affinity purified using CaptureSelectTM CH1-XLAffinity Matrix bulk resin (ThermoFisher PN 194346201L). Supernatants from 1000 mL transfections were divided into 500 mL portions and all supernatants were transferred to 1 L sterile shake flasks.
  • Resin was washed free of storage buffer using Dulbecco's PBS (pH 7.4, without Ca2+/Mg2+) by gravity filtration using disposable 10 mL columns (ThermoFisher Scientific PN 29924) and resuspended in PBS as a 50% slurry. Resin was aliquoted to shake flasks on a scale of 6 mL of 50% resin slurry per 500 mL of supernatant. Supernatant was incubated with resin for 1-2 hours at room temperature on a flask shaker operated at 170 RPM.
  • Resin was captured on a gravity filtration column equipped with reservoir attachment (GE Healthcare Life Sciences PN 18-3216-03) and washed with 30 mL DPBS (10 ⁇ settled resin bed volume). The resin bed was stringently washed with 30 mL with DPBS containing 500 mM NaCl. An additional wash was performed using 30 mL DPBS to reduce the concentration of NaCl prior to elution. Bound antibody was eluted from the gravity column using 9 mL 0.1 M sodium acetate (pH 3.5) into 2.25 mL neutralization buffer (2 M Tris-HCl, pH 7.5; Sigma PN T2944) contained in a 50 mL conical tube.
  • C40 x P24, C40 x P24s, and C56 x P22 antibodies affinity-purified antibodies from two separate lots were pooled prior to polishing.
  • C40 x P31.2, C59 x P22, and C59 x P31.2 antibodies utilized single lots for polishing. Each single or pooled lot was polished by strong cation exchange (SCX) using an AKTA pure fast protein liquid chromatography instrument (FPLC, GE Healthcare Life Sciences) running GE Unicorn v7.2 software. Aseptic techniques were used at all times.
  • SCX strong cation exchange
  • the entire flow-path (including the mobile phase reservoirs, samples loop, column, and switching valves) was cleaned using 500 mM NaOH in 20% ethanol by slowly pumping the cleaning solution through the instrument (0.1 mL/min for 2 hours). The instrument was then flushed with 20% ethanol and stored overnight.
  • a buffer exchange method was employed using molecular weight cutoff (MWCO) filters with buffer exchange performed within 1-2 hours of polishing with storage at room temperature until polishing commenced.
  • MWCO molecular weight cutoff
  • a master pool was created from purified material from each injection and was subjected to full analytics screening and freeze/thaw analysis.
  • Antibodies to CD47 or PD-L1 were generated by phage display, for example, such as described in Example 1.
  • bio-layer interferometry BBI was used to confirm the specific interaction of the antigens to the candidate antibodies obtained in Example 1.
  • Exemplary bispecific antibodies C40 x P24, C56 x P22, C40 x P31.2, C59 x P22, and C59 x P31.2 were tested using flow cytometry for binding to cells expressing CD47 and PD-L1 in various surface copy numbers. In some analyses, C40 x P24s was also tested.
  • Cells were harvested at 70-90% confluence on the day of the assay. Cells were collected by centrifugation at 200 ⁇ g for 5 minutes and media was removed. Cells were resuspended at 2 ⁇ 10 6 cells per mL in cold PBS. An 8-point antibody dilution series (2 ⁇ concentration) was prepared in PBS to cover the expected binding affinities of the antibodies being tested. 50 ⁇ L per well of the antibody dilution was plated in a 96 well V-bottom plate (Costar 3897). 50 ⁇ L per well of cell suspension was added. Plates were placed at 4° C. for 45-60 minutes.
  • CD47- and PD-L1-expressing TCA CHO cells were used to screen antibodies for binding to CD47 and PD-L1. These cells have a CD47 surface protein copy number of approximately 612,000 and a PD-L1 surface protein copy number of approximately 674,000.
  • the tested bispecific antibodies each with a first binding domain for CD47 and a second binding domain for PD-L1, were in a BC1 format. Additional monospecific antibody constructs were prepared each with a first binding domain for CD47 or for PD-L1 and a second binding domain for an irrelevant target (designated as a “dummy” binding domain or “D”). Cells were harvested and assayed for binding as described above.
  • Exemplary binding curves are depicted in FIGS. 1 A- 1 D .
  • Half maximal effective concentration (EC 50 ) of cell binding for the assayed antibodies are also summarized in Table 7.
  • Monospecific antibodies having only one binding domain capable of targeting CD47 (C40xD) or PD-L1 (DxP24) were also assayed as controls and a secondary antibody-only sample was used as a negative control.
  • Results indicate that the exemplary bispecific antibodies had a higher avidity for binding to CD47 PD-L1 TCA CHO cells than antibodies targeting only CD47 or PD-L1 ( FIGS. 1 A- 1 D ).
  • Bispecific antibody binding was tested in MDA-MB-231 cells expressing PD-L1 (PD-L1 MDA-MB-231 cells), which have a CD47 surface protein copy number of approximately 500,000 and a PD-L1 surface protein copy number of approximately 1,500,000.
  • the tested bispecific antibodies each with a first binding domain for CD47 and a second binding domain for PD-L1, were in a BC44 format as described herein.
  • Cells were harvested and assayed for binding as described above. Exemplary binding curves are depicted in FIGS. 2 A- 2 E .
