US20220135677A1 - Anti-sirp alpha antibodies - Google Patents
Anti-sirp alpha antibodies Download PDFInfo
- Publication number
- US20220135677A1 US20220135677A1 US17/576,109 US202217576109A US2022135677A1 US 20220135677 A1 US20220135677 A1 US 20220135677A1 US 202217576109 A US202217576109 A US 202217576109A US 2022135677 A1 US2022135677 A1 US 2022135677A1
- Authority
- US
- United States
- Prior art keywords
- seq
- antibody
- acid sequence
- hsirpα
- antigen
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 230000027455 binding Effects 0.000 claims description 385
- 241000282414 Homo sapiens Species 0.000 claims description 160
- 108090000623 proteins and genes Proteins 0.000 claims description 71
- 235000018102 proteins Nutrition 0.000 claims description 64
- 102000004169 proteins and genes Human genes 0.000 claims description 64
- 101000863873 Homo sapiens Tyrosine-protein phosphatase non-receptor type substrate 1 Proteins 0.000 claims description 54
- 102100029948 Tyrosine-protein phosphatase non-receptor type substrate 1 Human genes 0.000 claims description 54
- 230000001225 therapeutic effect Effects 0.000 claims description 31
- 239000000203 mixture Substances 0.000 claims description 23
- 101000868279 Homo sapiens Leukocyte surface antigen CD47 Proteins 0.000 claims description 22
- 239000003937 drug carrier Substances 0.000 claims description 12
- 239000003085 diluting agent Substances 0.000 claims description 11
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 claims description 7
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 claims description 7
- 102000044459 human CD47 Human genes 0.000 claims description 5
- 101100477531 Homo sapiens SIRPA gene Proteins 0.000 claims 6
- 102000001708 Protein Isoforms Human genes 0.000 claims 6
- 108010029485 Protein Isoforms Proteins 0.000 claims 6
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 claims 3
- 235000004279 alanine Nutrition 0.000 claims 3
- 206010028980 Neoplasm Diseases 0.000 abstract description 30
- 208000015181 infectious disease Diseases 0.000 abstract description 20
- 201000011510 cancer Diseases 0.000 abstract description 17
- 238000011282 treatment Methods 0.000 abstract description 14
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 abstract description 13
- 201000010099 disease Diseases 0.000 abstract description 12
- 208000035473 Communicable disease Diseases 0.000 abstract description 9
- 239000012634 fragment Substances 0.000 description 391
- 239000000427 antigen Substances 0.000 description 353
- 108091007433 antigens Proteins 0.000 description 351
- 102000036639 antigens Human genes 0.000 description 351
- 125000003275 alpha amino acid group Chemical group 0.000 description 214
- 150000007523 nucleic acids Chemical class 0.000 description 213
- 108091028043 Nucleic acid sequence Proteins 0.000 description 173
- 210000004027 cell Anatomy 0.000 description 149
- 238000000034 method Methods 0.000 description 67
- -1 radioactive label Substances 0.000 description 64
- 239000003112 inhibitor Substances 0.000 description 51
- 238000006467 substitution reaction Methods 0.000 description 42
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 38
- 235000001014 amino acid Nutrition 0.000 description 38
- 108060003951 Immunoglobulin Proteins 0.000 description 33
- 102000018358 immunoglobulin Human genes 0.000 description 33
- 229940024606 amino acid Drugs 0.000 description 31
- 150000001413 amino acids Chemical class 0.000 description 31
- 102000039446 nucleic acids Human genes 0.000 description 31
- 108020004707 nucleic acids Proteins 0.000 description 31
- 230000014509 gene expression Effects 0.000 description 29
- 102000040430 polynucleotide Human genes 0.000 description 28
- 108091033319 polynucleotide Proteins 0.000 description 28
- 239000002157 polynucleotide Substances 0.000 description 28
- 108090000765 processed proteins & peptides Proteins 0.000 description 28
- 206010057249 Phagocytosis Diseases 0.000 description 27
- 239000003814 drug Substances 0.000 description 26
- 230000008782 phagocytosis Effects 0.000 description 26
- SHZGCJCMOBCMKK-DHVFOXMCSA-N L-fucopyranose Chemical compound C[C@@H]1OC(O)[C@@H](O)[C@H](O)[C@@H]1O SHZGCJCMOBCMKK-DHVFOXMCSA-N 0.000 description 25
- 102000004196 processed proteins & peptides Human genes 0.000 description 24
- SHZGCJCMOBCMKK-UHFFFAOYSA-N D-mannomethylose Natural products CC1OC(O)C(O)C(O)C1O SHZGCJCMOBCMKK-UHFFFAOYSA-N 0.000 description 23
- 229940124597 therapeutic agent Drugs 0.000 description 22
- OVRNDRQMDRJTHS-RTRLPJTCSA-N N-acetyl-D-glucosamine Chemical compound CC(=O)N[C@H]1C(O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-RTRLPJTCSA-N 0.000 description 21
- 230000013595 glycosylation Effects 0.000 description 21
- 238000006206 glycosylation reaction Methods 0.000 description 21
- 229920001184 polypeptide Polymers 0.000 description 21
- OVRNDRQMDRJTHS-UHFFFAOYSA-N N-acelyl-D-glucosamine Natural products CC(=O)NC1C(O)OC(CO)C(O)C1O OVRNDRQMDRJTHS-UHFFFAOYSA-N 0.000 description 20
- MBLBDJOUHNCFQT-LXGUWJNJSA-N N-acetylglucosamine Natural products CC(=O)N[C@@H](C=O)[C@@H](O)[C@H](O)[C@H](O)CO MBLBDJOUHNCFQT-LXGUWJNJSA-N 0.000 description 20
- 230000001404 mediated effect Effects 0.000 description 20
- 230000005888 antibody-dependent cellular phagocytosis Effects 0.000 description 19
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 18
- 229960004641 rituximab Drugs 0.000 description 18
- 102100032913 Leukocyte surface antigen CD47 Human genes 0.000 description 17
- ZTOKCBJDEGPICW-GWPISINRSA-N alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc Chemical compound O[C@@H]1[C@@H](NC(=O)C)[C@H](O)O[C@H](CO)[C@H]1O[C@H]1[C@H](NC(C)=O)[C@@H](O)[C@H](O[C@H]2[C@H]([C@@H](O[C@@H]3[C@H]([C@@H](O)[C@H](O)[C@@H](CO)O3)O)[C@H](O)[C@@H](CO[C@@H]3[C@H]([C@@H](O)[C@H](O)[C@@H](CO)O3)O)O2)O)[C@@H](CO)O1 ZTOKCBJDEGPICW-GWPISINRSA-N 0.000 description 17
- 239000013604 expression vector Substances 0.000 description 17
- 230000035772 mutation Effects 0.000 description 15
- 241000699666 Mus <mouse, genus> Species 0.000 description 14
- 210000003714 granulocyte Anatomy 0.000 description 14
- 102000005962 receptors Human genes 0.000 description 14
- 108020003175 receptors Proteins 0.000 description 14
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 13
- 101000835928 Homo sapiens Signal-regulatory protein gamma Proteins 0.000 description 13
- 239000002202 Polyethylene glycol Substances 0.000 description 13
- 229920001223 polyethylene glycol Polymers 0.000 description 13
- 102100025795 Signal-regulatory protein gamma Human genes 0.000 description 12
- 150000001875 compounds Chemical class 0.000 description 12
- 239000003446 ligand Substances 0.000 description 12
- 210000001616 monocyte Anatomy 0.000 description 12
- 125000000539 amino acid group Chemical group 0.000 description 11
- 238000003556 assay Methods 0.000 description 11
- 239000012636 effector Substances 0.000 description 11
- 239000002609 medium Substances 0.000 description 11
- 241000894007 species Species 0.000 description 11
- 229960005486 vaccine Drugs 0.000 description 11
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 10
- PNNNRSAQSRJVSB-SLPGGIOYSA-N Fucose Natural products C[C@H](O)[C@@H](O)[C@H](O)[C@H](O)C=O PNNNRSAQSRJVSB-SLPGGIOYSA-N 0.000 description 10
- 238000013459 approach Methods 0.000 description 10
- 102000003886 Glycoproteins Human genes 0.000 description 9
- 108090000288 Glycoproteins Proteins 0.000 description 9
- 206010039491 Sarcoma Diseases 0.000 description 9
- 210000004602 germ cell Anatomy 0.000 description 9
- 238000002560 therapeutic procedure Methods 0.000 description 9
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 8
- 108020004414 DNA Proteins 0.000 description 8
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 8
- 101000716124 Homo sapiens T-cell surface glycoprotein CD1c Proteins 0.000 description 8
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 8
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 8
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 8
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 8
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 8
- 206010025323 Lymphomas Diseases 0.000 description 8
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 8
- 102100029215 Signaling lymphocytic activation molecule Human genes 0.000 description 8
- 102100024219 T-cell surface glycoprotein CD1a Human genes 0.000 description 8
- 208000009956 adenocarcinoma Diseases 0.000 description 8
- 230000004071 biological effect Effects 0.000 description 8
- 230000006870 function Effects 0.000 description 8
- 239000001963 growth medium Substances 0.000 description 8
- 230000003834 intracellular effect Effects 0.000 description 8
- 230000004048 modification Effects 0.000 description 8
- 238000012986 modification Methods 0.000 description 8
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Chemical compound [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 8
- 208000024891 symptom Diseases 0.000 description 8
- 210000004881 tumor cell Anatomy 0.000 description 8
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 7
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 7
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 7
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 7
- 241000700605 Viruses Species 0.000 description 7
- 230000002776 aggregation Effects 0.000 description 7
- 238000004220 aggregation Methods 0.000 description 7
- WYUKJASPBYYQRJ-VSJOFRJTSA-N beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-GlcpNAc-(1->4)-beta-D-GlcpNAc Chemical compound O[C@@H]1[C@@H](NC(=O)C)[C@H](O)O[C@H](CO)[C@H]1O[C@H]1[C@H](NC(C)=O)[C@@H](O)[C@H](O[C@H]2[C@H]([C@@H](O[C@@H]3[C@H]([C@@H](O)[C@H](O)[C@@H](CO)O3)O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O3)NC(C)=O)[C@H](O)[C@@H](CO[C@@H]3[C@H]([C@@H](O)[C@H](O)[C@@H](CO)O3)O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O3)NC(C)=O)O2)O)[C@@H](CO)O1 WYUKJASPBYYQRJ-VSJOFRJTSA-N 0.000 description 7
- 239000003795 chemical substances by application Substances 0.000 description 7
- 229940127089 cytotoxic agent Drugs 0.000 description 7
- 239000002254 cytotoxic agent Substances 0.000 description 7
- 229960002204 daratumumab Drugs 0.000 description 7
- 230000000694 effects Effects 0.000 description 7
- 210000002540 macrophage Anatomy 0.000 description 7
- 210000004962 mammalian cell Anatomy 0.000 description 7
- 125000000311 mannosyl group Chemical group C1([C@@H](O)[C@@H](O)[C@H](O)[C@H](O1)CO)* 0.000 description 7
- 230000001105 regulatory effect Effects 0.000 description 7
- 239000000523 sample Substances 0.000 description 7
- 206010041823 squamous cell carcinoma Diseases 0.000 description 7
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 7
- 229960000575 trastuzumab Drugs 0.000 description 7
- 239000013598 vector Substances 0.000 description 7
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 6
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 6
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 6
- 102100024263 CD160 antigen Human genes 0.000 description 6
- 201000009030 Carcinoma Diseases 0.000 description 6
- 102000004190 Enzymes Human genes 0.000 description 6
- 108090000790 Enzymes Proteins 0.000 description 6
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 6
- 101000761938 Homo sapiens CD160 antigen Proteins 0.000 description 6
- 101000994375 Homo sapiens Integrin alpha-4 Proteins 0.000 description 6
- 101000935040 Homo sapiens Integrin beta-2 Proteins 0.000 description 6
- 101000633786 Homo sapiens SLAM family member 6 Proteins 0.000 description 6
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 6
- 108010079585 Immunoglobulin Subunits Proteins 0.000 description 6
- 102000012745 Immunoglobulin Subunits Human genes 0.000 description 6
- 102100032818 Integrin alpha-4 Human genes 0.000 description 6
- 102100032816 Integrin alpha-6 Human genes 0.000 description 6
- 102100025390 Integrin beta-2 Human genes 0.000 description 6
- 102000014128 RANK Ligand Human genes 0.000 description 6
- 108010025832 RANK Ligand Proteins 0.000 description 6
- 102100029197 SLAM family member 6 Human genes 0.000 description 6
- 108010074687 Signaling Lymphocytic Activation Molecule Family Member 1 Proteins 0.000 description 6
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 6
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 6
- 102220503881 Tyrosine-protein kinase receptor UFO_P74A_mutation Human genes 0.000 description 6
- 230000003213 activating effect Effects 0.000 description 6
- 229960000548 alemtuzumab Drugs 0.000 description 6
- 235000009582 asparagine Nutrition 0.000 description 6
- 229960001230 asparagine Drugs 0.000 description 6
- GXJABQQUPOEUTA-RDJZCZTQSA-N bortezomib Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)B(O)O)NC(=O)C=1N=CC=NC=1)C1=CC=CC=C1 GXJABQQUPOEUTA-RDJZCZTQSA-N 0.000 description 6
- 229960005395 cetuximab Drugs 0.000 description 6
- 230000007423 decrease Effects 0.000 description 6
- 210000004443 dendritic cell Anatomy 0.000 description 6
- 229940088598 enzyme Drugs 0.000 description 6
- 230000001965 increasing effect Effects 0.000 description 6
- 230000003993 interaction Effects 0.000 description 6
- 230000007246 mechanism Effects 0.000 description 6
- 210000000822 natural killer cell Anatomy 0.000 description 6
- 230000011664 signaling Effects 0.000 description 6
- 239000000126 substance Substances 0.000 description 6
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 5
- 241000588724 Escherichia coli Species 0.000 description 5
- 241000233866 Fungi Species 0.000 description 5
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 5
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 5
- 102100026878 Interleukin-2 receptor subunit alpha Human genes 0.000 description 5
- 102000010638 Kinesin Human genes 0.000 description 5
- 108010063296 Kinesin Proteins 0.000 description 5
- 241001465754 Metazoa Species 0.000 description 5
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 5
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 5
- 229930012538 Paclitaxel Natural products 0.000 description 5
- 241000235648 Pichia Species 0.000 description 5
- 206010035226 Plasma cell myeloma Diseases 0.000 description 5
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 5
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 5
- 102100035533 Stimulator of interferon genes protein Human genes 0.000 description 5
- 101710196623 Stimulator of interferon genes protein Proteins 0.000 description 5
- 230000004913 activation Effects 0.000 description 5
- 239000000556 agonist Substances 0.000 description 5
- SHGAZHPCJJPHSC-YCNIQYBTSA-N all-trans-retinoic acid Chemical compound OC(=O)\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-YCNIQYBTSA-N 0.000 description 5
- 239000002246 antineoplastic agent Substances 0.000 description 5
- SQVRNKJHWKZAKO-UHFFFAOYSA-N beta-N-Acetyl-D-neuraminic acid Natural products CC(=O)NC1C(O)CC(O)(C(O)=O)OC1C(O)C(O)CO SQVRNKJHWKZAKO-UHFFFAOYSA-N 0.000 description 5
- 238000012258 culturing Methods 0.000 description 5
- 230000001086 cytosolic effect Effects 0.000 description 5
- 231100000599 cytotoxic agent Toxicity 0.000 description 5
- 229960000975 daunorubicin Drugs 0.000 description 5
- 230000006240 deamidation Effects 0.000 description 5
- 230000001419 dependent effect Effects 0.000 description 5
- 229960004679 doxorubicin Drugs 0.000 description 5
- 230000036541 health Effects 0.000 description 5
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 5
- 230000001900 immune effect Effects 0.000 description 5
- 230000001939 inductive effect Effects 0.000 description 5
- 239000012678 infectious agent Substances 0.000 description 5
- 238000004519 manufacturing process Methods 0.000 description 5
- 201000001441 melanoma Diseases 0.000 description 5
- 229960001592 paclitaxel Drugs 0.000 description 5
- 244000052769 pathogen Species 0.000 description 5
- 230000037361 pathway Effects 0.000 description 5
- FPVKHBSQESCIEP-JQCXWYLXSA-N pentostatin Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=CNC[C@H]2O)=C2N=C1 FPVKHBSQESCIEP-JQCXWYLXSA-N 0.000 description 5
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 5
- 230000004044 response Effects 0.000 description 5
- 229960001727 tretinoin Drugs 0.000 description 5
- WAEXFXRVDQXREF-UHFFFAOYSA-N vorinostat Chemical compound ONC(=O)CCCCCCC(=O)NC1=CC=CC=C1 WAEXFXRVDQXREF-UHFFFAOYSA-N 0.000 description 5
- UEJJHQNACJXSKW-UHFFFAOYSA-N 2-(2,6-dioxopiperidin-3-yl)-1H-isoindole-1,3(2H)-dione Chemical compound O=C1C2=CC=CC=C2C(=O)N1C1CCC(=O)NC1=O UEJJHQNACJXSKW-UHFFFAOYSA-N 0.000 description 4
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 4
- SJUXYGVRSGTPMC-IMJSIDKUSA-N Asn-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H](N)CC(N)=O SJUXYGVRSGTPMC-IMJSIDKUSA-N 0.000 description 4
- 102100038080 B-cell receptor CD22 Human genes 0.000 description 4
- 102100024217 CAMPATH-1 antigen Human genes 0.000 description 4
- 108010065524 CD52 Antigen Proteins 0.000 description 4
- 241000282693 Cercopithecidae Species 0.000 description 4
- 108091026890 Coding region Proteins 0.000 description 4
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 4
- 108010087819 Fc receptors Proteins 0.000 description 4
- 102000009109 Fc receptors Human genes 0.000 description 4
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 4
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 description 4
- 101001078158 Homo sapiens Integrin alpha-1 Proteins 0.000 description 4
- 101000994365 Homo sapiens Integrin alpha-6 Proteins 0.000 description 4
- 101001046687 Homo sapiens Integrin alpha-E Proteins 0.000 description 4
- 101000935043 Homo sapiens Integrin beta-1 Proteins 0.000 description 4
- 101000971538 Homo sapiens Killer cell lectin-like receptor subfamily F member 1 Proteins 0.000 description 4
- 101000633780 Homo sapiens Signaling lymphocytic activation molecule Proteins 0.000 description 4
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 4
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 4
- 102100025323 Integrin alpha-1 Human genes 0.000 description 4
- 102100022341 Integrin alpha-E Human genes 0.000 description 4
- 102100022339 Integrin alpha-L Human genes 0.000 description 4
- 102100025304 Integrin beta-1 Human genes 0.000 description 4
- 102100021458 Killer cell lectin-like receptor subfamily F member 1 Human genes 0.000 description 4
- 241000235058 Komagataella pastoris Species 0.000 description 4
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 4
- 206010024612 Lipoma Diseases 0.000 description 4
- 102100029193 Low affinity immunoglobulin gamma Fc region receptor III-A Human genes 0.000 description 4
- 208000034578 Multiple myelomas Diseases 0.000 description 4
- 241000699670 Mus sp. Species 0.000 description 4
- MBLBDJOUHNCFQT-UHFFFAOYSA-N N-acetyl-D-galactosamine Natural products CC(=O)NC(C=O)C(O)C(O)C(O)CO MBLBDJOUHNCFQT-UHFFFAOYSA-N 0.000 description 4
- 102100038082 Natural killer cell receptor 2B4 Human genes 0.000 description 4
- 108091000080 Phosphotransferase Proteins 0.000 description 4
- 102100027744 Semaphorin-4D Human genes 0.000 description 4
- 102100038717 TYRO protein tyrosine kinase-binding protein Human genes 0.000 description 4
- 101710187864 TYRO protein tyrosine kinase-binding protein Proteins 0.000 description 4
- MUMGGOZAMZWBJJ-DYKIIFRCSA-N Testostosterone Chemical compound O=C1CC[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 MUMGGOZAMZWBJJ-DYKIIFRCSA-N 0.000 description 4
- 102000004357 Transferases Human genes 0.000 description 4
- 108090000992 Transferases Proteins 0.000 description 4
- 102100028785 Tumor necrosis factor receptor superfamily member 14 Human genes 0.000 description 4
- 239000002253 acid Substances 0.000 description 4
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin D Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 description 4
- 229960000473 altretamine Drugs 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 4
- 230000001640 apoptogenic effect Effects 0.000 description 4
- VSRXQHXAPYXROS-UHFFFAOYSA-N azanide;cyclobutane-1,1-dicarboxylic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OC(=O)C1(C(O)=O)CCC1 VSRXQHXAPYXROS-UHFFFAOYSA-N 0.000 description 4
- 230000001580 bacterial effect Effects 0.000 description 4
- 229960000455 brentuximab vedotin Drugs 0.000 description 4
- 238000004422 calculation algorithm Methods 0.000 description 4
- 229960004562 carboplatin Drugs 0.000 description 4
- 230000001413 cellular effect Effects 0.000 description 4
- 239000003153 chemical reaction reagent Substances 0.000 description 4
- 230000000295 complement effect Effects 0.000 description 4
- 230000004540 complement-dependent cytotoxicity Effects 0.000 description 4
- 229960000684 cytarabine Drugs 0.000 description 4
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 4
- 238000010494 dissociation reaction Methods 0.000 description 4
- 230000005593 dissociations Effects 0.000 description 4
- 229960003668 docetaxel Drugs 0.000 description 4
- AAKJLRGGTJKAMG-UHFFFAOYSA-N erlotinib Chemical compound C=12C=C(OCCOC)C(OCCOC)=CC2=NC=NC=1NC1=CC=CC(C#C)=C1 AAKJLRGGTJKAMG-UHFFFAOYSA-N 0.000 description 4
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 4
- 230000002349 favourable effect Effects 0.000 description 4
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 4
- 229960002949 fluorouracil Drugs 0.000 description 4
- 229960002074 flutamide Drugs 0.000 description 4
- MKXKFYHWDHIYRV-UHFFFAOYSA-N flutamide Chemical compound CC(C)C(=O)NC1=CC=C([N+]([O-])=O)C(C(F)(F)F)=C1 MKXKFYHWDHIYRV-UHFFFAOYSA-N 0.000 description 4
- 230000004927 fusion Effects 0.000 description 4
- 208000005017 glioblastoma Diseases 0.000 description 4
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 4
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 4
- UUVWYPNAQBNQJQ-UHFFFAOYSA-N hexamethylmelamine Chemical compound CN(C)C1=NC(N(C)C)=NC(N(C)C)=N1 UUVWYPNAQBNQJQ-UHFFFAOYSA-N 0.000 description 4
- 229910052739 hydrogen Inorganic materials 0.000 description 4
- 229960000908 idarubicin Drugs 0.000 description 4
- 229940072221 immunoglobulins Drugs 0.000 description 4
- 238000004949 mass spectrometry Methods 0.000 description 4
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 4
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 4
- 230000000394 mitotic effect Effects 0.000 description 4
- 229960001156 mitoxantrone Drugs 0.000 description 4
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 4
- 239000002773 nucleotide Substances 0.000 description 4
- 125000003729 nucleotide group Chemical group 0.000 description 4
- 229960002450 ofatumumab Drugs 0.000 description 4
- 201000008968 osteosarcoma Diseases 0.000 description 4
- 210000001672 ovary Anatomy 0.000 description 4
- 229960001756 oxaliplatin Drugs 0.000 description 4
- DWAFYCQODLXJNR-BNTLRKBRSA-L oxaliplatin Chemical compound O1C(=O)C(=O)O[Pt]11N[C@@H]2CCCC[C@H]2N1 DWAFYCQODLXJNR-BNTLRKBRSA-L 0.000 description 4
- 230000001717 pathogenic effect Effects 0.000 description 4
- 229960002340 pentostatin Drugs 0.000 description 4
- 229960002087 pertuzumab Drugs 0.000 description 4
- 210000001539 phagocyte Anatomy 0.000 description 4
- 102000020233 phosphotransferase Human genes 0.000 description 4
- 229910052697 platinum Inorganic materials 0.000 description 4
- 230000002829 reductive effect Effects 0.000 description 4
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 4
- 229960001278 teniposide Drugs 0.000 description 4
- 229960003433 thalidomide Drugs 0.000 description 4
- WYWHKKSPHMUBEB-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 4
- 229960000303 topotecan Drugs 0.000 description 4
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 4
- 229960001612 trastuzumab emtansine Drugs 0.000 description 4
- LKJPYSCBVHEWIU-KRWDZBQOSA-N (R)-bicalutamide Chemical compound C([C@@](O)(C)C(=O)NC=1C=C(C(C#N)=CC=1)C(F)(F)F)S(=O)(=O)C1=CC=C(F)C=C1 LKJPYSCBVHEWIU-KRWDZBQOSA-N 0.000 description 3
- TZCPCKNHXULUIY-RGULYWFUSA-N 1,2-distearoyl-sn-glycero-3-phosphoserine Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(=O)OC[C@H](N)C(O)=O)OC(=O)CCCCCCCCCCCCCCCCC TZCPCKNHXULUIY-RGULYWFUSA-N 0.000 description 3
- RTQWWZBSTRGEAV-PKHIMPSTSA-N 2-[[(2s)-2-[bis(carboxymethyl)amino]-3-[4-(methylcarbamoylamino)phenyl]propyl]-[2-[bis(carboxymethyl)amino]propyl]amino]acetic acid Chemical compound CNC(=O)NC1=CC=C(C[C@@H](CN(CC(C)N(CC(O)=O)CC(O)=O)CC(O)=O)N(CC(O)=O)CC(O)=O)C=C1 RTQWWZBSTRGEAV-PKHIMPSTSA-N 0.000 description 3
- AOJJSUZBOXZQNB-VTZDEGQISA-N 4'-epidoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-VTZDEGQISA-N 0.000 description 3
- XAUDJQYHKZQPEU-KVQBGUIXSA-N 5-aza-2'-deoxycytidine Chemical compound O=C1N=C(N)N=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 XAUDJQYHKZQPEU-KVQBGUIXSA-N 0.000 description 3
- VDABVNMGKGUPEY-UHFFFAOYSA-N 6-carboxyfluorescein succinimidyl ester Chemical compound C=1C(O)=CC=C2C=1OC1=CC(O)=CC=C1C2(C1=C2)OC(=O)C1=CC=C2C(=O)ON1C(=O)CCC1=O VDABVNMGKGUPEY-UHFFFAOYSA-N 0.000 description 3
- 102100031585 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Human genes 0.000 description 3
- BUROJSBIWGDYCN-GAUTUEMISA-N AP 23573 Chemical compound C1C[C@@H](OP(C)(C)=O)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 BUROJSBIWGDYCN-GAUTUEMISA-N 0.000 description 3
- WPWUFUBLGADILS-WDSKDSINSA-N Ala-Pro Chemical compound C[C@H](N)C(=O)N1CCC[C@H]1C(O)=O WPWUFUBLGADILS-WDSKDSINSA-N 0.000 description 3
- 201000003076 Angiosarcoma Diseases 0.000 description 3
- KLKHFFMNGWULBN-VKHMYHEASA-N Asn-Gly Chemical group NC(=O)C[C@H](N)C(=O)NCC(O)=O KLKHFFMNGWULBN-VKHMYHEASA-N 0.000 description 3
- JHFNSBBHKSZXKB-VKHMYHEASA-N Asp-Gly Chemical group OC(=O)C[C@H](N)C(=O)NCC(O)=O JHFNSBBHKSZXKB-VKHMYHEASA-N 0.000 description 3
- 206010003571 Astrocytoma Diseases 0.000 description 3
- MLDQJTXFUGDVEO-UHFFFAOYSA-N BAY-43-9006 Chemical compound C1=NC(C(=O)NC)=CC(OC=2C=CC(NC(=O)NC=3C=C(C(Cl)=CC=3)C(F)(F)F)=CC=2)=C1 MLDQJTXFUGDVEO-UHFFFAOYSA-N 0.000 description 3
- 241000894006 Bacteria Species 0.000 description 3
- 208000035143 Bacterial infection Diseases 0.000 description 3
- 108010006654 Bleomycin Proteins 0.000 description 3
- 206010006187 Breast cancer Diseases 0.000 description 3
- 208000026310 Breast neoplasm Diseases 0.000 description 3
- 101150013553 CD40 gene Proteins 0.000 description 3
- 102100029968 Calreticulin Human genes 0.000 description 3
- 108090000549 Calreticulin Proteins 0.000 description 3
- KLWPJMFMVPTNCC-UHFFFAOYSA-N Camptothecin Natural products CCC1(O)C(=O)OCC2=C1C=C3C4Nc5ccccc5C=C4CN3C2=O KLWPJMFMVPTNCC-UHFFFAOYSA-N 0.000 description 3
- GAGWJHPBXLXJQN-UORFTKCHSA-N Capecitabine Chemical compound C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](C)O1 GAGWJHPBXLXJQN-UORFTKCHSA-N 0.000 description 3
- GAGWJHPBXLXJQN-UHFFFAOYSA-N Capecitabine Natural products C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1C1C(O)C(O)C(C)O1 GAGWJHPBXLXJQN-UHFFFAOYSA-N 0.000 description 3
- 241000699800 Cricetinae Species 0.000 description 3
- 241000699802 Cricetulus griseus Species 0.000 description 3
- 102000004127 Cytokines Human genes 0.000 description 3
- 108090000695 Cytokines Proteins 0.000 description 3
- 108010041986 DNA Vaccines Proteins 0.000 description 3
- 229940021995 DNA vaccine Drugs 0.000 description 3
- ZBNZXTGUTAYRHI-UHFFFAOYSA-N Dasatinib Chemical compound C=1C(N2CCN(CCO)CC2)=NC(C)=NC=1NC(S1)=NC=C1C(=O)NC1=C(C)C=CC=C1Cl ZBNZXTGUTAYRHI-UHFFFAOYSA-N 0.000 description 3
- YZCKVEUIGOORGS-OUBTZVSYSA-N Deuterium Chemical compound [2H] YZCKVEUIGOORGS-OUBTZVSYSA-N 0.000 description 3
- 206010014733 Endometrial cancer Diseases 0.000 description 3
- 206010014759 Endometrial neoplasm Diseases 0.000 description 3
- HTIJFSOGRVMCQR-UHFFFAOYSA-N Epirubicin Natural products COc1cccc2C(=O)c3c(O)c4CC(O)(CC(OC5CC(N)C(=O)C(C)O5)c4c(O)c3C(=O)c12)C(=O)CO HTIJFSOGRVMCQR-UHFFFAOYSA-N 0.000 description 3
- 241000206602 Eukaryota Species 0.000 description 3
- 201000008808 Fibrosarcoma Diseases 0.000 description 3
- VWUXBMIQPBEWFH-WCCTWKNTSA-N Fulvestrant Chemical compound OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3[C@H](CCCCCCCCCS(=O)CCCC(F)(F)C(F)(F)F)CC2=C1 VWUXBMIQPBEWFH-WCCTWKNTSA-N 0.000 description 3
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 3
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 description 3
- ZWZWYGMENQVNFU-UHFFFAOYSA-N Glycerophosphorylserin Natural products OC(=O)C(N)COP(O)(=O)OCC(O)CO ZWZWYGMENQVNFU-UHFFFAOYSA-N 0.000 description 3
- 108010069236 Goserelin Proteins 0.000 description 3
- 208000001258 Hemangiosarcoma Diseases 0.000 description 3
- 102100034458 Hepatitis A virus cellular receptor 2 Human genes 0.000 description 3
- 101000777636 Homo sapiens ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Proteins 0.000 description 3
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 description 3
- 101001068133 Homo sapiens Hepatitis A virus cellular receptor 2 Proteins 0.000 description 3
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 3
- 101000633784 Homo sapiens SLAM family member 7 Proteins 0.000 description 3
- 101000709256 Homo sapiens Signal-regulatory protein beta-1 Proteins 0.000 description 3
- 101000643024 Homo sapiens Stimulator of interferon genes protein Proteins 0.000 description 3
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 description 3
- 101000596234 Homo sapiens T-cell surface protein tactile Proteins 0.000 description 3
- 241000701806 Human papillomavirus Species 0.000 description 3
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 3
- 239000005511 L01XE05 - Sorafenib Substances 0.000 description 3
- 239000002067 L01XE06 - Dasatinib Substances 0.000 description 3
- 108010000817 Leuprolide Proteins 0.000 description 3
- 241000186781 Listeria Species 0.000 description 3
- 101710099301 Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 3
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 3
- OVRNDRQMDRJTHS-FMDGEEDCSA-N N-acetyl-beta-D-glucosamine Chemical group CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-FMDGEEDCSA-N 0.000 description 3
- SQVRNKJHWKZAKO-PFQGKNLYSA-N N-acetyl-beta-neuraminic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)O[C@H]1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-PFQGKNLYSA-N 0.000 description 3
- 108091007491 NSP3 Papain-like protease domains Proteins 0.000 description 3
- 206010029260 Neuroblastoma Diseases 0.000 description 3
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 3
- 108091034117 Oligonucleotide Proteins 0.000 description 3
- 206010033128 Ovarian cancer Diseases 0.000 description 3
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 3
- 241000700159 Rattus Species 0.000 description 3
- 101710100969 Receptor tyrosine-protein kinase erbB-3 Proteins 0.000 description 3
- 102100029986 Receptor tyrosine-protein kinase erbB-3 Human genes 0.000 description 3
- 241000283984 Rodentia Species 0.000 description 3
- 102100029198 SLAM family member 7 Human genes 0.000 description 3
- 208000005718 Stomach Neoplasms Diseases 0.000 description 3
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 description 3
- 102100035268 T-cell surface protein tactile Human genes 0.000 description 3
- BPEGJWRSRHCHSN-UHFFFAOYSA-N Temozolomide Chemical compound O=C1N(C)N=NC2=C(C(N)=O)N=CN21 BPEGJWRSRHCHSN-UHFFFAOYSA-N 0.000 description 3
- 206010043276 Teratoma Diseases 0.000 description 3
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 3
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 description 3
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 3
- 208000036142 Viral infection Diseases 0.000 description 3
- 230000009471 action Effects 0.000 description 3
- 230000004075 alteration Effects 0.000 description 3
- 239000004037 angiogenesis inhibitor Substances 0.000 description 3
- 229940121369 angiogenesis inhibitor Drugs 0.000 description 3
- 230000000340 anti-metabolite Effects 0.000 description 3
- 229940100197 antimetabolite Drugs 0.000 description 3
- 239000002256 antimetabolite Substances 0.000 description 3
- 239000003719 aurora kinase inhibitor Substances 0.000 description 3
- 208000022362 bacterial infectious disease Diseases 0.000 description 3
- GRHWEVYJIHXESA-HBHDJDHDSA-N beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc Chemical compound O[C@@H]1[C@@H](NC(=O)C)[C@H](O)O[C@H](CO)[C@H]1O[C@H]1[C@H](NC(C)=O)[C@@H](O)[C@H](O[C@H]2[C@H]([C@@H](O[C@@H]3[C@H]([C@@H](O)[C@H](O)[C@@H](CO)O3)O[C@H]3[C@@H]([C@@H](O)[C@H](O[C@H]4[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO)O4)O)[C@@H](CO)O3)NC(C)=O)[C@H](O)[C@@H](CO[C@@H]3[C@H]([C@@H](O)[C@H](O)[C@@H](CO)O3)O[C@H]3[C@@H]([C@@H](O)[C@H](O[C@H]4[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO)O4)O)[C@@H](CO)O3)NC(C)=O)O2)O)[C@@H](CO)O1 GRHWEVYJIHXESA-HBHDJDHDSA-N 0.000 description 3