  • EC 50 of cell binding for indicated antibodies are listed in Table 8.
  • Jeko1 cells expressing PD-L1 Jeko-PD-L1 cells. These cells have a CD47 surface protein copy number of approximately 200,000 to 500,000 and a PD-L1 surface protein copy number of approximately 100,000 to 300,000.
  • the tested exemplary bispecific antibodies, each with a first binding domain for CD47 and a second binding domain for PD-L1 were in a BC44 format as described herein.
  • EC 50 of cell binding for the assayed antibodies are listed in Table 9.
  • bispecific antibodies in a BC44 format as described herein were assayed using a CD47/SIRP ⁇ Signaling Bioassay Kit (93-1135C19, Eurofins DiscoverX) using the manufacturer protocol. Assays were conducted separately using MDA-MB-231-PD-L1 and Jeko-PD-L1 target cells.
  • the signaling assays are engineered to co-express a ProLinkTM (PK) tagged immune checkpoint receptor and an Enzyme Acceptor (EA) tagged SH2 domain.
  • PK ProLinkTM
  • EA Enzyme Acceptor
  • Ligand engagement leads to receptor activation and phosphorylation, resulting in SH2-EA recruitment to the receptor, and forcing complementation of the two p-galactosidase enzyme fragments (EA and PK).
  • EA and PK p-galactosidase enzyme fragments
  • the resulting functional enzyme hydrolyzes substrate to generate a chemiluminescent signal. Blocking of the ligand engagement leads to a drop in chemiluminescent signal.
  • Exemplary results of the CD47/SIRP ⁇ signaling assay are shown in FIG. 3 .
  • Antibodies having only one binding site capable of targeting CD47 (C40xD, C56xD, and C59xD) were assayed as controls and showed minimal inhibition.
  • IC 50 values for assays in MDA-MB-231-PD-L1 are shown in Table 10. Results indicate that all tested exemplary bispecific antibodies showed a reduction in the chemiluminescent signal compared to the antibodies targeting only CD47. Thus, the assayed bispecific antibodies efficiently blocked the engagement of CD47 ligand on the SIRP ⁇ receptor, inhibiting signaling.
  • bispecific antibodies to inhibit CD47/SIRP ⁇ signaling in Jeko-PD-L1 cells was also determined.
  • the CD47/SIRP ⁇ signaling assay was conducted in these cells as described above.
  • IC 50 values for the assay in Jeko target cells are shown in Table 11. These results show that the assayed exemplary bispecific antibodies inhibit CD47/SIRP ⁇ signaling, with the C40 x P24 (silent Fc) bispecifc antibody showing the most efficient inhibition of CD47/SIRP ⁇ signaling of the several tested in these assays.
  • bispecific antibodies were assayed using a PD-1/PD-L1 Signaling Bioassay Kit (93-1104Y19-00117, Eurofins DiscoverX) using the manufacturer protocol.
  • the assay was conducted in PD-L1 MDA-MB-231 cells, PD-L1 Jeko cells, and Raji-PD-L1 cells.
  • Exemplary results of the PD-1/PD-L1 checkpoint signaling assay in PD-L1 MDA-MB-231 cells are shown in FIG. 4 .
  • IC 50 values for the assay in PD-L1 MDA-MB-231 cells and Jeko-PD-L1 cells are shown in Table 12. These results show that in JeKo-PD-L1 cells, exemplary bispecific antibodies C40 x P31.2, C59 x P22, and C59 x P31.2 resulted in lower IC 50 values than other tested bispecific antibodies.
  • bispecific antibody C40 x P24 silicor Fc
  • JeKo cells and JeKo-PD-L1 cells were compared.
  • the PD-1/PD-L1 Checkpoint Signaling Assay was conducted in these cells, as described above.
  • IC 50 values for assays in Jeko-PD-L1 target cells are shown in Table 12 above.
  • IC 50 values for assays in Jeko cells were below the measurement threshold, indicating that the inhibitory effect of the bispecific antibody can be affected by the total number of ligand and receptor available on the cells.
  • Bispecific antibodies that were selected for binding to CD47 were evaluated for their effect in blocking interaction of CD47 ligand with SIRP ⁇ receptor and in promoting phagocytosis.
  • a primary M2 macrophage phagocytosis assay was conducted to determine the effect of bispecific antibodies on phagocytosis.
  • JeKo-PD-L1 target cells were labeled with pHrodo Red Cell Labeling Kit for Flow Cytometry (A10026, ThermoFisher Scientific) and analyzed by flow cytometry according to the manufacturer protocol. Using this method, labeled target cells show little or no fluorescence while apoptotic cells remain in the pH 7.4 extracellular environment.
  • phagocytosis is initiated by formation of the phagocytic cup. After engulfment of labeled cells by pinching off, the cell is within the acidic environment of the phagosome (pH 4.5-5.5), which leads to increased fluorescence.
  • bispecific antibodies Following labeling of target cells, cells were incubated with bispecific antibodies in a BC44 format as described herein to allow binding to cell surface CD47. Bispecific antibody-bound labeled cells were then co-cultured with M2 macrophage cells in the Incucyte live cell imaging system (Sartorius) and phase and fluorescent images were taken every 30 minutes for 24 hours.
  • FIGS. 5 A and 5 B Exemplary fluorescent microscopy images of labeled JeKo-PD-L1 cells at 0 hours and 5 hours after co-culturing with M2 macrophages are shown in FIGS. 5 A and 5 B .
  • Exemplary results are shown in FIGS. 5 C- 5 G for exemplary bispecific antibodies C40xP24 ( FIG. 5 C ), C56xP22 ( FIG. 5 D ), C40xP31.2 ( FIG. 5 E ), C59xP22 ( FIG. 5 F ), and C59xP31.2 ( FIG. 5 G ) after 5 hours co-incubation.
  • Results indicate that after five hours of co-incubation, there is an increase in phagocytosis (e.g., phagocytic activity or function) of JeKo-PD-L1 cells by M2 macrophages in the presence of all tested bispecific antibodies compared to the control with no antibody.
  • phagocytosis e.g., phagocytic activity or function
  • bispecific antibodies on phagocytosis was also tested using A375 target cells, which have a CD47 surface copy number of approximately 200,000 and a PD-L1 surface copy number of approximately 25,000.
  • Cells were labeled with pHrodo Red Cell Labeling Kit for Flow Cytometry and analyzed by flow cytometry as described above.
  • FIGS. 6 A and 6 B Exemplary fluorescent microscopy images of labeled A375 cells at 0 hours and 48 hours after co-culturing with M2 macrophages are shown in FIGS. 6 A and 6 B , respectively.
  • Exemplary results are shown in FIGS. 6 C- 6 G for exemplary bispecific antibodies C40xP24 ( FIG. 6 C ), C56xP22 ( FIG. 6 D ), C40xP31.2 ( FIG. 6 E ), C59xP22 ( FIG. 6 F ), and C59xP31.2 ( FIG. 6 G ) after 48 hours co-incubation.
  • Results indicate that after 48 hours of co-incubation, there is an increase in phagocytosis of A375 cells by M2 macrophages in response to all tested exemplary bispecific antibodies compared to the controls with no antibody.
  • Anti-CD47 antibodies may cause red blood cell agglutination, which limits their therapeutic applications.
  • Bispecific antibodies disclosed herein were tested using a red blood cell binding assay to determine the effect on red blood cell agglutination.
  • bispecific antibodies were tested in a syngeneic MC38-hPDL1/hCD47 murine colon carcinoma model in female B-hPD-L1/hS1R ⁇ /hCD47 mice.
  • the efficacy of the treatment was evaluated based on tumor volume (TV) changes.
  • the overall health of animals was also evaluated based on body weight (BW).
  • mice were homozygous B-hPD-L1/hSIRPa/hCD47 (h/h; h/h; h/h) mice in a C57BL/6 background).
  • the strain genotype was C57BL/6-Cd274 tm1(CD274) Sirp ⁇ tm1(SIRPA) Cd47 tm1(CD47) /Bcgen.
  • These mice are a triple knock-in mouse model generated by crossing 3 genetically engineered mouse strains B-hPD-L1, B-hSIRPA and B-hCD47 mice to triple homozygosity.
  • the extracellular region of endogenous PD-L1 (exon 3), Sirpa (exon 2) and CD47 (exon 2) have been replaced with the respective human counterparts in C57BL/6 mice.
  • mice were housed in a specific pathogen-free barrier in individual ventilated cages. The animals were acclimatized for 7 days before the experiment. Temperature and humidity were controlled as follows: 20-26° C., 40-70% humidity, and lighting every 12 hours. Cages contained pressure sterilized corncob bedding material that was changed once per week. Mice had free access to autoclaved sterilized dry granule food and water during the entire study period. Food was SPF grade and water was purified by ultrafiltration.
  • Bispecific antibodies in a BC44 format as described herein were kept in a stock concentration of 1 mg/mL and stored at ⁇ 80° C. Thaw was initiated one day prior to use. On the day of use, antibody vials were transferred to clear conical bottom 1.7 mL microcentrifuge tubes and centrifuged at maximum speed (21,130 rcf) for 2 minutes at 4° C. Antibody dilutions were made in Ca2+ and Mg2+ free PBS (Cat #20012027, Gibco).
  • mice 7-10 days prior to treatment, the mice were implanted with a murine colon carcinoma cell line, MC38-hPD-L1/hCD47 cells. Each mouse was subcutaneously injected with MC38-hPD-L1/hCD47 tumor cells (5.0 ⁇ 10 5) in 0.1 mL PBS in the right flank. The age of animals at inoculation was 7-10 weeks (date of birth of mice was within ⁇ 3 days within the cohort) and body weight at inoculation was 18-25 grams. Tumor-bearing animals were randomly enrolled into study groups when mean tumor size reached approximately 125 mm 3 . Each group consisted of 8 mice. The study groups and number of animals per group for the efficacy cohort are shown in Table 13. Treatment was started at Treatment Day 0 and the study endpoint was up to 28 days. TV and BW were monitored twice weekly.
  • the TVs were used for calculation of the tumor growth inhibition (TGI, an indicator of antitumor effectiveness) and tumor regression (TR) values using the formulae:
  • TGI (%) [1 ⁇ ( T t ⁇ T 0 )/( C t ⁇ C 0 )] ⁇ 100%
  • TR (%) [1 ⁇ ( T t ⁇ T 0 )] ⁇ 100%
  • Exemplary results for tumor volume (mm 3 ) are shown in FIG. 7 .
  • Body weights of mice were measured at least twice weekly throughout the study.
  • Body weight (BW) change expressed in %, was calculated using the following formula:
  • BW change (%) ((BW t ⁇ BW 0 )/BW 0 ) ⁇ 100
  • Exemplary results for body weight (grams) are shown in FIG. 8 .
  • CBC complete blood count
  • the remaining whole blood (250 ⁇ L or more) was collected into a serum collection tube.
  • the blood was then allowed to clot by leaving it undisturbed at room temperature for 30 minutes.