- 229960000397 bevacizumab Drugs 0.000 description 3
- 229960000997 bicalutamide Drugs 0.000 description 3
- 230000001588 bifunctional effect Effects 0.000 description 3
- 229960001561 bleomycin Drugs 0.000 description 3
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 3
- 229960001467 bortezomib Drugs 0.000 description 3
- 229940127093 camptothecin Drugs 0.000 description 3
- VSJKWCGYPAHWDS-FQEVSTJZSA-N camptothecin Chemical compound C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-FQEVSTJZSA-N 0.000 description 3
- 229960004117 capecitabine Drugs 0.000 description 3
- 150000001720 carbohydrates Chemical class 0.000 description 3
- 208000002458 carcinoid tumor Diseases 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 230000001684 chronic effect Effects 0.000 description 3
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 3
- 229960004316 cisplatin Drugs 0.000 description 3
- 238000003776 cleavage reaction Methods 0.000 description 3
- 230000001268 conjugating effect Effects 0.000 description 3
- 238000004132 cross linking Methods 0.000 description 3
- 125000004122 cyclic group Chemical group 0.000 description 3
- 229960004397 cyclophosphamide Drugs 0.000 description 3
- 239000000824 cytostatic agent Substances 0.000 description 3
- 231100000433 cytotoxic Toxicity 0.000 description 3
- 230000001472 cytotoxic effect Effects 0.000 description 3
- 230000003247 decreasing effect Effects 0.000 description 3
- 238000001514 detection method Methods 0.000 description 3
- 229910052805 deuterium Inorganic materials 0.000 description 3
- VSJKWCGYPAHWDS-UHFFFAOYSA-N dl-camptothecin Natural products C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-UHFFFAOYSA-N 0.000 description 3
- 229940079593 drug Drugs 0.000 description 3
- 229960004137 elotuzumab Drugs 0.000 description 3
- 239000003623 enhancer Substances 0.000 description 3
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 description 3
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 description 3
- 229960001904 epirubicin Drugs 0.000 description 3
- 229960001842 estramustine Drugs 0.000 description 3
- FRPJXPJMRWBBIH-RBRWEJTLSA-N estramustine Chemical compound ClCCN(CCCl)C(=O)OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 FRPJXPJMRWBBIH-RBRWEJTLSA-N 0.000 description 3
- 229960005420 etoposide Drugs 0.000 description 3
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 3
- 206010016629 fibroma Diseases 0.000 description 3
- 229960004039 finasteride Drugs 0.000 description 3
- DBEPLOCGEIEOCV-WSBQPABSSA-N finasteride Chemical compound N([C@@H]1CC2)C(=O)C=C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H](C(=O)NC(C)(C)C)[C@@]2(C)CC1 DBEPLOCGEIEOCV-WSBQPABSSA-N 0.000 description 3
- 229960000390 fludarabine Drugs 0.000 description 3
- 229960002258 fulvestrant Drugs 0.000 description 3
- 230000002538 fungal effect Effects 0.000 description 3
- 229930182830 galactose Natural products 0.000 description 3
- 206010017758 gastric cancer Diseases 0.000 description 3
- 108020002326 glutamine synthetase Proteins 0.000 description 3
- 201000011066 hemangioma Diseases 0.000 description 3
- 239000003276 histone deacetylase inhibitor Substances 0.000 description 3
- 229940121372 histone deacetylase inhibitor Drugs 0.000 description 3
- 102000049958 human SIRPB1 Human genes 0.000 description 3
- 210000004408 hybridoma Anatomy 0.000 description 3
- 229960001001 ibritumomab tiuxetan Drugs 0.000 description 3
- KTUFNOKKBVMGRW-UHFFFAOYSA-N imatinib Chemical compound C1CN(C)CCN1CC1=CC=C(C(=O)NC=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=CC=2)C=C1 KTUFNOKKBVMGRW-UHFFFAOYSA-N 0.000 description 3
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 3
- 230000002519 immonomodulatory effect Effects 0.000 description 3
- 210000002865 immune cell Anatomy 0.000 description 3
- 230000028993 immune response Effects 0.000 description 3
- 229940127121 immunoconjugate Drugs 0.000 description 3
- 230000005847 immunogenicity Effects 0.000 description 3
- 238000000338 in vitro Methods 0.000 description 3
- 238000001727 in vivo Methods 0.000 description 3
- 229950005015 inebilizumab Drugs 0.000 description 3
- 230000002401 inhibitory effect Effects 0.000 description 3
- 229960005386 ipilimumab Drugs 0.000 description 3
- 229960004768 irinotecan Drugs 0.000 description 3
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 3
- 229940043355 kinase inhibitor Drugs 0.000 description 3
- GFIJNRVAKGFPGQ-LIJARHBVSA-N leuprolide Chemical compound CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=CC=C(O)C=C1 GFIJNRVAKGFPGQ-LIJARHBVSA-N 0.000 description 3
- 229960004338 leuprorelin Drugs 0.000 description 3
- 229950010079 lumretuzumab Drugs 0.000 description 3
- 229950003135 margetuximab Drugs 0.000 description 3
- 239000011159 matrix material Substances 0.000 description 3
- 238000005259 measurement Methods 0.000 description 3
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 3
- 229960001924 melphalan Drugs 0.000 description 3
- 238000002844 melting Methods 0.000 description 3
- 230000008018 melting Effects 0.000 description 3
- 206010027191 meningioma Diseases 0.000 description 3
- 229960001428 mercaptopurine Drugs 0.000 description 3
- 229960000485 methotrexate Drugs 0.000 description 3
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 3
- CFCUWKMKBJTWLW-BKHRDMLASA-N mithramycin Chemical compound O([C@@H]1C[C@@H](O[C@H](C)[C@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1C)O[C@@H]1O[C@H](C)[C@@H](O)[C@H](O[C@@H]2O[C@H](C)[C@H](O)[C@H](O[C@@H]3O[C@H](C)[C@@H](O)[C@@](C)(O)C3)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@@H](O)[C@H](O)[C@@H](C)O1 CFCUWKMKBJTWLW-BKHRDMLASA-N 0.000 description 3
- 229960004857 mitomycin Drugs 0.000 description 3
- 230000000869 mutational effect Effects 0.000 description 3
- 210000000066 myeloid cell Anatomy 0.000 description 3
- HNQXDLYBFNWFEE-VHZSLYHRSA-N n-[(2r,3r,4r,5s,6r)-2-[(2r,3r,4s,5r)-2-acetamido-5-[(2r,3s,4s,5r,6r)-5-hydroxy-6-(hydroxymethyl)-3,4-bis[[(2r,3s,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy]oxan-2-yl]oxy-1-oxo-4-[(2s,3s,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl] Chemical compound O([C@H]([C@H](C=O)NC(=O)C)[C@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@@H](CO)O1)O)[C@@H](CO[C@@H]1[C@H]([C@@H](O)[C@H](O)[C@@H](CO)O1)O)O[C@@H]1[C@H]([C@@H](O[C@@H]2[C@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)O)[C@H](O)[C@@H](CO)O1)O[C@@H]1[C@H]([C@@H](O)[C@H](O)[C@@H](CO)O1)O)[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1NC(C)=O HNQXDLYBFNWFEE-VHZSLYHRSA-N 0.000 description 3
- YOHYSYJDKVYCJI-UHFFFAOYSA-N n-[3-[[6-[3-(trifluoromethyl)anilino]pyrimidin-4-yl]amino]phenyl]cyclopropanecarboxamide Chemical compound FC(F)(F)C1=CC=CC(NC=2N=CN=C(NC=3C=C(NC(=O)C4CC4)C=CC=3)C=2)=C1 YOHYSYJDKVYCJI-UHFFFAOYSA-N 0.000 description 3
- 229950006780 n-acetylglucosamine Drugs 0.000 description 3
- 229960003347 obinutuzumab Drugs 0.000 description 3
- 229960001972 panitumumab Drugs 0.000 description 3
- 229960005079 pemetrexed Drugs 0.000 description 3
- QOFFJEBXNKRSPX-ZDUSSCGKSA-N pemetrexed Chemical compound C1=N[C]2NC(N)=NC(=O)C2=C1CCC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 QOFFJEBXNKRSPX-ZDUSSCGKSA-N 0.000 description 3
- 239000008194 pharmaceutical composition Substances 0.000 description 3
- 239000003757 phosphotransferase inhibitor Substances 0.000 description 3
- 239000013612 plasmid Substances 0.000 description 3
- 229960003171 plicamycin Drugs 0.000 description 3
- 229920001481 poly(stearyl methacrylate) Polymers 0.000 description 3
- 229920000642 polymer Polymers 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 238000000746 purification Methods 0.000 description 3
- 238000001959 radiotherapy Methods 0.000 description 3
- 229960004622 raloxifene Drugs 0.000 description 3
- GZUITABIAKMVPG-UHFFFAOYSA-N raloxifene Chemical compound C1=CC(O)=CC=C1C1=C(C(=O)C=2C=CC(OCCN3CCCCC3)=CC=2)C2=CC=C(O)C=C2S1 GZUITABIAKMVPG-UHFFFAOYSA-N 0.000 description 3
- 238000003259 recombinant expression Methods 0.000 description 3
- 229930002330 retinoic acid Natural products 0.000 description 3
- 230000007017 scission Effects 0.000 description 3
- 210000002966 serum Anatomy 0.000 description 3
- 230000019491 signal transduction Effects 0.000 description 3
- 239000002904 solvent Substances 0.000 description 3
- 229960003787 sorafenib Drugs 0.000 description 3
- 201000011549 stomach cancer Diseases 0.000 description 3
- 235000000346 sugar Nutrition 0.000 description 3
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 3
- 229960001603 tamoxifen Drugs 0.000 description 3
- 238000002626 targeted therapy Methods 0.000 description 3
- 229960004964 temozolomide Drugs 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- 229960005026 toremifene Drugs 0.000 description 3
- XFCLJVABOIYOMF-QPLCGJKRSA-N toremifene Chemical compound C1=CC(OCCN(C)C)=CC=C1C(\C=1C=CC=CC=1)=C(\CCCl)C1=CC=CC=C1 XFCLJVABOIYOMF-QPLCGJKRSA-N 0.000 description 3
- 229960005267 tositumomab Drugs 0.000 description 3
- 238000013518 transcription Methods 0.000 description 3
- 230000035897 transcription Effects 0.000 description 3
- 239000003558 transferase inhibitor Substances 0.000 description 3
- 230000009261 transgenic effect Effects 0.000 description 3
- 229950004593 ublituximab Drugs 0.000 description 3
- 229950005972 urelumab Drugs 0.000 description 3
- 229950000815 veltuzumab Drugs 0.000 description 3
- GPXBXXGIAQBQNI-UHFFFAOYSA-N vemurafenib Chemical compound CCCS(=O)(=O)NC1=CC=C(F)C(C(=O)C=2C3=CC(=CN=C3NC=2)C=2C=CC(Cl)=CC=2)=C1F GPXBXXGIAQBQNI-UHFFFAOYSA-N 0.000 description 3
- 229960003048 vinblastine Drugs 0.000 description 3
- JXLYSJRDGCGARV-CFWMRBGOSA-N vinblastine Chemical compound C([C@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-CFWMRBGOSA-N 0.000 description 3
- 229960004528 vincristine Drugs 0.000 description 3
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 3
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 3
- 230000009385 viral infection Effects 0.000 description 3
- 229960000237 vorinostat Drugs 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- WVTKBKWTSCPRNU-KYJUHHDHSA-N (+)-Tetrandrine Chemical compound C([C@H]1C=2C=C(C(=CC=2CCN1C)OC)O1)C(C=C2)=CC=C2OC(=C2)C(OC)=CC=C2C[C@@H]2N(C)CCC3=CC(OC)=C(OC)C1=C23 WVTKBKWTSCPRNU-KYJUHHDHSA-N 0.000 description 2
- FPVKHBSQESCIEP-UHFFFAOYSA-N (8S)-3-(2-deoxy-beta-D-erythro-pentofuranosyl)-3,6,7,8-tetrahydroimidazo[4,5-d][1,3]diazepin-8-ol Natural products C1C(O)C(CO)OC1N1C(NC=NCC2O)=C2N=C1 FPVKHBSQESCIEP-UHFFFAOYSA-N 0.000 description 2
- FDKXTQMXEQVLRF-ZHACJKMWSA-N (E)-dacarbazine Chemical compound CN(C)\N=N\c1[nH]cnc1C(N)=O FDKXTQMXEQVLRF-ZHACJKMWSA-N 0.000 description 2
- VSNHCAURESNICA-NJFSPNSNSA-N 1-oxidanylurea Chemical compound N[14C](=O)NO VSNHCAURESNICA-NJFSPNSNSA-N 0.000 description 2
- ROZCIVXTLACYNY-UHFFFAOYSA-N 2,3,4,5,6-pentafluoro-n-(3-fluoro-4-methoxyphenyl)benzenesulfonamide Chemical compound C1=C(F)C(OC)=CC=C1NS(=O)(=O)C1=C(F)C(F)=C(F)C(F)=C1F ROZCIVXTLACYNY-UHFFFAOYSA-N 0.000 description 2
- JICOGKJOQXTAIP-UHFFFAOYSA-N 2-(4-hydroxyphenyl)-3-methyl-1-[[4-(2-piperidin-1-ylethoxy)phenyl]methyl]indol-5-ol Chemical compound C=1C=C(OCCN2CCCCC2)C=CC=1CN1C2=CC=C(O)C=C2C(C)=C1C1=CC=C(O)C=C1 JICOGKJOQXTAIP-UHFFFAOYSA-N 0.000 description 2
- PIMQWRZWLQKKBJ-SFHVURJKSA-N 2-[(2S)-1-[3-ethyl-7-[(1-oxido-3-pyridin-1-iumyl)methylamino]-5-pyrazolo[1,5-a]pyrimidinyl]-2-piperidinyl]ethanol Chemical compound C=1C(N2[C@@H](CCCC2)CCO)=NC2=C(CC)C=NN2C=1NCC1=CC=C[N+]([O-])=C1 PIMQWRZWLQKKBJ-SFHVURJKSA-N 0.000 description 2
- BSKHPKMHTQYZBB-UHFFFAOYSA-N 2-methylpyridine Chemical compound CC1=CC=CC=N1 BSKHPKMHTQYZBB-UHFFFAOYSA-N 0.000 description 2
- NDMPLJNOPCLANR-UHFFFAOYSA-N 3,4-dihydroxy-15-(4-hydroxy-18-methoxycarbonyl-5,18-seco-ibogamin-18-yl)-16-methoxy-1-methyl-6,7-didehydro-aspidospermidine-3-carboxylic acid methyl ester Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 NDMPLJNOPCLANR-UHFFFAOYSA-N 0.000 description 2
- AXRCEOKUDYDWLF-UHFFFAOYSA-N 3-(1-methyl-3-indolyl)-4-[1-[1-(2-pyridinylmethyl)-4-piperidinyl]-3-indolyl]pyrrole-2,5-dione Chemical compound C12=CC=CC=C2N(C)C=C1C(C(NC1=O)=O)=C1C(C1=CC=CC=C11)=CN1C(CC1)CCN1CC1=CC=CC=N1 AXRCEOKUDYDWLF-UHFFFAOYSA-N 0.000 description 2
- VPFUWHKTPYPNGT-UHFFFAOYSA-N 3-(3,4-dihydroxyphenyl)-1-(5-hydroxy-2,2-dimethylchromen-6-yl)propan-1-one Chemical compound OC1=C2C=CC(C)(C)OC2=CC=C1C(=O)CCC1=CC=C(O)C(O)=C1 VPFUWHKTPYPNGT-UHFFFAOYSA-N 0.000 description 2
- IDPUKCWIGUEADI-UHFFFAOYSA-N 5-[bis(2-chloroethyl)amino]uracil Chemical compound ClCCN(CCCl)C1=CNC(=O)NC1=O IDPUKCWIGUEADI-UHFFFAOYSA-N 0.000 description 2
- 239000002677 5-alpha reductase inhibitor Substances 0.000 description 2
- CERZMXAJYMMUDR-QBTAGHCHSA-N 5-amino-3,5-dideoxy-D-glycero-D-galacto-non-2-ulopyranosonic acid Chemical compound N[C@@H]1[C@@H](O)CC(O)(C(O)=O)O[C@H]1[C@H](O)[C@H](O)CO CERZMXAJYMMUDR-QBTAGHCHSA-N 0.000 description 2
- JTDYUFSDZATMKU-UHFFFAOYSA-N 6-(1,3-dioxo-2-benzo[de]isoquinolinyl)-N-hydroxyhexanamide Chemical compound C1=CC(C(N(CCCCCC(=O)NO)C2=O)=O)=C3C2=CC=CC3=C1 JTDYUFSDZATMKU-UHFFFAOYSA-N 0.000 description 2
- 102100023990 60S ribosomal protein L17 Human genes 0.000 description 2
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 2
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 description 2
- CXISPYVYMQWFLE-VKHMYHEASA-N Ala-Gly Chemical compound C[C@H]([NH3+])C(=O)NCC([O-])=O CXISPYVYMQWFLE-VKHMYHEASA-N 0.000 description 2
- 108010012934 Albumin-Bound Paclitaxel Proteins 0.000 description 2
- 108700028369 Alleles Proteins 0.000 description 2
- 108010032595 Antibody Binding Sites Proteins 0.000 description 2
- BFYIZQONLCFLEV-DAELLWKTSA-N Aromasine Chemical compound O=C1C=C[C@]2(C)[C@H]3CC[C@](C)(C(CC4)=O)[C@@H]4[C@@H]3CC(=C)C2=C1 BFYIZQONLCFLEV-DAELLWKTSA-N 0.000 description 2
- GOLCXWYRSKYTSP-UHFFFAOYSA-N Arsenious Acid Chemical compound O1[As]2O[As]1O2 GOLCXWYRSKYTSP-UHFFFAOYSA-N 0.000 description 2
- GADKFYNESXNRLC-WDSKDSINSA-N Asn-Pro Chemical compound NC(=O)C[C@H](N)C(=O)N1CCC[C@H]1C(O)=O GADKFYNESXNRLC-WDSKDSINSA-N 0.000 description 2
- 108010024976 Asparaginase Proteins 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 102100029822 B- and T-lymphocyte attenuator Human genes 0.000 description 2
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 2
- 108010074708 B7-H1 Antigen Proteins 0.000 description 2
- 239000012664 BCL-2-inhibitor Substances 0.000 description 2
- 229940123711 Bcl2 inhibitor Drugs 0.000 description 2
- 206010005003 Bladder cancer Diseases 0.000 description 2
- 241000283690 Bos taurus Species 0.000 description 2
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 2
- 108010056102 CD100 antigen Proteins 0.000 description 2
- 108010017009 CD11b Antigen Proteins 0.000 description 2
- 102100038077 CD226 antigen Human genes 0.000 description 2
- 102100027207 CD27 antigen Human genes 0.000 description 2
- 102100038078 CD276 antigen Human genes 0.000 description 2
- 102100032912 CD44 antigen Human genes 0.000 description 2
- 108010062802 CD66 antigens Proteins 0.000 description 2
- 102100035793 CD83 antigen Human genes 0.000 description 2
- 241000222122 Candida albicans Species 0.000 description 2
- 241000283707 Capra Species 0.000 description 2
- 102100024533 Carcinoembryonic antigen-related cell adhesion molecule 1 Human genes 0.000 description 2
- DLGOEMSEDOSKAD-UHFFFAOYSA-N Carmustine Chemical compound ClCCNC(=O)N(N=O)CCCl DLGOEMSEDOSKAD-UHFFFAOYSA-N 0.000 description 2
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 description 2
- 206010008342 Cervix carcinoma Diseases 0.000 description 2
- 241000606161 Chlamydia Species 0.000 description 2
- JWBOIMRXGHLCPP-UHFFFAOYSA-N Chloditan Chemical compound C=1C=CC=C(Cl)C=1C(C(Cl)Cl)C1=CC=C(Cl)C=C1 JWBOIMRXGHLCPP-UHFFFAOYSA-N 0.000 description 2
- 208000005243 Chondrosarcoma Diseases 0.000 description 2
- 208000006332 Choriocarcinoma Diseases 0.000 description 2
- 241001674013 Chrysosporium lucknowense Species 0.000 description 2
- PHEDXBVPIONUQT-UHFFFAOYSA-N Cocarcinogen A1 Natural products CCCCCCCCCCCCCC(=O)OC1C(C)C2(O)C3C=C(C)C(=O)C3(O)CC(CO)=CC2C2C1(OC(C)=O)C2(C)C PHEDXBVPIONUQT-UHFFFAOYSA-N 0.000 description 2
- 206010009944 Colon cancer Diseases 0.000 description 2
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 2
- 102220614178 Cyclin-dependent kinase 2_S228P_mutation Human genes 0.000 description 2
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 2
- 102100027816 Cytotoxic and regulatory T-cell molecule Human genes 0.000 description 2
- 108010092160 Dactinomycin Proteins 0.000 description 2
- 229920002307 Dextran Polymers 0.000 description 2
- 239000012824 ERK inhibitor Substances 0.000 description 2
- 102100025137 Early activation antigen CD69 Human genes 0.000 description 2
- 241000196324 Embryophyta Species 0.000 description 2
- 206010014967 Ependymoma Diseases 0.000 description 2
- 108010066687 Epithelial Cell Adhesion Molecule Proteins 0.000 description 2
- 102000018651 Epithelial Cell Adhesion Molecule Human genes 0.000 description 2
- 241000283073 Equus caballus Species 0.000 description 2
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 2
- HKVAMNSJSFKALM-GKUWKFKPSA-N Everolimus Chemical compound C1C[C@@H](OCCO)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 HKVAMNSJSFKALM-GKUWKFKPSA-N 0.000 description 2
- 208000006168 Ewing Sarcoma Diseases 0.000 description 2
- 108010021470 Fc gamma receptor IIC Proteins 0.000 description 2
- 206010017533 Fungal infection Diseases 0.000 description 2
- 241001149959 Fusarium sp. Species 0.000 description 2
- 208000032612 Glial tumor Diseases 0.000 description 2
- 206010018338 Glioma Diseases 0.000 description 2
- BLCLNMBMMGCOAS-URPVMXJPSA-N Goserelin Chemical compound C([C@@H](C(=O)N[C@H](COC(C)(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N1[C@@H](CCC1)C(=O)NNC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H]1NC(=O)CC1)C1=CC=C(O)C=C1 BLCLNMBMMGCOAS-URPVMXJPSA-N 0.000 description 2
- 229940125497 HER2 kinase inhibitor Drugs 0.000 description 2
- 208000002927 Hamartoma Diseases 0.000 description 2
- 102000002812 Heat-Shock Proteins Human genes 0.000 description 2
- 108010004889 Heat-Shock Proteins Proteins 0.000 description 2
- 102000003964 Histone deacetylase Human genes 0.000 description 2
- 108090000353 Histone deacetylase Proteins 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 101000864344 Homo sapiens B- and T-lymphocyte attenuator Proteins 0.000 description 2
- 101000884298 Homo sapiens CD226 antigen Proteins 0.000 description 2
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 description 2
- 101000868273 Homo sapiens CD44 antigen Proteins 0.000 description 2
- 101000946856 Homo sapiens CD83 antigen Proteins 0.000 description 2
- 101000721661 Homo sapiens Cellular tumor antigen p53 Proteins 0.000 description 2
- 101000889276 Homo sapiens Cytotoxic T-lymphocyte protein 4 Proteins 0.000 description 2
- 101000934374 Homo sapiens Early activation antigen CD69 Proteins 0.000 description 2
- 101001047628 Homo sapiens Immunoglobulin kappa variable 2-29 Proteins 0.000 description 2
- 101001035237 Homo sapiens Integrin alpha-D Proteins 0.000 description 2
- 101001046683 Homo sapiens Integrin alpha-L Proteins 0.000 description 2
- 101001046668 Homo sapiens Integrin alpha-X Proteins 0.000 description 2
- 101001015037 Homo sapiens Integrin beta-7 Proteins 0.000 description 2
- 101001043809 Homo sapiens Interleukin-7 receptor subunit alpha Proteins 0.000 description 2
- 101001138062 Homo sapiens Leukocyte-associated immunoglobulin-like receptor 1 Proteins 0.000 description 2
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 2
- 101001109503 Homo sapiens NKG2-C type II integral membrane protein Proteins 0.000 description 2
- 101001109501 Homo sapiens NKG2-D type II integral membrane protein Proteins 0.000 description 2
- 101000589305 Homo sapiens Natural cytotoxicity triggering receptor 2 Proteins 0.000 description 2
- 101000581981 Homo sapiens Neural cell adhesion molecule 1 Proteins 0.000 description 2
- 101000873418 Homo sapiens P-selectin glycoprotein ligand 1 Proteins 0.000 description 2
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 2
- 101000633778 Homo sapiens SLAM family member 5 Proteins 0.000 description 2
- 101000831007 Homo sapiens T-cell immunoreceptor with Ig and ITIM domains Proteins 0.000 description 2
- 101000980827 Homo sapiens T-cell surface glycoprotein CD1a Proteins 0.000 description 2
- 101000716149 Homo sapiens T-cell surface glycoprotein CD1b Proteins 0.000 description 2
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 2
- 101000795169 Homo sapiens Tumor necrosis factor receptor superfamily member 13C Proteins 0.000 description 2
- 101000648507 Homo sapiens Tumor necrosis factor receptor superfamily member 14 Proteins 0.000 description 2
- 101000801234 Homo sapiens Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 description 2
- 101000679857 Homo sapiens Tumor necrosis factor receptor superfamily member 3 Proteins 0.000 description 2
- 101000666896 Homo sapiens V-type immunoglobulin domain-containing suppressor of T-cell activation Proteins 0.000 description 2
- 241000725303 Human immunodeficiency virus Species 0.000 description 2
- 206010020751 Hypersensitivity Diseases 0.000 description 2
- 206010021143 Hypoxia Diseases 0.000 description 2
- 102100022949 Immunoglobulin kappa variable 2-29 Human genes 0.000 description 2
- 102100040061 Indoleamine 2,3-dioxygenase 1 Human genes 0.000 description 2
- 102100039904 Integrin alpha-D Human genes 0.000 description 2
- 102100022338 Integrin alpha-M Human genes 0.000 description 2
- 102100022297 Integrin alpha-X Human genes 0.000 description 2
- 108010041100 Integrin alpha6 Proteins 0.000 description 2
- 108010030465 Integrin alpha6beta1 Proteins 0.000 description 2
- 102100033016 Integrin beta-7 Human genes 0.000 description 2
- 108010064593 Intercellular Adhesion Molecule-1 Proteins 0.000 description 2
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 description 2
- 102100026720 Interferon beta Human genes 0.000 description 2
- 108090000467 Interferon-beta Proteins 0.000 description 2
- 108010050904 Interferons Proteins 0.000 description 2
- 102000014150 Interferons Human genes 0.000 description 2
- 102100021593 Interleukin-7 receptor subunit alpha Human genes 0.000 description 2
- 208000008839 Kidney Neoplasms Diseases 0.000 description 2
- 241000170280 Kluyveromyces sp. Species 0.000 description 2
- 102000003855 L-lactate dehydrogenase Human genes 0.000 description 2
- 108700023483 L-lactate dehydrogenases Proteins 0.000 description 2
- 239000005517 L01XE01 - Imatinib Substances 0.000 description 2
- 239000005551 L01XE03 - Erlotinib Substances 0.000 description 2
- 239000002147 L01XE04 - Sunitinib Substances 0.000 description 2
- 239000002136 L01XE07 - Lapatinib Substances 0.000 description 2
- 239000005536 L01XE08 - Nilotinib Substances 0.000 description 2
- 239000003798 L01XE11 - Pazopanib Substances 0.000 description 2
- 239000002118 L01XE12 - Vandetanib Substances 0.000 description 2
- 239000002146 L01XE16 - Crizotinib Substances 0.000 description 2
- 241000589248 Legionella Species 0.000 description 2
- 208000007764 Legionnaires' Disease Diseases 0.000 description 2
- 208000018142 Leiomyosarcoma Diseases 0.000 description 2
- 102100020943 Leukocyte-associated immunoglobulin-like receptor 1 Human genes 0.000 description 2
- HLFSDGLLUJUHTE-SNVBAGLBSA-N Levamisole Chemical compound C1([C@H]2CN3CCSC3=N2)=CC=CC=C1 HLFSDGLLUJUHTE-SNVBAGLBSA-N 0.000 description 2
- GQYIWUVLTXOXAJ-UHFFFAOYSA-N Lomustine Chemical compound ClCCN(N=O)C(=O)NC1CCCCC1 GQYIWUVLTXOXAJ-UHFFFAOYSA-N 0.000 description 2
- 108010015340 Low Density Lipoprotein Receptor-Related Protein-1 Proteins 0.000 description 2
- 102100029206 Low affinity immunoglobulin gamma Fc region receptor II-c Human genes 0.000 description 2
- 108060001084 Luciferase Proteins 0.000 description 2
- 239000005089 Luciferase Substances 0.000 description 2
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 2
- 108010064548 Lymphocyte Function-Associated Antigen-1 Proteins 0.000 description 2
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 2
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 2
- 229940125754 MDX-1097 Drugs 0.000 description 2
- 208000000172 Medulloblastoma Diseases 0.000 description 2
- 108010061593 Member 14 Tumor Necrosis Factor Receptors Proteins 0.000 description 2
- 102100034256 Mucin-1 Human genes 0.000 description 2
- 101100407308 Mus musculus Pdcd1lg2 gene Proteins 0.000 description 2
- 208000031888 Mycoses Diseases 0.000 description 2
- 201000003793 Myelodysplastic syndrome Diseases 0.000 description 2
- OVRNDRQMDRJTHS-CBQIKETKSA-N N-Acetyl-D-Galactosamine Chemical compound CC(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@H](O)[C@@H]1O OVRNDRQMDRJTHS-CBQIKETKSA-N 0.000 description 2
- 102000027581 NK cell receptors Human genes 0.000 description 2
- 108091008877 NK cell receptors Proteins 0.000 description 2
- 102100022683 NKG2-C type II integral membrane protein Human genes 0.000 description 2
- 102100022680 NKG2-D type II integral membrane protein Human genes 0.000 description 2
- 108010004217 Natural Cytotoxicity Triggering Receptor 1 Proteins 0.000 description 2
- 108010004222 Natural Cytotoxicity Triggering Receptor 3 Proteins 0.000 description 2
- 102100032870 Natural cytotoxicity triggering receptor 1 Human genes 0.000 description 2
- 102100032851 Natural cytotoxicity triggering receptor 2 Human genes 0.000 description 2
- 102100032852 Natural cytotoxicity triggering receptor 3 Human genes 0.000 description 2
- 101710141230 Natural killer cell receptor 2B4 Proteins 0.000 description 2
- 102100027347 Neural cell adhesion molecule 1 Human genes 0.000 description 2
- 241000221961 Neurospora crassa Species 0.000 description 2
- 241000320412 Ogataea angusta Species 0.000 description 2
- 241001489174 Ogataea minuta Species 0.000 description 2
- 201000010133 Oligodendroglioma Diseases 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 206010061535 Ovarian neoplasm Diseases 0.000 description 2
- 102100034925 P-selectin glycoprotein ligand 1 Human genes 0.000 description 2
- 239000012828 PI3K inhibitor Substances 0.000 description 2
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 2
- 208000030852 Parasitic disease Diseases 0.000 description 2
- 102000057297 Pepsin A Human genes 0.000 description 2
- 108090000284 Pepsin A Proteins 0.000 description 2
- 241000009328 Perro Species 0.000 description 2
- 241000235061 Pichia sp. Species 0.000 description 2
- 102000012338 Poly(ADP-ribose) Polymerases Human genes 0.000 description 2
- 108010061844 Poly(ADP-ribose) Polymerases Proteins 0.000 description 2
- 229920000776 Poly(Adenosine diphosphate-ribose) polymerase Polymers 0.000 description 2
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 2
- 108700030875 Programmed Cell Death 1 Ligand 2 Proteins 0.000 description 2
- 102100024216 Programmed cell death 1 ligand 1 Human genes 0.000 description 2
- 102100024213 Programmed cell death 1 ligand 2 Human genes 0.000 description 2
- 102100021923 Prolow-density lipoprotein receptor-related protein 1 Human genes 0.000 description 2
- 206010060862 Prostate cancer Diseases 0.000 description 2
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 2
- 108010038036 Receptor Activator of Nuclear Factor-kappa B Proteins 0.000 description 2
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 2
- 206010038389 Renal cancer Diseases 0.000 description 2
- 208000006265 Renal cell carcinoma Diseases 0.000 description 2
- 108700008625 Reporter Genes Proteins 0.000 description 2
- 201000000582 Retinoblastoma Diseases 0.000 description 2
- 102100029216 SLAM family member 5 Human genes 0.000 description 2
- 241000235088 Saccharomyces sp. Species 0.000 description 2
- 241000607142 Salmonella Species 0.000 description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 2
- 102000010841 Signaling Lymphocytic Activation Molecule Family Human genes 0.000 description 2
- 108010062314 Signaling Lymphocytic Activation Molecule Family Proteins 0.000 description 2
- 102000008115 Signaling Lymphocytic Activation Molecule Family Member 1 Human genes 0.000 description 2
- 208000021712 Soft tissue sarcoma Diseases 0.000 description 2
- 102100027208 T-cell antigen CD7 Human genes 0.000 description 2
- 102100024834 T-cell immunoreceptor with Ig and ITIM domains Human genes 0.000 description 2
- 102100025237 T-cell surface antigen CD2 Human genes 0.000 description 2
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 2
- 101710137500 T7 RNA polymerase Proteins 0.000 description 2
- 108010065917 TOR Serine-Threonine Kinases Proteins 0.000 description 2
- 102000013530 TOR Serine-Threonine Kinases Human genes 0.000 description 2
- 229940123237 Taxane Drugs 0.000 description 2
- CBPNZQVSJQDFBE-FUXHJELOSA-N Temsirolimus Chemical compound C1C[C@@H](OC(=O)C(C)(CO)CO)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 CBPNZQVSJQDFBE-FUXHJELOSA-N 0.000 description 2
- FOCVUCIESVLUNU-UHFFFAOYSA-N Thiotepa Chemical compound C1CN1P(N1CC1)(=S)N1CC1 FOCVUCIESVLUNU-UHFFFAOYSA-N 0.000 description 2
- 208000024770 Thyroid neoplasm Diseases 0.000 description 2
- 102000002689 Toll-like receptor Human genes 0.000 description 2
- 108020000411 Toll-like receptor Proteins 0.000 description 2
- IVTVGDXNLFLDRM-HNNXBMFYSA-N Tomudex Chemical compound C=1C=C2NC(C)=NC(=O)C2=CC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)S1 IVTVGDXNLFLDRM-HNNXBMFYSA-N 0.000 description 2
- 229940123468 Transferase inhibitor Drugs 0.000 description 2
- 241000499912 Trichoderma reesei Species 0.000 description 2
- RTKIYFITIVXBLE-UHFFFAOYSA-N Trichostatin A Natural products ONC(=O)C=CC(C)=CC(C)C(=O)C1=CC=C(N(C)C)C=C1 RTKIYFITIVXBLE-UHFFFAOYSA-N 0.000 description 2
- 102100040653 Tryptophan 2,3-dioxygenase Human genes 0.000 description 2
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 2
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 description 2
- 102100028787 Tumor necrosis factor receptor superfamily member 11A Human genes 0.000 description 2
- 102100029690 Tumor necrosis factor receptor superfamily member 13C Human genes 0.000 description 2
- 102100033728 Tumor necrosis factor receptor superfamily member 18 Human genes 0.000 description 2
- 102100033733 Tumor necrosis factor receptor superfamily member 1B Human genes 0.000 description 2
- 101710187830 Tumor necrosis factor receptor superfamily member 1B Proteins 0.000 description 2
- 102100022156 Tumor necrosis factor receptor superfamily member 3 Human genes 0.000 description 2
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 description 2
- 101710165473 Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 description 2
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 2
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 2
- 102100038282 V-type immunoglobulin domain-containing suppressor of T-cell activation Human genes 0.000 description 2
- 108010053099 Vascular Endothelial Growth Factor Receptor-2 Proteins 0.000 description 2
- 102100033178 Vascular endothelial growth factor receptor 1 Human genes 0.000 description 2
- 208000008383 Wilms tumor Diseases 0.000 description 2
- VWQVUPCCIRVNHF-OUBTZVSYSA-N Yttrium-90 Chemical compound [90Y] VWQVUPCCIRVNHF-OUBTZVSYSA-N 0.000 description 2
- UVIQSJCZCSLXRZ-UBUQANBQSA-N abiraterone acetate Chemical compound C([C@@H]1[C@]2(C)CC[C@@H]3[C@@]4(C)CC[C@@H](CC4=CC[C@H]31)OC(=O)C)C=C2C1=CC=CN=C1 UVIQSJCZCSLXRZ-UBUQANBQSA-N 0.000 description 2
- 229960004103 abiraterone acetate Drugs 0.000 description 2
- 229940028652 abraxane Drugs 0.000 description 2
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 2
- 230000001270 agonistic effect Effects 0.000 description 2
- 108010047495 alanylglycine Proteins 0.000 description 2
- 108010087924 alanylproline Proteins 0.000 description 2
- 229940100198 alkylating agent Drugs 0.000 description 2
- 239000002168 alkylating agent Substances 0.000 description 2
- 208000026935 allergic disease Diseases 0.000 description 2
- 230000007815 allergy Effects 0.000 description 2
- WQZGKKKJIJFFOK-PHYPRBDBSA-N alpha-D-galactose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 description 2