  • the clot was removed by centrifuging at 12,000 ⁇ g for 90 seconds in a refrigerated centrifuge per manufacturer's protocol. Following centrifugation, the resulting supernatant (serum) was immediately transferred into a clean labelled polypropylene tube, divided into 2 aliquots ( ⁇ 60 ⁇ L ⁇ 2) and stored at ⁇ 80° C. until analyzed by ELISA.
  • the serum samples were maintained at 2-8° C. while handling.
  • Anti-CD47 antibodies may cause red blood cell agglutination, which limits their therapeutic applications.
  • Bispecific antibodies disclosed herein were tested using a red blood cell binding assay to determine the effect on red blood cell agglutination.
  • RBCs and platelets are reported to have high expression of CD47. 48 hours after dosing, red blood cells and platelet concentrations were analyzed to determine if there was depletion of these cell types.
  • CBC was measured on HEMAVET950 (Drew Scientific) with blood collected via cardiac puncture as described. Hematological parameters on RBC, WBC (with counts of subtypes), platelets, hemoglobin, and hematocrit were determined for each sample ( FIGS. 9 A- 9 E ). Information of red cell distribution width (RDW), mean corpuscular volume (MCV), mean corpuscular hemoglobin (MCH), reticulocyte count was determined ( FIGS. 10 A- 10 G ).
  • RMW red cell distribution width
  • MCV mean corpuscular volume
  • MCH mean corpuscular hemoglobin
  • reticulocyte count was determined ( FIGS. 10 A- 10 G ).
  • ELISA enzyme-linked immune sorbent assay
  • This assay employed affiniPure Goat Anti-Human IgG (H+L) (Cat #109-005-003, Jackson ImmunoResearch) specific for human IgG antibody coated on a 96-well plate.
  • Standards, quality control samples and test specimens are pipetted into the wells and human IgG in a sample is bound to the wells by the immobilized antibody.
  • the wells were washed and peroxidase-conjugated affiniPureF(ab′) 2 fragment Goat Anti-Human IgG Fc antibody was added (Cat #109-0036-003, Jackson ImmunoResearch).
  • a TMB substrate solution was added to the wells and color developed in proportion to the amount of human IgG bound.
  • the Stop Solution changed the color from blue to yellow, and the intensity of the color was measured at 450 nm and 570 nm.
  • the Lower limit of quantitation (LLOQ) of the sandwich method for determining the human antibody concentration was approximately 1.56 ng/mL.
  • bispecific antibodies were tested in an additional study with the syngeneic MC38-hPDL1/hCD47 murine colon carcinoma model in the female B-hPD-L1/hSIR ⁇ /hCD47 mice as described in the previous study above.
  • the efficacy of the treatment was again evaluated based on tumor volume (TV) changes.
  • the overall health of animals was again evaluated based on body weight (BW).
  • mice were implanted with a murine colon carcinoma cell line, MC38-hPD-L1/hCD47 cells. Each mouse was subcutaneously injected with MC38-hPD-L1/hCD47 tumor cells (5.0 ⁇ 10 5 ) in 0.1 mL PBS in the right front flank. The age of animals at inoculation was 7-10 weeks (date of birth of mice was within ⁇ 3 days within the cohort) and body weight at inoculation was 18-25 grams. Tumor-bearing animals were randomly enrolled into study groups when mean tumor size reached approximately 117 mm 3 . Each group consisted of 8 mice. The study groups and number of animals per group for the efficacy cohort are shown in Table 15. Treatment was started at Treatment Day 0 and the study endpoint was up to 28 days. TV and BW were monitored twice weekly.
  • Tumor size was measured at least twice weekly with a caliper and the tumor volume (mm 3 ) was estimated as described in the previous study above.
  • Exemplary tumor volume (mm 3 ) results for mice in indicated treatment groups with the exemplary bispecific antibodies are shown in FIG. 12 A .
  • Exemplary tumor volume results for individual mice are shown in FIGS. 12 B- 12 D .
  • Tumor growth inhibition (TGI) was calculated as described above for the previous study. For example, at the end of this study (day 28 post start of treatment), exemplary results showed that C56 x P22 (20 mg/kg, IP) demonstrated anti-tumor activity as indicated by effects on tumor volume with % TGI of 58.5% (P ⁇ 0.05), and C59 x P22 (20 mg/kg, IP) demonstrated anti-tumor activity with % TGI of 36.6% (P>0.05).
  • Body weights of mice were measured at least twice weekly throughout the study.
  • Body weight (BW) change expressed in %, was calculated using the following formula:
  • BW change (%) ((BW t ⁇ BW 0 )/BW 0 ) ⁇ 100
  • Exemplary mean body weight (grams) results for mice in indicated treatment groups with the exemplary bispecific antibodies are shown in FIG. 12 E .
  • Tumor infiltrating leukocytes TIL
  • a single cell suspension of tumors was prepared to analyze by FACS. Tumors were cut into small pieces of 2-4 mm, transferred to tube containing enzyme mix (Miltenyi Biotec, cat #130-096-730) and incubated at 37° C. for 40 minutes. Tumor slices were then ground with a sterile syringe plunger in 10 mL RPMI-1640 at 4° C. Cell suspensions were centrifuged at 300 g for 7 minutes at 4° C. Supernatants were aspirated completely, cell pellets were resuspended in PBS at an appropriate volume and counted using a blood cell counting chamber. Tumor cells were resuspended in PBS to the required concentration for further FACS analysis.
  • the cell suspension of each tumor sample was incubated with anti-mouse CD16/32 antibody, a fixable viability dye for Fc receptor blocking, and live/dead staining at room temperature for 10 minutes. Samples were then stained with fluorescence conjugated antibodies for surface markers including mouse(m) CD45, mCD11 b, mCD3, mCD4, mCD8 and mF4/80 at 4° C. for 30 minutes. After staining, samples were washed twice with PBS. After being fixed and permeabilized, samples were stained with fluorescence conjugated anti-mouse Foxp3 antibody at 4° C. for 30 minutes. Samples were washed with PBS, resuspended in PBS and analyzed by flow cytometry (Attune NxT, Thermo Fisher Scientific).
  • CD4+ T cell count was determined by gating for CD45+CD3+CD4+CD8 ⁇ , and exemplary results for cell CD4+ T cells per gram tumor are shown in FIG. 13 A .
  • CD8+ T cell (CTL) count was by determined by gating CD45+CD3+CD4-CD8+, and exemplary results for CD8+ cells per gram tumor are shown in FIG. 13 B .
  • Treg count was determined by gating CD45+CD3+CD4+CD8-Foxp3+, and exemplary results for Treg cells per gram tumor are shown in FIG. 13 C .
  • Macrophage count was determined by gating CD45+CD11b+F4/80+, and exemplary results for macrophage count per gram tumor are shown in FIG. 13 D .
  • An increase in TILs was observed with C56 ⁇ P22 and C59 ⁇ P22 compared to the vehicle alone control group, as shown in FIGS. 13 A- 13 D .
  • A-375 cells have a CD47 surface copy number of approximately 200,000 and a PD-L1 surface copy number of approximately 25,000.
  • Bispecific antibodies in a BC44 format were provided at 1 mg/mL concentration and were stored at ⁇ 80° C. Prior to use, bispecific antibodies were thawed and used neat for the 10 mg/kg dose, with doses kept at 4° C. until in vivo injection. Vehicle was Ca++ and Mg++ free Dulbecco's PBS, pH7.4.
  • the A-375 cell line is a human skin melanoma (American Type Culture Collection, USA, cat #CRL1619) and was isolated from a 54 year-old female patient with melanoma by Giard et al. (D. J. Giard et al., “In vitro cultivation of human tumors: establishment of cell lines derived from a series of solid tumors,” J. Natl. Cancer Inst., vol. 51, no. 5, pp. 1417-1423, November 1973.). Tumor cells were grown as monolayer at 37° C.
  • the pelleted cells were washed, resuspended in RPMI without phenol red, counted and their viability assessed by 0.25% trypan blue exclusion assay. Tumor cell culture with a viability of >80% was used for in-vivo implant.
  • PBMCs Peripheral blood mononuclear cells
  • NOD-SCID mice Fifty-seven (57) healthy female NOD-SCID (NOD.CB17-Prkdcscid/NCrCrI) mice, 5 weeks old at reception, were obtained from Charles River Laboratories.
  • PBMCs were injected on Day-3 (D-3), 3 days prior to tumor induction.
  • the fifty-seven mice were split into 3 sub-groups of 19 mice each, and with each sub-group allocated to one PBMCs donor (donor A, B and C).
  • the three sub-groups had equivalent mean body weight at time of PBMC inoculation.
  • PBMCs from each donor were injected into one sub-group of 19 mice on the same day.
  • Each mouse received one single intravenous (IV) injection of 1 ⁇ 10 7 PBMCs in 200 ⁇ L RPMI without phenol red.
  • IV intravenous
  • mice On Day-0 (D0), tumors were induced in all fifty-seven NOD SCID female mice by subcutaneous injection of 1 ⁇ 10 7 A-375 cells in 200 ⁇ L RPMI 1640 without phenol red into the right flank of each animal. Animals were randomized on Day 1 (D1) by individual body weight. Three (3) mice from each sub-group were randomized into 6 groups according to their individual body weight using Vivo Manager® software. This distribution yielded 6 groups of 9 mice, 3 mice per donor per group. A statistical test (analysis of variance, ANOVA) was performed to test for homogeneity between groups for each donor.
  • ANOVA analysis of variance
  • the treatment was administered on Day 1 (D1) by injection into the peritoneal cavity (IP), with an IP formulation of pH 7.4 and an administration volume of 10 mL/kg, adjusted to the most recent individual body weight.
  • IP peritoneal cavity
  • Group designations, dosage levels, administration, and treatment schedule are described in Table 16.
  • Tumors were collection based on homogeneity of tumor growth, with one tumor per donor per group collected when tumor reach 500 mm 3 before study termination. For all other mice, tumors were collected when mice reach humane endpoints or at study endpoint (a maximum of 8 weeks after tumor cell injection). Tumors collected were cut into slices of 4 mm thick, fixed in 4% neutral buffered formalin for 24 to 48 hours, and subsequently embedded in paraffin (Histowax®, Histolab, Sweden) with the aim of allowing serial sectioning of the whole tumor. The level of tumor necrosis was evaluated and noted in the autopsy report.
  • mice were monitored for parameters including animal body weight measurements, tumor volume, clinical and mortality records, and animal viability and behavior was observed daily. Body weights were measured a minimum of twice a week. The length (L) and width (W) of tumors were measured twice a week with calipers and volume calculated with the formula (L x W2)/2. The monitoring of mice was done for a maximum of 8 weeks post tumor induction and all surviving mice were euthanized no later than Day 56 (D56). In addition, bispecific antibody levels in the blood were analyzed by a Human Therapeutic IgG1 ELISA (Cayman Chemical, Kit Item No. 500910). Exemplary results are shown in FIG. 14 .