- 150000001408 amides Chemical group 0.000 description 2
- 229960003437 aminoglutethimide Drugs 0.000 description 2
- ROBVIMPUHSLWNV-UHFFFAOYSA-N aminoglutethimide Chemical compound C=1C=C(N)C=CC=1C1(CC)CCC(=O)NC1=O ROBVIMPUHSLWNV-UHFFFAOYSA-N 0.000 description 2
- 229960002550 amrubicin Drugs 0.000 description 2
- VJZITPJGSQKZMX-XDPRQOKASA-N amrubicin Chemical compound O([C@H]1C[C@](CC2=C(O)C=3C(=O)C4=CC=CC=C4C(=O)C=3C(O)=C21)(N)C(=O)C)[C@H]1C[C@H](O)[C@H](O)CO1 VJZITPJGSQKZMX-XDPRQOKASA-N 0.000 description 2
- 229960001220 amsacrine Drugs 0.000 description 2
- XCPGHVQEEXUHNC-UHFFFAOYSA-N amsacrine Chemical compound COC1=CC(NS(C)(=O)=O)=CC=C1NC1=C(C=CC=C2)C2=NC2=CC=CC=C12 XCPGHVQEEXUHNC-UHFFFAOYSA-N 0.000 description 2
- 229960002932 anastrozole Drugs 0.000 description 2
- YBBLVLTVTVSKRW-UHFFFAOYSA-N anastrozole Chemical compound N#CC(C)(C)C1=CC(C(C)(C#N)C)=CC(CN2N=CN=C2)=C1 YBBLVLTVTVSKRW-UHFFFAOYSA-N 0.000 description 2
- 230000000259 anti-tumor effect Effects 0.000 description 2
- 229960001164 apremilast Drugs 0.000 description 2
- IMOZEMNVLZVGJZ-QGZVFWFLSA-N apremilast Chemical compound C1=C(OC)C(OCC)=CC([C@@H](CS(C)(=O)=O)N2C(C3=C(NC(C)=O)C=CC=C3C2=O)=O)=C1 IMOZEMNVLZVGJZ-QGZVFWFLSA-N 0.000 description 2
- MCGDSOGUHLTADD-UHFFFAOYSA-N arzoxifene Chemical compound C1=CC(OC)=CC=C1C1=C(OC=2C=CC(OCCN3CCCCC3)=CC=2)C2=CC=C(O)C=C2S1 MCGDSOGUHLTADD-UHFFFAOYSA-N 0.000 description 2
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 description 2
- 108010077245 asparaginyl-proline Proteins 0.000 description 2
- 229940120638 avastin Drugs 0.000 description 2
- 229960003005 axitinib Drugs 0.000 description 2
- RITAVMQDGBJQJZ-FMIVXFBMSA-N axitinib Chemical compound CNC(=O)C1=CC=CC=C1SC1=CC=C(C(\C=C\C=2N=CC=CC=2)=NN2)C2=C1 RITAVMQDGBJQJZ-FMIVXFBMSA-N 0.000 description 2
- 229960000190 bacillus calmette–guérin vaccine Drugs 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 239000013060 biological fluid Substances 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 229960002092 busulfan Drugs 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- 229960005084 calcitriol Drugs 0.000 description 2
- GMRQFYUYWCNGIN-NKMMMXOESA-N calcitriol Chemical compound C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@@H](CCCC(C)(C)O)C)=C\C=C1\C[C@@H](O)C[C@H](O)C1=C GMRQFYUYWCNGIN-NKMMMXOESA-N 0.000 description 2
- 229940095731 candida albicans Drugs 0.000 description 2
- 238000005251 capillar electrophoresis Methods 0.000 description 2
- 108010021331 carfilzomib Proteins 0.000 description 2
- BLMPQMFVWMYDKT-NZTKNTHTSA-N carfilzomib Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC(C)C)C(=O)[C@]1(C)OC1)NC(=O)CN1CCOCC1)CC1=CC=CC=C1 BLMPQMFVWMYDKT-NZTKNTHTSA-N 0.000 description 2
- 229960005243 carmustine Drugs 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 230000004663 cell proliferation Effects 0.000 description 2
- 230000005889 cellular cytotoxicity Effects 0.000 description 2
- VERWOWGGCGHDQE-UHFFFAOYSA-N ceritinib Chemical compound CC=1C=C(NC=2N=C(NC=3C(=CC=CC=3)S(=O)(=O)C(C)C)C(Cl)=CN=2)C(OC(C)C)=CC=1C1CCNCC1 VERWOWGGCGHDQE-UHFFFAOYSA-N 0.000 description 2
- 201000010881 cervical cancer Diseases 0.000 description 2
- 229960004630 chlorambucil Drugs 0.000 description 2
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 2
- 239000011651 chromium Substances 0.000 description 2
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 description 2
- 229950009003 cilengitide Drugs 0.000 description 2
- AMLYAMJWYAIXIA-VWNVYAMZSA-N cilengitide Chemical compound N1C(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](C(C)C)N(C)C(=O)[C@H]1CC1=CC=CC=C1 AMLYAMJWYAIXIA-VWNVYAMZSA-N 0.000 description 2
- 108010072917 class-I restricted T cell-associated molecule Proteins 0.000 description 2
- KTEIFNKAUNYNJU-GFCCVEGCSA-N crizotinib Chemical compound O([C@H](C)C=1C(=C(F)C=CC=1Cl)Cl)C(C(=NC=1)N)=CC=1C(=C1)C=NN1C1CCNCC1 KTEIFNKAUNYNJU-GFCCVEGCSA-N 0.000 description 2
- 239000013078 crystal Substances 0.000 description 2
- UWFYSQMTEOIJJG-FDTZYFLXSA-N cyproterone acetate Chemical compound C1=C(Cl)C2=CC(=O)[C@@H]3C[C@@H]3[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(C)=O)(OC(=O)C)[C@@]1(C)CC2 UWFYSQMTEOIJJG-FDTZYFLXSA-N 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 102000003675 cytokine receptors Human genes 0.000 description 2
- 108010057085 cytokine receptors Proteins 0.000 description 2
- 239000003145 cytotoxic factor Substances 0.000 description 2
- BFSMGDJOXZAERB-UHFFFAOYSA-N dabrafenib Chemical compound S1C(C(C)(C)C)=NC(C=2C(=C(NS(=O)(=O)C=3C(=CC=CC=3F)F)C=CC=2)F)=C1C1=CC=NC(N)=N1 BFSMGDJOXZAERB-UHFFFAOYSA-N 0.000 description 2
- 229960003901 dacarbazine Drugs 0.000 description 2
- 229960000640 dactinomycin Drugs 0.000 description 2
- 229950006418 dactolisib Drugs 0.000 description 2
- JOGKUKXHTYWRGZ-UHFFFAOYSA-N dactolisib Chemical compound O=C1N(C)C2=CN=C3C=CC(C=4C=C5C=CC=CC5=NC=4)=CC3=C2N1C1=CC=C(C(C)(C)C#N)C=C1 JOGKUKXHTYWRGZ-UHFFFAOYSA-N 0.000 description 2
- 229960002482 dalotuzumab Drugs 0.000 description 2
- 230000006378 damage Effects 0.000 description 2
- 229960002448 dasatinib Drugs 0.000 description 2
- 229960003603 decitabine Drugs 0.000 description 2
- 230000022811 deglycosylation Effects 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- CFCUWKMKBJTWLW-UHFFFAOYSA-N deoliosyl-3C-alpha-L-digitoxosyl-MTM Natural products CC=1C(O)=C2C(O)=C3C(=O)C(OC4OC(C)C(O)C(OC5OC(C)C(O)C(OC6OC(C)C(O)C(C)(O)C6)C5)C4)C(C(OC)C(=O)C(O)C(C)O)CC3=CC2=CC=1OC(OC(C)C1O)CC1OC1CC(O)C(O)C(C)O1 CFCUWKMKBJTWLW-UHFFFAOYSA-N 0.000 description 2
- RGLYKWWBQGJZGM-ISLYRVAYSA-N diethylstilbestrol Chemical compound C=1C=C(O)C=CC=1C(/CC)=C(\CC)C1=CC=C(O)C=C1 RGLYKWWBQGJZGM-ISLYRVAYSA-N 0.000 description 2
- 229960000452 diethylstilbestrol Drugs 0.000 description 2
- 230000004069 differentiation Effects 0.000 description 2
- 229950009859 dinaciclib Drugs 0.000 description 2
- 239000003534 dna topoisomerase inhibitor Substances 0.000 description 2
- 231100000673 dose–response relationship Toxicity 0.000 description 2
- ZWAOHEXOSAUJHY-ZIYNGMLESA-N doxifluridine Chemical compound O[C@@H]1[C@H](O)[C@@H](C)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ZWAOHEXOSAUJHY-ZIYNGMLESA-N 0.000 description 2
- 239000000975 dye Substances 0.000 description 2
- 229950006595 edotreotide Drugs 0.000 description 2
- 239000012893 effector ligand Substances 0.000 description 2
- 229940121647 egfr inhibitor Drugs 0.000 description 2
- 229930013356 epothilone Natural products 0.000 description 2
- HESCAJZNRMSMJG-KKQRBIROSA-N epothilone A Chemical class C/C([C@@H]1C[C@@H]2O[C@@H]2CCC[C@@H]([C@@H]([C@@H](C)C(=O)C(C)(C)[C@@H](O)CC(=O)O1)O)C)=C\C1=CSC(C)=N1 HESCAJZNRMSMJG-KKQRBIROSA-N 0.000 description 2
- 229940082789 erbitux Drugs 0.000 description 2
- 229960001433 erlotinib Drugs 0.000 description 2
- 229940011871 estrogen Drugs 0.000 description 2
- 239000000262 estrogen Substances 0.000 description 2
- 239000002834 estrogen receptor modulator Substances 0.000 description 2
- OGPBJKLSAFTDLK-IGMARMGPSA-N europium-152 Chemical compound [152Eu] OGPBJKLSAFTDLK-IGMARMGPSA-N 0.000 description 2
- 229960005167 everolimus Drugs 0.000 description 2
- 229960000255 exemestane Drugs 0.000 description 2
- 229950009929 farletuzumab Drugs 0.000 description 2
- ODKNJVUHOIMIIZ-RRKCRQDMSA-N floxuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ODKNJVUHOIMIIZ-RRKCRQDMSA-N 0.000 description 2
- 229960000961 floxuridine Drugs 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- 238000002866 fluorescence resonance energy transfer Methods 0.000 description 2
- 239000007850 fluorescent dye Substances 0.000 description 2
- 229960001751 fluoxymesterone Drugs 0.000 description 2
- YLRFCQOZQXIBAB-RBZZARIASA-N fluoxymesterone Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1CC[C@](C)(O)[C@@]1(C)C[C@@H]2O YLRFCQOZQXIBAB-RBZZARIASA-N 0.000 description 2
- IJJVMEJXYNJXOJ-UHFFFAOYSA-N fluquinconazole Chemical compound C=1C=C(Cl)C=C(Cl)C=1N1C(=O)C2=CC(F)=CC=C2N=C1N1C=NC=N1 IJJVMEJXYNJXOJ-UHFFFAOYSA-N 0.000 description 2
- 101150034785 gamma gene Proteins 0.000 description 2
- 229960005277 gemcitabine Drugs 0.000 description 2
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 2
- 239000008103 glucose Substances 0.000 description 2
- 108010078144 glutaminyl-glycine Proteins 0.000 description 2
- 229960002913 goserelin Drugs 0.000 description 2
- QBKSWRVVCFFDOT-UHFFFAOYSA-N gossypol Chemical compound CC(C)C1=C(O)C(O)=C(C=O)C2=C(O)C(C=3C(O)=C4C(C=O)=C(O)C(O)=C(C4=CC=3C)C(C)C)=C(C)C=C21 QBKSWRVVCFFDOT-UHFFFAOYSA-N 0.000 description 2
- 239000003102 growth factor Substances 0.000 description 2
- 201000010536 head and neck cancer Diseases 0.000 description 2
- 208000014829 head and neck neoplasm Diseases 0.000 description 2
- 208000006359 hepatoblastoma Diseases 0.000 description 2
- 229940088597 hormone Drugs 0.000 description 2
- 239000005556 hormone Substances 0.000 description 2
- 239000001257 hydrogen Substances 0.000 description 2
- 230000002209 hydrophobic effect Effects 0.000 description 2
- 230000007954 hypoxia Effects 0.000 description 2
- 229960001101 ifosfamide Drugs 0.000 description 2
- HOMGKSMUEGBAAB-UHFFFAOYSA-N ifosfamide Chemical compound ClCCNP1(=O)OCCCN1CCCl HOMGKSMUEGBAAB-UHFFFAOYSA-N 0.000 description 2
- 229960002411 imatinib Drugs 0.000 description 2
- 150000003949 imides Chemical class 0.000 description 2
- 230000007124 immune defense Effects 0.000 description 2
- 210000000987 immune system Anatomy 0.000 description 2
- 239000002955 immunomodulating agent Substances 0.000 description 2
- 229940121354 immunomodulator Drugs 0.000 description 2
- 230000002584 immunomodulator Effects 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 229940090044 injection Drugs 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 102000006495 integrins Human genes 0.000 description 2
- 108010044426 integrins Proteins 0.000 description 2
- 230000002452 interceptive effect Effects 0.000 description 2
- 229940079322 interferon Drugs 0.000 description 2
- 229950007752 isatuximab Drugs 0.000 description 2
- 238000006317 isomerization reaction Methods 0.000 description 2
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 2
- 229960005280 isotretinoin Drugs 0.000 description 2
- SHGAZHPCJJPHSC-XFYACQKRSA-N isotretinoin Chemical compound OC(=O)/C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-XFYACQKRSA-N 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 201000010982 kidney cancer Diseases 0.000 description 2
- 229960004891 lapatinib Drugs 0.000 description 2
- BCFGMOOMADDAQU-UHFFFAOYSA-N lapatinib Chemical compound O1C(CNCCS(=O)(=O)C)=CC=C1C1=CC=C(N=CN=C2NC=3C=C(Cl)C(OCC=4C=C(F)C=CC=4)=CC=3)C2=C1 BCFGMOOMADDAQU-UHFFFAOYSA-N 0.000 description 2
- 201000010260 leiomyoma Diseases 0.000 description 2
- 229960004942 lenalidomide Drugs 0.000 description 2
- GOTYRUGSSMKFNF-UHFFFAOYSA-N lenalidomide Chemical compound C1C=2C(N)=CC=CC=2C(=O)N1C1CCC(=O)NC1=O GOTYRUGSSMKFNF-UHFFFAOYSA-N 0.000 description 2
- 229960003881 letrozole Drugs 0.000 description 2
- HPJKCIUCZWXJDR-UHFFFAOYSA-N letrozole Chemical compound C1=CC(C#N)=CC=C1C(N1N=CN=C1)C1=CC=C(C#N)C=C1 HPJKCIUCZWXJDR-UHFFFAOYSA-N 0.000 description 2
- 208000032839 leukemia Diseases 0.000 description 2
- 229960001614 levamisole Drugs 0.000 description 2
- 239000002502 liposome Substances 0.000 description 2
- 201000007270 liver cancer Diseases 0.000 description 2
- 208000014018 liver neoplasm Diseases 0.000 description 2
- 229960002247 lomustine Drugs 0.000 description 2
- 210000004072 lung Anatomy 0.000 description 2
- 201000005202 lung cancer Diseases 0.000 description 2
- 208000020816 lung neoplasm Diseases 0.000 description 2
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- PSGAAPLEWMOORI-PEINSRQWSA-N medroxyprogesterone acetate Chemical compound C([C@@]12C)CC(=O)C=C1[C@@H](C)C[C@@H]1[C@@H]2CC[C@]2(C)[C@@](OC(C)=O)(C(C)=O)CC[C@H]21 PSGAAPLEWMOORI-PEINSRQWSA-N 0.000 description 2
- 229960002985 medroxyprogesterone acetate Drugs 0.000 description 2
- RQZAXGRLVPAYTJ-GQFGMJRRSA-N megestrol acetate Chemical compound C1=C(C)C2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(C)=O)(OC(=O)C)[C@@]1(C)CC2 RQZAXGRLVPAYTJ-GQFGMJRRSA-N 0.000 description 2
- 229960004296 megestrol acetate Drugs 0.000 description 2
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 2
- 231100000782 microtubule inhibitor Toxicity 0.000 description 2
- 239000002829 mitogen activated protein kinase inhibitor Substances 0.000 description 2
- 229960000350 mitotane Drugs 0.000 description 2
- 230000008600 mitotic progression Effects 0.000 description 2
- 229950007699 mogamulizumab Drugs 0.000 description 2
- 238000000302 molecular modelling Methods 0.000 description 2
- CERZMXAJYMMUDR-UHFFFAOYSA-N neuraminic acid Natural products NC1C(O)CC(O)(C(O)=O)OC1C(O)C(O)CO CERZMXAJYMMUDR-UHFFFAOYSA-N 0.000 description 2
- 229960001346 nilotinib Drugs 0.000 description 2
- HHZIURLSWUIHRB-UHFFFAOYSA-N nilotinib Chemical compound C1=NC(C)=CN1C1=CC(NC(=O)C=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=CC=2)=CC(C(F)(F)F)=C1 HHZIURLSWUIHRB-UHFFFAOYSA-N 0.000 description 2
- 229960003301 nivolumab Drugs 0.000 description 2
- XHWRWCSCBDLOLM-UHFFFAOYSA-N nolatrexed Chemical compound CC1=CC=C2NC(N)=NC(=O)C2=C1SC1=CC=NC=C1 XHWRWCSCBDLOLM-UHFFFAOYSA-N 0.000 description 2
- 229950000891 nolatrexed Drugs 0.000 description 2
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 2
- 229960000435 oblimersen Drugs 0.000 description 2
- MIMNFCVQODTQDP-NDLVEFNKSA-N oblimersen Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](COP(S)(=O)O[C@@H]2[C@H](O[C@H](C2)N2C3=NC=NC(N)=C3N=C2)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C3=NC=NC(N)=C3N=C2)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)CO)[C@@H](O)C1 MIMNFCVQODTQDP-NDLVEFNKSA-N 0.000 description 2
- 210000000056 organ Anatomy 0.000 description 2
- 229960004390 palbociclib Drugs 0.000 description 2
- AHJRHEGDXFFMBM-UHFFFAOYSA-N palbociclib Chemical compound N1=C2N(C3CCCC3)C(=O)C(C(=O)C)=C(C)C2=CN=C1NC(N=C1)=CC=C1N1CCNCC1 AHJRHEGDXFFMBM-UHFFFAOYSA-N 0.000 description 2
- 201000002528 pancreatic cancer Diseases 0.000 description 2
- 208000008443 pancreatic carcinoma Diseases 0.000 description 2
- 229960000639 pazopanib Drugs 0.000 description 2
- CUIHSIWYWATEQL-UHFFFAOYSA-N pazopanib Chemical compound C1=CC2=C(C)N(C)N=C2C=C1N(C)C(N=1)=CC=NC=1NC1=CC=C(C)C(S(N)(=O)=O)=C1 CUIHSIWYWATEQL-UHFFFAOYSA-N 0.000 description 2
- 229960002621 pembrolizumab Drugs 0.000 description 2
- 229940111202 pepsin Drugs 0.000 description 2
- PHEDXBVPIONUQT-RGYGYFBISA-N phorbol 13-acetate 12-myristate Chemical compound C([C@]1(O)C(=O)C(C)=C[C@H]1[C@@]1(O)[C@H](C)[C@H]2OC(=O)CCCCCCCCCCCCC)C(CO)=C[C@H]1[C@H]1[C@]2(OC(C)=O)C1(C)C PHEDXBVPIONUQT-RGYGYFBISA-N 0.000 description 2
- 229940043441 phosphoinositide 3-kinase inhibitor Drugs 0.000 description 2
- LHNIIDJUOCFXAP-UHFFFAOYSA-N pictrelisib Chemical compound C1CN(S(=O)(=O)C)CCN1CC1=CC2=NC(C=3C=4C=NNC=4C=CC=3)=NC(N3CCOCC3)=C2S1 LHNIIDJUOCFXAP-UHFFFAOYSA-N 0.000 description 2
- 229960000688 pomalidomide Drugs 0.000 description 2
- UVSMNLNDYGZFPF-UHFFFAOYSA-N pomalidomide Chemical compound O=C1C=2C(N)=CC=CC=2C(=O)N1C1CCC(=O)NC1=O UVSMNLNDYGZFPF-UHFFFAOYSA-N 0.000 description 2
- 229960005205 prednisolone Drugs 0.000 description 2
- OIGNJSKKLXVSLS-VWUMJDOOSA-N prednisolone Chemical compound O=C1C=C[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 OIGNJSKKLXVSLS-VWUMJDOOSA-N 0.000 description 2
- 229960004618 prednisone Drugs 0.000 description 2
- XOFYZVNMUHMLCC-ZPOLXVRWSA-N prednisone Chemical compound O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 XOFYZVNMUHMLCC-ZPOLXVRWSA-N 0.000 description 2
- 229960000624 procarbazine Drugs 0.000 description 2
- CPTBDICYNRMXFX-UHFFFAOYSA-N procarbazine Chemical compound CNNCC1=CC=C(C(=O)NC(C)C)C=C1 CPTBDICYNRMXFX-UHFFFAOYSA-N 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- XJMOSONTPMZWPB-UHFFFAOYSA-M propidium iodide Chemical compound [I-].[I-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CCC[N+](C)(CC)CC)=C1C1=CC=CC=C1 XJMOSONTPMZWPB-UHFFFAOYSA-M 0.000 description 2
- 239000003528 protein farnesyltransferase inhibitor Substances 0.000 description 2
- 230000005180 public health Effects 0.000 description 2
- 238000003127 radioimmunoassay Methods 0.000 description 2
- 229960004432 raltitrexed Drugs 0.000 description 2
- 229960002633 ramucirumab Drugs 0.000 description 2
- ZAHRKKWIAAJSAO-UHFFFAOYSA-N rapamycin Natural products COCC(O)C(=C/C(C)C(=O)CC(OC(=O)C1CCCCN1C(=O)C(=O)C2(O)OC(CC(OC)C(=CC=CC=CC(C)CC(C)C(=O)C)C)CCC2C)C(C)CC3CCC(O)C(C3)OC)C ZAHRKKWIAAJSAO-UHFFFAOYSA-N 0.000 description 2
- 230000009257 reactivity Effects 0.000 description 2
- 230000000717 retained effect Effects 0.000 description 2
- 102000027483 retinoid hormone receptors Human genes 0.000 description 2
- 108091008679 retinoid hormone receptors Proteins 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 2
- 229960001302 ridaforolimus Drugs 0.000 description 2
- 229950001808 robatumumab Drugs 0.000 description 2
- OHRURASPPZQGQM-GCCNXGTGSA-N romidepsin Chemical compound O1C(=O)[C@H](C(C)C)NC(=O)C(=C/C)/NC(=O)[C@H]2CSSCC\C=C\[C@@H]1CC(=O)N[C@H](C(C)C)C(=O)N2 OHRURASPPZQGQM-GCCNXGTGSA-N 0.000 description 2
- VHXNKPBCCMUMSW-FQEVSTJZSA-N rubitecan Chemical compound C1=CC([N+]([O-])=O)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VHXNKPBCCMUMSW-FQEVSTJZSA-N 0.000 description 2
- 229950009213 rubitecan Drugs 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 230000003248 secreting effect Effects 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 239000000849 selective androgen receptor modulator Substances 0.000 description 2
- 229940095743 selective estrogen receptor modulator Drugs 0.000 description 2
- 239000000333 selective estrogen receptor modulator Substances 0.000 description 2
- SQVRNKJHWKZAKO-OQPLDHBCSA-N sialic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)OC1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-OQPLDHBCSA-N 0.000 description 2
- 229960002930 sirolimus Drugs 0.000 description 2
- QFJCIRLUMZQUOT-HPLJOQBZSA-N sirolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 QFJCIRLUMZQUOT-HPLJOQBZSA-N 0.000 description 2
- NSFFYSQTVOCNLX-JKIHJDPOSA-M sodium;[(2r,3s,4s,5r)-5-(4-amino-2-oxopyrimidin-1-yl)-3,4-dihydroxyoxolan-2-yl]methyl octadecyl phosphate;hydrate Chemical compound O.[Na+].O[C@H]1[C@H](O)[C@@H](COP([O-])(=O)OCCCCCCCCCCCCCCCCCC)O[C@H]1N1C(=O)N=C(N)C=C1 NSFFYSQTVOCNLX-JKIHJDPOSA-M 0.000 description 2
- 230000009870 specific binding Effects 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 230000000087 stabilizing effect Effects 0.000 description 2
- 229960001052 streptozocin Drugs 0.000 description 2
- ZSJLQEPLLKMAKR-GKHCUFPYSA-N streptozocin Chemical compound O=NN(C)C(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O ZSJLQEPLLKMAKR-GKHCUFPYSA-N 0.000 description 2
- 150000008163 sugars Chemical class 0.000 description 2
- WINHZLLDWRZWRT-ATVHPVEESA-N sunitinib Chemical compound CCN(CC)CCNC(=O)C1=C(C)NC(\C=C/2C3=CC(F)=CC=C3NC\2=O)=C1C WINHZLLDWRZWRT-ATVHPVEESA-N 0.000 description 2
- 229960001796 sunitinib Drugs 0.000 description 2
- 238000004885 tandem mass spectrometry Methods 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- 229960000235 temsirolimus Drugs 0.000 description 2
- QFJCIRLUMZQUOT-UHFFFAOYSA-N temsirolimus Natural products C1CC(O)C(OC)CC1CC(C)C1OC(=O)C2CCCCN2C(=O)C(=O)C(O)(O2)C(C)CCC2CC(OC)C(C)=CC=CC=CC(C)CC(C)C(=O)C(OC)C(O)C(C)=CC(C)C(=O)C1 QFJCIRLUMZQUOT-UHFFFAOYSA-N 0.000 description 2
- 229960003604 testosterone Drugs 0.000 description 2
- 229960001196 thiotepa Drugs 0.000 description 2
- 201000002510 thyroid cancer Diseases 0.000 description 2
- 229960003087 tioguanine Drugs 0.000 description 2
- PLHJCIYEEKOWNM-HHHXNRCGSA-N tipifarnib Chemical compound CN1C=NC=C1[C@](N)(C=1C=C2C(C=3C=C(Cl)C=CC=3)=CC(=O)N(C)C2=CC=1)C1=CC=C(Cl)C=C1 PLHJCIYEEKOWNM-HHHXNRCGSA-N 0.000 description 2
- 229950009158 tipifarnib Drugs 0.000 description 2
- 229940044693 topoisomerase inhibitor Drugs 0.000 description 2
- 239000003053 toxin Substances 0.000 description 2
- 231100000765 toxin Toxicity 0.000 description 2
- 108700012359 toxins Proteins 0.000 description 2
- 229960000977 trabectedin Drugs 0.000 description 2
- PKVRCIRHQMSYJX-AIFWHQITSA-N trabectedin Chemical compound C([C@@]1(C(OC2)=O)NCCC3=C1C=C(C(=C3)O)OC)S[C@@H]1C3=C(OC(C)=O)C(C)=C4OCOC4=C3[C@H]2N2[C@@H](O)[C@H](CC=3C4=C(O)C(OC)=C(C)C=3)N(C)[C@H]4[C@@H]21 PKVRCIRHQMSYJX-AIFWHQITSA-N 0.000 description 2
- 238000001890 transfection Methods 0.000 description 2
- 206010044412 transitional cell carcinoma Diseases 0.000 description 2
- 238000013519 translation Methods 0.000 description 2
- 102000035160 transmembrane proteins Human genes 0.000 description 2
- 108091005703 transmembrane proteins Proteins 0.000 description 2
- 229950007217 tremelimumab Drugs 0.000 description 2
- RTKIYFITIVXBLE-QEQCGCAPSA-N trichostatin A Chemical compound ONC(=O)/C=C/C(/C)=C/[C@@H](C)C(=O)C1=CC=C(N(C)C)C=C1 RTKIYFITIVXBLE-QEQCGCAPSA-N 0.000 description 2
- 102000003298 tumor necrosis factor receptor Human genes 0.000 description 2
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 2
- 210000004981 tumor-associated macrophage Anatomy 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 241001529453 unidentified herpesvirus Species 0.000 description 2
- 229960001055 uracil mustard Drugs 0.000 description 2
- 201000005112 urinary bladder cancer Diseases 0.000 description 2
- 229960000653 valrubicin Drugs 0.000 description 2
- ZOCKGBMQLCSHFP-KQRAQHLDSA-N valrubicin Chemical compound O([C@H]1C[C@](CC2=C(O)C=3C(=O)C4=CC=CC(OC)=C4C(=O)C=3C(O)=C21)(O)C(=O)COC(=O)CCCC)[C@H]1C[C@H](NC(=O)C(F)(F)F)[C@H](O)[C@H](C)O1 ZOCKGBMQLCSHFP-KQRAQHLDSA-N 0.000 description 2
- 229960000241 vandetanib Drugs 0.000 description 2
- UHTHHESEBZOYNR-UHFFFAOYSA-N vandetanib Chemical compound COC1=CC(C(/N=CN2)=N/C=3C(=CC(Br)=CC=3)F)=C2C=C1OCC1CCN(C)CC1 UHTHHESEBZOYNR-UHFFFAOYSA-N 0.000 description 2
- YCOYDOIWSSHVCK-UHFFFAOYSA-N vatalanib Chemical compound C1=CC(Cl)=CC=C1NC(C1=CC=CC=C11)=NN=C1CC1=CC=NC=C1 YCOYDOIWSSHVCK-UHFFFAOYSA-N 0.000 description 2
- 229950000578 vatalanib Drugs 0.000 description 2
- 229960003862 vemurafenib Drugs 0.000 description 2
- 229960004355 vindesine Drugs 0.000 description 2
- UGGWPQSBPIFKDZ-KOTLKJBCSA-N vindesine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(N)=O)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1N=C1[C]2C=CC=C1 UGGWPQSBPIFKDZ-KOTLKJBCSA-N 0.000 description 2
- 229960002066 vinorelbine Drugs 0.000 description 2
- GBABOYUKABKIAF-IELIFDKJSA-N vinorelbine Chemical compound C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC GBABOYUKABKIAF-IELIFDKJSA-N 0.000 description 2
- BMKDZUISNHGIBY-ZETCQYMHSA-N (+)-dexrazoxane Chemical compound C([C@H](C)N1CC(=O)NC(=O)C1)N1CC(=O)NC(=O)C1 BMKDZUISNHGIBY-ZETCQYMHSA-N 0.000 description 1
- JKFZMIQMKFWJAY-RQJQXFIZSA-N (1r,3s,5z)-5-[(2e)-2-[(3as,7as)-1-[(2r)-6-hydroxy-6-methylhept-4-yn-2-yl]-7a-methyl-3a,5,6,7-tetrahydro-3h-inden-4-ylidene]ethylidene]-4-methylidenecyclohexane-1,3-diol Chemical compound C1(/[C@@H]2CC=C([C@]2(CCC1)C)[C@@H](CC#CC(C)(C)O)C)=C\C=C1\C[C@@H](O)C[C@H](O)C1=C JKFZMIQMKFWJAY-RQJQXFIZSA-N 0.000 description 1
- KSOVGRCOLZZTPF-QMKUDKLTSA-N (1s,2s,3r,4r)-3-[[5-fluoro-2-[3-methyl-4-(4-methylpiperazin-1-yl)anilino]pyrimidin-4-yl]amino]bicyclo[2.2.1]hept-5-ene-2-carboxamide Chemical compound N([C@H]1[C@H]([C@@]2([H])C[C@@]1(C=C2)[H])C(N)=O)C(C(=CN=1)F)=NC=1NC(C=C1C)=CC=C1N1CCN(C)CC1 KSOVGRCOLZZTPF-QMKUDKLTSA-N 0.000 description 1
- PFJFPBDHCFMQPN-RGJAOAFDSA-N (1s,3s,7s,10r,11s,12s,16r)-3-[(e)-1-[2-(aminomethyl)-1,3-thiazol-4-yl]prop-1-en-2-yl]-7,11-dihydroxy-8,8,10,12,16-pentamethyl-4,17-dioxabicyclo[14.1.0]heptadecane-5,9-dione Chemical compound C/C([C@@H]1C[C@@H]2O[C@]2(C)CCC[C@@H]([C@@H]([C@@H](C)C(=O)C(C)(C)[C@@H](O)CC(=O)O1)O)C)=C\C1=CSC(CN)=N1 PFJFPBDHCFMQPN-RGJAOAFDSA-N 0.000 description 1
- XMAYWYJOQHXEEK-OZXSUGGESA-N (2R,4S)-ketoconazole Chemical compound C1CN(C(=O)C)CCN1C(C=C1)=CC=C1OC[C@@H]1O[C@@](CN2C=NC=C2)(C=2C(=CC(Cl)=CC=2)Cl)OC1 XMAYWYJOQHXEEK-OZXSUGGESA-N 0.000 description 1
- YWTBGJGMTBHQTM-IBGZPJMESA-N (2S)-1-(1H-indol-3-yl)-3-[[5-(3-methyl-2H-indazol-5-yl)-3-pyridinyl]oxy]-2-propanamine Chemical compound C1=CC=C2C(C[C@H](N)COC=3C=NC=C(C=3)C3=CC=C4NN=C(C4=C3)C)=CNC2=C1 YWTBGJGMTBHQTM-IBGZPJMESA-N 0.000 description 1
- SVNJBEMPMKWDCO-KCHLEUMXSA-N (2s)-2-[[(2s)-3-carboxy-2-[[2-[[(2s)-5-(diaminomethylideneamino)-2-[[4-oxo-4-[[4-(4-oxo-8-phenylchromen-2-yl)morpholin-4-ium-4-yl]methoxy]butanoyl]amino]pentanoyl]amino]acetyl]amino]propanoyl]amino]-3-hydroxypropanoate Chemical compound C=1C(=O)C2=CC=CC(C=3C=CC=CC=3)=C2OC=1[N+]1(COC(=O)CCC(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C([O-])=O)CCOCC1 SVNJBEMPMKWDCO-KCHLEUMXSA-N 0.000 description 1
- YXTKHLHCVFUPPT-YYFJYKOTSA-N (2s)-2-[[4-[(2-amino-5-formyl-4-oxo-1,6,7,8-tetrahydropteridin-6-yl)methylamino]benzoyl]amino]pentanedioic acid;(1r,2r)-1,2-dimethanidylcyclohexane;5-fluoro-1h-pyrimidine-2,4-dione;oxalic acid;platinum(2+) Chemical compound [Pt+2].OC(=O)C(O)=O.[CH2-][C@@H]1CCCC[C@H]1[CH2-].FC1=CNC(=O)NC1=O.C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 YXTKHLHCVFUPPT-YYFJYKOTSA-N 0.000 description 1
- ZUQBAQVRAURMCL-DOMZBBRYSA-N (2s)-2-[[4-[2-[(6r)-2-amino-4-oxo-5,6,7,8-tetrahydro-1h-pyrido[2,3-d]pyrimidin-6-yl]ethyl]benzoyl]amino]pentanedioic acid Chemical compound C([C@@H]1CC=2C(=O)N=C(NC=2NC1)N)CC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 ZUQBAQVRAURMCL-DOMZBBRYSA-N 0.000 description 1
- NECZZOFFLFZNHL-XVGZVFJZSA-N (2s)-2-amino-5-[[(2r)-3-[2-[bis[bis(2-chloroethyl)amino]-oxidophosphaniumyl]oxyethylsulfonyl]-1-[[(r)-carboxy(phenyl)methyl]amino]-1-oxopropan-2-yl]amino]-5-oxopentanoic acid;hydron;chloride Chemical compound Cl.ClCCN(CCCl)P(=O)(N(CCCl)CCCl)OCCS(=O)(=O)C[C@H](NC(=O)CC[C@H](N)C(O)=O)C(=O)N[C@@H](C(O)=O)C1=CC=CC=C1 NECZZOFFLFZNHL-XVGZVFJZSA-N 0.000 description 1
- ZBVJFYPGLGEMIN-OYLNGHKZSA-N (2s)-n-[(2s)-1-[[(2s)-1-[[(2s)-1-[[(2s)-1-[[(2r)-1-[[(2s)-1-[[(2s)-1-[(2s)-2-[(2-amino-2-oxoethyl)carbamoyl]pyrrolidin-1-yl]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(1h-indol-3-yl)-1-oxopropan-2-yl]amino]-3-( Chemical compound C1=CC=C2C(CC=3C4=CC=CC=C4C=C(C=3O)C(=O)O)=C(O)C(C(O)=O)=CC2=C1.C([C@@H](C(=O)N[C@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1[C@@H](CCC1)C(=O)NCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)C1=CC=C(O)C=C1 ZBVJFYPGLGEMIN-OYLNGHKZSA-N 0.000 description 1
- GTXSRFUZSLTDFX-HRCADAONSA-N (2s)-n-[(2s)-3,3-dimethyl-1-(methylamino)-1-oxobutan-2-yl]-4-methyl-2-[[(2s)-2-sulfanyl-4-(3,4,4-trimethyl-2,5-dioxoimidazolidin-1-yl)butanoyl]amino]pentanamide Chemical compound CNC(=O)[C@H](C(C)(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](S)CCN1C(=O)N(C)C(C)(C)C1=O GTXSRFUZSLTDFX-HRCADAONSA-N 0.000 description 1
- XSAKVDNHFRWJKS-IIZANFQQSA-N (2s)-n-benzyl-1-[(2s)-1-[(2s)-2-[[(2s)-2-[[(2s)-2-(dimethylamino)-3-methylbutanoyl]amino]-3-methylbutanoyl]-methylamino]-3-methylbutanoyl]pyrrolidine-2-carbonyl]pyrrolidine-2-carboxamide Chemical compound CC(C)[C@H](N(C)C)C(=O)N[C@@H](C(C)C)C(=O)N(C)[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)N1[C@H](C(=O)NCC=2C=CC=CC=2)CCC1 XSAKVDNHFRWJKS-IIZANFQQSA-N 0.000 description 1
- PSVUJBVBCOISSP-SPFKKGSWSA-N (2s,3r,4s,5s,6r)-2-bis(2-chloroethylamino)phosphoryloxy-6-(hydroxymethyl)oxane-3,4,5-triol Chemical compound OC[C@H]1O[C@@H](OP(=O)(NCCCl)NCCCl)[C@H](O)[C@@H](O)[C@@H]1O PSVUJBVBCOISSP-SPFKKGSWSA-N 0.000 description 1
- YPBKTZBXSBLTDK-PKNBQFBNSA-N (3e)-3-[(3-bromo-4-fluoroanilino)-nitrosomethylidene]-4-[2-(sulfamoylamino)ethylamino]-1,2,5-oxadiazole Chemical compound NS(=O)(=O)NCCNC1=NON\C1=C(N=O)/NC1=CC=C(F)C(Br)=C1 YPBKTZBXSBLTDK-PKNBQFBNSA-N 0.000 description 1
- KCOYQXZDFIIGCY-CZIZESTLSA-N (3e)-4-amino-5-fluoro-3-[5-(4-methylpiperazin-1-yl)-1,3-dihydrobenzimidazol-2-ylidene]quinolin-2-one Chemical compound C1CN(C)CCN1C1=CC=C(N\C(N2)=C/3C(=C4C(F)=CC=CC4=NC\3=O)N)C2=C1 KCOYQXZDFIIGCY-CZIZESTLSA-N 0.000 description 1
- SGYJGGKDGBXCNY-QXUYBEEESA-N (3s,9s,12r)-3-benzyl-6,6-dimethyl-9-[6-[(2s)-oxiran-2-yl]-6-oxohexyl]-1,4,7,10-tetrazabicyclo[10.3.0]pentadecane-2,5,8,11-tetrone Chemical compound C([C@H]1C(=O)NC(C(N[C@@H](CC=2C=CC=CC=2)C(=O)N2CCC[C@@H]2C(=O)N1)=O)(C)C)CCCCC(=O)[C@@H]1CO1 SGYJGGKDGBXCNY-QXUYBEEESA-N 0.000 description 1
- DEQANNDTNATYII-OULOTJBUSA-N (4r,7s,10s,13r,16s,19r)-10-(4-aminobutyl)-19-[[(2r)-2-amino-3-phenylpropanoyl]amino]-16-benzyl-n-[(2r,3r)-1,3-dihydroxybutan-2-yl]-7-[(1r)-1-hydroxyethyl]-13-(1h-indol-3-ylmethyl)-6,9,12,15,18-pentaoxo-1,2-dithia-5,8,11,14,17-pentazacycloicosane-4-carboxa Chemical compound C([C@@H](N)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](CC=2C3=CC=CC=C3NC=2)NC(=O)[C@H](CC=2C=CC=CC=2)NC1=O)C(=O)N[C@H](CO)[C@H](O)C)C1=CC=CC=C1 DEQANNDTNATYII-OULOTJBUSA-N 0.000 description 1
- SQWZFLMPDUSYGV-POHAHGRESA-N (5Z)-5-(quinoxalin-6-ylmethylidene)-1,3-thiazolidine-2,4-dione Chemical compound S1C(=O)NC(=O)\C1=C\C1=CC=C(N=CC=N2)C2=C1 SQWZFLMPDUSYGV-POHAHGRESA-N 0.000 description 1
- ZKSNZYLCOXUJIR-VOKUKXJJSA-N (5s,5ar,8ar,9r)-5-[[(2r,4ar,6r,7r,8r,8as)-7-(dimethylamino)-8-hydroxy-2-methyl-4,4a,6,7,8,8a-hexahydropyrano[3,2-d][1,3]dioxin-6-yl]oxy]-9-(4-hydroxy-3,5-dimethoxyphenyl)-5a,6,8a,9-tetrahydro-5h-[2]benzofuro[6,5-f][1,3]benzodioxol-8-one Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)N(C)C)[C@@H]3[C@@H]2C(OC3)=O)=C1 ZKSNZYLCOXUJIR-VOKUKXJJSA-N 0.000 description 1
- DLROLUIVVKTFPW-LVEBQJTPSA-N (5s,5as,8ar,9r)-9-(4-hydroxy-3,5-dimethoxyphenyl)-5-(4-nitroanilino)-5a,6,8a,9-tetrahydro-5h-[2]benzofuro[5,6-f][1,3]benzodioxol-8-one Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](NC=3C=CC(=CC=3)[N+]([O-])=O)[C@@H]3[C@@H]2C(OC3)=O)=C1 DLROLUIVVKTFPW-LVEBQJTPSA-N 0.000 description 1
- OYYVWNDMOQPMGE-SDQBBNPISA-N (5z)-5-[[5-(4-fluoro-2-hydroxyphenyl)furan-2-yl]methylidene]-1,3-thiazolidine-2,4-dione Chemical compound OC1=CC(F)=CC=C1C(O1)=CC=C1\C=C/1C(=O)NC(=O)S\1 OYYVWNDMOQPMGE-SDQBBNPISA-N 0.000 description 1
- WTSKMKRYHATLLL-UHFFFAOYSA-N (6-benzoyloxy-3-cyanopyridin-2-yl) 3-[3-(ethoxymethyl)-5-fluoro-2,6-dioxopyrimidine-1-carbonyl]benzoate Chemical compound O=C1N(COCC)C=C(F)C(=O)N1C(=O)C1=CC=CC(C(=O)OC=2C(=CC=C(OC(=O)C=3C=CC=CC=3)N=2)C#N)=C1 WTSKMKRYHATLLL-UHFFFAOYSA-N 0.000 description 1
- OPBPMGYBSDKJBT-DQHLZUIQSA-N (7s,9r,10r)-9-ethyl-4,6,9,10,11-pentahydroxy-7-[(2r,4s,5s,6s)-5-hydroxy-6-methyl-4-morpholin-4-yloxan-2-yl]oxy-8,10-dihydro-7h-tetracene-5,12-dione Chemical compound N1([C@H]2C[C@@H](O[C@@H](C)[C@H]2O)O[C@H]2C[C@]([C@@H](C3=C(O)C=4C(=O)C5=CC=CC(O)=C5C(=O)C=4C(O)=C32)O)(O)CC)CCOCC1 OPBPMGYBSDKJBT-DQHLZUIQSA-N 0.000 description 1
- BSRQHWFOFMAZRL-BODGVHBXSA-N (7s,9s)-7-[(2r,4s,5s,6s)-5-[(2s,4s,5s,6s)-4-amino-5-hydroxy-6-methyloxan-2-yl]oxy-4-hydroxy-6-methyloxan-2-yl]oxy-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-8,10-dihydro-7h-tetracene-5,12-dione;hydron;chloride Chemical compound Cl.C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@H]1[C@@H](O)C[C@H](O[C@@H]2C3=C(O)C=4C(=O)C5=CC=CC=C5C(=O)C=4C(O)=C3C[C@](O)(C2)C(=O)CO)O[C@H]1C BSRQHWFOFMAZRL-BODGVHBXSA-N 0.000 description 1
- JNKQAHJZAUFSLB-BAWYVGMJSA-N (8s,9r,11s,13s,14s,17s)-4-chloro-11-[4-[2-(diethylamino)ethoxy]phenyl]-13-methyl-6,7,8,9,11,12,14,15,16,17-decahydrocyclopenta[a]phenanthrene-3,17-diol Chemical compound C1=CC(OCCN(CC)CC)=CC=C1[C@@H]1[C@@H]2C3=CC=C(O)C(Cl)=C3CC[C@H]2[C@@H]2CC[C@H](O)[C@@]2(C)C1 JNKQAHJZAUFSLB-BAWYVGMJSA-N 0.000 description 1
- ZGNLFUXWZJGETL-YUSKDDKASA-N (Z)-[(2S)-2-amino-2-carboxyethyl]-hydroxyimino-oxidoazanium Chemical compound N[C@@H](C\[N+]([O-])=N\O)C(O)=O ZGNLFUXWZJGETL-YUSKDDKASA-N 0.000 description 1
- QRPSQQUYPMFERG-LFYBBSHMSA-N (e)-5-[3-(benzenesulfonamido)phenyl]-n-hydroxypent-2-en-4-ynamide Chemical compound ONC(=O)\C=C\C#CC1=CC=CC(NS(=O)(=O)C=2C=CC=CC=2)=C1 QRPSQQUYPMFERG-LFYBBSHMSA-N 0.000 description 1
- BWDQBBCUWLSASG-MDZDMXLPSA-N (e)-n-hydroxy-3-[4-[[2-hydroxyethyl-[2-(1h-indol-3-yl)ethyl]amino]methyl]phenyl]prop-2-enamide Chemical compound C=1NC2=CC=CC=C2C=1CCN(CCO)CC1=CC=C(\C=C\C(=O)NO)C=C1 BWDQBBCUWLSASG-MDZDMXLPSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- GMRQFYUYWCNGIN-UHFFFAOYSA-N 1,25-Dihydroxy-vitamin D3' Natural products C1CCC2(C)C(C(CCCC(C)(C)O)C)CCC2C1=CC=C1CC(O)CC(O)C1=C GMRQFYUYWCNGIN-UHFFFAOYSA-N 0.000 description 1
- KPZGRMZPZLOPBS-UHFFFAOYSA-N 1,3-dichloro-2,2-bis(chloromethyl)propane Chemical compound ClCC(CCl)(CCl)CCl KPZGRMZPZLOPBS-UHFFFAOYSA-N 0.000 description 1
- HJTAZXHBEBIQQX-UHFFFAOYSA-N 1,5-bis(chloromethyl)naphthalene Chemical compound C1=CC=C2C(CCl)=CC=CC2=C1CCl HJTAZXHBEBIQQX-UHFFFAOYSA-N 0.000 description 1