  • Exemplary mean tumor volume (Mean TV) and median tumor volume (Median TV) results for mice in indicated treatment groups with the exemplary bispecific antibodies are shown in FIG. 15 A and FIG. 15 B , respectively.
  • Exemplary tumor volume results for individual mice are shown in FIGS. 15 C- 15 G .
  • Exemplary mean body weight results for mice in indicated treatment groups with the exemplary bispecific antibodies are shown in FIG. 15 H .
  • PBMCs used for in vivo injection were prepared also as described in the previous A-375 study above.
  • NOD-SCID mice Fifty-four healthy female NOD-SCID mice, 7 to 8 weeks old at reception, were obtained from Charles River Laboratories. PBMCs were injected on Day-3 (D-3), 3 days prior to tumor induction. The fifty-four mice were split into 6 sub-groups of 9 mice each, and with each sub-group was allocated to one PBMCs donor (donor A, B and C). The three sub-groups had equivalent mean body weight at time of PBMC inoculation. PBMCs from each donor were injected into one sub-group of 9 mice on the same day. Each mouse received one single intravenous (IV) injection of 1 ⁇ 10 7 PBMCs in 200 ⁇ L RPMI without phenol red.
  • IV intravenous
  • mice On Day-0 (D0), tumors were induced in all fifty-four NOD SCID female mice by subcutaneous injection of 1 ⁇ 10 7 A-375 cells in 200 ⁇ L RPMI 1640 without phenol red into the right flank of each animal. Animals were randomized on Day 1 (D1) by individual body weight. Three (3) mice from each sub-group were randomized into 6 groups according to their individual body weight using Vivo Manager® software. This distribution yielded 6 groups of 9 mice, 3 mice per donor per group. A statistical test (analysis of variance, ANOVA) was performed to test for homogeneity between groups for each donor.
  • ANOVA analysis of variance
  • the treatment was administered on Day 1 (D1) by injection into the peritoneal cavity (IP), with an IP formulation of pH 7.3-7.4 and an administration volume of 10 mL/kg, adjusted to the most recent individual body weight.
  • IP peritoneal cavity
  • Group designations, dosage levels, administration, and treatment schedule with the exemplary bispecific antibodies (TIWx4, thrice per week for 4 weeks) is described in Table 17.
  • Tumors were collected at Day 31 (D31) after a final dose on Day 29 (D29), weighed, and used to evaluate tumor infiltrates by flow cytometry analysis. Animals were monitored for parameters including animal body weight measurements, tumor volume, clinical and mortality records, and animal viability and behavior was observed daily. Body weights were measured a minimum of twice a week. The length (L) and width (W) of tumors were measured twice a week with calipers and volume calculated with the formula (L ⁇ W2)/2. The monitoring of mice was done for a maximum of 8 weeks post tumor induction and all surviving mice were euthanized no later than Day 56 (D56).
  • Exemplary mean tumor volume (Mean TV) results for mice in indicated treatment groups with the exemplary bispecific antibodies are shown in FIG. 16 A .
  • Exemplary mean body weight results for mice in indicated treatment groups with the exemplary bispecific antibodies are shown in FIG. 16 B .
  • Macrophage infiltration into tumors was analyzed by flow cytometry.
  • the excised and weighed tumors were dissected into smaller fragments using scalpels, further dissociated into single cell suspensions in a non-enzymatic cell dissociation buffer, incubated at 37° C. for 30 minutes and mechanically separated through a 70 ⁇ m cell strainer.
  • Viable cells were enriched using ficoll-based gradient centrifugation. Prior to any staining, cell suspensions were enumerated and one million cells (when possible) were distributed per well/tube. Cells were stained in a final staining volume of 100 ⁇ L per well.
  • a first step of staining with a viability dye was performed to allow dead cell exclusion at the analysis. Non-specific binding was minimized using the FcR blocking reagent (human and mouse). Fluorescent labeled surface target antibodies were added, according to the procedure described by the supplier for each antibody (or a titrated dose if it was a standardized panel). The mixture was incubated for 30 minutes at 4° C. protected from light. After one wash, intracellular staining was performed using the FoxP3 staining buffer following the manufacturer's instructions. This step included both fixation and permeabilization steps allowing intracytoplasmic and intranuclear staining. Fluorescent-labeled antibodies directed against the intracellular targets were added, according to the procedure described by the supplier.
  • the staining solution was incubated for 30 minutes at 4° C. protected from light, washed with permeabilization buffer and finally resuspended in 200 ⁇ L PBS 1% formaldehyde containing PKH26 beads. All samples were stored at +4° C. and protected from light until acquisition on cytometer.