- VAMFSFIPDOODFH-UHFFFAOYSA-N 1-(3,4-dichlorophenyl)-3-(2,3-dihydro-1-benzofuran-5-ylsulfonyl)urea Chemical compound C1=C(Cl)C(Cl)=CC=C1NC(=O)NS(=O)(=O)C1=CC=C(OCC2)C2=C1 VAMFSFIPDOODFH-UHFFFAOYSA-N 0.000 description 1
- MZNMZWZGUGFQJP-UHFFFAOYSA-N 1-[11-(dodecylamino)-10-hydroxyundecyl]-3,7-dimethylpurine-2,6-dione Chemical compound O=C1N(CCCCCCCCCC(O)CNCCCCCCCCCCCC)C(=O)N(C)C2=C1N(C)C=N2 MZNMZWZGUGFQJP-UHFFFAOYSA-N 0.000 description 1
- SPMVMDHWKHCIDT-UHFFFAOYSA-N 1-[2-chloro-4-[(6,7-dimethoxy-4-quinolinyl)oxy]phenyl]-3-(5-methyl-3-isoxazolyl)urea Chemical compound C=12C=C(OC)C(OC)=CC2=NC=CC=1OC(C=C1Cl)=CC=C1NC(=O)NC=1C=C(C)ON=1 SPMVMDHWKHCIDT-UHFFFAOYSA-N 0.000 description 1
- BJHCYTJNPVGSBZ-YXSASFKJSA-N 1-[4-[6-amino-5-[(Z)-methoxyiminomethyl]pyrimidin-4-yl]oxy-2-chlorophenyl]-3-ethylurea Chemical compound CCNC(=O)Nc1ccc(Oc2ncnc(N)c2\C=N/OC)cc1Cl BJHCYTJNPVGSBZ-YXSASFKJSA-N 0.000 description 1
- 102100025573 1-alkyl-2-acetylglycerophosphocholine esterase Human genes 0.000 description 1
- BFPYWIDHMRZLRN-UHFFFAOYSA-N 17alpha-ethynyl estradiol Natural products OC1=CC=C2C3CCC(C)(C(CC4)(O)C#C)C4C3CCC2=C1 BFPYWIDHMRZLRN-UHFFFAOYSA-N 0.000 description 1
- GCKMFJBGXUYNAG-UHFFFAOYSA-N 17alpha-methyltestosterone Natural products C1CC2=CC(=O)CCC2(C)C2C1C1CCC(C)(O)C1(C)CC2 GCKMFJBGXUYNAG-UHFFFAOYSA-N 0.000 description 1
- DBPWSSGDRRHUNT-CEGNMAFCSA-N 17α-hydroxyprogesterone Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(=O)C)(O)[C@@]1(C)CC2 DBPWSSGDRRHUNT-CEGNMAFCSA-N 0.000 description 1
- VOXZDWNPVJITMN-ZBRFXRBCSA-N 17β-estradiol Chemical compound OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 VOXZDWNPVJITMN-ZBRFXRBCSA-N 0.000 description 1
- QMVPQBFHUJZJCS-NTKFZFFISA-N 1v8x590xdp Chemical compound O=C1N(NC(CO)CO)C(=O)C(C2=C3[CH]C=C(O)C=C3NC2=C23)=C1C2=C1C=CC(O)=C[C]1N3[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O QMVPQBFHUJZJCS-NTKFZFFISA-N 0.000 description 1
- KGLPWQKSKUVKMJ-UHFFFAOYSA-N 2,3-dihydrophthalazine-1,4-dione Chemical class C1=CC=C2C(=O)NNC(=O)C2=C1 KGLPWQKSKUVKMJ-UHFFFAOYSA-N 0.000 description 1
- 125000003870 2-(1-piperidinyl)ethoxy group Chemical group [*]OC([H])([H])C([H])([H])N1C([H])([H])C([H])([H])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- XWNJMSJGJFSGRY-UHFFFAOYSA-N 2-(benzylamino)-3,7-dihydropurin-6-one Chemical compound N1C=2N=CNC=2C(=O)N=C1NCC1=CC=CC=C1 XWNJMSJGJFSGRY-UHFFFAOYSA-N 0.000 description 1
- UQBIAGWOJDEOMN-UHFFFAOYSA-N 2-O-(2-O-(alpha-D-mannopyranosyl)-alpha-D-mannopyranosyl)-D-mannopyranose Natural products OC1C(O)C(CO)OC(O)C1OC1C(OC2C(C(O)C(O)C(CO)O2)O)C(O)C(O)C(CO)O1 UQBIAGWOJDEOMN-UHFFFAOYSA-N 0.000 description 1
- QUNOQBDEVTWCTA-UHFFFAOYSA-N 2-[2-[3-[2-(1,3-dioxobenzo[de]isoquinolin-2-yl)ethylamino]propylamino]ethyl]benzo[de]isoquinoline-1,3-dione Chemical compound C1=CC(C(=O)N(CCNCCCNCCN2C(C=3C=CC=C4C=CC=C(C=34)C2=O)=O)C2=O)=C3C2=CC=CC3=C1 QUNOQBDEVTWCTA-UHFFFAOYSA-N 0.000 description 1
- RZHKDBRREKOZEW-AAXZNHDCSA-N 2-[4-[2-[[(2r)-1-[[(4r,7s,10s,13r,16s,19r)-10-(4-aminobutyl)-4-[[(2r,3r)-1,3-dihydroxybutan-2-yl]carbamoyl]-7-[(1r)-1-hydroxyethyl]-16-[(4-hydroxyphenyl)methyl]-13-(1h-indol-3-ylmethyl)-6,9,12,15,18-pentaoxo-1,2-dithia-5,8,11,14,17-pentazacycloicos-19-yl] Chemical compound C([C@H](C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](CC=2C3=CC=CC=C3NC=2)NC(=O)[C@H](CC=2C=CC(O)=CC=2)NC1=O)C(=O)N[C@H](CO)[C@H](O)C)NC(=O)CN1CCN(CC(O)=O)CCN(CC(O)=O)CCN(CC(O)=O)CC1)C1=CC=CC=C1 RZHKDBRREKOZEW-AAXZNHDCSA-N 0.000 description 1
- PDGKHKMBHVFCMG-UHFFFAOYSA-N 2-[[5-(4-methylpiperazin-1-yl)pyridin-2-yl]amino]spiro[7,8-dihydropyrazino[5,6]pyrrolo[1,2-d]pyrimidine-9,1'-cyclohexane]-6-one Chemical compound C1CN(C)CCN1C(C=N1)=CC=C1NC1=NC=C(C=C2N3C4(CCCCC4)CNC2=O)C3=N1 PDGKHKMBHVFCMG-UHFFFAOYSA-N 0.000 description 1
- BGFTWECWAICPDG-UHFFFAOYSA-N 2-[bis(4-chlorophenyl)methyl]-4-n-[3-[bis(4-chlorophenyl)methyl]-4-(dimethylamino)phenyl]-1-n,1-n-dimethylbenzene-1,4-diamine Chemical compound C1=C(C(C=2C=CC(Cl)=CC=2)C=2C=CC(Cl)=CC=2)C(N(C)C)=CC=C1NC(C=1)=CC=C(N(C)C)C=1C(C=1C=CC(Cl)=CC=1)C1=CC=C(Cl)C=C1 BGFTWECWAICPDG-UHFFFAOYSA-N 0.000 description 1
- FBUTXZSKZCQABC-UHFFFAOYSA-N 2-amino-1-methyl-7h-purine-6-thione Chemical compound S=C1N(C)C(N)=NC2=C1NC=N2 FBUTXZSKZCQABC-UHFFFAOYSA-N 0.000 description 1
- 125000000022 2-aminoethyl group Chemical group [H]C([*])([H])C([H])([H])N([H])[H] 0.000 description 1
- NEAQRZUHTPSBBM-UHFFFAOYSA-N 2-hydroxy-3,3-dimethyl-7-nitro-4h-isoquinolin-1-one Chemical compound C1=C([N+]([O-])=O)C=C2C(=O)N(O)C(C)(C)CC2=C1 NEAQRZUHTPSBBM-UHFFFAOYSA-N 0.000 description 1
- FFRFGVHNKJYNOV-DOVUUNBWSA-N 3',4'-Anhydrovinblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C=C(C2)CC)N2CCC2=C1NC1=CC=CC=C21 FFRFGVHNKJYNOV-DOVUUNBWSA-N 0.000 description 1
- NHFDRBXTEDBWCZ-ZROIWOOFSA-N 3-[2,4-dimethyl-5-[(z)-(2-oxo-1h-indol-3-ylidene)methyl]-1h-pyrrol-3-yl]propanoic acid Chemical compound OC(=O)CCC1=C(C)NC(\C=C/2C3=CC=CC=C3NC\2=O)=C1C NHFDRBXTEDBWCZ-ZROIWOOFSA-N 0.000 description 1
- WEVYNIUIFUYDGI-UHFFFAOYSA-N 3-[6-[4-(trifluoromethoxy)anilino]-4-pyrimidinyl]benzamide Chemical compound NC(=O)C1=CC=CC(C=2N=CN=C(NC=3C=CC(OC(F)(F)F)=CC=3)C=2)=C1 WEVYNIUIFUYDGI-UHFFFAOYSA-N 0.000 description 1
- GSCPDZHWVNUUFI-UHFFFAOYSA-N 3-aminobenzamide Chemical compound NC(=O)C1=CC=CC(N)=C1 GSCPDZHWVNUUFI-UHFFFAOYSA-N 0.000 description 1
- CURYRIVJTBNEGU-UHFFFAOYSA-L 3-bromo-1-[12-(3-bromopropanoyl)-3,12-diaza-6,9-diazoniadispiro[5.2.5^{9}.2^{6}]hexadecan-3-yl]propan-1-one;dichloride Chemical compound [Cl-].[Cl-].C1CN(C(=O)CCBr)CC[N+]21CC[N+]1(CCN(CC1)C(=O)CCBr)CC2 CURYRIVJTBNEGU-UHFFFAOYSA-L 0.000 description 1
- XXJWYDDUDKYVKI-UHFFFAOYSA-N 4-[(4-fluoro-2-methyl-1H-indol-5-yl)oxy]-6-methoxy-7-[3-(1-pyrrolidinyl)propoxy]quinazoline Chemical compound COC1=CC2=C(OC=3C(=C4C=C(C)NC4=CC=3)F)N=CN=C2C=C1OCCCN1CCCC1 XXJWYDDUDKYVKI-UHFFFAOYSA-N 0.000 description 1
- DODQJNMQWMSYGS-QPLCGJKRSA-N 4-[(z)-1-[4-[2-(dimethylamino)ethoxy]phenyl]-1-phenylbut-1-en-2-yl]phenol Chemical compound C=1C=C(O)C=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 DODQJNMQWMSYGS-QPLCGJKRSA-N 0.000 description 1
- SYYMNUFXRFAELA-BTQNPOSSSA-N 4-[4-[[(1r)-1-phenylethyl]amino]-7h-pyrrolo[2,3-d]pyrimidin-6-yl]phenol;hydrobromide Chemical compound Br.N([C@H](C)C=1C=CC=CC=1)C(C=1C=2)=NC=NC=1NC=2C1=CC=C(O)C=C1 SYYMNUFXRFAELA-BTQNPOSSSA-N 0.000 description 1
- OZBUFFXESDBEHG-FXILSDISSA-N 4-[[(2e,4e,6e,8e)-3,7-dimethyl-9-(2,6,6-trimethylcyclohexen-1-yl)nona-2,4,6,8-tetraenoyl]amino]benzoic acid Chemical compound C=1C=C(C(O)=O)C=CC=1NC(=O)\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C OZBUFFXESDBEHG-FXILSDISSA-N 0.000 description 1
- HHFBDROWDBDFBR-UHFFFAOYSA-N 4-[[9-chloro-7-(2,6-difluorophenyl)-5H-pyrimido[5,4-d][2]benzazepin-2-yl]amino]benzoic acid Chemical compound C1=CC(C(=O)O)=CC=C1NC1=NC=C(CN=C(C=2C3=CC=C(Cl)C=2)C=2C(=CC=CC=2F)F)C3=N1 HHFBDROWDBDFBR-UHFFFAOYSA-N 0.000 description 1
- GFFXZLZWLOBBLO-BWVDBABLSA-N 4-amino-1-[(2r,4s,5r)-3-(fluoromethylidene)-4-hydroxy-5-(hydroxymethyl)oxolan-2-yl]pyrimidin-2-one Chemical compound O=C1N=C(N)C=CN1[C@H]1C(=CF)[C@H](O)[C@@H](CO)O1 GFFXZLZWLOBBLO-BWVDBABLSA-N 0.000 description 1
- PULHLIOPJXPGJN-BWVDBABLSA-N 4-amino-1-[(2r,4s,5r)-4-hydroxy-5-(hydroxymethyl)-3-methylideneoxolan-2-yl]pyrimidin-2-one Chemical compound O=C1N=C(N)C=CN1[C@H]1C(=C)[C@H](O)[C@@H](CO)O1 PULHLIOPJXPGJN-BWVDBABLSA-N 0.000 description 1
- TVZGACDUOSZQKY-LBPRGKRZSA-N 4-aminofolic acid Chemical compound C1=NC2=NC(N)=NC(N)=C2N=C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 TVZGACDUOSZQKY-LBPRGKRZSA-N 0.000 description 1
- 102100033400 4F2 cell-surface antigen heavy chain Human genes 0.000 description 1
- UHPMCKVQTMMPCG-UHFFFAOYSA-N 5,8-dihydroxy-2-methoxy-6-methyl-7-(2-oxopropyl)naphthalene-1,4-dione Chemical compound CC1=C(CC(C)=O)C(O)=C2C(=O)C(OC)=CC(=O)C2=C1O UHPMCKVQTMMPCG-UHFFFAOYSA-N 0.000 description 1
- ZHJGWYRLJUCMRT-QGZVFWFLSA-N 5-[6-[(4-methyl-1-piperazinyl)methyl]-1-benzimidazolyl]-3-[(1R)-1-[2-(trifluoromethyl)phenyl]ethoxy]-2-thiophenecarboxamide Chemical compound O([C@H](C)C=1C(=CC=CC=1)C(F)(F)F)C(=C(S1)C(N)=O)C=C1N(C1=C2)C=NC1=CC=C2CN1CCN(C)CC1 ZHJGWYRLJUCMRT-QGZVFWFLSA-N 0.000 description 1
- GBOQUHPYCRYKGV-UHFFFAOYSA-N 5-nitro-2-(2-pyrrolidin-1-ylethyl)benzo[de]isoquinoline-1,3-dione Chemical compound O=C1C(C=23)=CC=CC3=CC([N+](=O)[O-])=CC=2C(=O)N1CCN1CCCC1 GBOQUHPYCRYKGV-UHFFFAOYSA-N 0.000 description 1
- OZPFIJIOIVJZMN-SFHVURJKSA-N 6-[(7s)-7-hydroxy-5,6-dihydropyrrolo[1,2-c]imidazol-7-yl]-n-methylnaphthalene-2-carboxamide Chemical compound C1=CC2=CC(C(=O)NC)=CC=C2C=C1[C@]1(O)C2=CN=CN2CC1 OZPFIJIOIVJZMN-SFHVURJKSA-N 0.000 description 1
- KAEVHZSIYLATMK-UHFFFAOYSA-N 6-n-[bis(aziridin-1-yl)phosphoryl]-2-n,2-n,7-trimethylpurine-2,6-diamine Chemical compound C=12N(C)C=NC2=NC(N(C)C)=NC=1NP(=O)(N1CC1)N1CC1 KAEVHZSIYLATMK-UHFFFAOYSA-N 0.000 description 1
- VVIAGPKUTFNRDU-UHFFFAOYSA-N 6S-folinic acid Natural products C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-UHFFFAOYSA-N 0.000 description 1
- VHRSUDSXCMQTMA-PJHHCJLFSA-N 6alpha-methylprednisolone Chemical compound C([C@@]12C)=CC(=O)C=C1[C@@H](C)C[C@@H]1[C@@H]2[C@@H](O)C[C@]2(C)[C@@](O)(C(=O)CO)CC[C@H]21 VHRSUDSXCMQTMA-PJHHCJLFSA-N 0.000 description 1
- UBIYLIJTJQTBNU-DOKXERMVSA-N 6ob452mc0e Chemical compound O.C=12C3=NC=NC=1N(C)N=C(N)C2=CN3[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@H]1O UBIYLIJTJQTBNU-DOKXERMVSA-N 0.000 description 1
- RGVRUQHYQSORBY-UHFFFAOYSA-N 7-(4-amino-5-hydroxy-6-methyloxan-2-yl)oxy-6,9,11-trihydroxy-9-(2-hydroxyethyl)-4-methoxy-8,10-dihydro-7h-tetracene-5,12-dione Chemical compound C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(CCO)CC1OC1CC(N)C(O)C(C)O1 RGVRUQHYQSORBY-UHFFFAOYSA-N 0.000 description 1
- KABRXLINDSPGDF-UHFFFAOYSA-N 7-bromoisoquinoline Chemical compound C1=CN=CC2=CC(Br)=CC=C21 KABRXLINDSPGDF-UHFFFAOYSA-N 0.000 description 1
- RHXHGRAEPCAFML-UHFFFAOYSA-N 7-cyclopentyl-n,n-dimethyl-2-[(5-piperazin-1-ylpyridin-2-yl)amino]pyrrolo[2,3-d]pyrimidine-6-carboxamide Chemical compound N1=C2N(C3CCCC3)C(C(=O)N(C)C)=CC2=CN=C1NC(N=C1)=CC=C1N1CCNCC1 RHXHGRAEPCAFML-UHFFFAOYSA-N 0.000 description 1
- CJIJXIFQYOPWTF-UHFFFAOYSA-N 7-hydroxycoumarin Natural products O1C(=O)C=CC2=CC(O)=CC=C21 CJIJXIFQYOPWTF-UHFFFAOYSA-N 0.000 description 1
- PBCZSGKMGDDXIJ-XMCQDBRXSA-N 7-hydroxystaurosporine Chemical compound N([C@@H](O)C1=C2C3=CC=CC=C3N3C2=C24)C(=O)C1=C2C1=CC=CC=C1N4[C@@H]1C[C@@H](NC)[C@@H](OC)[C@@]3(C)O1 PBCZSGKMGDDXIJ-XMCQDBRXSA-N 0.000 description 1
- PBCZSGKMGDDXIJ-UHFFFAOYSA-N 7beta-hydroxystaurosporine Natural products C12=C3N4C5=CC=CC=C5C3=C3C(O)NC(=O)C3=C2C2=CC=CC=C2N1C1CC(NC)C(OC)C4(C)O1 PBCZSGKMGDDXIJ-UHFFFAOYSA-N 0.000 description 1
- CPRAGQJXBLMUEL-UHFFFAOYSA-N 9-(1-anilinoethyl)-7-methyl-2-(4-morpholinyl)-4-pyrido[1,2-a]pyrimidinone Chemical compound C=1C(C)=CN(C(C=C(N=2)N3CCOCC3)=O)C=2C=1C(C)NC1=CC=CC=C1 CPRAGQJXBLMUEL-UHFFFAOYSA-N 0.000 description 1
- SHGAZHPCJJPHSC-ZVCIMWCZSA-N 9-cis-retinoic acid Chemical compound OC(=O)/C=C(\C)/C=C/C=C(/C)\C=C\C1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-ZVCIMWCZSA-N 0.000 description 1
- 102100033793 ALK tyrosine kinase receptor Human genes 0.000 description 1
- KVLFRAWTRWDEDF-IRXDYDNUSA-N AZD-8055 Chemical compound C1=C(CO)C(OC)=CC=C1C1=CC=C(C(=NC(=N2)N3[C@H](COCC3)C)N3[C@H](COCC3)C)C2=N1 KVLFRAWTRWDEDF-IRXDYDNUSA-N 0.000 description 1
- GBJVVSCPOBPEIT-UHFFFAOYSA-N AZT-1152 Chemical compound N=1C=NC2=CC(OCCCN(CC)CCOP(O)(O)=O)=CC=C2C=1NC(=NN1)C=C1CC(=O)NC1=CC=CC(F)=C1 GBJVVSCPOBPEIT-UHFFFAOYSA-N 0.000 description 1
- 108010066676 Abrin Proteins 0.000 description 1
- 241000235389 Absidia Species 0.000 description 1
- 241000224422 Acanthamoeba Species 0.000 description 1
- 206010069754 Acquired gene mutation Diseases 0.000 description 1
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 1
- 229930024421 Adenine Natural products 0.000 description 1
- GFFGJBXGBJISGV-UHFFFAOYSA-N Adenine Chemical compound NC1=NC=NC2=C1N=CN2 GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 1
- 206010001233 Adenoma benign Diseases 0.000 description 1
- 102100026423 Adhesion G protein-coupled receptor E5 Human genes 0.000 description 1
- 108010000239 Aequorin Proteins 0.000 description 1
- 229940126638 Akt inhibitor Drugs 0.000 description 1
- HJCMDXDYPOUFDY-WHFBIAKZSA-N Ala-Gln Chemical compound C[C@H](N)C(=O)N[C@H](C(O)=O)CCC(N)=O HJCMDXDYPOUFDY-WHFBIAKZSA-N 0.000 description 1
- XZWXFWBHYRFLEF-FSPLSTOPSA-N Ala-His Chemical compound C[C@H](N)C(=O)N[C@H](C(O)=O)CC1=CN=CN1 XZWXFWBHYRFLEF-FSPLSTOPSA-N 0.000 description 1
- IPWKGIFRRBGCJO-IMJSIDKUSA-N Ala-Ser Chemical compound C[C@H]([NH3+])C(=O)N[C@@H](CO)C([O-])=O IPWKGIFRRBGCJO-IMJSIDKUSA-N 0.000 description 1
- 102400000068 Angiostatin Human genes 0.000 description 1
- 108010079709 Angiostatins Proteins 0.000 description 1
- 244000303258 Annona diversifolia Species 0.000 description 1
- 235000002198 Annona diversifolia Nutrition 0.000 description 1
- 102100025511 Anti-Muellerian hormone type-2 receptor Human genes 0.000 description 1
- 108020004491 Antisense DNA Proteins 0.000 description 1
- 108020005544 Antisense RNA Proteins 0.000 description 1
- 101001005269 Arabidopsis thaliana Ceramide synthase 1 LOH3 Proteins 0.000 description 1
- 101001005312 Arabidopsis thaliana Ceramide synthase LOH1 Proteins 0.000 description 1
- 101100067974 Arabidopsis thaliana POP2 gene Proteins 0.000 description 1
- 208000006400 Arbovirus Encephalitis Diseases 0.000 description 1
- TWXZVVXRRRRSLT-IMJSIDKUSA-N Asn-Cys Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](CS)C(O)=O TWXZVVXRRRRSLT-IMJSIDKUSA-N 0.000 description 1
- QCWJKJLNCFEVPQ-WHFBIAKZSA-N Asn-Gln Chemical compound NC(=O)C[C@H](N)C(=O)N[C@H](C(O)=O)CCC(N)=O QCWJKJLNCFEVPQ-WHFBIAKZSA-N 0.000 description 1
- IIFDPDVJAHQFSR-WHFBIAKZSA-N Asn-Glu Chemical compound NC(=O)C[C@H](N)C(=O)N[C@H](C(O)=O)CCC(O)=O IIFDPDVJAHQFSR-WHFBIAKZSA-N 0.000 description 1
- DVUFTQLHHHJEMK-IMJSIDKUSA-N Asp-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H](N)CC(O)=O DVUFTQLHHHJEMK-IMJSIDKUSA-N 0.000 description 1
- 102000015790 Asparaginase Human genes 0.000 description 1
- 241000228212 Aspergillus Species 0.000 description 1
- 241000351920 Aspergillus nidulans Species 0.000 description 1
- 241000228245 Aspergillus niger Species 0.000 description 1
- 240000006439 Aspergillus oryzae Species 0.000 description 1
- 235000002247 Aspergillus oryzae Nutrition 0.000 description 1
- 101000669426 Aspergillus restrictus Ribonuclease mitogillin Proteins 0.000 description 1
- 241000228257 Aspergillus sp. Species 0.000 description 1
- 229940123877 Aurora kinase inhibitor Drugs 0.000 description 1
- 108090000433 Aurora kinases Proteins 0.000 description 1
- 102000003989 Aurora kinases Human genes 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 108010008014 B-Cell Maturation Antigen Proteins 0.000 description 1
- 102000006942 B-Cell Maturation Antigen Human genes 0.000 description 1
- 208000028564 B-cell non-Hodgkin lymphoma Diseases 0.000 description 1
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 1
- CWHUFRVAEUJCEF-UHFFFAOYSA-N BKM120 Chemical compound C1=NC(N)=CC(C(F)(F)F)=C1C1=CC(N2CCOCC2)=NC(N2CCOCC2)=N1 CWHUFRVAEUJCEF-UHFFFAOYSA-N 0.000 description 1
- OLCWFLWEHWLBTO-HSZRJFAPSA-N BMS-214662 Chemical compound C=1C=CSC=1S(=O)(=O)N([C@@H](C1)CC=2C=CC=CC=2)CC2=CC(C#N)=CC=C2N1CC1=CN=CN1 OLCWFLWEHWLBTO-HSZRJFAPSA-N 0.000 description 1
- 241000223848 Babesia microti Species 0.000 description 1
- 241000304886 Bacilli Species 0.000 description 1
- 241000193830 Bacillus <bacterium> Species 0.000 description 1
- 101000840545 Bacillus thuringiensis L-isoleucine-4-hydroxylase Proteins 0.000 description 1
- 241001235572 Balantioides coli Species 0.000 description 1
- 241000151861 Barnettozyma salicaria Species 0.000 description 1
- 206010004146 Basal cell carcinoma Diseases 0.000 description 1
- 241000228405 Blastomyces dermatitidis Species 0.000 description 1
- 206010005949 Bone cancer Diseases 0.000 description 1
- 206010073106 Bone giant cell tumour malignant Diseases 0.000 description 1
- 208000018084 Bone neoplasm Diseases 0.000 description 1
- 208000003174 Brain Neoplasms Diseases 0.000 description 1
- 241000589562 Brucella Species 0.000 description 1
- 108010037003 Buserelin Proteins 0.000 description 1
- 101710149863 C-C chemokine receptor type 4 Proteins 0.000 description 1
- 108700012439 CA9 Proteins 0.000 description 1
- 102100032976 CCR4-NOT transcription complex subunit 6 Human genes 0.000 description 1
- 102100025221 CD70 antigen Human genes 0.000 description 1
- 102100027217 CD82 antigen Human genes 0.000 description 1
- 101710139831 CD82 antigen Proteins 0.000 description 1
- 102000024905 CD99 Human genes 0.000 description 1
- 108060001253 CD99 Proteins 0.000 description 1
- 229940124297 CDK 4/6 inhibitor Drugs 0.000 description 1
- DBBYYRWVNDQECM-CDWOPPGASA-N CG-1521 Chemical compound ONC(=O)\C=C\C=C\C=C\C1=CC=CC=C1 DBBYYRWVNDQECM-CDWOPPGASA-N 0.000 description 1
- LLVZBTWPGQVVLW-SNAWJCMRSA-N CP-724714 Chemical compound C12=CC(/C=C/CNC(=O)COC)=CC=C2N=CN=C1NC(C=C1C)=CC=C1OC1=CC=C(C)N=C1 LLVZBTWPGQVVLW-SNAWJCMRSA-N 0.000 description 1
- 101150027801 CTA1 gene Proteins 0.000 description 1
- 229940045513 CTLA4 antagonist Drugs 0.000 description 1
- 101100326430 Caenorhabditis elegans bub-1 gene Proteins 0.000 description 1
- 102100025570 Cancer/testis antigen 1 Human genes 0.000 description 1
- 241000222120 Candida <Saccharomycetales> Species 0.000 description 1
- 101100273295 Candida albicans (strain SC5314 / ATCC MYA-2876) CAT1 gene Proteins 0.000 description 1
- 239000005461 Canertinib Substances 0.000 description 1
- 101710158575 Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase Proteins 0.000 description 1
- 102100024423 Carbonic anhydrase 9 Human genes 0.000 description 1
- 208000009458 Carcinoma in Situ Diseases 0.000 description 1
- AOCCBINRVIKJHY-UHFFFAOYSA-N Carmofur Chemical compound CCCCCCNC(=O)N1C=C(F)C(=O)NC1=O AOCCBINRVIKJHY-UHFFFAOYSA-N 0.000 description 1
- 102000003908 Cathepsin D Human genes 0.000 description 1
- 108090000258 Cathepsin D Proteins 0.000 description 1
- 108090000625 Cathepsin K Proteins 0.000 description 1
- 102000004171 Cathepsin K Human genes 0.000 description 1
- 241000700199 Cavia porcellus Species 0.000 description 1
- 102100025832 Centromere-associated protein E Human genes 0.000 description 1
- 229940124957 Cervarix Drugs 0.000 description 1
- 206010008263 Cervical dysplasia Diseases 0.000 description 1
- SGYJGGKDGBXCNY-UHFFFAOYSA-N Chlamydocin Natural products N1C(=O)C2CCCN2C(=O)C(CC=2C=CC=CC=2)NC(=O)C(C)(C)NC(=O)C1CCCCCC(=O)C1CO1 SGYJGGKDGBXCNY-UHFFFAOYSA-N 0.000 description 1
- 101710164760 Chlorotoxin Proteins 0.000 description 1
- 201000005262 Chondroma Diseases 0.000 description 1
- 201000009047 Chordoma Diseases 0.000 description 1
- 208000004378 Choroid plexus papilloma Diseases 0.000 description 1
- VYZAMTAEIAYCRO-UHFFFAOYSA-N Chromium Chemical compound [Cr] VYZAMTAEIAYCRO-UHFFFAOYSA-N 0.000 description 1
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 1
- PTOAARAWEBMLNO-KVQBGUIXSA-N Cladribine Chemical compound C1=NC=2C(N)=NC(Cl)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)O1 PTOAARAWEBMLNO-KVQBGUIXSA-N 0.000 description 1
- 241000193403 Clostridium Species 0.000 description 1
- 241000193155 Clostridium botulinum Species 0.000 description 1
- 241000223205 Coccidioides immitis Species 0.000 description 1
- 102100031162 Collagen alpha-1(XVIII) chain Human genes 0.000 description 1
- 108090000909 Collectins Proteins 0.000 description 1
- 102000004405 Collectins Human genes 0.000 description 1
- 206010048832 Colon adenoma Diseases 0.000 description 1
- 102100025680 Complement decay-accelerating factor Human genes 0.000 description 1
- 206010010356 Congenital anomaly Diseases 0.000 description 1
- 241000711573 Coronaviridae Species 0.000 description 1
- 241000557626 Corvus corax Species 0.000 description 1
- 241000186227 Corynebacterium diphtheriae Species 0.000 description 1
- 241001445332 Coxiella <snail> Species 0.000 description 1
- 241000709687 Coxsackievirus Species 0.000 description 1
- 239000004971 Cross linker Substances 0.000 description 1
- 108700032819 Croton tiglium crotin II Proteins 0.000 description 1
- 201000007336 Cryptococcosis Diseases 0.000 description 1
- 241000221204 Cryptococcus neoformans Species 0.000 description 1
- 229930188224 Cryptophycin Natural products 0.000 description 1
- 241000223935 Cryptosporidium Species 0.000 description 1
- 108010016788 Cyclin-Dependent Kinase Inhibitor p21 Proteins 0.000 description 1
- 102000000578 Cyclin-Dependent Kinase Inhibitor p21 Human genes 0.000 description 1
- 102100032857 Cyclin-dependent kinase 1 Human genes 0.000 description 1
- 101710106279 Cyclin-dependent kinase 1 Proteins 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 239000012623 DNA damaging agent Substances 0.000 description 1
- 229940123780 DNA topoisomerase I inhibitor Drugs 0.000 description 1
- 229940124087 DNA topoisomerase II inhibitor Drugs 0.000 description 1
- 101100481408 Danio rerio tie2 gene Proteins 0.000 description 1
- 108010019673 Darbepoetin alfa Proteins 0.000 description 1
- CYCGRDQQIOGCKX-UHFFFAOYSA-N Dehydro-luciferin Natural products OC(=O)C1=CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 CYCGRDQQIOGCKX-UHFFFAOYSA-N 0.000 description 1
- 241000725619 Dengue virus Species 0.000 description 1
- 108010002156 Depsipeptides Proteins 0.000 description 1
- 241000005319 Dictyoptera aurora Species 0.000 description 1
- 101000582926 Dictyostelium discoideum Probable serine/threonine-protein kinase PLK Proteins 0.000 description 1
- LQKSHSFQQRCAFW-UHFFFAOYSA-N Dolastatin 15 Natural products COC1=CC(=O)N(C(=O)C(OC(=O)C2N(CCC2)C(=O)C2N(CCC2)C(=O)C(C(C)C)N(C)C(=O)C(NC(=O)C(C(C)C)N(C)C)C(C)C)C(C)C)C1CC1=CC=CC=C1 LQKSHSFQQRCAFW-UHFFFAOYSA-N 0.000 description 1
- ZQZFYGIXNQKOAV-OCEACIFDSA-N Droloxifene Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=C(O)C=CC=1)\C1=CC=C(OCCN(C)C)C=C1 ZQZFYGIXNQKOAV-OCEACIFDSA-N 0.000 description 1
- 208000007033 Dysgerminoma Diseases 0.000 description 1
- 208000000471 Dysplastic Nevus Syndrome Diseases 0.000 description 1
- 102000001301 EGF receptor Human genes 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 101150084967 EPCAM gene Proteins 0.000 description 1
- 101150076616 EPHA2 gene Proteins 0.000 description 1
- 241001466953 Echovirus Species 0.000 description 1
- XXPXYPLPSDPERN-UHFFFAOYSA-N Ecteinascidin 743 Natural products COc1cc2C(NCCc2cc1O)C(=O)OCC3N4C(O)C5Cc6cc(C)c(OC)c(O)c6C(C4C(S)c7c(OC(=O)C)c(C)c8OCOc8c37)N5C XXPXYPLPSDPERN-UHFFFAOYSA-N 0.000 description 1
- 108700038672 Edotreotide Proteins 0.000 description 1
- 241000605314 Ehrlichia Species 0.000 description 1
- 201000009051 Embryonal Carcinoma Diseases 0.000 description 1
- 102100037241 Endoglin Human genes 0.000 description 1
- 108010036395 Endoglin Proteins 0.000 description 1
- 108010079505 Endostatins Proteins 0.000 description 1
- 229940124884 Engerix-B Drugs 0.000 description 1
- SAMRUMKYXPVKPA-VFKOLLTISA-N Enocitabine Chemical compound O=C1N=C(NC(=O)CCCCCCCCCCCCCCCCCCCCC)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 SAMRUMKYXPVKPA-VFKOLLTISA-N 0.000 description 1
- 241000224432 Entamoeba histolytica Species 0.000 description 1
- 241000709661 Enterovirus Species 0.000 description 1
- 241000991587 Enterovirus C Species 0.000 description 1
- 108010055191 EphA3 Receptor Proteins 0.000 description 1
- 102100030340 Ephrin type-A receptor 2 Human genes 0.000 description 1
- 102100030324 Ephrin type-A receptor 3 Human genes 0.000 description 1
- 102400001368 Epidermal growth factor Human genes 0.000 description 1
- 101800003838 Epidermal growth factor Proteins 0.000 description 1
- 241000283074 Equus asinus Species 0.000 description 1
- 241001658031 Eris Species 0.000 description 1
- 101000867232 Escherichia coli Heat-stable enterotoxin II Proteins 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- BFPYWIDHMRZLRN-SLHNCBLASA-N Ethinyl estradiol Chemical compound OC1=CC=C2[C@H]3CC[C@](C)([C@](CC4)(O)C#C)[C@@H]4[C@@H]3CCC2=C1 BFPYWIDHMRZLRN-SLHNCBLASA-N 0.000 description 1
- 229910052693 Europium Inorganic materials 0.000 description 1
- 101150021185 FGF gene Proteins 0.000 description 1
- RSCIYYHIBVZXDI-UHFFFAOYSA-O Fagaridine Chemical compound C1=C2OCOC2=CC2=CC=C3C4=CC=C(OC)C(O)=C4C=[N+](C)C3=C21 RSCIYYHIBVZXDI-UHFFFAOYSA-O 0.000 description 1
- 201000001342 Fallopian tube cancer Diseases 0.000 description 1
- 208000013452 Fallopian tube neoplasm Diseases 0.000 description 1
- 108010021468 Fc gamma receptor IIA Proteins 0.000 description 1
- 108010021472 Fc gamma receptor IIB Proteins 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 208000007659 Fibroadenoma Diseases 0.000 description 1
- 102100023600 Fibroblast growth factor receptor 2 Human genes 0.000 description 1
- 101710182389 Fibroblast growth factor receptor 2 Proteins 0.000 description 1
- 206010053717 Fibrous histiocytoma Diseases 0.000 description 1
- 108010029961 Filgrastim Proteins 0.000 description 1
- BJGNCJDXODQBOB-UHFFFAOYSA-N Fivefly Luciferin Natural products OC(=O)C1CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 BJGNCJDXODQBOB-UHFFFAOYSA-N 0.000 description 1
- 241000710831 Flavivirus Species 0.000 description 1
- 102000010451 Folate receptor alpha Human genes 0.000 description 1
- 108050001931 Folate receptor alpha Proteins 0.000 description 1
- 241000589601 Francisella Species 0.000 description 1
- 241000223218 Fusarium Species 0.000 description 1
- 241000567178 Fusarium venenatum Species 0.000 description 1
- KGPGFQWBCSZGEL-ZDUSSCGKSA-N GSK690693 Chemical compound C=12N(CC)C(C=3C(=NON=3)N)=NC2=C(C#CC(C)(C)O)N=CC=1OC[C@H]1CCCNC1 KGPGFQWBCSZGEL-ZDUSSCGKSA-N 0.000 description 1
- 229940032072 GVAX vaccine Drugs 0.000 description 1
- PAFKTGFSEFKSQG-PAASFTFBSA-N Galeterone Chemical compound C1=NC2=CC=CC=C2N1C1=CC[C@H]2[C@H](CC=C3[C@@]4(CC[C@H](O)C3)C)[C@@H]4CC[C@@]21C PAFKTGFSEFKSQG-PAASFTFBSA-N 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 229940124897 Gardasil Drugs 0.000 description 1
- JRZJKWGQFNTSRN-UHFFFAOYSA-N Geldanamycin Natural products C1C(C)CC(OC)C(O)C(C)C=C(C)C(OC(N)=O)C(OC)CCC=C(C)C(=O)NC2=CC(=O)C(OC)=C1C2=O JRZJKWGQFNTSRN-UHFFFAOYSA-N 0.000 description 1
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 1
- 208000000527 Germinoma Diseases 0.000 description 1
- 208000007569 Giant Cell Tumors Diseases 0.000 description 1
- 241000224466 Giardia Species 0.000 description 1
- 241000224470 Giardia sp. Species 0.000 description 1
- 201000010915 Glioblastoma multiforme Diseases 0.000 description 1
- 201000005409 Gliomatosis cerebri Diseases 0.000 description 1
- JEFZIKRIDLHOIF-BYPYZUCNSA-N Gln-Gly Chemical compound NC(=O)CC[C@H](N)C(=O)NCC(O)=O JEFZIKRIDLHOIF-BYPYZUCNSA-N 0.000 description 1
- XITLYYAIPBBHPX-ZKWXMUAHSA-N Gln-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@@H](N)CCC(N)=O XITLYYAIPBBHPX-ZKWXMUAHSA-N 0.000 description 1
- NJMYZEJORPYOTO-BQBZGAKWSA-N Gln-Pro Chemical compound NC(=O)CC[C@H](N)C(=O)N1CCC[C@H]1C(O)=O NJMYZEJORPYOTO-BQBZGAKWSA-N 0.000 description 1
- 101710088083 Glomulin Proteins 0.000 description 1
- 206010018404 Glucagonoma Diseases 0.000 description 1
- 206010018691 Granuloma Diseases 0.000 description 1
- 241000590002 Helicobacter pylori Species 0.000 description 1
- 206010019629 Hepatic adenoma Diseases 0.000 description 1
- 241000700721 Hepatitis B virus Species 0.000 description 1
- 102100021866 Hepatocyte growth factor Human genes 0.000 description 1
- 229920000209 Hexadimethrine bromide Polymers 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- WSDOHRLQDGAOGU-BQBZGAKWSA-N His-Asn Chemical compound NC(=O)C[C@@H](C(O)=O)NC(=O)[C@@H](N)CC1=CN=CN1 WSDOHRLQDGAOGU-BQBZGAKWSA-N 0.000 description 1
- MDCTVRUPVLZSPG-BQBZGAKWSA-N His-Asp Chemical compound OC(=O)C[C@@H](C(O)=O)NC(=O)[C@@H](N)CC1=CNC=N1 MDCTVRUPVLZSPG-BQBZGAKWSA-N 0.000 description 1
- 241000228404 Histoplasma capsulatum Species 0.000 description 1
- 208000017604 Hodgkin disease Diseases 0.000 description 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 1
- 101000800023 Homo sapiens 4F2 cell-surface antigen heavy chain Proteins 0.000 description 1
- 101000718243 Homo sapiens Adhesion G protein-coupled receptor E5 Proteins 0.000 description 1
- 101000693801 Homo sapiens Anti-Muellerian hormone type-2 receptor Proteins 0.000 description 1
- 101000934356 Homo sapiens CD70 antigen Proteins 0.000 description 1
- 101000856237 Homo sapiens Cancer/testis antigen 1 Proteins 0.000 description 1
- 101000914324 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 5 Proteins 0.000 description 1
- 101000914321 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 7 Proteins 0.000 description 1
- 101000856022 Homo sapiens Complement decay-accelerating factor Proteins 0.000 description 1
- 101100118549 Homo sapiens EGFR gene Proteins 0.000 description 1
- 101000898034 Homo sapiens Hepatocyte growth factor Proteins 0.000 description 1
- 101000998953 Homo sapiens Immunoglobulin heavy variable 1-2 Proteins 0.000 description 1
- 101001008255 Homo sapiens Immunoglobulin kappa variable 1D-8 Proteins 0.000 description 1
- 101001008321 Homo sapiens Immunoglobulin kappa variable 2D-26 Proteins 0.000 description 1
- 101001047619 Homo sapiens Immunoglobulin kappa variable 3-20 Proteins 0.000 description 1
- 101001008263 Homo sapiens Immunoglobulin kappa variable 3D-15 Proteins 0.000 description 1
- 101001037256 Homo sapiens Indoleamine 2,3-dioxygenase 1 Proteins 0.000 description 1
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 1
- 101000960952 Homo sapiens Interleukin-1 receptor accessory protein Proteins 0.000 description 1
- 101000998120 Homo sapiens Interleukin-3 receptor subunit alpha Proteins 0.000 description 1
- 101001076408 Homo sapiens Interleukin-6 Proteins 0.000 description 1
- 101000605743 Homo sapiens Kinesin-like protein KIF23 Proteins 0.000 description 1
- 101000605020 Homo sapiens Large neutral amino acids transporter small subunit 1 Proteins 0.000 description 1
- 101000777628 Homo sapiens Leukocyte antigen CD37 Proteins 0.000 description 1
- 101001137987 Homo sapiens Lymphocyte activation gene 3 protein Proteins 0.000 description 1
- 101000916644 Homo sapiens Macrophage colony-stimulating factor 1 receptor Proteins 0.000 description 1
- 101001008874 Homo sapiens Mast/stem cell growth factor receptor Kit Proteins 0.000 description 1
- 101001133056 Homo sapiens Mucin-1 Proteins 0.000 description 1
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 description 1
- 101001084266 Homo sapiens Parathyroid hormone 2 receptor Proteins 0.000 description 1
- 101000692455 Homo sapiens Platelet-derived growth factor receptor beta Proteins 0.000 description 1
- 101000617725 Homo sapiens Pregnancy-specific beta-1-glycoprotein 2 Proteins 0.000 description 1
- 101000904173 Homo sapiens Progonadoliberin-1 Proteins 0.000 description 1
- 101000984753 Homo sapiens Serine/threonine-protein kinase B-raf Proteins 0.000 description 1
- 101000665442 Homo sapiens Serine/threonine-protein kinase TBK1 Proteins 0.000 description 1
- 101000884271 Homo sapiens Signal transducer CD24 Proteins 0.000 description 1
- 101000868152 Homo sapiens Son of sevenless homolog 1 Proteins 0.000 description 1
- 101000914496 Homo sapiens T-cell antigen CD7 Proteins 0.000 description 1
- 101000934346 Homo sapiens T-cell surface antigen CD2 Proteins 0.000 description 1
- 101000934341 Homo sapiens T-cell surface glycoprotein CD5 Proteins 0.000 description 1
- 101000807561 Homo sapiens Tyrosine-protein kinase receptor UFO Proteins 0.000 description 1
- 101000851018 Homo sapiens Vascular endothelial growth factor receptor 1 Proteins 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 241000598436 Human T-cell lymphotropic virus Species 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 1
- DOMWKUIIPQCAJU-LJHIYBGHSA-N Hydroxyprogesterone caproate Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(C)=O)(OC(=O)CCCCC)[C@@]1(C)CC2 DOMWKUIIPQCAJU-LJHIYBGHSA-N 0.000 description 1
- JJKOTMDDZAJTGQ-DQSJHHFOSA-N Idoxifene Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN2CCCC2)=CC=1)/C1=CC=C(I)C=C1 JJKOTMDDZAJTGQ-DQSJHHFOSA-N 0.000 description 1
- 108010073807 IgG Receptors Proteins 0.000 description 1
- 102000009490 IgG Receptors Human genes 0.000 description 1
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 description 1
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 1
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 1
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 1
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 1
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 1
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 1
- 102000013463 Immunoglobulin Light Chains Human genes 0.000 description 1
- 108010065825 Immunoglobulin Light Chains Proteins 0.000 description 1
- 102100036887 Immunoglobulin heavy variable 1-2 Human genes 0.000 description 1
- 102000003781 Inhibitor of growth protein 1 Human genes 0.000 description 1
- 108090000191 Inhibitor of growth protein 1 Proteins 0.000 description 1
- 102000048143 Insulin-Like Growth Factor II Human genes 0.000 description 1
- 108090001117 Insulin-Like Growth Factor II Proteins 0.000 description 1
- 208000005045 Interdigitating dendritic cell sarcoma Diseases 0.000 description 1
- 108010032038 Interferon Regulatory Factor-3 Proteins 0.000 description 1
- 102100029843 Interferon regulatory factor 3 Human genes 0.000 description 1
- 102000008070 Interferon-gamma Human genes 0.000 description 1
- 108010074328 Interferon-gamma Proteins 0.000 description 1
- 102100039880 Interleukin-1 receptor accessory protein Human genes 0.000 description 1
- 108010065805 Interleukin-12 Proteins 0.000 description 1
- 102000013462 Interleukin-12 Human genes 0.000 description 1
- 102100033493 Interleukin-3 receptor subunit alpha Human genes 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 102000004889 Interleukin-6 Human genes 0.000 description 1
- 241000701460 JC polyomavirus Species 0.000 description 1
- 229940122245 Janus kinase inhibitor Drugs 0.000 description 1
- 208000002260 Keloid Diseases 0.000 description 1
- 102100038406 Kinesin-like protein KIF23 Human genes 0.000 description 1
- 102100023424 Kinesin-like protein KIF2C Human genes 0.000 description 1
- 101710134369 Kinesin-like protein KIF2C Proteins 0.000 description 1
- 241000588748 Klebsiella Species 0.000 description 1
- 241001138401 Kluyveromyces lactis Species 0.000 description 1
- MLFKVJCWGUZWNV-UHFFFAOYSA-N L-alanosine Natural products OC(=O)C(N)CN(O)N=O MLFKVJCWGUZWNV-UHFFFAOYSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- 108010043135 L-methionine gamma-lyase Proteins 0.000 description 1
- 239000005411 L01XE02 - Gefitinib Substances 0.000 description 1
- 239000002177 L01XE27 - Ibrutinib Substances 0.000 description 1
- 102000017578 LAG3 Human genes 0.000 description 1
- UCEQXRCJXIVODC-PMACEKPBSA-N LSM-1131 Chemical compound C1CCC2=CC=CC3=C2N1C=C3[C@@H]1C(=O)NC(=O)[C@H]1C1=CNC2=CC=CC=C12 UCEQXRCJXIVODC-PMACEKPBSA-N 0.000 description 1
- CZQHHVNHHHRRDU-UHFFFAOYSA-N LY294002 Chemical compound C1=CC=C2C(=O)C=C(N3CCOCC3)OC2=C1C1=CC=CC=C1 CZQHHVNHHHRRDU-UHFFFAOYSA-N 0.000 description 1
- DAQAKHDKYAWHCG-UHFFFAOYSA-N Lactacystin Natural products CC(=O)NC(C(O)=O)CSC(=O)C1(C(O)C(C)C)NC(=O)C(C)C1O DAQAKHDKYAWHCG-UHFFFAOYSA-N 0.000 description 1
- 241001245510 Lambia <signal fly> Species 0.000 description 1
- 208000031671 Large B-Cell Diffuse Lymphoma Diseases 0.000 description 1
- 241000222727 Leishmania donovani Species 0.000 description 1
- 241001137872 Leishmania sp. Species 0.000 description 1
- 241000713666 Lentivirus Species 0.000 description 1
- VTJUNIYRYIAIHF-IUCAKERBSA-N Leu-Pro Chemical compound CC(C)C[C@H](N)C(=O)N1CCC[C@H]1C(O)=O VTJUNIYRYIAIHF-IUCAKERBSA-N 0.000 description 1
- 102100031586 Leukocyte antigen CD37 Human genes 0.000 description 1
- 241000186779 Listeria monocytogenes Species 0.000 description 1
- 208000002404 Liver Cell Adenoma Diseases 0.000 description 1
- 102100029204 Low affinity immunoglobulin gamma Fc region receptor II-a Human genes 0.000 description 1
- 102100029205 Low affinity immunoglobulin gamma Fc region receptor II-b Human genes 0.000 description 1
- DDWFXDSYGUXRAY-UHFFFAOYSA-N Luciferin Natural products CCc1c(C)c(CC2NC(=O)C(=C2C=C)C)[nH]c1Cc3[nH]c4C(=C5/NC(CC(=O)O)C(C)C5CC(=O)O)CC(=O)c4c3C DDWFXDSYGUXRAY-UHFFFAOYSA-N 0.000 description 1
- 108090000856 Lyases Proteins 0.000 description 1
- 102000004317 Lyases Human genes 0.000 description 1
- 201000003791 MALT lymphoma Diseases 0.000 description 1
- 229940122696 MAP kinase inhibitor Drugs 0.000 description 1
- 229940124647 MEK inhibitor Drugs 0.000 description 1
- 241000282567 Macaca fascicularis Species 0.000 description 1
- 102100028198 Macrophage colony-stimulating factor 1 receptor Human genes 0.000 description 1
- 208000006644 Malignant Fibrous Histiocytoma Diseases 0.000 description 1
- 102000005727 Mammaglobin A Human genes 0.000 description 1
- 108010031030 Mammaglobin A Proteins 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 208000025205 Mantle-Cell Lymphoma Diseases 0.000 description 1
- 102100027754 Mast/stem cell growth factor receptor Kit Human genes 0.000 description 1
- 241000712079 Measles morbillivirus Species 0.000 description 1
- 102000012750 Membrane Glycoproteins Human genes 0.000 description 1
- 108010090054 Membrane Glycoproteins Proteins 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- XOGTZOOQQBDUSI-UHFFFAOYSA-M Mesna Chemical compound [Na+].[O-]S(=O)(=O)CCS XOGTZOOQQBDUSI-UHFFFAOYSA-M 0.000 description 1
- 102000003735 Mesothelin Human genes 0.000 description 1
- 108090000015 Mesothelin Proteins 0.000 description 1
- 206010027406 Mesothelioma Diseases 0.000 description 1
- IMTUWVJPCQPJEE-IUCAKERBSA-N Met-Lys Chemical compound CSCC[C@H](N)C(=O)N[C@H](C(O)=O)CCCCN IMTUWVJPCQPJEE-IUCAKERBSA-N 0.000 description 1
- 108010006035 Metalloproteases Proteins 0.000 description 1
- 102000005741 Metalloproteases Human genes 0.000 description 1
- GCKMFJBGXUYNAG-HLXURNFRSA-N Methyltestosterone Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@](C)(O)[C@@]1(C)CC2 GCKMFJBGXUYNAG-HLXURNFRSA-N 0.000 description 1
- 108700011259 MicroRNAs Proteins 0.000 description 1
- 229940119336 Microtubule stabilizer Drugs 0.000 description 1
- 229930192392 Mitomycin Natural products 0.000 description 1
- 244000302512 Momordica charantia Species 0.000 description 1
- 235000009811 Momordica charantia Nutrition 0.000 description 1
- 108010008707 Mucin-1 Proteins 0.000 description 1
- 241000235395 Mucor Species 0.000 description 1
- 241000235388 Mucorales Species 0.000 description 1
- 241000711386 Mumps virus Species 0.000 description 1
- 101100236305 Mus musculus Ly9 gene Proteins 0.000 description 1
- 101100481410 Mus musculus Tek gene Proteins 0.000 description 1
- 208000023178 Musculoskeletal disease Diseases 0.000 description 1
- 241000186359 Mycobacterium Species 0.000 description 1
- 241001467552 Mycobacterium bovis BCG Species 0.000 description 1
- 241000186362 Mycobacterium leprae Species 0.000 description 1
- 241000178382 Mycobacterium lepromatosis Species 0.000 description 1
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 1
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 1
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 description 1
- 208000014767 Myeloproliferative disease Diseases 0.000 description 1
- QPCDCPDFJACHGM-UHFFFAOYSA-N N,N-bis{2-[bis(carboxymethyl)amino]ethyl}glycine Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(=O)O)CCN(CC(O)=O)CC(O)=O QPCDCPDFJACHGM-UHFFFAOYSA-N 0.000 description 1
- NFIXBCVWIPOYCD-UHFFFAOYSA-N N,N-diethyl-2-[4-(phenylmethyl)phenoxy]ethanamine Chemical compound C1=CC(OCCN(CC)CC)=CC=C1CC1=CC=CC=C1 NFIXBCVWIPOYCD-UHFFFAOYSA-N 0.000 description 1
- GCIKSSRWRFVXBI-UHFFFAOYSA-N N-[4-[[4-(4-methyl-1-piperazinyl)-6-[(5-methyl-1H-pyrazol-3-yl)amino]-2-pyrimidinyl]thio]phenyl]cyclopropanecarboxamide Chemical compound C1CN(C)CCN1C1=CC(NC2=NNC(C)=C2)=NC(SC=2C=CC(NC(=O)C3CC3)=CC=2)=N1 GCIKSSRWRFVXBI-UHFFFAOYSA-N 0.000 description 1
- XKFTZKGMDDZMJI-HSZRJFAPSA-N N-[5-[(2R)-2-methoxy-1-oxo-2-phenylethyl]-4,6-dihydro-1H-pyrrolo[3,4-c]pyrazol-3-yl]-4-(4-methyl-1-piperazinyl)benzamide Chemical compound O=C([C@H](OC)C=1C=CC=CC=1)N(CC=12)CC=1NN=C2NC(=O)C(C=C1)=CC=C1N1CCN(C)CC1 XKFTZKGMDDZMJI-HSZRJFAPSA-N 0.000 description 1
- 125000003047 N-acetyl group Chemical group 0.000 description 1
- SQVRNKJHWKZAKO-LUWBGTNYSA-N N-acetylneuraminic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)CC(O)(C(O)=O)O[C@H]1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-LUWBGTNYSA-N 0.000 description 1
- 241000224438 Naegleria fowleri Species 0.000 description 1
- 241000588653 Neisseria Species 0.000 description 1
- 201000004404 Neurofibroma Diseases 0.000 description 1
- 241000207746 Nicotiana benthamiana Species 0.000 description 1
- 241001126259 Nippostrongylus brasiliensis Species 0.000 description 1
- 229920000305 Nylon 6,10 Polymers 0.000 description 1
- KRWMERLEINMZFT-UHFFFAOYSA-N O6-benzylguanine Chemical compound C=12NC=NC2=NC(N)=NC=1OCC1=CC=CC=C1 KRWMERLEINMZFT-UHFFFAOYSA-N 0.000 description 1
- 102100037589 OX-2 membrane glycoprotein Human genes 0.000 description 1
- 108010016076 Octreotide Proteins 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- 241001452677 Ogataea methanolica Species 0.000 description 1
- 241000489470 Ogataea trehalophila Species 0.000 description 1
- 241000826199 Ogataea wickerhamii Species 0.000 description 1
- 208000010191 Osteitis Deformans Diseases 0.000 description 1
- 208000000035 Osteochondroma Diseases 0.000 description 1
- TUVCWJQQGGETHL-UHFFFAOYSA-N PI-103 Chemical compound OC1=CC=CC(C=2N=C3C4=CC=CN=C4OC3=C(N3CCOCC3)N=2)=C1 TUVCWJQQGGETHL-UHFFFAOYSA-N 0.000 description 1
- 108091007960 PI3Ks Proteins 0.000 description 1
- 102000038030 PI3Ks Human genes 0.000 description 1
- 229940032310 PROSTVAC vaccine Drugs 0.000 description 1
- QIUASFSNWYMDFS-NILGECQDSA-N PX-866 Chemical compound CC(=O)O[C@@H]1C[C@]2(C)C(=O)CC[C@H]2C2=C1[C@@]1(C)[C@@H](COC)OC(=O)\C(=C\N(CC=C)CC=C)C1=C(O)C2=O QIUASFSNWYMDFS-NILGECQDSA-N 0.000 description 1
- 208000027067 Paget disease of bone Diseases 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 208000037064 Papilloma of choroid plexus Diseases 0.000 description 1
- 241001631646 Papillomaviridae Species 0.000 description 1
- 241000526686 Paracoccidioides brasiliensis Species 0.000 description 1
- 102100030869 Parathyroid hormone 2 receptor Human genes 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 241000530350 Phaffomyces opuntiae Species 0.000 description 1
- 241000529953 Phaffomyces thermotolerans Species 0.000 description 1
- FSXRLASFHBWESK-HOTGVXAUSA-N Phe-Tyr Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=CC=C1 FSXRLASFHBWESK-HOTGVXAUSA-N 0.000 description 1
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 1
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 1
- 108010053210 Phycocyanin Proteins 0.000 description 1
- 108010004729 Phycoerythrin Proteins 0.000 description 1
- 241000195887 Physcomitrella patens Species 0.000 description 1
- 101100413173 Phytolacca americana PAP2 gene Proteins 0.000 description 1
- 241000235062 Pichia membranifaciens Species 0.000 description 1
- 208000007641 Pinealoma Diseases 0.000 description 1
- KMSKQZKKOZQFFG-HSUXVGOQSA-N Pirarubicin Chemical compound O([C@H]1[C@@H](N)C[C@@H](O[C@H]1C)O[C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1CCCCO1 KMSKQZKKOZQFFG-HSUXVGOQSA-N 0.000 description 1
- 208000007913 Pituitary Neoplasms Diseases 0.000 description 1
- 201000005746 Pituitary adenoma Diseases 0.000 description 1
- 206010061538 Pituitary tumour benign Diseases 0.000 description 1
- 241000224016 Plasmodium Species 0.000 description 1
- 241000223810 Plasmodium vivax Species 0.000 description 1
- 102100026547 Platelet-derived growth factor receptor beta Human genes 0.000 description 1
- 241000233872 Pneumocystis carinii Species 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- HRHKSTOGXBBQCB-UHFFFAOYSA-N Porfiromycine Chemical compound O=C1C(N)=C(C)C(=O)C2=C1C(COC(N)=O)C1(OC)C3N(C)C3CN12 HRHKSTOGXBBQCB-UHFFFAOYSA-N 0.000 description 1
- HFVNWDWLWUCIHC-GUPDPFMOSA-N Prednimustine Chemical compound O=C([C@@]1(O)CC[C@H]2[C@H]3[C@@H]([C@]4(C=CC(=O)C=C4CC3)C)[C@@H](O)C[C@@]21C)COC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 HFVNWDWLWUCIHC-GUPDPFMOSA-N 0.000 description 1
- 102100022019 Pregnancy-specific beta-1-glycoprotein 2 Human genes 0.000 description 1
- 206010057846 Primitive neuroectodermal tumour Diseases 0.000 description 1
- 102100024028 Progonadoliberin-1 Human genes 0.000 description 1
- 108010002519 Prolactin Receptors Proteins 0.000 description 1
- 102100029000 Prolactin receptor Human genes 0.000 description 1
- 102100023832 Prolyl endopeptidase FAP Human genes 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 102000009516 Protein Serine-Threonine Kinases Human genes 0.000 description 1
- 108010009341 Protein Serine-Threonine Kinases Proteins 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 1
- 241000588769 Proteus <enterobacteria> Species 0.000 description 1
- 108010014608 Proto-Oncogene Proteins c-kit Proteins 0.000 description 1
- 102000016971 Proto-Oncogene Proteins c-kit Human genes 0.000 description 1
- 241000125945 Protoparvovirus Species 0.000 description 1
- 241000589516 Pseudomonas Species 0.000 description 1
- 101900161471 Pseudomonas aeruginosa Exotoxin A Proteins 0.000 description 1
- 201000004681 Psoriasis Diseases 0.000 description 1
- 241000711798 Rabies lyssavirus Species 0.000 description 1
- AHHFEZNOXOZZQA-ZEBDFXRSSA-N Ranimustine Chemical compound CO[C@H]1O[C@H](CNC(=O)N(CCCl)N=O)[C@@H](O)[C@H](O)[C@H]1O AHHFEZNOXOZZQA-ZEBDFXRSSA-N 0.000 description 1
- 102000004278 Receptor Protein-Tyrosine Kinases Human genes 0.000 description 1
- 102100029981 Receptor tyrosine-protein kinase erbB-4 Human genes 0.000 description 1
- 101710100963 Receptor tyrosine-protein kinase erbB-4 Proteins 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 229940124942 Recombivax HB Drugs 0.000 description 1
- 108700033496 Recombivax HB Proteins 0.000 description 1
- 241000725643 Respiratory syncytial virus Species 0.000 description 1
- 206010039019 Rhabdoid tumour of the kidney Diseases 0.000 description 1
- 208000005678 Rhabdomyoma Diseases 0.000 description 1
- 241000235527 Rhizopus Species 0.000 description 1
- OWPCHSCAPHNHAV-UHFFFAOYSA-N Rhizoxin Natural products C1C(O)C2(C)OC2C=CC(C)C(OC(=O)C2)CC2CC2OC2C(=O)OC1C(C)C(OC)C(C)=CC=CC(C)=CC1=COC(C)=N1 OWPCHSCAPHNHAV-UHFFFAOYSA-N 0.000 description 1
- 108010039491 Ricin Proteins 0.000 description 1
- 241000606701 Rickettsia Species 0.000 description 1
- 241000606651 Rickettsiales Species 0.000 description 1
- 241000702670 Rotavirus Species 0.000 description 1
- 241000710799 Rubella virus Species 0.000 description 1
- 229940044665 STING agonist Drugs 0.000 description 1
- 101100123851 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) HER1 gene Proteins 0.000 description 1
- 101001037255 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) Indoleamine 2,3-dioxygenase Proteins 0.000 description 1
- 240000003946 Saponaria officinalis Species 0.000 description 1
- 201000010208 Seminoma Diseases 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- RZEQTVHJZCIUBT-WDSKDSINSA-N Ser-Arg Chemical compound OC[C@H](N)C(=O)N[C@H](C(O)=O)CCCNC(N)=N RZEQTVHJZCIUBT-WDSKDSINSA-N 0.000 description 1
- LZLREEUGSYITMX-JQWIXIFHSA-N Ser-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@H](CO)N)C(O)=O)=CNC2=C1 LZLREEUGSYITMX-JQWIXIFHSA-N 0.000 description 1
- 102100027103 Serine/threonine-protein kinase B-raf Human genes 0.000 description 1
- 102100031463 Serine/threonine-protein kinase PLK1 Human genes 0.000 description 1
- 101710183160 Serine/threonine-protein kinase PLK1 Proteins 0.000 description 1
- 102100038192 Serine/threonine-protein kinase TBK1 Human genes 0.000 description 1
- 241000607720 Serratia Species 0.000 description 1
- 208000000097 Sertoli-Leydig cell tumor Diseases 0.000 description 1
- 102100038081 Signal transducer CD24 Human genes 0.000 description 1
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 1
- 206010041067 Small cell lung cancer Diseases 0.000 description 1
- 108020004459 Small interfering RNA Proteins 0.000 description 1
- OCOKWVBYZHBHLU-UHFFFAOYSA-N Sobuzoxane Chemical compound C1C(=O)N(COC(=O)OCC(C)C)C(=O)CN1CCN1CC(=O)N(COC(=O)OCC(C)C)C(=O)C1 OCOKWVBYZHBHLU-UHFFFAOYSA-N 0.000 description 1
- 101000668858 Spinacia oleracea 30S ribosomal protein S1, chloroplastic Proteins 0.000 description 1
- 241001149962 Sporothrix Species 0.000 description 1
- UIRKNQLZZXALBI-MSVGPLKSSA-N Squalamine Chemical compound C([C@@H]1C[C@H]2O)[C@@H](NCCCNCCCCN)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@H](C)CC[C@H](C(C)C)OS(O)(=O)=O)[C@@]2(C)CC1 UIRKNQLZZXALBI-MSVGPLKSSA-N 0.000 description 1
- UIRKNQLZZXALBI-UHFFFAOYSA-N Squalamine Natural products OC1CC2CC(NCCCNCCCCN)CCC2(C)C2C1C1CCC(C(C)CCC(C(C)C)OS(O)(=O)=O)C1(C)CC2 UIRKNQLZZXALBI-UHFFFAOYSA-N 0.000 description 1
- 241000295644 Staphylococcaceae Species 0.000 description 1
- 241000191940 Staphylococcus Species 0.000 description 1
- 102100021719 Steroid 17-alpha-hydroxylase/17,20 lyase Human genes 0.000 description 1
- 101710163849 Steroid 17-alpha-hydroxylase/17,20 lyase Proteins 0.000 description 1
- 101000898746 Streptomyces clavuligerus Clavaminate synthase 1 Proteins 0.000 description 1
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 1
- 241000282898 Sus scrofa Species 0.000 description 1
- 101000996723 Sus scrofa Gonadotropin-releasing hormone receptor Proteins 0.000 description 1
- 230000005867 T cell response Effects 0.000 description 1
- 206010042971 T-cell lymphoma Diseases 0.000 description 1
- 208000027585 T-cell non-Hodgkin lymphoma Diseases 0.000 description 1
- 102100025244 T-cell surface glycoprotein CD5 Human genes 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- 108700011582 TER 286 Proteins 0.000 description 1
- 108010034610 TG4010 Proteins 0.000 description 1
- 108091021474 TMEM173 Proteins 0.000 description 1
- 102000002259 TNF-Related Apoptosis-Inducing Ligand Receptors Human genes 0.000 description 1
- 108010000449 TNF-Related Apoptosis-Inducing Ligand Receptors Proteins 0.000 description 1
- JACAAXNEHGBPOQ-LLVKDONJSA-N Talampanel Chemical compound C([C@H](N(N=1)C(C)=O)C)C2=CC=3OCOC=3C=C2C=1C1=CC=C(N)C=C1 JACAAXNEHGBPOQ-LLVKDONJSA-N 0.000 description 1
- NAVMQTYZDKMPEU-UHFFFAOYSA-N Targretin Chemical compound CC1=CC(C(CCC2(C)C)(C)C)=C2C=C1C(=C)C1=CC=C(C(O)=O)C=C1 NAVMQTYZDKMPEU-UHFFFAOYSA-N 0.000 description 1
- GKLVYJBZJHMRIY-OUBTZVSYSA-N Technetium-99 Chemical compound [99Tc] GKLVYJBZJHMRIY-OUBTZVSYSA-N 0.000 description 1
- NYTOUQBROMCLBJ-UHFFFAOYSA-N Tetranitromethane Chemical compound [O-][N+](=O)C([N+]([O-])=O)([N+]([O-])=O)[N+]([O-])=O NYTOUQBROMCLBJ-UHFFFAOYSA-N 0.000 description 1
- QHOPXUFELLHKAS-UHFFFAOYSA-N Thespesin Natural products CC(C)c1c(O)c(O)c2C(O)Oc3c(c(C)cc1c23)-c1c2OC(O)c3c(O)c(O)c(C(C)C)c(cc1C)c23 QHOPXUFELLHKAS-UHFFFAOYSA-N 0.000 description 1
- DSGIVWSDDRDJIO-ZXXMMSQZSA-N Thr-Thr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(O)=O DSGIVWSDDRDJIO-ZXXMMSQZSA-N 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 208000005485 Thrombocytosis Diseases 0.000 description 1
- 239000000365 Topoisomerase I Inhibitor Substances 0.000 description 1
- 239000000317 Topoisomerase II Inhibitor Substances 0.000 description 1
- IWEQQRMGNVVKQW-OQKDUQJOSA-N Toremifene citrate Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O.C1=CC(OCCN(C)C)=CC=C1C(\C=1C=CC=CC=1)=C(\CCCl)C1=CC=CC=C1 IWEQQRMGNVVKQW-OQKDUQJOSA-N 0.000 description 1
- 101710120037 Toxin CcdB Proteins 0.000 description 1
- 241000223996 Toxoplasma Species 0.000 description 1
- 241000223997 Toxoplasma gondii Species 0.000 description 1
- 108010050144 Triptorelin Pamoate Proteins 0.000 description 1
- 241000223105 Trypanosoma brucei Species 0.000 description 1
- 241000223109 Trypanosoma cruzi Species 0.000 description 1
- 241000223093 Trypanosoma sp. Species 0.000 description 1
- 101710136122 Tryptophan 2,3-dioxygenase Proteins 0.000 description 1
- 102000004243 Tubulin Human genes 0.000 description 1
- 108090000704 Tubulin Proteins 0.000 description 1
- 102100040247 Tumor necrosis factor Human genes 0.000 description 1
- CGWAPUBOXJWXMS-HOTGVXAUSA-N Tyr-Phe Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=C(O)C=C1 CGWAPUBOXJWXMS-HOTGVXAUSA-N 0.000 description 1
- 102100022596 Tyrosine-protein kinase ABL1 Human genes 0.000 description 1
- 102100037236 Tyrosine-protein kinase receptor UFO Human genes 0.000 description 1
- 229940127507 Ubiquitin Ligase Inhibitors Drugs 0.000 description 1
- 208000015778 Undifferentiated pleomorphic sarcoma Diseases 0.000 description 1
- 108091008605 VEGF receptors Proteins 0.000 description 1
- 208000009311 VIPoma Diseases 0.000 description 1
- VEPKQEUBKLEPRA-UHFFFAOYSA-N VX-745 Chemical compound FC1=CC(F)=CC=C1SC1=NN2C=NC(=O)C(C=3C(=CC=CC=3Cl)Cl)=C2C=C1 VEPKQEUBKLEPRA-UHFFFAOYSA-N 0.000 description 1
- 241000700618 Vaccinia virus Species 0.000 description 1
- JKHXYJKMNSSFFL-IUCAKERBSA-N Val-Lys Chemical compound CC(C)[C@H](N)C(=O)N[C@H](C(O)=O)CCCCN JKHXYJKMNSSFFL-IUCAKERBSA-N 0.000 description 1
- 108010053096 Vascular Endothelial Growth Factor Receptor-1 Proteins 0.000 description 1
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 1
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 1
- 240000001866 Vernicia fordii Species 0.000 description 1
- 208000014070 Vestibular schwannoma Diseases 0.000 description 1
- 241000607626 Vibrio cholerae Species 0.000 description 1
- 241000370136 Wickerhamomyces pijperi Species 0.000 description 1
- 206010048214 Xanthoma Diseases 0.000 description 1
- 206010048215 Xanthomatosis Diseases 0.000 description 1
- 241000235015 Yarrowia lipolytica Species 0.000 description 1
- 241000607734 Yersinia <bacteria> Species 0.000 description 1
- 241000607479 Yersinia pestis Species 0.000 description 1
- HGVNLRPZOWWDKD-UHFFFAOYSA-N ZSTK-474 Chemical compound FC(F)C1=NC2=CC=CC=C2N1C(N=1)=NC(N2CCOCC2)=NC=1N1CCOCC1 HGVNLRPZOWWDKD-UHFFFAOYSA-N 0.000 description 1
- XMYKNCNAZKMVQN-NYYWCZLTSA-N [(e)-(3-aminopyridin-2-yl)methylideneamino]thiourea Chemical compound NC(=S)N\N=C\C1=NC=CC=C1N XMYKNCNAZKMVQN-NYYWCZLTSA-N 0.000 description 1
- XSMVECZRZBFTIZ-UHFFFAOYSA-M [2-(aminomethyl)cyclobutyl]methanamine;2-oxidopropanoate;platinum(4+) Chemical compound [Pt+4].CC([O-])C([O-])=O.NCC1CCC1CN XSMVECZRZBFTIZ-UHFFFAOYSA-M 0.000 description 1
- CKXIPXAIFMTQCS-LRDUUELOSA-N [2-[(2s,4s)-4-[(2r,3r,4r,5s,6s)-3-fluoro-4,5-dihydroxy-6-methyloxan-2-yl]oxy-2,5,12-trihydroxy-7-methoxy-6,11-dioxo-3,4-dihydro-1h-tetracen-2-yl]-2-oxoethyl] 3-aminopropanoate Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)COC(=O)CCN)[C@@H]1O[C@@H](C)[C@@H](O)[C@@H](O)[C@H]1F CKXIPXAIFMTQCS-LRDUUELOSA-N 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- IEDXPSOJFSVCKU-HOKPPMCLSA-N [4-[[(2S)-5-(carbamoylamino)-2-[[(2S)-2-[6-(2,5-dioxopyrrolidin-1-yl)hexanoylamino]-3-methylbutanoyl]amino]pentanoyl]amino]phenyl]methyl N-[(2S)-1-[[(2S)-1-[[(3R,4S,5S)-1-[(2S)-2-[(1R,2R)-3-[[(1S,2R)-1-hydroxy-1-phenylpropan-2-yl]amino]-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl]-3-methoxy-5-methyl-1-oxoheptan-4-yl]-methylamino]-3-methyl-1-oxobutan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]-N-methylcarbamate Chemical compound CC[C@H](C)[C@@H]([C@@H](CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C)[C@@H](O)c1ccccc1)OC)N(C)C(=O)[C@@H](NC(=O)[C@H](C(C)C)N(C)C(=O)OCc1ccc(NC(=O)[C@H](CCCNC(N)=O)NC(=O)[C@@H](NC(=O)CCCCCN2C(=O)CCC2=O)C(C)C)cc1)C(C)C IEDXPSOJFSVCKU-HOKPPMCLSA-N 0.000 description 1
- 229950001573 abemaciclib Drugs 0.000 description 1
- 239000002250 absorbent Substances 0.000 description 1
- 230000002745 absorbent Effects 0.000 description 1
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 1
- DUYNJNWVGIWJRI-LJAQVGFWSA-N acolbifene Chemical compound C1=CC([C@H]2C(=C(C3=CC=C(O)C=C3O2)C)C=2C=CC(O)=CC=2)=CC=C1OCCN1CCCCC1 DUYNJNWVGIWJRI-LJAQVGFWSA-N 0.000 description 1
- 229950002421 acolbifene Drugs 0.000 description 1
- 208000004064 acoustic neuroma Diseases 0.000 description 1
- 208000017733 acquired polycythemia vera Diseases 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 239000008186 active pharmaceutical agent Substances 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 238000005917 acylation reaction Methods 0.000 description 1
- 230000003044 adaptive effect Effects 0.000 description 1
- 102000035181 adaptor proteins Human genes 0.000 description 1
- 108091005764 adaptor proteins Proteins 0.000 description 1
- 229950009084 adecatumumab Drugs 0.000 description 1
- 229960000643 adenine Drugs 0.000 description 1
- 208000002718 adenomatoid tumor Diseases 0.000 description 1
- 210000004100 adrenal gland Anatomy 0.000 description 1
- 229940009456 adriamycin Drugs 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 238000001261 affinity purification Methods 0.000 description 1
- 229960002833 aflibercept Drugs 0.000 description 1
- 108010081667 aflibercept Proteins 0.000 description 1
- MLFKVJCWGUZWNV-REOHCLBHSA-N alanosine Chemical compound OC(=O)[C@@H](N)CN(O)N=O MLFKVJCWGUZWNV-REOHCLBHSA-N 0.000 description 1
- 229950005033 alanosine Drugs 0.000 description 1
- 108010044940 alanylglutamine Proteins 0.000 description 1
- 108010070944 alanylhistidine Proteins 0.000 description 1
- 150000001299 aldehydes Chemical class 0.000 description 1
- 229960001445 alitretinoin Drugs 0.000 description 1
- 238000005804 alkylation reaction Methods 0.000 description 1
- 230000000735 allogeneic effect Effects 0.000 description 1
- 108010004469 allophycocyanin Proteins 0.000 description 1
- GLEIMNFBCWCWPW-QOTBAUSGSA-N alpha-D-Man-(1->2)-alpha-D-Man-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Man-(1->3)-[alpha-D-Man-(1->6)]-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-D-GlcNAc Chemical compound O[C@@H]1[C@@H](NC(=O)C)C(O)O[C@H](CO)[C@H]1O[C@H]1[C@H](NC(C)=O)[C@@H](O)[C@H](O[C@H]2[C@H]([C@@H](O[C@@H]3[C@H]([C@@H](O)[C@H](O)[C@@H](CO)O3)O[C@@H]3[C@H]([C@@H](O)[C@H](O)[C@@H](CO)O3)O[C@@H]3[C@H]([C@@H](O)[C@H](O)[C@@H](CO)O3)O)[C@H](O)[C@@H](CO[C@@H]3[C@H]([C@@H](O[C@@H]4[C@H]([C@@H](O)[C@H](O)[C@@H](CO)O4)O)[C@H](O)[C@@H](CO[C@@H]4[C@H]([C@@H](O)[C@H](O)[C@@H](CO)O4)O)O3)O)O2)O)[C@@H](CO)O1 GLEIMNFBCWCWPW-QOTBAUSGSA-N 0.000 description 1
- ORDAZKGHSNRHTD-UHFFFAOYSA-N alpha-Toxicarol Natural products O1C(C)(C)C=CC2=C1C=CC1=C2OC2COC(C=C(C(=C3)OC)OC)=C3C2C1=O ORDAZKGHSNRHTD-UHFFFAOYSA-N 0.000 description 1
- 108010001818 alpha-sarcin Proteins 0.000 description 1
- 210000001132 alveolar macrophage Anatomy 0.000 description 1
- 229950010817 alvocidib Drugs 0.000 description 1
- BIIVYFLTOXDAOV-YVEFUNNKSA-N alvocidib Chemical compound O[C@@H]1CN(C)CC[C@@H]1C1=C(O)C=C(O)C2=C1OC(C=1C(=CC=CC=1)Cl)=CC2=O BIIVYFLTOXDAOV-YVEFUNNKSA-N 0.000 description 1
- 229960001097 amifostine Drugs 0.000 description 1
- JKOQGQFVAUAYPM-UHFFFAOYSA-N amifostine Chemical compound NCCCNCCSP(O)(O)=O JKOQGQFVAUAYPM-UHFFFAOYSA-N 0.000 description 1
- 229960003896 aminopterin Drugs 0.000 description 1
- 229960001694 anagrelide Drugs 0.000 description 1
- OTBXOEAOVRKTNQ-UHFFFAOYSA-N anagrelide Chemical compound N1=C2NC(=O)CN2CC2=C(Cl)C(Cl)=CC=C21 OTBXOEAOVRKTNQ-UHFFFAOYSA-N 0.000 description 1
- 206010002224 anaplastic astrocytoma Diseases 0.000 description 1
- 239000003098 androgen Substances 0.000 description 1
- 229940030486 androgens Drugs 0.000 description 1
- 230000033115 angiogenesis Effects 0.000 description 1
- 229950001104 anhydrovinblastine Drugs 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 238000005349 anion exchange Methods 0.000 description 1
- CIDNKDMVSINJCG-GKXONYSUSA-N annamycin Chemical compound I[C@@H]1[C@H](O)[C@@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(=O)CO)C1 CIDNKDMVSINJCG-GKXONYSUSA-N 0.000 description 1
- 230000003042 antagnostic effect Effects 0.000 description 1
- 229940045799 anthracyclines and related substance Drugs 0.000 description 1
- 230000002280 anti-androgenic effect Effects 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 229940046836 anti-estrogen Drugs 0.000 description 1
- 230000001833 anti-estrogenic effect Effects 0.000 description 1
- 230000003388 anti-hormonal effect Effects 0.000 description 1
- 230000003110 anti-inflammatory effect Effects 0.000 description 1
- 230000000118 anti-neoplastic effect Effects 0.000 description 1
- 230000001028 anti-proliverative effect Effects 0.000 description 1
- 239000000051 antiandrogen Substances 0.000 description 1
- 229940030495 antiandrogen sex hormone and modulator of the genital system Drugs 0.000 description 1
- 229940125644 antibody drug Drugs 0.000 description 1
- 229940049595 antibody-drug conjugate Drugs 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 229940034982 antineoplastic agent Drugs 0.000 description 1
- 239000003816 antisense DNA Substances 0.000 description 1
- 239000000074 antisense oligonucleotide Substances 0.000 description 1
- 238000012230 antisense oligonucleotides Methods 0.000 description 1
- 230000025194 apoptotic cell clearance Effects 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- 229940115115 aranesp Drugs 0.000 description 1
- 238000000149 argon plasma sintering Methods 0.000 description 1
- 239000003886 aromatase inhibitor Substances 0.000 description 1
- 229940046844 aromatase inhibitors Drugs 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 229950005529 arzoxifene Drugs 0.000 description 1
- 229960003272 asparaginase Drugs 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-M asparaginate Chemical compound [O-]C(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-M 0.000 description 1
- 108010047857 aspartylglycine Proteins 0.000 description 1
- FZCSTZYAHCUGEM-UHFFFAOYSA-N aspergillomarasmine B Natural products OC(=O)CNC(C(O)=O)CNC(C(O)=O)CC(O)=O FZCSTZYAHCUGEM-UHFFFAOYSA-N 0.000 description 1
- TWHSQQYCDVSBRK-UHFFFAOYSA-N asulacrine Chemical compound C12=CC=CC(C)=C2N=C2C(C(=O)NC)=CC=CC2=C1NC1=CC=C(NS(C)(=O)=O)C=C1OC TWHSQQYCDVSBRK-UHFFFAOYSA-N 0.000 description 1
- 229950011088 asulacrine Drugs 0.000 description 1
- 125000004429 atom Chemical group 0.000 description 1
- 229950010993 atrasentan Drugs 0.000 description 1
- MOTJMGVDPWRKOC-QPVYNBJUSA-N atrasentan Chemical compound C1([C@H]2[C@@H]([C@H](CN2CC(=O)N(CCCC)CCCC)C=2C=C3OCOC3=CC=2)C(O)=O)=CC=C(OC)C=C1 MOTJMGVDPWRKOC-QPVYNBJUSA-N 0.000 description 1
- 108010044540 auristatin Proteins 0.000 description 1
- 229940037642 autologous vaccine Drugs 0.000 description 1
- 229950006332 axalimogene filolisbac Drugs 0.000 description 1
- KLNFSAOEKUDMFA-UHFFFAOYSA-N azanide;2-hydroxyacetic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OCC(O)=O KLNFSAOEKUDMFA-UHFFFAOYSA-N 0.000 description 1
- 208000007456 balantidiasis Diseases 0.000 description 1
- 229950001429 batabulin Drugs 0.000 description 1
- 229960000817 bazedoxifene Drugs 0.000 description 1
- UCJGJABZCDBEDK-UHFFFAOYSA-N bazedoxifene Chemical compound C=1C=C(OCCN2CCCCCC2)C=CC=1CN1C2=CC=C(O)C=C2C(C)=C1C1=CC=C(O)C=C1 UCJGJABZCDBEDK-UHFFFAOYSA-N 0.000 description 1
- 229960003094 belinostat Drugs 0.000 description 1
- NCNRHFGMJRPRSK-MDZDMXLPSA-N belinostat Chemical compound ONC(=O)\C=C\C1=CC=CC(S(=O)(=O)NC=2C=CC=CC=2)=C1 NCNRHFGMJRPRSK-MDZDMXLPSA-N 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 208000001119 benign fibrous histiocytoma Diseases 0.000 description 1
- 125000005605 benzo group Chemical group 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 229960002938 bexarotene Drugs 0.000 description 1
- 238000012575 bio-layer interferometry Methods 0.000 description 1
- 238000004166 bioassay Methods 0.000 description 1
- 229960000074 biopharmaceutical Drugs 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 229950008548 bisantrene Drugs 0.000 description 1
- 229960003008 blinatumomab Drugs 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000000601 blood cell Anatomy 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- UBJAHGAUPNGZFF-XOVTVWCYSA-N bms-184476 Chemical compound O([C@H]1[C@@H]2[C@]3(OC(C)=O)CO[C@@H]3C[C@@H]([C@]2(C(=O)[C@H](OC(C)=O)C2=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)C=3C=CC=CC=3)C=3C=CC=CC=3)C[C@]1(O)C2(C)C)C)OCSC)C(=O)C1=CC=CC=C1 UBJAHGAUPNGZFF-XOVTVWCYSA-N 0.000 description 1
- GMJWGJSDPOAZTP-MIDYMNAOSA-N bms-188797 Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](OC(C)=O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)C=4C=CC=CC=4)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)OC)C(=O)C1=CC=CC=C1 GMJWGJSDPOAZTP-MIDYMNAOSA-N 0.000 description 1
- 208000016738 bone Paget disease Diseases 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 201000009480 botryoid rhabdomyosarcoma Diseases 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 201000003149 breast fibroadenoma Diseases 0.000 description 1
- 208000003362 bronchogenic carcinoma Diseases 0.000 description 1