  • FMO fluorescence minus one
  • Exemplary Jeko-PD-L1 tumor volumes are shown in FIG. 18 A by treatment group (mean ⁇ SEM) from randomization (day 0) to Day 14 or 17.
  • Exemplary body weights are also shown in FIG. 18 B by treatment group (mean ⁇ SEM) from randomization (day 0) to Day 14 or 17.
  • FIG. 18 A and FIG. 18 B compared to the vehicle group, all treatment groups showed significant tumor inhibition 2 weeks after start of dosing and no treatment group had mean body weight loss of over 10%.
  • TGI Percent tumor growth inhibition
  • Exemplary results showed that the exemplary bispecific antibodies had anti-tumor activity as indicated by effects on tumor volume with % TGIs shown in Table 19.
  • Bispecific antibodies that were selected for binding to CD47 and PD-L1, for example, such as those described in Examples 1-3, were tested in various developability methods.
  • various chromatographic methods including size exclusion chromatography (SEC), hydrophobic interaction chromatography (HIC), and standup monolayer adsorption chromatography (SMAC) were employed to assess developability factors, such as monomer percentage, solubility, and antibody aggregation or precipitation.
  • Size exclusion chromatography (SEC) analysis was performed using a 7.8 mm ID ⁇ 30 cm TSKgel G3000SWXL column (Tosoh Bioscience LLC, PN 08541) on an Agilent 1100 HPLC.
  • Bispecific antibodies in a BC44 format as described herein were normalized to 1 mg/mL concentration in Dulbecco's PBS (pH 7.4, without Ca2+/Mg2+) and clarified via centrifugation to pellet particulates while still retaining soluble aggregates.
  • the mobile phase buffer was Dulbecco's PBS (pH 7.4, without Ca2+/Mg2+). For each sample, 10 ⁇ L was loaded and isocratically eluted at 1.0 mL/min over 20 minutes.
  • FIGS. 19 A- 19 C Exemplary SEC results are shown in FIGS. 19 A- 19 C . Results indicate low bispecific antibody aggregation.
  • Hydrophobic interaction chromatography (HIC) analysis was performed using a 4.6 mm ID ⁇ 3.5 cm TSKgel Butyl-NPR column (Tosoh Bioscience LLC, PN 14947) on an Agilent 1100 HPLC.
  • Bispecific antibodies in a BC44 format as described herein were normalized to 2 mg/mL concentration in dPBS (pH 7.4) and then diluted with an equal volume of mobile phase buffer B to a final protein concentration of 1 mg/m L.
  • the column was equilibrated with 100% mobile phase Buffer B (2 M ammonium sulfate/20 mM sodium phosphate, pH 7.0) at a flow rate of 1 mL/min.
  • HIC results are shown in FIGS. 20 A- 20 D .
  • Antibody hydrophobicity can impact antibody aggregation, solubility and viscosity. Results show similar retention times for the tested antibodies, and indicates a low propensity for aggregation and precipitation.
  • the HIC elution profiles e.g., sharpness of elution peak and uniform retention times
  • Standup monolayer adsorption chromatography (SMAC) analysis was performed using a 4.6 mm ID x 300 mm Zenix SEC 300 column (Sepax Technologies, PN 213300P-4630) on an Agilent 1100 HPLC.
  • Bispecific antibodies in a BC44 format as described herein were normalized to 1 mg/mL concentration in dPBS (pH 7.4) and clarified via centrifugation to pellet particulates.
  • the mobile phase buffer was dPBS (pH 7.4, without calcium and magnesium).
  • 10 ⁇ L was loaded and isocratically eluted at 0.25 mL/min over 32 min. Absorbance was monitored at 280 nm. Sample retention time was calculated and compared to a set of standard controls to identify bispecific antibodies with increased retention time (increased propensity to form aggregates).
  • FIGS. 21 A- 21 D Exemplary SMAC results are shown in FIGS. 21 A- 21 D . Results show that tested exemplary bispecific antibodies had similar short retention times, indicating colloidal stability and low propensity to aggregate.
  • An octet-based “in tandem” assay format was used for the cross-competition assays to establish competitive binding data and epitope binning.
  • 100 nM biotinylated antigen was immobilized on a streptavidin sensor in 10 ⁇ kinetic buffer (ForteBio).
  • the association of antibodies to CD47 or PD-L1 were monitored by dipping the sensor in consecutive steps into wells containing saturating concentrations of two competing (or non-competing) antibodies. If the saturation with the first antibody did not block the binding (indicated by further increment in the BLI signal) then the antibodies were considered to be binding to distinct or non-overlapping epitopes and belong to different bins.
  • Results indicate that C40, C56 and C59 bin together. Results also indicate that P22 and P31.2 bin together (data not shown) and bin separately from P24.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Veterinary Medicine (AREA)
  • General Chemical & Material Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Animal Behavior & Ethology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Peptides Or Proteins (AREA)
  • Medicinal Preparation (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
US18/018,864 2020-08-04 2021-08-03 Multispecific binding agents and uses thereof Pending US20240010751A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US18/018,864 US20240010751A1 (en) 2020-08-04 2021-08-03 Multispecific binding agents and uses thereof