- 201000002143 bronchus adenoma Diseases 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 229950003628 buparlisib Drugs 0.000 description 1
- CUWODFFVMXJOKD-UVLQAERKSA-N buserelin Chemical compound CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](COC(C)(C)C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=CC=C(O)C=C1 CUWODFFVMXJOKD-UVLQAERKSA-N 0.000 description 1
- 229960002719 buserelin Drugs 0.000 description 1
- 235000020964 calcitriol Nutrition 0.000 description 1
- 239000011612 calcitriol Substances 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 229940112129 campath Drugs 0.000 description 1
- 238000002619 cancer immunotherapy Methods 0.000 description 1
- 239000012830 cancer therapeutic Substances 0.000 description 1
- 229940022399 cancer vaccine Drugs 0.000 description 1
- 238000009566 cancer vaccine Methods 0.000 description 1
- 229950002826 canertinib Drugs 0.000 description 1
- OMZCMEYTWSXEPZ-UHFFFAOYSA-N canertinib Chemical compound C1=C(Cl)C(F)=CC=C1NC1=NC=NC2=CC(OCCCN3CCOCC3)=C(NC(=O)C=C)C=C12 OMZCMEYTWSXEPZ-UHFFFAOYSA-N 0.000 description 1
- 229950000772 canfosfamide Drugs 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 230000000747 cardiac effect Effects 0.000 description 1
- 229960002438 carfilzomib Drugs 0.000 description 1
- 229960003261 carmofur Drugs 0.000 description 1
- 229950005629 carotuximab Drugs 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 238000005341 cation exchange Methods 0.000 description 1
- 229960000419 catumaxomab Drugs 0.000 description 1
- 229960002412 cediranib Drugs 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 230000005887 cellular phagocytosis Effects 0.000 description 1
- 108010046713 cemadotin Proteins 0.000 description 1
- 229950009017 cemadotin Drugs 0.000 description 1
- 108010031379 centromere protein E Proteins 0.000 description 1
- 229960001602 ceritinib Drugs 0.000 description 1
- 208000019065 cervical carcinoma Diseases 0.000 description 1
- 210000003679 cervix uteri Anatomy 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- IQCIQDNWBGEGRL-UHFFFAOYSA-N chembl1614651 Chemical compound O=C1C2=C(O)C=CC(O)=C2N2N=C(CNCCO)C3=CC=C(NCCCN)C1=C32 IQCIQDNWBGEGRL-UHFFFAOYSA-N 0.000 description 1
- ZXFCRFYULUUSDW-OWXODZSWSA-N chembl2104970 Chemical compound C([C@H]1C2)C3=CC=CC(O)=C3C(=O)C1=C(O)[C@@]1(O)[C@@H]2CC(O)=C(C(=O)N)C1=O ZXFCRFYULUUSDW-OWXODZSWSA-N 0.000 description 1
- YOQPCWIXYUNEET-UHFFFAOYSA-N chembl307697 Chemical compound C1=CC(O)=CC=C1C(C=1C=CC(O)=CC=1)=NNC1=CC=C([N+]([O-])=O)C=C1[N+]([O-])=O YOQPCWIXYUNEET-UHFFFAOYSA-N 0.000 description 1
- ROWSTIYZUWEOMM-UHFFFAOYSA-N chembl488755 Chemical compound C12=CC=CC=C2C(=O)C2=C1C1=CC=C(O)C=C1N=C2NCCN(C)C ROWSTIYZUWEOMM-UHFFFAOYSA-N 0.000 description 1
- PIQCTGMSNWUMAF-UHFFFAOYSA-N chembl522892 Chemical compound C1CN(C)CCN1C1=CC=C(NC(=N2)C=3C(NC4=CC=CC(F)=C4C=3N)=O)C2=C1 PIQCTGMSNWUMAF-UHFFFAOYSA-N 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 108700023145 chlamydocin Proteins 0.000 description 1
- 229960005534 chlorotoxin Drugs 0.000 description 1
- QPAKKWCQMHUHNI-GQIQPHNSSA-N chlorotoxin Chemical compound C([C@H]1C(=O)NCC(=O)N2CCC[C@H]2C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H]2CSSC[C@H]3C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H]4CSSC[C@@H](C(N[C@@H](CCSC)C(=O)N5CCC[C@H]5C(=O)N[C@@H](CSSC[C@@H](C(=O)N1)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)CNC(=O)CNC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CC(C)C)NC2=O)C(=O)N[C@@H](CCCNC(N)=N)C(N)=O)NC4=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1N=CNC=1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N3)=O)NC(=O)[C@@H](N)CCSC)C1=CC=C(O)C=C1 QPAKKWCQMHUHNI-GQIQPHNSSA-N 0.000 description 1
- 229960002559 chlorotrianisene Drugs 0.000 description 1
- BFPSDSIWYFKGBC-UHFFFAOYSA-N chlorotrianisene Chemical compound C1=CC(OC)=CC=C1C(Cl)=C(C=1C=CC(OC)=CC=1)C1=CC=C(OC)C=C1 BFPSDSIWYFKGBC-UHFFFAOYSA-N 0.000 description 1
- 208000006990 cholangiocarcinoma Diseases 0.000 description 1
- 201000005217 chondroblastoma Diseases 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 229910052804 chromium Inorganic materials 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 238000002983 circular dichroism Methods 0.000 description 1
- 229960002436 cladribine Drugs 0.000 description 1
- 208000009060 clear cell adenocarcinoma Diseases 0.000 description 1
- 229960002286 clodronic acid Drugs 0.000 description 1
- ACSIXWWBWUQEHA-UHFFFAOYSA-N clodronic acid Chemical compound OP(O)(=O)C(Cl)(Cl)P(O)(O)=O ACSIXWWBWUQEHA-UHFFFAOYSA-N 0.000 description 1
- VNFPBHJOKIVQEB-UHFFFAOYSA-N clotrimazole Chemical compound ClC1=CC=CC=C1C(N1C=NC=C1)(C=1C=CC=CC=1)C1=CC=CC=C1 VNFPBHJOKIVQEB-UHFFFAOYSA-N 0.000 description 1
- 230000006957 competitive inhibition Effects 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 239000003184 complementary RNA Substances 0.000 description 1
- 238000000205 computational method Methods 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- POADTFBBIXOWFJ-VWLOTQADSA-N cositecan Chemical compound C1=CC=C2C(CC[Si](C)(C)C)=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 POADTFBBIXOWFJ-VWLOTQADSA-N 0.000 description 1
- 229960005061 crizotinib Drugs 0.000 description 1
- 239000003431 cross linking reagent Substances 0.000 description 1
- 230000009260 cross reactivity Effects 0.000 description 1
- 108010006226 cryptophycin Proteins 0.000 description 1
- PSNOPSMXOBPNNV-VVCTWANISA-N cryptophycin 1 Chemical compound C1=C(Cl)C(OC)=CC=C1C[C@@H]1C(=O)NC[C@@H](C)C(=O)O[C@@H](CC(C)C)C(=O)O[C@H]([C@H](C)[C@@H]2[C@H](O2)C=2C=CC=CC=2)C/C=C/C(=O)N1 PSNOPSMXOBPNNV-VVCTWANISA-N 0.000 description 1
- PSNOPSMXOBPNNV-UHFFFAOYSA-N cryptophycin-327 Natural products C1=C(Cl)C(OC)=CC=C1CC1C(=O)NCC(C)C(=O)OC(CC(C)C)C(=O)OC(C(C)C2C(O2)C=2C=CC=CC=2)CC=CC(=O)N1 PSNOPSMXOBPNNV-UHFFFAOYSA-N 0.000 description 1
- 201000010305 cutaneous fibrous histiocytoma Diseases 0.000 description 1
- 208000035250 cutaneous malignant susceptibility to 1 melanoma Diseases 0.000 description 1
- 239000002875 cyclin dependent kinase inhibitor Substances 0.000 description 1
- 229940043378 cyclin-dependent kinase inhibitor Drugs 0.000 description 1
- 229960003843 cyproterone Drugs 0.000 description 1
- 229960000978 cyproterone acetate Drugs 0.000 description 1
- UFULAYFCSOUIOV-UHFFFAOYSA-N cysteamine Chemical compound NCCS UFULAYFCSOUIOV-UHFFFAOYSA-N 0.000 description 1
- 229950006614 cytarabine ocfosfate Drugs 0.000 description 1
- 210000005220 cytoplasmic tail Anatomy 0.000 description 1
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Natural products NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 1
- 229940104302 cytosine Drugs 0.000 description 1
- 229960002465 dabrafenib Drugs 0.000 description 1
- 229950005259 dacinostat Drugs 0.000 description 1
- 229940059359 dacogen Drugs 0.000 description 1
- 125000001295 dansyl group Chemical group [H]C1=C([H])C(N(C([H])([H])[H])C([H])([H])[H])=C2C([H])=C([H])C([H])=C(C2=C1[H])S(*)(=O)=O 0.000 description 1
- 229950002966 danusertib Drugs 0.000 description 1
- 229940094732 darzalex Drugs 0.000 description 1
- 238000007405 data analysis Methods 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- ORDAZKGHSNRHTD-UXHICEINSA-N deguelin Chemical compound O1C(C)(C)C=CC2=C1C=CC1=C2O[C@@H]2COC(C=C(C(=C3)OC)OC)=C3[C@@H]2C1=O ORDAZKGHSNRHTD-UXHICEINSA-N 0.000 description 1
- GSZRULWGAWHHRI-UHFFFAOYSA-N deguelin Natural products O1C=CC(C)(C)C2=C1C=CC1=C2OC2COC(C=C(C(=C3)OC)OC)=C3C2C1=O GSZRULWGAWHHRI-UHFFFAOYSA-N 0.000 description 1
- 229940029030 dendritic cell vaccine Drugs 0.000 description 1
- 108010017271 denileukin diftitox Proteins 0.000 description 1
- 229950002756 depatuxizumab Drugs 0.000 description 1
- 229940070968 depocyt Drugs 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 229960000605 dexrazoxane Drugs 0.000 description 1
- NIJJYAXOARWZEE-UHFFFAOYSA-N di-n-propyl-acetic acid Natural products CCCC(C(O)=O)CCC NIJJYAXOARWZEE-UHFFFAOYSA-N 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 239000000032 diagnostic agent Substances 0.000 description 1
- 229940039227 diagnostic agent Drugs 0.000 description 1
- 150000004985 diamines Chemical class 0.000 description 1
- 229930191339 dianthin Natural products 0.000 description 1
- 150000008364 diarylpropionitriles Chemical class 0.000 description 1
- 229950007457 dibrospidium chloride Drugs 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- BMTPVPNVQOYGAP-UHFFFAOYSA-N diethyl 6-methoxy-5,7-dihydroindolo[2,3-b]carbazole-2,10-dicarboxylate Chemical compound N1C2=CC=C(C(=O)OCC)C=C2C2=C1C(OC)=C1NC3=CC=C(C(=O)OCC)C=C3C1=C2 BMTPVPNVQOYGAP-UHFFFAOYSA-N 0.000 description 1
- 238000000113 differential scanning calorimetry Methods 0.000 description 1
- 206010012818 diffuse large B-cell lymphoma Diseases 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 229950009278 dimesna Drugs 0.000 description 1
- FSXRLASFHBWESK-UHFFFAOYSA-N dipeptide phenylalanyl-tyrosine Natural products C=1C=C(O)C=CC=1CC(C(O)=O)NC(=O)C(N)CC1=CC=CC=C1 FSXRLASFHBWESK-UHFFFAOYSA-N 0.000 description 1
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 1
- 230000006806 disease prevention Effects 0.000 description 1
- GDLPAGOVHZLZEK-JBUFHSOLSA-L disodium;(4s)-4-amino-5-[[(1s)-1-carboxylato-2-(1h-indol-3-yl)ethyl]amino]-5-oxopentanoate Chemical compound [Na+].[Na+].C1=CC=C2C(C[C@H](NC(=O)[C@H](CCC([O-])=O)N)C([O-])=O)=CNC2=C1 GDLPAGOVHZLZEK-JBUFHSOLSA-L 0.000 description 1
- KQYGMURBTJPBPQ-UHFFFAOYSA-L disodium;2-(2-sulfonatoethyldisulfanyl)ethanesulfonate Chemical compound [Na+].[Na+].[O-]S(=O)(=O)CCSSCCS([O-])(=O)=O KQYGMURBTJPBPQ-UHFFFAOYSA-L 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 1
- AMRJKAQTDDKMCE-UHFFFAOYSA-N dolastatin Chemical compound CC(C)C(N(C)C)C(=O)NC(C(C)C)C(=O)N(C)C(C(C)C)C(OC)CC(=O)N1CCCC1C(OC)C(C)C(=O)NC(C=1SC=CN=1)CC1=CC=CC=C1 AMRJKAQTDDKMCE-UHFFFAOYSA-N 0.000 description 1
- 229930188854 dolastatin Natural products 0.000 description 1
- 229950005778 dovitinib Drugs 0.000 description 1
- 230000007783 downstream signaling Effects 0.000 description 1
- 229950005454 doxifluridine Drugs 0.000 description 1
- 229940115080 doxil Drugs 0.000 description 1
- 229950004203 droloxifene Drugs 0.000 description 1
- NOTIQUSPUUHHEH-UXOVVSIBSA-N dromostanolone propionate Chemical compound C([C@@H]1CC2)C(=O)[C@H](C)C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H](OC(=O)CC)[C@@]2(C)CC1 NOTIQUSPUUHHEH-UXOVVSIBSA-N 0.000 description 1
- 229950004683 drostanolone propionate Drugs 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 229950001287 edotecarin Drugs 0.000 description 1
- 229960001776 edrecolomab Drugs 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 229950004438 elinafide Drugs 0.000 description 1
- 201000009409 embryonal rhabdomyosarcoma Diseases 0.000 description 1
- 229950005450 emitefur Drugs 0.000 description 1
- 238000005538 encapsulation Methods 0.000 description 1
- 201000003914 endometrial carcinoma Diseases 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 229950011487 enocitabine Drugs 0.000 description 1
- 108010028531 enomycin Proteins 0.000 description 1
- 229950010640 ensituximab Drugs 0.000 description 1
- 229940007078 entamoeba histolytica Drugs 0.000 description 1
- 229960004671 enzalutamide Drugs 0.000 description 1
- WXCXUHSOUPDCQV-UHFFFAOYSA-N enzalutamide Chemical compound C1=C(F)C(C(=O)NC)=CC=C1N1C(C)(C)C(=O)N(C=2C=C(C(C#N)=CC=2)C(F)(F)F)C1=S WXCXUHSOUPDCQV-UHFFFAOYSA-N 0.000 description 1
- 229950002189 enzastaurin Drugs 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 229950006370 epacadostat Drugs 0.000 description 1
- 229940116977 epidermal growth factor Drugs 0.000 description 1
- 108010087914 epidermal growth factor receptor VIII Proteins 0.000 description 1
- 229950009760 epratuzumab Drugs 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- 210000003236 esophagogastric junction Anatomy 0.000 description 1
- 210000003238 esophagus Anatomy 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 229960005309 estradiol Drugs 0.000 description 1
- 229930182833 estradiol Natural products 0.000 description 1
- 239000000328 estrogen antagonist Substances 0.000 description 1
- 150000002168 ethanoic acid esters Chemical class 0.000 description 1
- 229960002568 ethinylestradiol Drugs 0.000 description 1
- JEFPWOBULVSOTM-PPHPATTJSA-N ethyl n-[(2s)-5-amino-2-methyl-3-phenyl-1,2-dihydropyrido[3,4-b]pyrazin-7-yl]carbamate;2-hydroxyethanesulfonic acid Chemical compound OCCS(O)(=O)=O.C=1([C@H](C)NC=2C=C(N=C(N)C=2N=1)NC(=O)OCC)C1=CC=CC=C1 JEFPWOBULVSOTM-PPHPATTJSA-N 0.000 description 1
- LIQODXNTTZAGID-OCBXBXKTSA-N etoposide phosphate Chemical compound COC1=C(OP(O)(O)=O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 LIQODXNTTZAGID-OCBXBXKTSA-N 0.000 description 1
- 229960000752 etoposide phosphate Drugs 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- OGPBJKLSAFTDLK-UHFFFAOYSA-N europium atom Chemical compound [Eu] OGPBJKLSAFTDLK-UHFFFAOYSA-N 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 229950002846 ficlatuzumab Drugs 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 229960005304 fludarabine phosphate Drugs 0.000 description 1
- 229960002011 fludrocortisone Drugs 0.000 description 1
- AAXVEMMRQDVLJB-BULBTXNYSA-N fludrocortisone Chemical compound O=C1CC[C@]2(C)[C@@]3(F)[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 AAXVEMMRQDVLJB-BULBTXNYSA-N 0.000 description 1
- ZFKJVJIDPQDDFY-UHFFFAOYSA-N fluorescamine Chemical compound C12=CC=CC=C2C(=O)OC1(C1=O)OC=C1C1=CC=CC=C1 ZFKJVJIDPQDDFY-UHFFFAOYSA-N 0.000 description 1
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 1
- 238000000799 fluorescence microscopy Methods 0.000 description 1
- VVIAGPKUTFNRDU-ABLWVSNPSA-N folinic acid Chemical compound C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-ABLWVSNPSA-N 0.000 description 1
- 235000008191 folinic acid Nutrition 0.000 description 1
- 239000011672 folinic acid Substances 0.000 description 1
- 201000003444 follicular lymphoma Diseases 0.000 description 1
- 229960004783 fotemustine Drugs 0.000 description 1
- YAKWPXVTIGTRJH-UHFFFAOYSA-N fotemustine Chemical compound CCOP(=O)(OCC)C(C)NC(=O)N(CCCl)N=O YAKWPXVTIGTRJH-UHFFFAOYSA-N 0.000 description 1
- 238000013467 fragmentation Methods 0.000 description 1
- 238000006062 fragmentation reaction Methods 0.000 description 1
- 230000005714 functional activity Effects 0.000 description 1
- ZZUFCTLCJUWOSV-UHFFFAOYSA-N furosemide Chemical compound C1=C(Cl)C(S(=O)(=O)N)=CC(C(O)=O)=C1NCC1=CC=CO1 ZZUFCTLCJUWOSV-UHFFFAOYSA-N 0.000 description 1
- 229950011325 galarubicin Drugs 0.000 description 1
- 229950003400 galeterone Drugs 0.000 description 1
- 229950004410 galocitabine Drugs 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 208000015419 gastrin-producing neuroendocrine tumor Diseases 0.000 description 1
- 201000000052 gastrinoma Diseases 0.000 description 1
- XGALLCVXEZPNRQ-UHFFFAOYSA-N gefitinib Chemical compound C=12C=C(OCCCN3CCOCC3)C(OC)=CC2=NC=NC=1NC1=CC=C(F)C(Cl)=C1 XGALLCVXEZPNRQ-UHFFFAOYSA-N 0.000 description 1
- 229960002584 gefitinib Drugs 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- QTQAWLPCGQOSGP-GBTDJJJQSA-N geldanamycin Chemical compound N1C(=O)\C(C)=C/C=C\[C@@H](OC)[C@H](OC(N)=O)\C(C)=C/[C@@H](C)[C@@H](O)[C@H](OC)C[C@@H](C)CC2=C(OC)C(=O)C=C1C2=O QTQAWLPCGQOSGP-GBTDJJJQSA-N 0.000 description 1
- 238000002523 gelfiltration Methods 0.000 description 1
- 229960003297 gemtuzumab ozogamicin Drugs 0.000 description 1
- 201000003115 germ cell cancer Diseases 0.000 description 1
- UIVFUQKYVFCEKJ-OPTOVBNMSA-N gimatecan Chemical compound C1=CC=C2C(\C=N\OC(C)(C)C)=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UIVFUQKYVFCEKJ-OPTOVBNMSA-N 0.000 description 1
- 229950009073 gimatecan Drugs 0.000 description 1
- 229950011595 glufosfamide Drugs 0.000 description 1
- 229960002989 glutamic acid Drugs 0.000 description 1
- 102000005396 glutamine synthetase Human genes 0.000 description 1
- 210000002288 golgi apparatus Anatomy 0.000 description 1
- 239000003163 gonadal steroid hormone Substances 0.000 description 1
- XLXSAKCOAKORKW-UHFFFAOYSA-N gonadorelin Chemical compound C1CCC(C(=O)NCC(N)=O)N1C(=O)C(CCCN=C(N)N)NC(=O)C(CC(C)C)NC(=O)CNC(=O)C(NC(=O)C(CO)NC(=O)C(CC=1C2=CC=CC=C2NC=1)NC(=O)C(CC=1NC=NC=1)NC(=O)C1NC(=O)CC1)CC1=CC=C(O)C=C1 XLXSAKCOAKORKW-UHFFFAOYSA-N 0.000 description 1
- 229960003690 goserelin acetate Drugs 0.000 description 1
- 229950005277 gossypol Drugs 0.000 description 1
- 229930000755 gossypol Natural products 0.000 description 1
- 230000003394 haemopoietic effect Effects 0.000 description 1
- 229940037467 helicobacter pylori Drugs 0.000 description 1
- 230000002489 hematologic effect Effects 0.000 description 1
- 208000019691 hematopoietic and lymphoid cell neoplasm Diseases 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- 201000002735 hepatocellular adenoma Diseases 0.000 description 1
- 229940022353 herceptin Drugs 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 238000004896 high resolution mass spectrometry Methods 0.000 description 1
- 230000003054 hormonal effect Effects 0.000 description 1
- 238000001794 hormone therapy Methods 0.000 description 1
- 102000054510 human SIRPG Human genes 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 150000002431 hydrogen Chemical class 0.000 description 1
- 229920001477 hydrophilic polymer Polymers 0.000 description 1
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 1
- 229960002899 hydroxyprogesterone Drugs 0.000 description 1
- 229950000801 hydroxyprogesterone caproate Drugs 0.000 description 1
- 229960001507 ibrutinib Drugs 0.000 description 1
- XYFPWWZEPKGCCK-GOSISDBHSA-N ibrutinib Chemical compound C1=2C(N)=NC=NC=2N([C@H]2CN(CCC2)C(=O)C=C)N=C1C(C=C1)=CC=C1OC1=CC=CC=C1 XYFPWWZEPKGCCK-GOSISDBHSA-N 0.000 description 1
- 229960003445 idelalisib Drugs 0.000 description 1
- YKLIKGKUANLGSB-HNNXBMFYSA-N idelalisib Chemical compound C1([C@@H](NC=2[C]3N=CN=C3N=CN=2)CC)=NC2=CC=CC(F)=C2C(=O)N1C1=CC=CC=C1 YKLIKGKUANLGSB-HNNXBMFYSA-N 0.000 description 1
- 229950002248 idoxifene Drugs 0.000 description 1
- 229950007275 ifabotuzumab Drugs 0.000 description 1
- 229940091204 imlygic Drugs 0.000 description 1
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 description 1
- 229940124622 immune-modulator drug Drugs 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 229940027941 immunoglobulin g Drugs 0.000 description 1
- 239000000367 immunologic factor Substances 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 229950008097 improsulfan Drugs 0.000 description 1
- DBIGHPPNXATHOF-UHFFFAOYSA-N improsulfan Chemical compound CS(=O)(=O)OCCCNCCCOS(C)(=O)=O DBIGHPPNXATHOF-UHFFFAOYSA-N 0.000 description 1
- 201000004933 in situ carcinoma Diseases 0.000 description 1
- 238000000099 in vitro assay Methods 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- APFVFJFRJDLVQX-AHCXROLUSA-N indium-111 Chemical compound [111In] APFVFJFRJDLVQX-AHCXROLUSA-N 0.000 description 1
- 239000000411 inducer Substances 0.000 description 1
- 229940050282 inebilizumab-cdon Drugs 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 108091008042 inhibitory receptors Proteins 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 239000002198 insoluble material Substances 0.000 description 1
- 206010022498 insulinoma Diseases 0.000 description 1
- 229960003130 interferon gamma Drugs 0.000 description 1
- 229940047124 interferons Drugs 0.000 description 1
- 229940117681 interleukin-12 Drugs 0.000 description 1
- 210000002570 interstitial cell Anatomy 0.000 description 1
- 229940065638 intron a Drugs 0.000 description 1
- 201000010985 invasive ductal carcinoma Diseases 0.000 description 1
- 229950005254 irofulven Drugs 0.000 description 1
- NICJCIQSJJKZAH-AWEZNQCLSA-N irofulven Chemical compound O=C([C@@]1(O)C)C2=CC(C)=C(CO)C2=C(C)C21CC2 NICJCIQSJJKZAH-AWEZNQCLSA-N 0.000 description 1
- 230000006338 isoaspartate formation Effects 0.000 description 1
- 150000002540 isothiocyanates Chemical class 0.000 description 1
- 230000000155 isotopic effect Effects 0.000 description 1
- FABUFPQFXZVHFB-PVYNADRNSA-N ixabepilone Chemical compound C/C([C@@H]1C[C@@H]2O[C@]2(C)CCC[C@@H]([C@@H]([C@@H](C)C(=O)C(C)(C)[C@@H](O)CC(=O)N1)O)C)=C\C1=CSC(C)=N1 FABUFPQFXZVHFB-PVYNADRNSA-N 0.000 description 1
- 229960002014 ixabepilone Drugs 0.000 description 1
- 210000001117 keloid Anatomy 0.000 description 1
- 229940065223 kepivance Drugs 0.000 description 1
- BQINXKOTJQCISL-GRCPKETISA-N keto-neuraminic acid Chemical compound OC(=O)C(=O)C[C@H](O)[C@@H](N)[C@@H](O)[C@H](O)[C@H](O)CO BQINXKOTJQCISL-GRCPKETISA-N 0.000 description 1
- 229960004125 ketoconazole Drugs 0.000 description 1
- 208000022013 kidney Wilms tumor Diseases 0.000 description 1
- 210000003292 kidney cell Anatomy 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 229940000764 kyprolis Drugs 0.000 description 1
- KXJTWOGIBOWZDJ-LELJLAJGSA-N l-blp25 Chemical compound C([C@@H](C(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(O)=O)NC(=O)[C@H](C)NC(=O)[C@H]1N(CCC1)C(=O)[C@H]1N(CCC1)C(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@@H](N)CO)[C@@H](C)O)C1=CNC=N1 KXJTWOGIBOWZDJ-LELJLAJGSA-N 0.000 description 1
- DAQAKHDKYAWHCG-RWTHQLGUSA-N lactacystin Chemical compound CC(=O)N[C@H](C(O)=O)CSC(=O)[C@]1([C@@H](O)C(C)C)NC(=O)[C@H](C)[C@@H]1O DAQAKHDKYAWHCG-RWTHQLGUSA-N 0.000 description 1
- 229960002367 lasofoxifene Drugs 0.000 description 1
- GXESHMAMLJKROZ-IAPPQJPRSA-N lasofoxifene Chemical compound C1([C@@H]2[C@@H](C3=CC=C(C=C3CC2)O)C=2C=CC(OCCN3CCCC3)=CC=2)=CC=CC=C1 GXESHMAMLJKROZ-IAPPQJPRSA-N 0.000 description 1
- 229960001691 leucovorin Drugs 0.000 description 1
- 108010057821 leucylproline Proteins 0.000 description 1
- 229950002884 lexatumumab Drugs 0.000 description 1
- UGFHIPBXIWJXNA-UHFFFAOYSA-N liarozole Chemical compound ClC1=CC=CC(C(C=2C=C3NC=NC3=CC=2)N2C=NC=C2)=C1 UGFHIPBXIWJXNA-UHFFFAOYSA-N 0.000 description 1
- 229950007056 liarozole Drugs 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 206010024627 liposarcoma Diseases 0.000 description 1
- 238000001294 liquid chromatography-tandem mass spectrometry Methods 0.000 description 1
- 229950011263 lirilumab Drugs 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 229950008991 lobaplatin Drugs 0.000 description 1
- 229950000909 lometrexol Drugs 0.000 description 1
- 229950001750 lonafarnib Drugs 0.000 description 1
- DHMTURDWPRKSOA-RUZDIDTESA-N lonafarnib Chemical compound C1CN(C(=O)N)CCC1CC(=O)N1CCC([C@@H]2C3=C(Br)C=C(Cl)C=C3CCC3=CC(Br)=CN=C32)CC1 DHMTURDWPRKSOA-RUZDIDTESA-N 0.000 description 1
- 229960003538 lonidamine Drugs 0.000 description 1
- WDRYRZXSPDWGEB-UHFFFAOYSA-N lonidamine Chemical compound C12=CC=CC=C2C(C(=O)O)=NN1CC1=CC=C(Cl)C=C1Cl WDRYRZXSPDWGEB-UHFFFAOYSA-N 0.000 description 1
- FBQPGGIHOFZRGH-UHFFFAOYSA-N lucanthone Chemical compound S1C2=CC=CC=C2C(=O)C2=C1C(C)=CC=C2NCCN(CC)CC FBQPGGIHOFZRGH-UHFFFAOYSA-N 0.000 description 1
- 229950005239 lucanthone Drugs 0.000 description 1
- 229950004563 lucatumumab Drugs 0.000 description 1
- 238000003670 luciferase enzyme activity assay Methods 0.000 description 1
- RVFGKBWWUQOIOU-NDEPHWFRSA-N lurtotecan Chemical compound O=C([C@]1(O)CC)OCC(C(N2CC3=4)=O)=C1C=C2C3=NC1=CC=2OCCOC=2C=C1C=4CN1CCN(C)CC1 RVFGKBWWUQOIOU-NDEPHWFRSA-N 0.000 description 1
- 229950002654 lurtotecan Drugs 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 108010026228 mRNA guanylyltransferase Proteins 0.000 description 1
- 229940124302 mTOR inhibitor Drugs 0.000 description 1
- 201000004593 malignant giant cell tumor Diseases 0.000 description 1
- 201000000289 malignant teratoma Diseases 0.000 description 1
- 239000003628 mammalian target of rapamycin inhibitor Substances 0.000 description 1
- 150000002704 mannoses Chemical class 0.000 description 1
- 229950001869 mapatumumab Drugs 0.000 description 1
- 238000013507 mapping Methods 0.000 description 1
- 229950008959 marimastat Drugs 0.000 description 1
- OCSMOTCMPXTDND-OUAUKWLOSA-N marimastat Chemical compound CNC(=O)[C@H](C(C)(C)C)NC(=O)[C@H](CC(C)C)[C@H](O)C(=O)NO OCSMOTCMPXTDND-OUAUKWLOSA-N 0.000 description 1
- 238000000816 matrix-assisted laser desorption--ionisation Methods 0.000 description 1
- 238000001906 matrix-assisted laser desorption--ionisation mass spectrometry Methods 0.000 description 1
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical compound ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 1
- 229960004961 mechlorethamine Drugs 0.000 description 1
- 210000002418 meninge Anatomy 0.000 description 1
- 229960003151 mercaptamine Drugs 0.000 description 1
- 229960004635 mesna Drugs 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 208000037819 metastatic cancer Diseases 0.000 description 1
- 208000011575 metastatic malignant neoplasm Diseases 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 229960004584 methylprednisolone Drugs 0.000 description 1
- 229960001566 methyltestosterone Drugs 0.000 description 1
- 239000002679 microRNA Substances 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- VFKZTMPDYBFSTM-GUCUJZIJSA-N mitolactol Chemical compound BrC[C@H](O)[C@@H](O)[C@@H](O)[C@H](O)CBr VFKZTMPDYBFSTM-GUCUJZIJSA-N 0.000 description 1
- 229950010913 mitolactol Drugs 0.000 description 1
- 108010010621 modeccin Proteins 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 210000004980 monocyte derived macrophage Anatomy 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 208000010492 mucinous cystadenocarcinoma Diseases 0.000 description 1
- 208000025113 myeloid leukemia Diseases 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 208000009091 myxoma Diseases 0.000 description 1
- QTHCAAFKVUWAFI-DJKKODMXSA-N n-[(e)-(6-bromoimidazo[1,2-a]pyridin-3-yl)methylideneamino]-n,2-dimethyl-5-nitrobenzenesulfonamide Chemical compound C=1N=C2C=CC(Br)=CN2C=1/C=N/N(C)S(=O)(=O)C1=CC([N+]([O-])=O)=CC=C1C QTHCAAFKVUWAFI-DJKKODMXSA-N 0.000 description 1
- NJSMWLQOCQIOPE-OCHFTUDZSA-N n-[(e)-[10-[(e)-(4,5-dihydro-1h-imidazol-2-ylhydrazinylidene)methyl]anthracen-9-yl]methylideneamino]-4,5-dihydro-1h-imidazol-2-amine Chemical compound N1CCN=C1N\N=C\C(C1=CC=CC=C11)=C(C=CC=C2)C2=C1\C=N\NC1=NCCN1 NJSMWLQOCQIOPE-OCHFTUDZSA-N 0.000 description 1
- TVYPSLDUBVTDIS-FUOMVGGVSA-N n-[1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-methyloxolan-2-yl]-5-fluoro-2-oxopyrimidin-4-yl]-3,4,5-trimethoxybenzamide Chemical compound COC1=C(OC)C(OC)=CC(C(=O)NC=2C(=CN(C(=O)N=2)[C@H]2[C@@H]([C@H](O)[C@@H](C)O2)O)F)=C1 TVYPSLDUBVTDIS-FUOMVGGVSA-N 0.000 description 1
- BLCLNMBMMGCOAS-UHFFFAOYSA-N n-[1-[[1-[[1-[[1-[[1-[[1-[[1-[2-[(carbamoylamino)carbamoyl]pyrrolidin-1-yl]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-[(2-methylpropan-2-yl)oxy]-1-oxopropan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amin Chemical compound C1CCC(C(=O)NNC(N)=O)N1C(=O)C(CCCN=C(N)N)NC(=O)C(CC(C)C)NC(=O)C(COC(C)(C)C)NC(=O)C(NC(=O)C(CO)NC(=O)C(CC=1C2=CC=CC=C2NC=1)NC(=O)C(CC=1NC=NC=1)NC(=O)C1NC(=O)CC1)CC1=CC=C(O)C=C1 BLCLNMBMMGCOAS-UHFFFAOYSA-N 0.000 description 1
- ZDUZYDDAHVZGCI-UHFFFAOYSA-N n-[2-(dimethylamino)ethyl]-9-hydroxy-5,6-dimethylpyrido[4,3-b]carbazole-1-carboxamide Chemical compound CN1C2=CC=C(O)C=C2C2=C1C(C)=C1C=CN=C(C(=O)NCCN(C)C)C1=C2 ZDUZYDDAHVZGCI-UHFFFAOYSA-N 0.000 description 1
- XBGNERSKEKDZDS-UHFFFAOYSA-N n-[2-(dimethylamino)ethyl]acridine-4-carboxamide Chemical compound C1=CC=C2N=C3C(C(=O)NCCN(C)C)=CC=CC3=CC2=C1 XBGNERSKEKDZDS-UHFFFAOYSA-N 0.000 description 1
- UZWDCWONPYILKI-UHFFFAOYSA-N n-[5-[(4-ethylpiperazin-1-yl)methyl]pyridin-2-yl]-5-fluoro-4-(7-fluoro-2-methyl-3-propan-2-ylbenzimidazol-5-yl)pyrimidin-2-amine Chemical compound C1CN(CC)CCN1CC(C=N1)=CC=C1NC1=NC=C(F)C(C=2C=C3N(C(C)C)C(C)=NC3=C(F)C=2)=N1 UZWDCWONPYILKI-UHFFFAOYSA-N 0.000 description 1
- GWLFIMOOGVXSMZ-UHFFFAOYSA-N n-[[1-[2-(diethylamino)ethylamino]-7-methoxy-9-oxothioxanthen-4-yl]methyl]formamide Chemical compound S1C2=CC=C(OC)C=C2C(=O)C2=C1C(CNC=O)=CC=C2NCCN(CC)CC GWLFIMOOGVXSMZ-UHFFFAOYSA-N 0.000 description 1
- MUTBJZVSRNUIHA-UHFFFAOYSA-N n-hydroxy-2-(4-naphthalen-2-ylsulfonylpiperazin-1-yl)pyrimidine-5-carboxamide Chemical compound N1=CC(C(=O)NO)=CN=C1N1CCN(S(=O)(=O)C=2C=C3C=CC=CC3=CC=2)CC1 MUTBJZVSRNUIHA-UHFFFAOYSA-N 0.000 description 1
- CBAUPWKIZUBNOQ-UHFFFAOYSA-N n-hydroxy-5-[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]thiophene-2-carboxamide Chemical compound CN1N=C(C(F)(F)F)C=C1C1=CC=C(C(=O)NO)S1 CBAUPWKIZUBNOQ-UHFFFAOYSA-N 0.000 description 1
- 229940086322 navelbine Drugs 0.000 description 1
- 229950004847 navitoclax Drugs 0.000 description 1
- JLYAXFNOILIKPP-KXQOOQHDSA-N navitoclax Chemical compound C([C@@H](NC1=CC=C(C=C1S(=O)(=O)C(F)(F)F)S(=O)(=O)NC(=O)C1=CC=C(C=C1)N1CCN(CC1)CC1=C(CCC(C1)(C)C)C=1C=CC(Cl)=CC=1)CSC=1C=CC=CC=1)CN1CCOCC1 JLYAXFNOILIKPP-KXQOOQHDSA-N 0.000 description 1
- 229950007221 nedaplatin Drugs 0.000 description 1
- 229960000801 nelarabine Drugs 0.000 description 1
- IXOXBSCIXZEQEQ-UHTZMRCNSA-N nelarabine Chemical compound C1=NC=2C(OC)=NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@@H]1O IXOXBSCIXZEQEQ-UHTZMRCNSA-N 0.000 description 1
- 230000001613 neoplastic effect Effects 0.000 description 1
- 201000008026 nephroblastoma Diseases 0.000 description 1
- 229950008835 neratinib Drugs 0.000 description 1
- JWNPDZNEKVCWMY-VQHVLOKHSA-N neratinib Chemical compound C=12C=C(NC(=O)\C=C\CN(C)C)C(OCC)=CC2=NC=C(C#N)C=1NC(C=C1Cl)=CC=C1OCC1=CC=CC=N1 JWNPDZNEKVCWMY-VQHVLOKHSA-N 0.000 description 1
- 210000000653 nervous system Anatomy 0.000 description 1
- 229940060155 neuac Drugs 0.000 description 1
- 229940071846 neulasta Drugs 0.000 description 1
- 229940029345 neupogen Drugs 0.000 description 1
- 208000007538 neurilemmoma Diseases 0.000 description 1
- 201000004662 neurofibroma of spinal cord Diseases 0.000 description 1
- 208000004649 neutrophil actin dysfunction Diseases 0.000 description 1
- 229960002653 nilutamide Drugs 0.000 description 1
- XWXYUMMDTVBTOU-UHFFFAOYSA-N nilutamide Chemical compound O=C1C(C)(C)NC(=O)N1C1=CC=C([N+]([O-])=O)C(C(F)(F)F)=C1 XWXYUMMDTVBTOU-UHFFFAOYSA-N 0.000 description 1
- 229950010203 nimotuzumab Drugs 0.000 description 1
- 229960001420 nimustine Drugs 0.000 description 1
- VFEDRRNHLBGPNN-UHFFFAOYSA-N nimustine Chemical compound CC1=NC=C(CNC(=O)N(CCCl)N=O)C(N)=N1 VFEDRRNHLBGPNN-UHFFFAOYSA-N 0.000 description 1
- 229950011068 niraparib Drugs 0.000 description 1
- PCHKPVIQAHNQLW-CQSZACIVSA-N niraparib Chemical compound N1=C2C(C(=O)N)=CC=CC2=CN1C(C=C1)=CC=C1[C@@H]1CCCNC1 PCHKPVIQAHNQLW-CQSZACIVSA-N 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 239000002777 nucleoside Substances 0.000 description 1
- 210000004940 nucleus Anatomy 0.000 description 1
- 229950009090 ocaratuzumab Drugs 0.000 description 1
- 229950005751 ocrelizumab Drugs 0.000 description 1
- 229960002700 octreotide Drugs 0.000 description 1
- 229960000572 olaparib Drugs 0.000 description 1
- FDLYAMZZIXQODN-UHFFFAOYSA-N olaparib Chemical compound FC1=CC=C(CC=2C3=CC=CC=C3C(=O)NN=2)C=C1C(=O)N(CC1)CCN1C(=O)C1CC1 FDLYAMZZIXQODN-UHFFFAOYSA-N 0.000 description 1
- 229920001542 oligosaccharide Polymers 0.000 description 1
- 150000002482 oligosaccharides Chemical class 0.000 description 1
- 244000309459 oncolytic virus Species 0.000 description 1
- 238000010397 one-hybrid screening Methods 0.000 description 1
- 229940100027 ontak Drugs 0.000 description 1
- 229950007283 oregovomab Drugs 0.000 description 1
- 229950004023 orteronel Drugs 0.000 description 1
- 208000003388 osteoid osteoma Diseases 0.000 description 1
- 208000008798 osteoma Diseases 0.000 description 1
- 229950000121 otlertuzumab Drugs 0.000 description 1
- 210000003101 oviduct Anatomy 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 230000000242 pagocytic effect Effects 0.000 description 1
- WRUUGTRCQOWXEG-UHFFFAOYSA-N pamidronate Chemical compound NCCC(O)(P(O)(O)=O)P(O)(O)=O WRUUGTRCQOWXEG-UHFFFAOYSA-N 0.000 description 1
- 229940046231 pamidronate Drugs 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 208000021255 pancreatic insulinoma Diseases 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 244000045947 parasite Species 0.000 description 1
- 229950010966 patritumab Drugs 0.000 description 1
- 108010044644 pegfilgrastim Proteins 0.000 description 1
- 108010092851 peginterferon alfa-2b Proteins 0.000 description 1
- 229940106366 pegintron Drugs 0.000 description 1
- 230000006320 pegylation Effects 0.000 description 1
- WVUNYSQLFKLYNI-AATRIKPKSA-N pelitinib Chemical compound C=12C=C(NC(=O)\C=C\CN(C)C)C(OCC)=CC2=NC=C(C#N)C=1NC1=CC=C(F)C(Cl)=C1 WVUNYSQLFKLYNI-AATRIKPKSA-N 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- SZFPYBIJACMNJV-UHFFFAOYSA-N perifosine Chemical compound CCCCCCCCCCCCCCCCCCOP([O-])(=O)OC1CC[N+](C)(C)CC1 SZFPYBIJACMNJV-UHFFFAOYSA-N 0.000 description 1