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
US202063061112P 2020-08-04 2020-08-04
PCT/US2021/044356 WO2022031710A2 (en) 2020-08-04 2021-08-03 Multispecific binding agents and uses thereof
US18/018,864 US20240010751A1 (en) 2020-08-04 2021-08-03 Multispecific binding agents and uses thereof

Publications (1)

Publication Number Publication Date
US20240010751A1 true US20240010751A1 (en) 2024-01-11

Family

ID=80120131

Family Applications (1)

Application Number Title Priority Date Filing Date
US18/018,864 Pending US20240010751A1 (en) 2020-08-04 2021-08-03 Multispecific binding agents and uses thereof

Country Status (7)

Country Link
US (1) US20240010751A1 (enExample)
EP (1) EP4192878A4 (enExample)
JP (1) JP7840312B2 (enExample)
CN (1) CN116390939A (enExample)
AU (1) AU2021322114A1 (enExample)
CA (1) CA3188068A1 (enExample)
WO (1) WO2022031710A2 (enExample)

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
IL314395A (en) * 2022-01-31 2024-09-01 Centessa Pharmaceuticals Uk Ltd Bispecific anti-CD47 and anti-PD-L1 activatable proteins and their uses
EP4540290A2 (en) * 2022-06-14 2025-04-23 Invenra Inc. Multispecific binding agents that target b7h3 and gd2 and uses thereof
WO2024108137A2 (en) * 2022-11-18 2024-05-23 Seismic Therapeutic, Inc. Fc fusion molecules and uses thereof
JP2026501731A (ja) 2023-01-06 2026-01-16 サイズミック セラピューティク インコーポレイテッド プロテアーゼ変異体及びその使用

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20230303699A1 (en) * 2020-08-04 2023-09-28 Exelixis, Inc. Pd-l1 binding agents and uses thereof
US20230357391A1 (en) * 2020-08-04 2023-11-09 Exelixis, Inc. Cd47 binding agents and uses thereof

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP4209510B1 (en) * 2008-12-09 2024-01-31 F. Hoffmann-La Roche AG Anti-pd-l1 antibodies and their use to enhance t-cell function
SG11202003652QA (en) * 2017-10-27 2020-05-28 Univ New York Anti-galectin-9 antibodies and uses thereof
AU2017439776B2 (en) * 2017-11-20 2025-03-27 Taizhou Mabtech Pharmaceutical Co., Ltd Bifunctional fusion protein targeting CD47 and PD-l1
EA202091364A1 (ru) * 2017-12-04 2020-10-13 Бейджин Ханми Фармасьютикал Ко., Лтд. Анти-pd-l1/анти-cd47 биспецифическое антитело с подобной природному антителу структурой и в форме гетеродимера и способ его получения
WO2019179434A1 (en) * 2018-03-20 2019-09-26 Wuxi Biologics (Shanghai) Co., Ltd. Novel bispecific pd-1/cd47 antibody molecules

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20230303699A1 (en) * 2020-08-04 2023-09-28 Exelixis, Inc. Pd-l1 binding agents and uses thereof
US20230357391A1 (en) * 2020-08-04 2023-11-09 Exelixis, Inc. Cd47 binding agents and uses thereof

Non-Patent Citations (11)

* Cited by examiner, † Cited by third party
Title
Akbar et al., Cell Reports 34, 108856, (Mar. 16, 2021) *
Almagro & Franssen, Frontiers in Bioscience, 13:1619-33 (2008) *
Altshuler et al., Biochemistry (Moscow), 75(13):1584-1605 (2010) *
Edwards et al., J Mol Biol 334:103-118 (2003) *
Hasegawa et al., MABS, VOL. 9, NO. 5, pp. 854-873 (2017) *
Lippow et al., Nature Biotechnology, 25(10):1171-1176 (2007) *
Lo et al., BMC Genomics volume 22, Article number: 116 (2021) *
Marchalonis et al., Dev & Comp Immunol. 30:223-247 (2006) *
Marks et al., J. Biol. Chem. 295(29) 9823-9837 (2020) *
Sulea et al., Scientific Reports, 8(260):1-11 (2018) *
Vajda et al., Current Opinion in Structural Biology, 67 pp. 226-231 (2021) *

Also Published As

Publication number Publication date
EP4192878A2 (en) 2023-06-14
JP7840312B2 (ja) 2026-04-03
WO2022031710A3 (en) 2022-03-31
CN116390939A (zh) 2023-07-04
CA3188068A1 (en) 2022-02-10
JP2023536631A (ja) 2023-08-28
WO2022031710A2 (en) 2022-02-10
AU2021322114A1 (en) 2023-03-02
EP4192878A4 (en) 2025-04-16

Similar Documents

Publication Publication Date Title
AU2012245477B2 (en) Antibodies and other molecules that bind B7-H1 and PD-1
TW202210514A (zh) 針對tigit的抗體
US20250197502A1 (en) Multispecific binding agents and uses thereof
JP7840312B2 (ja) 多重特異性結合性作用剤およびその使用
JP7627258B2 (ja) 抗bcma抗体、その抗原結合断片、及びそれらの医療用途
US20250326858A1 (en) 5t4 binding agents and uses thereof
CA3218656A1 (en) Alpha 5 beta 1 integrin binding agents and uses thereof
US20230357391A1 (en) Cd47 binding agents and uses thereof
US20230303699A1 (en) Pd-l1 binding agents and uses thereof
EP4615516A1 (en) Anti-alpha5 integrin antibodies and uses thereof
CN118974098A (zh) 多重特异性结合剂及其用途
WO2025230866A1 (en) Anti-alpha5 integrin antibodies and uses thereof

Legal Events

Date Code Title Description
STPP Information on status: patent application and granting procedure in general

Free format text: APPLICATION UNDERGOING PREEXAM PROCESSING

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION COUNTED, NOT YET MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

AS Assignment

Owner name: EXELIXIS, INC., CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:INVENRA INC.;REEL/FRAME:073281/0081

Effective date: 20210831

Owner name: EXELIXIS, INC., CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:KANTAK, SEEMA;REEL/FRAME:073281/0087

Effective date: 20210913

Owner name: INVENRA INC., WISCONSIN

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:GLASER, BRYAN;HAMMER, BONNIE;REEL/FRAME:073281/0084

Effective date: 20210830

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: FINAL REJECTION COUNTED, NOT YET MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: FINAL REJECTION MAILED