- 229950010632 perifosine Drugs 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 201000002628 peritoneum cancer Diseases 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 108010076042 phenomycin Proteins 0.000 description 1
- RXNXLAHQOVLMIE-UHFFFAOYSA-N phenyl 10-methylacridin-10-ium-9-carboxylate Chemical compound C12=CC=CC=C2[N+](C)=C2C=CC=CC2=C1C(=O)OC1=CC=CC=C1 RXNXLAHQOVLMIE-UHFFFAOYSA-N 0.000 description 1
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 230000000704 physical effect Effects 0.000 description 1
- 229950004941 pictilisib Drugs 0.000 description 1
- 229950004317 pinafide Drugs 0.000 description 1
- 208000024724 pineal body neoplasm Diseases 0.000 description 1
- 201000004123 pineal gland cancer Diseases 0.000 description 1
- 229950007124 pipendoxifene Drugs 0.000 description 1
- 229960000952 pipobroman Drugs 0.000 description 1
- NJBFOOCLYDNZJN-UHFFFAOYSA-N pipobroman Chemical compound BrCCC(=O)N1CCN(C(=O)CCBr)CC1 NJBFOOCLYDNZJN-UHFFFAOYSA-N 0.000 description 1
- 229960001221 pirarubicin Drugs 0.000 description 1
- 208000021310 pituitary gland adenoma Diseases 0.000 description 1
- 229950008499 plitidepsin Drugs 0.000 description 1
- 108010049948 plitidepsin Proteins 0.000 description 1
- UUSZLLQJYRSZIS-LXNNNBEUSA-N plitidepsin Chemical compound CN([C@H](CC(C)C)C(=O)N[C@@H]1C(=O)N[C@@H]([C@H](CC(=O)O[C@H](C(=O)[C@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N2CCC[C@H]2C(=O)N(C)[C@@H](CC=2C=CC(OC)=CC=2)C(=O)O[C@@H]1C)C(C)C)O)[C@@H](C)CC)C(=O)[C@@H]1CCCN1C(=O)C(C)=O UUSZLLQJYRSZIS-LXNNNBEUSA-N 0.000 description 1
- 239000002770 polo like kinase inhibitor Substances 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 208000037244 polycythemia vera Diseases 0.000 description 1
- 229920000573 polyethylene Polymers 0.000 description 1
- 102000054765 polymorphisms of proteins Human genes 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 229960004694 prednimustine Drugs 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000037452 priming Effects 0.000 description 1
- 208000029340 primitive neuroectodermal tumor Diseases 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 239000000583 progesterone congener Substances 0.000 description 1
- WGYKZJWCGVVSQN-UHFFFAOYSA-N propylamine Chemical compound CCCN WGYKZJWCGVVSQN-UHFFFAOYSA-N 0.000 description 1
- 210000002307 prostate Anatomy 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 229940121649 protein inhibitor Drugs 0.000 description 1
- 239000012268 protein inhibitor Substances 0.000 description 1
- 239000003197 protein kinase B inhibitor Substances 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 210000001938 protoplast Anatomy 0.000 description 1
- 244000079416 protozoan pathogen Species 0.000 description 1
- 229940034080 provenge Drugs 0.000 description 1
- 229950007401 pumitepa Drugs 0.000 description 1
- WVTKBKWTSCPRNU-UHFFFAOYSA-N rac-Tetrandrin Natural products O1C(C(=CC=2CCN3C)OC)=CC=2C3CC(C=C2)=CC=C2OC(=C2)C(OC)=CC=C2CC2N(C)CCC3=CC(OC)=C(OC)C1=C23 WVTKBKWTSCPRNU-UHFFFAOYSA-N 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 150000003254 radicals Chemical class 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 229960002185 ranimustine Drugs 0.000 description 1
- 229910052761 rare earth metal Inorganic materials 0.000 description 1
- 150000002910 rare earth metals Chemical class 0.000 description 1
- BMKDZUISNHGIBY-UHFFFAOYSA-N razoxane Chemical compound C1C(=O)NC(=O)CN1C(C)CN1CC(=O)NC(=O)C1 BMKDZUISNHGIBY-UHFFFAOYSA-N 0.000 description 1
- 229960000460 razoxane Drugs 0.000 description 1
- 108091006082 receptor inhibitors Proteins 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 208000015347 renal cell adenocarcinoma Diseases 0.000 description 1
- 238000003571 reporter gene assay Methods 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 208000029922 reticulum cell sarcoma Diseases 0.000 description 1
- 229940100552 retinamide Drugs 0.000 description 1
- 208000013860 rhabdoid tumor of the kidney Diseases 0.000 description 1
- OWPCHSCAPHNHAV-LMONGJCWSA-N rhizoxin Chemical compound C/C([C@H](OC)[C@@H](C)[C@@H]1C[C@H](O)[C@]2(C)O[C@@H]2/C=C/[C@@H](C)[C@]2([H])OC(=O)C[C@@](C2)(C[C@@H]2O[C@H]2C(=O)O1)[H])=C\C=C\C(\C)=C\C1=COC(C)=N1 OWPCHSCAPHNHAV-LMONGJCWSA-N 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- 229950003687 ribociclib Drugs 0.000 description 1
- 229960003452 romidepsin Drugs 0.000 description 1
- 108010091666 romidepsin Proteins 0.000 description 1
- OHRURASPPZQGQM-UHFFFAOYSA-N romidepsin Natural products O1C(=O)C(C(C)C)NC(=O)C(=CC)NC(=O)C2CSSCCC=CC1CC(=O)NC(C(C)C)C(=O)N2 OHRURASPPZQGQM-UHFFFAOYSA-N 0.000 description 1
- 229960005399 satraplatin Drugs 0.000 description 1
- 190014017285 satraplatin Chemical compound 0.000 description 1
- 238000013391 scatchard analysis Methods 0.000 description 1
- 206010039667 schwannoma Diseases 0.000 description 1
- BTIHMVBBUGXLCJ-OAHLLOKOSA-N seliciclib Chemical compound C=12N=CN(C(C)C)C2=NC(N[C@@H](CO)CC)=NC=1NCC1=CC=CC=C1 BTIHMVBBUGXLCJ-OAHLLOKOSA-N 0.000 description 1
- 229950000055 seliciclib Drugs 0.000 description 1
- CYOHGALHFOKKQC-UHFFFAOYSA-N selumetinib Chemical compound OCCONC(=O)C=1C=C2N(C)C=NC2=C(F)C=1NC1=CC=C(Br)C=C1Cl CYOHGALHFOKKQC-UHFFFAOYSA-N 0.000 description 1
- 229950010746 selumetinib Drugs 0.000 description 1
- WUWDLXZGHZSWQZ-WQLSENKSSA-N semaxanib Chemical compound N1C(C)=CC(C)=C1\C=C/1C2=CC=CC=C2NC\1=O WUWDLXZGHZSWQZ-WQLSENKSSA-N 0.000 description 1
- 229950003647 semaxanib Drugs 0.000 description 1
- 208000004548 serous cystadenocarcinoma Diseases 0.000 description 1
- 125000005629 sialic acid group Chemical group 0.000 description 1
- 229960000714 sipuleucel-t Drugs 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 208000017520 skin disease Diseases 0.000 description 1
- 210000003625 skull Anatomy 0.000 description 1
- 208000000587 small cell lung carcinoma Diseases 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 229950010372 sobuzoxane Drugs 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 230000037439 somatic mutation Effects 0.000 description 1
- 230000019130 spindle checkpoint Effects 0.000 description 1
- 125000003003 spiro group Chemical group 0.000 description 1
- 229960002256 spironolactone Drugs 0.000 description 1
- LXMSZDCAJNLERA-ZHYRCANASA-N spironolactone Chemical compound C([C@@H]1[C@]2(C)CC[C@@H]3[C@@]4(C)CCC(=O)C=C4C[C@H]([C@@H]13)SC(=O)C)C[C@@]21CCC(=O)O1 LXMSZDCAJNLERA-ZHYRCANASA-N 0.000 description 1
- 210000001845 splenic macrophage Anatomy 0.000 description 1
- 230000002269 spontaneous effect Effects 0.000 description 1
- 229940068117 sprycel Drugs 0.000 description 1
- 229950001248 squalamine Drugs 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 229910052717 sulfur Inorganic materials 0.000 description 1
- 239000011593 sulfur Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 229960005566 swainsonine Drugs 0.000 description 1
- FXUAIOOAOAVCGD-FKSUSPILSA-N swainsonine Chemical compound C1CC[C@H](O)[C@H]2[C@H](O)[C@H](O)CN21 FXUAIOOAOAVCGD-FKSUSPILSA-N 0.000 description 1
- FXUAIOOAOAVCGD-UHFFFAOYSA-N swainsonine Natural products C1CCC(O)C2C(O)C(O)CN21 FXUAIOOAOAVCGD-UHFFFAOYSA-N 0.000 description 1
- 206010042863 synovial sarcoma Diseases 0.000 description 1
- 229940081616 tafinlar Drugs 0.000 description 1
- 101150047061 tag-72 gene Proteins 0.000 description 1
- 229950004608 talampanel Drugs 0.000 description 1
- 229950008461 talimogene laherparepvec Drugs 0.000 description 1
- AYUNIORJHRXIBJ-TXHRRWQRSA-N tanespimycin Chemical compound N1C(=O)\C(C)=C\C=C/[C@H](OC)[C@@H](OC(N)=O)\C(C)=C\[C@H](C)[C@@H](O)[C@@H](OC)C[C@H](C)CC2=C(NCC=C)C(=O)C=C1C2=O AYUNIORJHRXIBJ-TXHRRWQRSA-N 0.000 description 1
- 229950007866 tanespimycin Drugs 0.000 description 1
- 229960003102 tasonermin Drugs 0.000 description 1
- DKPFODGZWDEEBT-QFIAKTPHSA-N taxane Chemical class C([C@]1(C)CCC[C@@H](C)[C@H]1C1)C[C@H]2[C@H](C)CC[C@@H]1C2(C)C DKPFODGZWDEEBT-QFIAKTPHSA-N 0.000 description 1
- RCINICONZNJXQF-XAZOAEDWSA-N taxol® Chemical compound O([C@@H]1[C@@]2(CC(C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3(C21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-XAZOAEDWSA-N 0.000 description 1
- 229940063683 taxotere Drugs 0.000 description 1
- 229960001674 tegafur Drugs 0.000 description 1
- WFWLQNSHRPWKFK-ZCFIWIBFSA-N tegafur Chemical compound O=C1NC(=O)C(F)=CN1[C@@H]1OCCC1 WFWLQNSHRPWKFK-ZCFIWIBFSA-N 0.000 description 1
- 208000001608 teratocarcinoma Diseases 0.000 description 1
- 229950007967 tesmilifene Drugs 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- 229960005353 testolactone Drugs 0.000 description 1
- BPEWUONYVDABNZ-DZBHQSCQSA-N testolactone Chemical compound O=C1C=C[C@]2(C)[C@H]3CC[C@](C)(OC(=O)CC4)[C@@H]4[C@@H]3CCC2=C1 BPEWUONYVDABNZ-DZBHQSCQSA-N 0.000 description 1
- 229960000814 tetanus toxoid Drugs 0.000 description 1
- 229960003723 tiazofurine Drugs 0.000 description 1
- FVRDYQYEVDDKCR-DBRKOABJSA-N tiazofurine Chemical compound NC(=O)C1=CSC([C@H]2[C@@H]([C@H](O)[C@@H](CO)O2)O)=N1 FVRDYQYEVDDKCR-DBRKOABJSA-N 0.000 description 1
- 229950002376 tirapazamine Drugs 0.000 description 1
- QVMPZNRFXAKISM-UHFFFAOYSA-N tirapazamine Chemical compound C1=CC=C2[N+]([O-])=NC(=N)N(O)C2=C1 QVMPZNRFXAKISM-UHFFFAOYSA-N 0.000 description 1
- 238000004448 titration Methods 0.000 description 1
- 229950005976 tivantinib Drugs 0.000 description 1
- 229960000940 tivozanib Drugs 0.000 description 1
- 229960004167 toremifene citrate Drugs 0.000 description 1
- 229950000185 tozasertib Drugs 0.000 description 1
- LIRYPHYGHXZJBZ-UHFFFAOYSA-N trametinib Chemical compound CC(=O)NC1=CC=CC(N2C(N(C3CC3)C(=O)C3=C(NC=4C(=CC(I)=CC=4)F)N(C)C(=O)C(C)=C32)=O)=C1 LIRYPHYGHXZJBZ-UHFFFAOYSA-N 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- IUCJMVBFZDHPDX-UHFFFAOYSA-N tretamine Chemical compound C1CN1C1=NC(N2CC2)=NC(N2CC2)=N1 IUCJMVBFZDHPDX-UHFFFAOYSA-N 0.000 description 1
- 229950001353 tretamine Drugs 0.000 description 1
- 229960005294 triamcinolone Drugs 0.000 description 1
- GFNANZIMVAIWHM-OBYCQNJPSA-N triamcinolone Chemical compound O=C1C=C[C@]2(C)[C@@]3(F)[C@@H](O)C[C@](C)([C@@]([C@H](O)C4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 GFNANZIMVAIWHM-OBYCQNJPSA-N 0.000 description 1
- 229960005526 triapine Drugs 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 229950007127 trilaciclib Drugs 0.000 description 1
- 229960001099 trimetrexate Drugs 0.000 description 1
- NOYPYLRCIDNJJB-UHFFFAOYSA-N trimetrexate Chemical compound COC1=C(OC)C(OC)=CC(NCC=2C(=C3C(N)=NC(N)=NC3=CC=2)C)=C1 NOYPYLRCIDNJJB-UHFFFAOYSA-N 0.000 description 1
- 239000001226 triphosphate Substances 0.000 description 1
- 235000011178 triphosphate Nutrition 0.000 description 1
- 229960000294 triptorelin pamoate Drugs 0.000 description 1
- 229940086984 trisenox Drugs 0.000 description 1
- 229960000875 trofosfamide Drugs 0.000 description 1
- UMKFEPPTGMDVMI-UHFFFAOYSA-N trofosfamide Chemical compound ClCCN(CCCl)P1(=O)OCCCN1CCCl UMKFEPPTGMDVMI-UHFFFAOYSA-N 0.000 description 1
- 229950010147 troxacitabine Drugs 0.000 description 1
- RXRGZNYSEHTMHC-BQBZGAKWSA-N troxacitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1O[C@@H](CO)OC1 RXRGZNYSEHTMHC-BQBZGAKWSA-N 0.000 description 1
- 208000022271 tubular adenoma Diseases 0.000 description 1
- 102000003390 tumor necrosis factor Human genes 0.000 description 1
- 229940121358 tyrosine kinase inhibitor Drugs 0.000 description 1
- 239000005483 tyrosine kinase inhibitor Substances 0.000 description 1
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 238000010798 ubiquitination Methods 0.000 description 1
- 230000034512 ubiquitination Effects 0.000 description 1
- ORHBXUUXSCNDEV-UHFFFAOYSA-N umbelliferone Chemical compound C1=CC(=O)OC2=CC(O)=CC=C21 ORHBXUUXSCNDEV-UHFFFAOYSA-N 0.000 description 1
- HFTAFOQKODTIJY-UHFFFAOYSA-N umbelliferone Natural products Cc1cc2C=CC(=O)Oc2cc1OCC=CC(C)(C)O HFTAFOQKODTIJY-UHFFFAOYSA-N 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241000712461 unidentified influenza virus Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 210000003708 urethra Anatomy 0.000 description 1
- VBEQCZHXXJYVRD-GACYYNSASA-N uroanthelone Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)C(C)C)[C@@H](C)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCSC)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CS)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O)C(C)C)[C@@H](C)CC)C1=CC=C(O)C=C1 VBEQCZHXXJYVRD-GACYYNSASA-N 0.000 description 1
- 210000004291 uterus Anatomy 0.000 description 1
- 239000012646 vaccine adjuvant Substances 0.000 description 1
- 229940124931 vaccine adjuvant Drugs 0.000 description 1
- 210000001215 vagina Anatomy 0.000 description 1
- MSRILKIQRXUYCT-UHFFFAOYSA-M valproate semisodium Chemical compound [Na+].CCCC(C(O)=O)CCC.CCCC(C([O-])=O)CCC MSRILKIQRXUYCT-UHFFFAOYSA-M 0.000 description 1
- 229960000604 valproic acid Drugs 0.000 description 1
- 108010073969 valyllysine Proteins 0.000 description 1
- 239000002525 vasculotropin inhibitor Substances 0.000 description 1
- 229940099039 velcade Drugs 0.000 description 1
- 229950011257 veliparib Drugs 0.000 description 1
- JNAHVYVRKWKWKQ-CYBMUJFWSA-N veliparib Chemical compound N=1C2=CC=CC(C(N)=O)=C2NC=1[C@@]1(C)CCCN1 JNAHVYVRKWKWKQ-CYBMUJFWSA-N 0.000 description 1
- 229940118696 vibrio cholerae Drugs 0.000 description 1
- 208000009540 villous adenoma Diseases 0.000 description 1
- 229960005212 vindesine sulfate Drugs 0.000 description 1
- NMDYYWFGPIMTKO-HBVLKOHWSA-N vinflunine Chemical compound C([C@@](C1=C(C2=CC=CC=C2N1)C1)(C2=C(OC)C=C3N(C)[C@@H]4[C@@]5(C3=C2)CCN2CC=C[C@]([C@@H]52)([C@H]([C@]4(O)C(=O)OC)OC(C)=O)CC)C(=O)OC)[C@H]2C[C@@H](C(C)(F)F)CN1C2 NMDYYWFGPIMTKO-HBVLKOHWSA-N 0.000 description 1
- 229960000922 vinflunine Drugs 0.000 description 1
- CILBMBUYJCWATM-PYGJLNRPSA-N vinorelbine ditartrate Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O.OC(=O)[C@H](O)[C@@H](O)C(O)=O.C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC CILBMBUYJCWATM-PYGJLNRPSA-N 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 210000003905 vulva Anatomy 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 229920003169 water-soluble polymer Polymers 0.000 description 1
- QDLHCMPXEPAAMD-QAIWCSMKSA-N wortmannin Chemical compound C1([C@]2(C)C3=C(C4=O)OC=C3C(=O)O[C@@H]2COC)=C4[C@@H]2CCC(=O)[C@@]2(C)C[C@H]1OC(C)=O QDLHCMPXEPAAMD-QAIWCSMKSA-N 0.000 description 1
- QDLHCMPXEPAAMD-UHFFFAOYSA-N wortmannin Natural products COCC1OC(=O)C2=COC(C3=O)=C2C1(C)C1=C3C2CCC(=O)C2(C)CC1OC(C)=O QDLHCMPXEPAAMD-UHFFFAOYSA-N 0.000 description 1
- 238000002424 x-ray crystallography Methods 0.000 description 1
- 229940049068 xalkori Drugs 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
- 229950009002 zanolimumab Drugs 0.000 description 1
- 229940034727 zelboraf Drugs 0.000 description 1
- XRASPMIURGNCCH-UHFFFAOYSA-N zoledronic acid Chemical compound OP(=O)(O)C(P(O)(O)=O)(O)CN1C=CN=C1 XRASPMIURGNCCH-UHFFFAOYSA-N 0.000 description 1
- 229960004276 zoledronic acid Drugs 0.000 description 1
- 229940061261 zolinza Drugs 0.000 description 1
- 229960000641 zorubicin Drugs 0.000 description 1
- FBTUMDXHSRTGRV-ALTNURHMSA-N zorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(\C)=N\NC(=O)C=1C=CC=CC=1)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 FBTUMDXHSRTGRV-ALTNURHMSA-N 0.000 description 1
- 229950009819 zotarolimus Drugs 0.000 description 1
- CGTADGCBEXYWNE-JUKNQOCSSA-N zotarolimus Chemical compound N1([C@H]2CC[C@@H](C[C@@H](C)[C@H]3OC(=O)[C@@H]4CCCCN4C(=O)C(=O)[C@@]4(O)[C@H](C)CC[C@H](O4)C[C@@H](/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C3)OC)C[C@H]2OC)C=NN=N1 CGTADGCBEXYWNE-JUKNQOCSSA-N 0.000 description 1
- 229940052129 zykadia Drugs 0.000 description 1
- VLCYCQAOQCDTCN-ZCFIWIBFSA-N α-difluoromethylornithine Chemical compound NCCC[C@@](N)(C(F)F)C(O)=O VLCYCQAOQCDTCN-ZCFIWIBFSA-N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/57484—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumor, cancer, neoplasia, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides, metabolites
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6854—Immunoglobulins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
- G01N2333/70503—Immunoglobulin superfamily, e.g. VCAMs, PECAM, LFA-3
Definitions
- This application includes an electronically submitted sequence listing in .txt format.
- the .txt file contains a sequence listing entitled “ABE-0007-DV2_SeqListing.txt” created on Jan. 14, 2022, and is 233 kilobytes in size.
- the sequence listing contained in this .txt file is part of the specification and is hereby incorporated by reference herein in its entirety.
- the present invention relates to anti-SIRP ⁇ antibodies, as well as use of these antibodies in the treatment of diseases.
- SIRP ⁇ Signal regulatory protein alpha
- SIRP ⁇ is membrane glycoprotein from the SIRP family.
- SIRP ⁇ has an extended intracellular domain containing four tyrosine residues that form two immunoreceptor tyrosine-based inhibitory motifs (ITIMs), while SIRP ⁇ 1 contains a lysine residue in the transmembrane domain followed by a short intracellular tail lacking ITIMs serving as a receptor for DAP12.
- ITIMs immunoreceptor tyrosine-based inhibitory motifs
- “Eat-me” signals are extracellular players specifically produced by and displayed on the surface of apoptotic cells, but not healthy cells, and are key to the initiation of phagocytosis by activating phagocytic receptors and subsequent signaling cascades. Eat-me signals require extracellular trafficking in order to be displayed on apoptotic cells.
- a particular category of eat-me signals is provided by membrane-anchored proteins such as phosphatidylserine (PtdSer) and calreticulin (CRT). Externalized PtdSer binds to its receptors on phagocytes to facilitate clearance of apoptotic cells (a process known as efferocytosis). Likewise, CRT is upregulated on the surface of apoptotic cells and binds to LDL-receptor-related protein 1 (LRP1) on the phagocyte thereby mediating engulfment.
- LRP1 LDL-receptor-related protein 1
- SIRP ⁇ is broadly expressed on phagocytes (e.g., macrophages, granulocytes, and dendritic cells) and acts as an inhibitory receptor through its interaction with a transmembrane protein CD47. This interaction mediates a response referred to as the “don't eat me” signal. This interaction negatively regulates effector function of innate immune cells such as host cell phagocytosis. As CD47 is often present on tumor cells, this “don't eat me” signal is thought to contribute to the resistance of tumors to phagocyte-dependent clearance.
- SIRP ⁇ 1 does not bind CD47 at detectable levels and so does not mediate the “don't eat me” signal. Instead, SIRP ⁇ 1 is involved in the activation of myeloid cells.
- CD47-SIRP ⁇ signalling e.g., by antagonistic monoclonal antibodies that bind to either CD47 or SIRP ⁇
- Disruption of CD47-SIRP ⁇ signalling reportedly results in enhanced phagocytosis of both solid and hematopoietic tumor cells, including increased phagocytosis of glioblastoma cells in vitro and significant anti-tumor activity in vivo.
- the invention provides anti-SIRP ⁇ antibodies and antigen binding fragments thereof comprising the structural and functional features specified below.
- the invention provides an antibody or antigen binding fragment thereof that binds to human SIRP ⁇ comprising one, two, or all three of (i), (ii) and (iii): (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1 or an amino acid sequence differing from SEQ ID NO: 1 by 1, 2, 3, or more conservative substitutions; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2 or an amino acid sequence differing from SEQ ID NO: 2 by 1, 2, 3, or more conservative substitutions; and/or (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3 or an amino acid sequence differing from SEQ ID NO: 3 by 1, 2, 3, or more conservative substitutions.
- the invention provides an antibody or antigen binding fragment thereof that binds to human SIRP ⁇ comprising one, two, or all three of (i), (ii) and (iii): (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 69 or an amino acid sequence differing from SEQ ID NO: 1 by 1, 2, 3, or more conservative substitutions; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 70 or an amino acid sequence differing from SEQ ID NO: 2 by 1, 2, 3, or more conservative substitutions; and/or (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 71 or an amino acid sequence differing from SEQ ID NO: 3 by 1, 2, 3, or more conservative substitutions.
- the antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising an amino acid sequence selected from the group consisting of:
- the invention also provides an antibody or antigen binding fragment thereof that binds to human SIRP ⁇ comprising one, two, or all three of (i), (ii) and (iii): (i) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4 or an amino acid sequence differing from SEQ ID NO: 4 by 1, 2, 3, or more conservative substitutions; (ii) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5 or an amino acid sequence differing from SEQ ID NO: 5 by 1, 2, 3, or more conservative substitutions; and/or (iii) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6 or an amino acid sequence differing from SEQ ID NO: 6 by 1, 2, 3, or more conservative substitutions.
- a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4 or an amino acid sequence differing from SEQ ID NO: 4 by 1, 2, 3, or more conservative substitutions
- the invention also provides an antibody or antigen binding fragment thereof that binds to human SIRP ⁇ comprising one, two, or all three of (i), (ii) and (iii): (i) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 72 or an amino acid sequence differing from SEQ ID NO: 4 by 1, 2, 3, or more conservative substitutions; (ii) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 73 or an amino acid sequence differing from SEQ ID NO: 5 by 1, 2, 3, or more conservative substitutions; and/or (iii) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 74 or an amino acid sequence differing from SEQ ID NO: 6 by 1, 2, 3, or more conservative substitutions.
- a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 72 or an amino acid sequence differing from SEQ ID NO: 4 by 1, 2, 3, or more conservative substitutions
- the antibody or antigen binding fragment thereof comprises a light chain variable region comprising an amino acid sequence selected from the group consisting of:
- the invention provides an antibody or antigen binding fragment thereof that binds to human SIRP ⁇ comprising:
- the invention provides an antibody or antigen binding fragment thereof that binds to human SIRP ⁇ comprising:
- the invention provides an antibody or antigen binding fragment thereof that binds to human SIRP ⁇ comprising:
- a heavy chain variable region comprising an amino acid sequence selected from the group consisting of:
- the invention provides an antibody or antigen binding fragment thereof that binds to human SIRP ⁇ comprising:
- sequence similarity is based on the extent of identity combined with the extent of conservative changes.
- conserve changes and “identity” are considered to be species of the broader term “similarity”.
- sequence similarity is used it embraces sequence “identity” and “conservative changes”.
- the conservative changes are disregarded and the percent sequence similarity refers to percent sequence identity.
- the changes in a sequence permitted by the referenced percent sequence identity are all or nearly all conservative changes; that is, when a sequence is 90% identical, the remaining 10% are all or nearly all conservative changes.
- the term “nearly all” in this context refers to at least 75% of the permitted sequence changes are conservative changes, more preferably at least 85%, still more preferably at least 90%, and most preferably at least 95%.
- the permitted sequence changes are within the framework regions and not in the CDRs.
- said antibody has a heavy chain according to SEQ ID NO: 7. Further preferably said antibody has a light chain according to SEQ ID NO: 8. More preferably, the heavy chain is chosen from any of SEQ ID NO: 10, 12, 14, 16, 18, or 30. More preferably, the light chain is chosen from any of SEQ ID NO: 20, 22, 24, 26, 28, or 32.
- said antibody has a heavy chain according to SEQ ID NO: 75. Further preferably said antibody has a light chain according to SEQ ID NO: 76. More preferably, the heavy chain is chosen from any of SEQ ID NO: 78, 80, 82, 84, 86, 88 or 102. More preferably, the light chain is chosen from any of SEQ ID NO: 90, 92, 94, 96, 98, 100 or 104.
- the antibody or antigen binding fragment thereof may be isolated, as that term is defined herein.
- the antibody or antigen binding fragment thereof is a recombinant antibody, as that term is defined herein.
- the antibody or antigen binding fragment thereof is a full-length antibody, as that term is defined herein.
- Antibodies or antigen binding fragments of the present invention may be obtained from a variety of species.
- the antibodies of the present invention may comprise immunoglobulin sequences which are rabbit, mouse, rat, guinea pig, chicken, goat, sheep, donkey, human, llama or camelid sequences, or combinations of such sequences (so-called chimeric antibodies).
- the antibodies or antigen binding fragments are human or humanized antibodies or antigen binding fragments.
- antibody includes antigen-binding portions, i.e., “antigen binding sites,” (e.g., fragments, subsequences, complementarity determining regions (CDRs)) that retain capacity to bind antigen, including (i) a Fab fragment, a monovalent fragment consisting of the V L , V H , C L and C H 1 domains; (ii) a F(ab′) 2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the V H and C H 1 domains; (iv) a Fv fragment consisting of the V L and V H domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a VH domain; and (vi) an isolated complementarity determining region (CDR).
- antigen binding sites e.g.,
- Single chain antibodies are also included by reference in the term “antibody.”
- Preferred therapeutic antibodies are intact IgG antibodies.
- the term “intact IgG” as used herein is meant as a polypeptide belonging to the class of antibodies that are substantially encoded by a recognized immunoglobulin gamma gene. In humans this class comprises IgG1, IgG2, IgG3, and IgG4. In mice this class comprises IgG1, IgG2a, IgG2b, and IgG3.
- the known Ig domains in the IgG class of antibodies are V H , C ⁇ 1, C ⁇ 2, C ⁇ 3, V L , and C L .
- the antibody or antigen binding fragment thereof is a human or humanized antibody comprising two heavy chains and two light chains.
- the antibody is an IgG.
- antibody is an IgG1, IgG2, or IgG4, and preferably a human IgG1, IgG2, or IgG4.
- the antibody or antigen binding fragment thereof of the invention can comprise any of the light chain variable regions described above and a human kappa or lambda light chain constant domain and an IgG1, IgG2, or IgG4 heavy chain constant domain.
- Exemplary light (kappa) and heavy (IgG2 and IgG4) constant region sequences which may be used in accordance with the invention are recited in SEQ ID NOs: 63, 65, 67 (each a nucleotide sequence), 64, 66, and 68 (each a polypeptide sequence).
- such antibody or antigen binding fragment thereof comprises one of the following combinations of heavy chain sequence/light chain variable region sequences:
- SEQ ID NO: 10/SEQ ID NO: 20 (referred to herein as hSIRP ⁇ .50A.H1L1) SEQ ID NO: 10/SEQ ID NO: 22 (referred to herein as hSIRP ⁇ .50A.H1L2) SEQ ID NO: 10/SEQ ID NO: 24 (referred to herein as hSIRP ⁇ .50A.H1L3) SEQ ID NO: 10/SEQ ID NO: 26 (referred to herein as hSIRP ⁇ .50A.H1L4) SEQ ID NO: 10/SEQ ID NO: 28 (referred to herein as hSIRP ⁇ .50A.H1L5) SEQ ID NO: 12/SEQ ID NO: 20 (referred to herein as hSIRP ⁇ .50A.H2L1) SEQ ID NO: 12/SEQ ID NO: 22 (referred to herein as hSIRP ⁇ .50A.H2L2) SEQ ID NO: 12/SEQ ID NO: 24 (referred to herein as hSI
- the antibody or antigen binding fragment is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 10 and each light chain comprises SEQ ID NO: 20, or, in each case, at least 90%, 95%, 97%, 98%, or 99% similar or identical to a respective SEQ ID NO, and most preferably each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG1, IgG2, or IgG4 constant region.
- the antibody or antigen binding fragment is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 16 and each light chain comprises SEQ ID NO: 28, or, in each case, at least 90%, 95%, 97%, 98%, or 99% similar or identical to a respective SEQ ID NO, and most preferably each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG1, IgG2, or IgG4 constant region.
- the antibody or antigen binding fragment is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 18 and each light chain comprises SEQ ID NO: 20, or, in each case, at least 90%, 95%, 97%, 98%, or 99% similar or identical to a respective SEQ ID NO, and most preferably each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG1, IgG2, or IgG4 constant region.
- the antibody or antigen binding fragment is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 80 and each light chain comprises SEQ ID NO: 90, or, in each case, at least 90%, 95%, 97%, 98%, or 99% similar or identical to a respective SEQ ID NO, and most preferably each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG1, IgG2, or IgG4 constant region.
- the antibody or antigen binding fragment is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 80 and each light chain comprises SEQ ID NO: 92, or, in each case, at least 90%, 95%, 97%, 98%, or 99% similar or identical to a respective SEQ ID NO, and most preferably each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG1, IgG2, or IgG4 constant region.
- the antibody or antigen binding fragment is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 80 and each light chain comprises SEQ ID NO: 96, or, in each case, at least 90%, 95%, 97%, 98%, or 99% similar or identical to a respective SEQ ID NO, and most preferably each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG1, IgG2, or IgG4 constant region.
- the anti-SIRP ⁇ antibody of the invention comprises a full length antibody structure having two light chains and two heavy chains as recited above, wherein each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG1 constant region.
- the anti-SIRP ⁇ antibody of the invention comprises a full length antibody structure having two light chains and two heavy chains as recited above, wherein each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG2 constant region.
- the anti-SIRP ⁇ antibody of the invention comprises a full-length antibody structure having two light chains and two heavy chains as recited above, wherein each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG4 constant region.
- the antibodies or antigen binding fragments of the present invention have one, two, three, four, or more, and preferably each of, the following functional characteristics:
- the anti-SIRP ⁇ antibodies or antigen binding fragments of the invention do not appreciably bind to one or both of SIRP ⁇ V1(P74A) and SIRP ⁇ 1 protein at an antibody concentration of 100 nM or alternatively at an antibody concentration that is 200-fold greater than the antibody's EC50 for SIRP ⁇ V1 or SIRP ⁇ V2, while binding to a cell expressing human SIRP ⁇ V1 protein with an EC50 ⁇ 10 nM.
- each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG1, IgG2, or IgG4 constant region.
- the anti-SIRP ⁇ antibody or antigen binding fragment thereof of the invention can be conjugated to at least one therapeutic agent.
- the therapeutic agent is a second antibody or fragment thereof, an immunomodulator, a hormone, a cytotoxic agent, an enzyme, a radionuclide, or a second antibody conjugated to at least one immunomodulator, enzyme, radioactive label, hormone, antisense oligonucleotide, or cytotoxic agent, or a combination thereof.
- the invention also provides isolated polypeptides comprising the amino acid sequence of any one of SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 76, 90, 92, 94, 96, 98, 100, 102, 104, 7, 10, 12, 14, 16, 18, 30, 8, 20, 22, 24, 26, 28, and 32 or a fragment of any said sequences, or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- the invention also provides isolated nucleic acids encoding anyone of the anti-SIRP ⁇ antibodies or antigen binding fragments of the invention.
- the invention provides an isolated nucleic acid which encodes an amino acid sequence selected from the group consisting of:
- the amino acid sequence of SEQ ID NO: 10 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 9 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- amino acid sequence of SEQ ID NO: 12 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 11 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- amino acid sequence of SEQ ID NO: 14 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 13 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- the amino acid sequence of SEQ ID NO: 16 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 15 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- amino acid sequence of SEQ ID NO: 18 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 17 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- amino acid sequence of SEQ ID NO: 30 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 29 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- amino acid sequence of SEQ ID NO: 78 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 77 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- amino acid sequence of SEQ ID NO: 80 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 79 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- the amino acid sequence of SEQ ID NO: 82 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 81 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- the amino acid sequence of SEQ ID NO: 84 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 83 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- amino acid sequence of SEQ ID NO: 86 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 85 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- amino acid sequence of SEQ ID NO: 88 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 87 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- the amino acid sequence of SEQ ID NO: 102 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 101 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- the invention provides an isolated nucleic acid which encodes an amino acid sequence selected from the group consisting of:
- amino acid sequence of SEQ ID NO: 20 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 19 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- amino acid sequence of SEQ ID NO: 22 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 21 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- amino acid sequence of SEQ ID NO: 24 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 23 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- amino acid sequence of SEQ ID NO: 26 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 25 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- amino acid sequence of SEQ ID NO: 28 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 27 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- amino acid sequence of SEQ ID NO: 32 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 31 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- amino acid sequence of SEQ ID NO: 90 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 89 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- the amino acid sequence of SEQ ID NO: 92 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 91 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- the amino acid sequence of SEQ ID NO: 94 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 93 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- the amino acid sequence of SEQ ID NO: 96 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 95 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- the amino acid sequence of SEQ ID NO: 98 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 97 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- the amino acid sequence of SEQ ID NO: 100 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 99 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- the amino acid sequence of SEQ ID NO: 104 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 103 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- the isolated nucleic acids of the present invention can optionally comprise a leader sequence.
- nucleic acids can comprise one or more of the following nucleic acid sequences:
- the nucleic acid can encode a human or humanized antibody, and includes nucleic acid sequences for both heavy and light chains.
- the antibody is an IgG.
- antibody is an IgG1, IgG2, or IgG4, and preferably a human IgG1, IgG2, or IgG4.
- the light chain sequence comprises a human kappa light chain or a human lambda light chain constant domain sequence; and each heavy chain sequence comprises a human IgG1, IgG2, or IgG4 constant region sequence.
- nucleic acids comprise the following combination heavy chain and light chain variable region nucleic acid sequences:
- SEQ ID NO: 9/SEQ ID NO: 19 (referred to herein as hSIRP ⁇ .50A.H1L1) SEQ ID NO: 9/SEQ ID NO: 21 (referred to herein as hSIRP ⁇ .50A.H1L2) SEQ ID NO: 9/SEQ ID NO: 23 (referred to herein as hSIRP ⁇ .50A.H1L3) SEQ ID NO: 9/SEQ ID NO: 25 (referred to herein as hSIRP ⁇ .50A.H1L4) SEQ ID NO: 9/SEQ ID NO: 27 (referred to herein as hSIRP ⁇ .50A.H1L5) SEQ ID NO: 11/SEQ ID NO: 19 (referred to herein as hSIRP ⁇ .50A.H2L1) SEQ ID NO: 11/SEQ ID NO: 21 (referred to herein as hSIRP ⁇ .50A.H2L2) SEQ ID NO: 11/SEQ ID NO: 23 (referred to herein as hSI
- the nucleic acid comprises SEQ ID NO: 9 and SEQ ID NO: 19 or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO.
- the nucleic acid comprises SEQ ID NO: 15 and SEQ ID NO: 27 or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO.
- the nucleic acid comprises SEQ ID NO: 17 and SEQ ID NO: 19 or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO.
- the nucleic acid comprises SEQ ID NO: 79 and SEQ ID NO: 89 or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO.
- the nucleic acid comprises SEQ ID NO: 79 and SEQ ID NO: 91 or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO.
- the nucleic acid comprises SEQ ID NO: 79 and SEQ ID NO: 95 or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO.
- the invention also provides expression vectors comprising one or more nucleic acids of the present invention.
- An expression vector is a DNA molecule comprising the regulatory elements necessary for transcription of a target nucleic acid in a host cell.
- the target nucleic acid is placed under the control of certain regulatory elements including constitutive or inducible promoters, tissue-specific regulatory elements, and enhancer elements.
- Such a target nucleic acid is said to be “operably linked to” the regulatory elements when the regulating element controls the expression of the gene.
- nucleic acids and the expression vectors comprising them may be used to express the antibodies of the invention or antigen binding fragments thereof in recombinant host cells.
- the invention also provides host cells comprising an expression vector of the present invention.
- Such expression vectors can comprise one or more of the following nucleic acid sequences operably linked to regulatory elements:
- the expression vector comprises nucleic acid sequences encoding both a heavy chain sequence and a light chain sequence of an anti-SIRP ⁇ antibody of the present invention.
- expression vectors comprise the following combination heavy chain and light chain variable region nucleic acid sequences:
- SEQ ID NO: 9/SEQ ID NO: 19 (referred to herein as hSIRP ⁇ .50A.H1L1) SEQ ID NO: 9/SEQ ID NO: 21 (referred to herein as hSIRP ⁇ .50A.H1L2) SEQ ID NO: 9/SEQ ID NO: 23 (referred to herein as hSIRP ⁇ .50A.H1L3) SEQ ID NO: 9/SEQ ID NO: 25 (referred to herein as hSIRP ⁇ .50A.H1L4) SEQ ID NO: 9/SEQ ID NO: 27 (referred to herein as hSIRP ⁇ .50A.H1L5) SEQ ID NO: 11/SEQ ID NO: 19 (referred to herein as hSIRP ⁇ .50A.H2L1) SEQ ID NO: 11/SEQ ID NO: 21 (referred to herein as hSIRP ⁇ .50A.H2L2) SEQ ID NO: 11/SEQ ID NO: 23 (referred to herein as hSI
- the expression vector can encode for expression a human or humanized antibody, and includes nucleic acid sequences for both heavy and light chains.
- the antibody is an IgG.
- antibody is an IgG1, IgG2, or IgG4, and preferably a human IgG1, IgG2, or IgG4.
- the light chain sequence comprises a human kappa light chain or a human lambda light chain constant domain sequence; and each heavy chain sequence comprises a human IgG4 constant region sequence.
- the expression vector encodes for expression a human or humanized antibody, wherein the heavy chain nucleic acid sequence comprises SEQ ID NO: 9 and the light chain nucleic acid sequence comprises SEQ ID NO: 19, or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO, and is most preferably an IgG1, IgG2, or IgG4 isotype.
- the expression vector encodes for expression a human or humanized antibody, wherein the heavy chain nucleic acid sequence comprises SEQ ID NO: 15 and the light chain nucleic acid sequence comprises SEQ ID NO: 27, or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO, and is most preferably an IgG1, IgG2, or IgG4 isotype.
- the expression vector encodes for expression a human or humanized antibody, wherein the heavy chain nucleic acid sequence comprises SEQ ID NO: 17 and the light chain nucleic acid sequence comprises SEQ ID NO: 19, or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO, and is most preferably an IgG1, IgG2, or IgG4 isotype.
- the expression vector encodes for expression a human or humanized antibody, wherein the heavy chain nucleic acid sequence comprises SEQ ID NO: 79 and the light chain nucleic acid sequence comprises SEQ ID NO: 89, or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO, and is most preferably an IgG1, IgG2, or IgG4 isotype.
- the expression vector encodes for expression a human or humanized antibody, wherein the heavy chain nucleic acid sequence comprises SEQ ID NO: 79 and the light chain nucleic acid sequence comprises SEQ ID NO: 91, or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO, and is most preferably an IgG1, IgG2, or IgG4 isotype.
- the expression vector encodes for expression a human or humanized antibody, wherein the heavy chain nucleic acid sequence comprises SEQ ID NO: 79 and the light chain nucleic acid sequence comprises SEQ ID NO: 95, or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO, and is most preferably an IgG1, IgG2, or IgG4 isotype.
- the host cell is Chinese hamster ovary (CHO) cell.
- the host cell is a mammalian cell (e.g., a human cell such as an HEK293 cell, a hamster cell such as a CHO cell, etc.), a bacterial cell (e.g., an E. coli cell) a yeast cell (e.g., a Pichia pastoris cell, etc.), a plant cell (e.g., a Nicotiana benthamiana cell), etc. . . . Mammalian cells are preferred due to glycosylation patterns that are most favorable.
- the invention also provides pharmaceutical compositions comprising an antibody or antigen binding fragment of the invention and a pharmaceutically acceptable carrier or diluent.
- the composition comprises one or more further therapeutic agents.
- the further therapeutic agent is selected from the group consisting of: an anti-CD27 antibody or an antigen binding fragment thereof; an anti-LAG3 antibody or an antigen binding fragment thereof; an anti-APRIL antibody or an antigen binding fragment thereof; an anti-TIGIT antibody or antigen biding fragment thereof; an anti-VISTA antibody or an antigen binding fragment thereof; an anti-BTLA antibody or an antigen binding fragment thereof; an anti-TIM3 antibody or an antigen binding fragment thereof; an anti-CTLA4 antibody or an antigen binding fragment thereof; an anti-HVEM antibody or an antigen binding fragment thereof; an anti-CD70 antibody or an antigen binding fragment thereof; an anti-CD137 antibody or an antigen binding fragment thereof; an anti-OX40 antibody or an antigen binding fragment thereof; an anti-CD28 antibody or an antigen binding fragment thereof; thereof; an anti-PD1 antibody or an antigen binding fragment thereof; an anti-PDL1 antibody or an antigen binding fragment thereof; an anti-PDL1 antibody or an anti
- the invention also comprises a combination comprising an antibody or antigen binding fragment of the invention and a second antibody that induces ADCC, wherein said antibody or antigen binding fragment of the invention enhances the antibody-mediated destruction of cells by the second antibody.
- Antibody-dependent cell-mediated cytotoxicity is a mechanism of cell-mediated immune defense whereby an effector cell of the immune system actively lyses a target cell, whose membrane-surface antigens have been bound by specific antibodies.
- ADCC is often thought of as being mediated by natural killer (NK) cells, but dendritic cells, macrophages, monocytes, and granulocytes can also mediate ADCC.
- the invention also comprises a combination comprising an antibody or antigen binding fragment of the invention and a second antibody that induces ADCP, wherein said antibody or antigen binding fragment of the invention enhances the antibody-mediated phagocytosis of cells by the second antibody.
- Antibody-dependent cell-mediated phagocytosis is a mechanism of cell-mediated immune defense whereby target cells are killed via granulocyte, monocyte, dendritic cell, or macrophage-mediated phagocytosis.
- NK cells play a major role in cancer immunotherapies that involve tumor-antigen targeting by monoclonal antibodies (mAbs).
- mAbs monoclonal antibodies
- NK cells can be “specifically activated” through certain Fc receptors that are expressed on their cell surface.
- NK cells can express Fc ⁇ RIIIA and/or Fc ⁇ RIIC, which can bind to the Fc portion of immunoglobulins, transmitting activating signals within NK cells. Once activated through Fc receptors by antibodies bound to target cells, NK cells are able to lyse target cells without priming, and secrete cytokines like interferon gamma to recruit adaptive immune cells.
- tumor-associated macrophages express surface receptors that bind the Fc fragment of antibodies and enable them to engage in Ab-dependent cellular cytotoxicity/phagocytosis (ADCC/ADCP).
- ADCC/ADCP Ab-dependent cellular cytotoxicity/phagocytosis
- ADCC/ADCP as a mode of action may be utilized in the treatment of various cancers and infectious diseases.
- An exemplary list of ADCC/ADCP-inducing antibodies and antibody conjugates that can be combined with the antibodies or antigen binding fragments of the present invention includes, but is not limited to, Rituximab, ublituximab, margetuximab, IMGN-529, SCT400, veltuzumab, Obinutuzumab, ADCT-502, Hul4.18K322A, Hu3F8, Dinituximab, Trastuzumab, Cetuximab, Rituximab-RLI, c.60C3-RLI, Hul4.18-IL2, KM2812, AFM13, and (CD20) 2 xCD16, erlotinib (Tarceva), daratumumab, alemtuzumab, pertuzumab, brentuximab, elotuzumab, ibri
- An exemplary list of target antigens for such ADCC/ADCP-inducing antibodies includes, but is not limited to, AMHR2, AXL, BCMA, CA IX, CD4, CD16, CD19, CD20, CD22, CD30, CD37, CD38, CD40, CD52, CD98, CSF1R, GD2, CCR4, CS1, EpCam, EGFR, EGFRvIII, Endoglin, EPHA2, EphA3, FGFR2b, folate receptor alpha, fucosyl-GM1, HER2, HER3, IL1RAP, kappa myeloma antigen, MS4A1, prolactin receptor, TA-MUC1, and PSMA.
- the second antibody or antigen binding fragment thereof induces ADCP.
- such antibodies may be selected from the group consisting of Rituximab, ublituximab, margetuximab, IMGN-529, SCT400, veltuzumab, Obinutuzumab, Trastuzumab, Cetuximab, alemtuzumab, ibritumomab, farletuzumab, inebilizumab, lumretuzumab, 4G7SDIE, BMS-986012, BVX-20, mogamulizumab, ChiLob-7/4, GM102, GSK-2857916, PankoMab-GEX, chKM-4927, MDX-1097, MOR202, and MOR-208.
- the antibodies or antigen binding fragments of the present invention are combined with one or more ADCC/ADCP-inducing antibodies and antibody conjugates, such combinations may also be used optionally in association with a further therapeutic agent or therapeutic procedure.
- the further therapeutic agent is selected from the group consisting of: an anti-LAG3 antibody or an antigen binding fragment thereof; an anti-APRIL antibody or an antigen binding fragment thereof; an anti-TIGIT antibody or an antigen binding fragment thereof; an anti-VISTA antibody or an antigen binding fragment thereof; an anti-BTLA antibody or an antigen binding fragment thereof; an anti-TIM3 antibody or an antigen binding fragment thereof; an anti-CTLA4 antibody or an antigen binding fragment thereof; an anti-HVEM antibody or an antigen binding fragment thereof; an anti-CD70 antibody or an antigen binding fragment thereof; an anti-CD137 antibody or an antigen binding fragment thereof; an anti-OX40 antibody or an antigen binding fragment thereof; an anti-CD28 antibody or an antigen binding fragment thereof; thereof; an anti-PD1
- the invention also provides a vessel or injection device comprising anyone of the anti-SIRP ⁇ antibodies or antigen binding fragments of the invention.
- the invention also provides a method of producing an anti-SIRP ⁇ antibody or antigen binding fragment of the invention comprising: culturing a host cell comprising a polynucleotide encoding a heavy chain and/or light chain of an antibody of the invention (or an antigen binding fragment thereof) under conditions favorable to expression of the polynucleotide; and optionally, recovering the antibody or antigen binding fragment from the host cell and/or culture medium.
- the polynucleotide encoding the heavy chain and the polynucleotide encoding the light chain are in a single vector.
- the polynucleotide encoding the heavy chain and the polynucleotide encoding the light chain are in different vectors.
- the invention also provides a method of treating cancer in a subject in need thereof, comprising administering to the subject an effective amount of an anti-SIRP ⁇ antibody or antigen binding fragment of the invention, optionally in association with a further therapeutic agent or therapeutic procedure.
- the subject to be treated is a human subject.
- the further therapeutic agent is selected from the group consisting of: an anti-LAG3 antibody or an antigen binding fragment thereof; an anti-APRIL antibody or an antigen binding fragment thereof; an an anti-TIGIT antibody or an antigen binding fragment thereof; an anti-VISTA antibody or an antigen binding fragment thereof; an anti-BTLA antibody or an antigen binding fragment thereof; an anti-TIM3 antibody or an antigen binding fragment thereof; an anti-CTLA4 antibody or an antigen binding fragment thereof; an anti-HVEM antibody or an antigen binding fragment thereof; an anti-CD70 antibody or an antigen binding fragment thereof; an anti-CD137 antibody or an antigen binding fragment thereof; an anti-OX40 antibody or an antigen binding fragment thereof; an anti-CD28 antibody or an antigen binding fragment thereof; thereof; an anti-PD1 antibody or an antigen binding fragment thereof; an anti-PDL1 antibody or an antigen binding fragment thereof; an anti-PDL2 antibody or an antigen binding fragment thereof; an antigen binding fragment thereof;
- the invention also provides a method of treating an infection or infectious disease in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment of the invention, optionally in association with a further therapeutic agent or therapeutic procedure.
- the subject to be treated is a human subject.
- the further therapeutic agent is selected from the group consisting of: an anti-LAG3 antibody or an antigen binding fragment thereof; an anti-APRIL antibody or an antigen binding fragment thereof; an an anti-TIGIT antibody or an antigen binding fragment thereof; an anti-VISTA antibody or an antigen binding fragment thereof; an anti-BTLA antibody or an antigen binding fragment thereof; an anti-TIM3 antibody or an antigen binding fragment thereof; an anti-CTLA4 antibody or an antigen binding fragment thereof; an anti-HVEM antibody or an antigen binding fragment thereof; an anti-CD70 antibody or an antigen binding fragment thereof; an anti-CD137 antibody or an antigen binding fragment thereof; an anti-OX40 antibody or an antigen binding fragment thereof; an anti-CD28 antibody or an antigen binding fragment thereof; thereof; an anti-PD1 antibody or an antigen binding fragment thereof; an anti-PDL1 antibody or an antigen binding fragment thereof; an anti-PDL2 antibody or an antigen binding fragment thereof; an anti-GITR antibody or an antigen binding fragment thereof; an anti-
- the invention also provides a method for detecting the presence of a SIRP ⁇ peptide or a fragment thereof in a sample comprising contacting the sample with an antibody or antigen binding fragment thereof of the invention and detecting the presence of a complex between the antibody or fragment and the peptide; wherein detection of the complex indicates the presence of the SIRP ⁇ peptide.
- FIG. 1 depicts cross-reactivity of commercially available anti-hSIRP ⁇ antibodies with hSIRP ⁇ 1 and allele-specific binding to hSIRP ⁇ V1 and hSIRP ⁇ V2.
- FIG. 2 depicts reactivity of KWAR23 antibody with hSIRP ⁇ V1, hSIRP ⁇ V2, hSIRP ⁇ 1, and hSIRP ⁇ .
- FIG. 3 depicts reactivity of antibody clone hSIRP ⁇ .50A for various hSIRP ⁇ alleles.
- FIG. 4 depicts the ability of hSIRP ⁇ .50A antibody to block recombinant hCD47/Fc-protein binding to cell surface expressed hSIRP ⁇ .
- FIG. 5A depicts binding of hSIRP?0.50A antibody to primary CD14+ enriched monocytes from a human donor.
- FIG. 5B depicts binding of hSIRP?0.50A antibody to primary CD14+ enriched monocytes from a second human donor.
- FIG. 5C depicts the ability of hSIRP?0.50A antibody to block hCD47 binding to to primary CD14+ enriched monocytes from a human donor.
- FIG. 5D depicts the ability of hSIRP?0.50A antibody to block hCD47 binding to to primary CD14+ enriched monocytes from a second human donor.
- FIG. 6A depicts binding of hSIRP ⁇ .50A antibody to primary human granulocytes.
- FIG. 6B depicts phagocytosis of tumor cells by primary human granulocytes in the presence of rituximab plus or minus the hSIRP ⁇ .50A antibody.
- FIG. 6C depicts phagocytosis of tumor cells by primary human granulocytes in the presence of daratumumab plus or minus the hSIRP ⁇ .50A antibody.
- FIG. 6D depicts phagocytosis of tumor cells by primary human granulocytes in the presence of alemtuzumab plus or minus the hSIRP ⁇ .50A antibody.
- FIG. 6E depicts phagocytosis of tumor cells by primary human granulocytes in the presence of cetuximab plus or minus the hSIRP ⁇ .50A antibody.
- FIG. 7 depicts phagocytosis of tumor cells by human macrophages in the presence of the indicated antibody (rituximab or daratumumab) plus or minus the hSIRP ⁇ .50A antibody.
- FIG. 8 depicts blocking of the hSIRP ⁇ /hCD47 interaction by mouse hSIRP ⁇ .50A and humanized hSIRP ⁇ .50A antibodies to hSIRP ⁇ .
- FIG. 9 depicts depicts hSIRP ⁇ .50A antibody binding to hSIRP ⁇ V1, hSIRP ⁇ V2, hSIRP ⁇ 1, hSIRP ⁇ -V ⁇ C1 ⁇ C2 ⁇ , hSIRP ⁇ -V ⁇ C1 ⁇ C2 ⁇ , and hSIRP ⁇ -V ⁇ C1 ⁇ C2 ⁇ .
- FIG. 10A depicts an alignment of the hSIRP ⁇ and hSIRP ⁇ 1 IgV domain amino acid sequences (SEQ ID NOS: 133-135).
- FIG. 10B depicts loss of hSIRP ⁇ .50A antibody binding to hSIRP ⁇ V1(P74A).
- FIG. 11 depicts binding of hSIRP ⁇ .40A and hSIRP ⁇ .50A antibodies to hSIRP ⁇ V1, hSIRP ⁇ V2, hSIRP ⁇ 1, hSIRP ⁇ L, and hSIRP ⁇ .
- FIG. 12 depicts binding of hSIRP ⁇ .40A and hSIRP ⁇ .50A antibodies to hSIRP ⁇ V1, hSIRP ⁇ V2, hSIRP ⁇ V3, hSIRP ⁇ V4, hSIRP ⁇ V5, hSIRP ⁇ V6, hSIRP ⁇ V8, and hSIRP ⁇ V9.
- FIG. 13 depicts the ability of hSIRP ⁇ .40A and hSIRP ⁇ .50A antibodies to block recombinant hCD47/Fc-protein binding to cell surface expressed hSIRP ⁇ .
- FIG. 14A depicts binding of hSIRP?0.40A antibody to primary CD14+ enriched monocytes from a human donor.
- FIG. 14B depicts binding of hSIRP?0.40A antibody to primary CD14+ enriched monocytes from a second human donor.
- FIG. 14C depicts the ability of hSIRP?0.40A antibody to block hCD47 binding to to primary CD14+ enriched monocytes from a human donor.
- FIG. 14D depicts the ability of hSIRP?0.40A antibody to block hCD47 binding to to primary CD14+ enriched monocytes from a second human donor.
- FIG. 15A depicts binding of hSIRP ⁇ .40A and hSIRP ⁇ .50A antibodies to primary human granulocytes.
- FIG. 15B depicts phagocytosis of Ramos cells by primary human granulocytes in the presence of rituximab plus or minus the hSIRP ⁇ .40A and hSIRP ⁇ .50A antibodies.
- FIG. 16 depicts enhancement of rituximab-induced Raji cell phagocytosis by hSIRP ⁇ .40A and hSIRP ⁇ .50A antibodies.
- FIG. 17 depicts binding of mouse hSIRP ⁇ .40A and humanized hSIRP ⁇ .40A antibodies to hSIRP ⁇ .
- FIG. 18 depicts the blockade of hCD47 binding to hSIRP ⁇ in the presence of humanized hSIRP ⁇ .40A antibody variants.
- FIG. 19 depicts binding of hSIRP ⁇ .40A and hSIRP ⁇ .50A antibodies to hSIRP ⁇ V1, hSIRP ⁇ V2, hSIRP ⁇ 1, hSIRP-V ⁇ C1 ⁇ C2 ⁇ , hSIRP-V ⁇ C1 ⁇ C2 ⁇ , and hSIRP-V ⁇ C1 ⁇ C2 ⁇ .
- FIG. 20 depicts loss of hSIRP ⁇ .40A and hSIRP ⁇ .50A antibody binding to hSIRP ⁇ V1(P74A).
- FIG. 21 depicts the ability of chimeric hSIRP ⁇ .40A antibody variants to affect rituximab-mediated phagocytosis.
- FIG. 22 depicts the ability of humanized hSIRP ⁇ .40A antibody variants to affect rituximab-mediated phagocytosis.
- FIG. 23A depicts the ability of mouse hSIRP ⁇ .50A and chimeric hSIRP ⁇ .50A hIgG2 and hIgG4 antibody variants to affect rituximab-mediated phagocytosis.
- FIG. 23B depicts the ability of chimeric hSIRP ⁇ .50A hIgG2 and hIgG4 antibody variants to affect rituximab-mediated phagocytosis.
- FIG. 23C depicts the ability of chimeric hSIRP ⁇ .50A hIgG2 and hIgG4 antibody variants to affect daratumumab-mediated phagocytosis.
- FIG. 23D depicts the ability of mouse hSIRP ⁇ .50A and chimeric hSIRP ⁇ .50A hIgG2 antibody variants to affect rituximab-mediated phagocytosis in granulocytes.
- FIG. 24A depicts the ability of mouse hSIRP ⁇ .50A and chimeric hSIRP ⁇ .50A.hIgG 1.N297Q, hSIRP ⁇ .50A.hIgG4.N297Q or hSIRP ⁇ .50A.hIgG2 antibody variants to affect rituximab-mediated phagocytosis.
- FIG. 24B depicts the ability of mouse hSIRP ⁇ .50A and chimeric hSIRP ⁇ .50A.hIgG 1.N297Q, hSIRP ⁇ .50A.hIgG4.N297Q or hSIRP ⁇ .50A.hIgG2 antibody variants to affect daratumumab-mediated phagocytosis.
- FIG. 25 depicts the ability of chimeric hSIRP ⁇ .50A.hIgG1.N297Q, hSIRP ⁇ .50A hIgG1.L234A.L235A.P329G, and hSIRP ⁇ .50A hIgG2 or hIgG4 antibody variants to affect rituximab-mediated phagocytosis.
- administering refers to contact of an exogenous pharmaceutical, therapeutic, diagnostic agent, or composition to the animal, human, subject, cell, tissue, organ, or biological fluid.
- Treatment of a cell encompasses contact of a reagent to the cell, as well as contact of a reagent to a fluid, where the fluid is in contact with the cell.
- administering and “treatment” also means in vitro and ex vivo treatments, e.g., of a cell, by a reagent, diagnostic, binding compound, or by another cell.
- Treat” or “treating” means to administer a therapeutic agent, such as a composition containing any of the antibodies or antigen-binding fragments of the present invention, internally or externally to a subject or patient having one or more disease symptoms, or being suspected of having a disease, for which the agent has therapeutic activity.
- the agent is administered in an amount effective to alleviate one or more disease symptoms in the treated subject or population, whether by inducing the regression of or inhibiting the progression of such symptom(s) by any clinically measurable degree.
- the amount of a therapeutic agent that is effective to alleviate any particular disease symptom may vary according to factors such as the disease state, age, and weight of the patient, and the ability of the drug to elicit a desired response in the subject. Whether a disease symptom has been alleviated can be assessed by any clinical measurement typically used by physicians or other skilled healthcare providers to assess the severity or progression status of that symptom.
- Recombinant expression of a protein means the transcription and translation of an exogenous gene in a host organism to generate the protein, which is referred to herein as a “recombinant protein.”
- SIRP ⁇ belongs to a class of membrane proteins known as “paired receptors” that contain several genes coding for proteins (e.g., SIRP ⁇ , SIRP ⁇ 1, and SIRP ⁇ ) with similar extracellular regions but different transmembrane and/or cytoplasmic regions having opposite (activating or inhibitory) signaling abilities.
- paired receptors there are several examples of paired receptors on NK cells and some on myeloid cells, including the SIRP and CD200 receptor families (Hatherley et al., Mol Cell. 2008; 31: 266-277).
- SIRP ⁇ contains an extracellular region that can be subdivided into three separate domains: the Ig-like (immunoglobulin-like) V-type (IgV), Ig-like C1-type (IgC1), and Ig-like C2-type (IgC2) domain.
- the IgV domain is also known as the ligand-binding N-terminal domain of SIRP ⁇ .
- SIRP ⁇ also the related proteins SIRP ⁇ 1 and SIRP ⁇ comprise an extracellular region that can be subdivided into an IgV, IgC1, and IgC2 domain.
- SIRP ⁇ , SIRP ⁇ 1 and SIRP ⁇ have different cytoplasmic regions.
- SIRP ⁇ 1 has a very short cytoplasmic region of only 6 amino acids and lacks signalling motifs for association with phosphatases. Instead, this protein associates with DNAX activation protein 12 (DAP12), a dimeric adaptor protein that binds an amino acid with a basic side chain in the transmembrane region of SIRP ⁇ 1 and is able to transmit activating signals through its immunoreceptor tyrosine-based activation motif (ITAM).
- SIRP ⁇ also has a short cytoplasmic region of 4 amino acids, but it lacks a charged amino-acid side chain in the transmembrane region and therefore does not associate with DAP12. Hence, SIRP ⁇ is annotated as a non-signalling protein (Barclay, A. N. and Brown, M. H., Nat Rev Immunol. 2006; 6: 457-464).
- CD47 The major ligand of SIRP ⁇ is CD47, which consists of one extracellular IgV domain, a five times transmembrane-spanning domain, and a short cytoplasmic tail. CD47 functions as a cellular ligand with binding mediated through the NH2-terminal IgV domain of SIRP ⁇ .
- Evidence that CD47 contributes to recognition of self comes from the observation that splenic macrophages derived from CD47-expressing mice clear infused blood cells from CD47 ⁇ / ⁇ mice (Oldenborg et al., Science. 2000; 288: 2051-2054).
- SIRP ⁇ ligands have been reported, known as surfactant proteins A and D (Sp-A and Sp-D), both of which belong to the collectin family.
- Sp-D has been reported to bind to the membrane-proximal IgC2 domain of SIRP ⁇ in a calcium- and saccharide-dependent manner. It is thought that Sp-A and Sp-D help maintain an anti-inflammatory environment in the lung by stimulating SIRP ⁇ on alveolar macrophages (Gardai et al., Cell. 2003; 115: 13-23).
- amino acid sequence of eight human SIRP ⁇ variants are listed in SEQ ID NOs: 34, 36, 44, 46, 48, 50, 52, and 54; exemplary nucleic acid sequences encoding these variants are listed in SEQ ID NOs: 33, 35, 43, 45, 47, 49, 51, and 53, respectively.
- amino acid sequence of human SIRP ⁇ 1 and SIRP ⁇ are listed in SEQ ID NOs: 38 and 40, respectively, and exemplary nucleic acid sequences in SEQ ID NOs: 37 and 39, respectively.
- amino acid sequence of human CD47 is listed in SEQ ID NO: 42, and an exemplary nucleic acid sequence in SEQ ID NO: 41.
- Modified SIRP ⁇ polypeptides hSIRP ⁇ -V ⁇ C1 ⁇ C2 ⁇ , hSIRP ⁇ -V ⁇ C1 ⁇ C2 ⁇ , hSIRP ⁇ -V ⁇ C1 ⁇ C2 ⁇ , and hSIRP ⁇ V1(P74A) discussed hereinafter are listed in SEQ ID NOs: 56, 58, 60, and 62; exemplary nucleic acid sequences encoding these variants are listed in SEQ ID NOs: 55, 57, 59, and 61, respectively.
- the present invention provides antibodies or antigen-binding fragments thereof that bind human SIRP ⁇ and uses of such antibodies or fragments.
- the anti-SIRP ⁇ antibodies are isolated.
- Whether an antibody specifically binds to a polypeptide sequence can be determined using any assay known in the art.
- assays known in the art to determining binding affinity include surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g. KinExa or OCTET).
- antibody refers to any form of antibody that exhibits the desired biological activity.
- the term antibody includes antigen-binding portions, i.e., “antigen binding sites,” (e.g., fragments, subsequences, complementarity determining regions (CDRs)) that retain capacity to bind antigen, including (i) a Fab fragment, a monovalent fragment consisting of the V L , V H , C L and C H 1 domains; (ii) a F(ab′) 2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the V H and C H 1 domains; (iv) a Fv fragment consisting of the V L and V H domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a VH domain; and
- antigen binding sites
- Single chain antibodies are also included by reference in the term “antibody.”
- Preferred therapeutic antibodies are intact IgG antibodies.
- the term “intact IgG” as used herein is meant as a polypeptide belonging to the class of antibodies that are substantially encoded by a recognized immunoglobulin gamma gene. In humans this class comprises IgG1, IgG2, IgG3, and IgG4. In mice this class comprises IgG1, IgG2a, IgG2b, IgG3.
- the known Ig domains in the IgG class of antibodies are V H , C ⁇ 1, C ⁇ 2, C ⁇ 3, V L , and C L .
- the present invention includes anti-SIRP ⁇ antigen-binding fragments and methods of use thereof.
- a “full length antibody” is, in the case of an IgG, a bivalent molecule comprising two heavy chains and two light chains. Each heavy chain comprises a V H domain followed by a constant domain (C H1 ), a hinge region, and two more constant (C H2 and C H3 ) domains; while each light chain comprises one V L domain and one constant (C L ) domain.
- a full length antibody in the case of an IgM is a decavalent or dodecavalent molecule comprising 5 or 6 linked immunoglobulins in which immunoglobulin each monomer has two antigen binding sites formed of a heavy and light chain.
- antibody fragment or “antigen-binding fragment” refers to antigen-binding fragments of antibodies, i.e. antibody fragments that retain the ability to bind specifically to the antigen bound by the full-length antibody, e.g. fragments that retain one or more CDR regions.
- antigen-binding fragments include, but are not limited to, Fab, Fab′, F(ab′) 2 , and Fv fragments; diabodies; linear antibodies; single-chain antibody molecules, e.g., sc-Fv; nanobodies and multispecific antibodies formed from antibody fragments.
- the present invention includes anti-SIRP ⁇ Fab fragments and methods of use thereof.
- a “Fab fragment” is comprised of one light chain and the C H 1 and variable regions of one heavy chain. The heavy chain of a Fab molecule cannot form a disulfide bond with another heavy chain molecule.
- a “Fab fragment” can be the product of papain cleavage of an antibody.
- the present invention includes anti-SIRP ⁇ antibodies and antigen-binding fragments thereof which comprise an Fc region and methods of use thereof.
- An “Fc” region contains two heavy chain fragments comprising the C H 3 and C H 2 domains of an antibody. The two heavy chain fragments are held together by two or more disulfide bonds and by hydrophobic interactions of the C H 3 domains.
- the present invention includes anti-SIRP ⁇ Fab′ fragments and methods of use thereof.
- a “Fab′ fragment” contains one light chain and a portion or fragment of one heavy chain that contains the V H domain and the C H 1 domain and also the region between the C H 1 and C H2 domains, such that an interchain disulfide bond can be formed between the two heavy chains of two Fab′ fragments to form a F(ab′) 2 molecule.
- the present invention includes anti-SIRP ⁇ F(ab′) 2 fragments and methods of use thereof.
- a “F(ab′) 2 fragment” contains two light chains and two heavy chains containing a portion of the constant region between the C H 1 and C H 2 domains, such that an interchain disulfide bond is formed between the two heavy chains.
- a F(ab′) 2 fragment thus is composed of two Fab′ fragments that are held together by a disulfide bond between the two heavy chains.
- An “F(ab′) 2 fragment” can be the product of pepsin cleavage of an antibody.
- the present invention includes anti-SIRP ⁇ Fv fragments and methods of use thereof.
- the “Fv region” comprises the variable regions from both the heavy and light chains, but lacks the constant regions.
- the present invention includes anti-SIRP ⁇ scFv fragments and methods of use thereof.
- the term “single-chain Fv” or “scFv” antibody refers to antibody fragments comprising the VH and V L domains of an antibody, wherein these domains are present in a single polypeptide chain.
- the Fv polypeptide further comprises a polypeptide linker between the V H and V L domains which enables the scFv to form the desired structure for antigen-binding.
- scFv see Pluckthun (1994) THE PHARMACOLOGY OF MONOCLONAL ANTIBODIES, vol. 113, Rosenburg and Moore eds. Springer-Verlag, New York, pp. 269-315. See also, International Patent Application Publication No. WO 88/01649 and U.S. Pat. Nos. 4,946,778 and 5,260,203.
- the present invention includes anti-SIRP ⁇ domain antibodies and methods of use thereof.
- a “domain antibody” is an immunologically functional immunoglobulin fragment containing only the variable region of a heavy chain or the variable region of a light chain.
- two or more V H regions are covalently joined with a peptide linker to create a bivalent domain antibody.
- the two V H regions of a bivalent domain antibody may target the same or different antigens.
- the present invention includes anti-SIRP ⁇ bivalent antibodies and methods of use thereof.
- a “bivalent antibody” comprises two antigen-binding sites. In some instances, the two binding sites have the same antigen specificities. However, bivalent antibodies may be bispecific (see below).
- the present invention includes anti-SIRP ⁇ diabodies and methods of use thereof.
- diabodies refers to small antibody fragments with two antigen-binding sites, which fragments comprise a heavy chain variable domain (V H ) connected to a light chain variable domain (V L ) in the same polypeptide chain (V H -V L or V L -V H ).
- V H heavy chain variable domain
- V L light chain variable domain
- the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites.
- Diabodies are described more fully in, e.g., EP 404,097; WO 93/11161; and Holliger et al. (1993) Proc.
- an antibody or antigen-binding fragment of the invention which is modified in some way retains at least 10% of its binding activity (when compared to the parental antibody) when that activity is expressed on a molar basis.
- an antibody or antigen-binding fragment of the invention retains at least 20%, 50%, 70%, 80%, 90%, 95% or 100% or more of the SIRP ⁇ binding affinity as the parental antibody.
- an antibody or antigen-binding fragment of the invention can include conservative or non-conservative amino acid substitutions (referred to as “conservative variants” or “function conserved variants” of the antibody) that do not substantially alter its biologic activity.
- the present invention includes isolated anti-SIRP ⁇ antibodies and antigen-binding fragments thereof and methods of use thereof.
- isolated is not intended to refer to a complete absence of such biological molecules or to an absence of water, buffers, or salts or to components of a pharmaceutical formulation that includes the antibodies or fragments.
- An “isolated” antibody, antigen-binding fragment, nucleic acid, etc., is one which has been identified and separated and/or recovered from one or more components of its natural environment.
- the antibody, antigen-binding fragment, nucleic acid, etc. is purified to 75% by weight or more, more preferably to 90% by weight or more, still more preferably to 95% by weight or more, an still more preferably to 98% by weight or more.
- isolated biological molecules are at least partially free of other biological molecules from the cells or cell cultures in which they are produced. Such biological molecules include nucleic acids, proteins, lipids, carbohydrates, or other material such as cellular debris and growth medium.
- An isolated antibody or antigen-binding fragment may further be at least partially free of expression system components such as biological molecules from a host cell or of the growth medium thereof.
- the present invention includes anti-SIRP ⁇ chimeric antibodies (e.g., human constant domain/mouse variable domain) and methods of use thereof.
- a “chimeric antibody” is an antibody having the variable domain from a first antibody and the constant domain from a second antibody, where the first and second antibodies are from different species.
- variable domains are obtained from an antibody from an experimental animal (the “parental antibody”), such as a rodent, and the constant domain sequences are obtained from human antibodies, so that the resulting chimeric antibody will be less likely to elicit an adverse immune response in a human subject than the parental (e.g., mouse) antibody.
- parental antibody an antibody from an experimental animal
- the constant domain sequences are obtained from human antibodies, so that the resulting chimeric antibody will be less likely to elicit an adverse immune response in a human subject than the parental (e.g., mouse) antibody.
- the present invention includes anti-SIRP ⁇ humanized antibodies and antigen-binding fragments thereof (e.g., rat or mouse antibodies that have been humanized) and methods of use thereof.
- humanized antibody refers to forms of antibodies that contain sequences from both human and non-human (e.g., mouse or rat) antibodies.
- the humanized antibody will comprise substantially of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin, and all or substantially all of the framework (FR) regions are those of a human immunoglobulin sequence.
- the humanized antibody may optionally comprise at least a portion of a human immunoglobulin constant region (Fc).
- the basic antibody structural unit comprises a tetramer.
- Each tetramer includes two identical pairs of polypeptide chains, each pair having one “light” (about 25 kDa) and one “heavy” chain (about 50-70 kDa).
- the amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition.
- the carboxy-terminal portion of the heavy chain may define a constant region primarily responsible for effector function.
- human light chains are classified as kappa and lambda light chains.
- human heavy chains are typically classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively.
- the variable and constant regions are joined by a “J” region of about 12 or more amino acids, with the heavy chain also including a “D” region of about 10 more amino acids. See generally, Fundamental Immunology Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989).
- variable regions of each light/heavy chain pair form the antibody binding site.
- an intact antibody has two binding sites.
- the two binding sites are, in general, the same.
- variable domains of both the heavy and light chains comprise three hypervariable regions, also called complementarity determining regions (CDRs), located within relatively conserved framework regions (FR).
- CDRs complementarity determining regions
- FR framework regions
- the CDRs are usually aligned by the framework regions, enabling binding to a specific epitope.
- both light and heavy chains variable domains comprise FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4.
- the assignment of amino acids to each domain is, generally, in accordance with the definitions of Sequences of Proteins of Immunological Interest, Kabat, et al.; National Institutes of Health, Bethesda, Md.; 5 th ed.; NIH Publ. No.
- hypervariable region refers to the amino acid residues of an antibody or antigen-binding fragment thereof that are responsible for antigen-binding.
- the hypervariable region comprises amino acid residues from a “complementarity determining region” or “CDR” (i.e. CDRL1, CDRL2 and CDRL3 in the light chain variable domain and CDRH1, CDRH2 and CDRH3 in the heavy chain variable domain).
- CDR complementarity determining region
- isolated nucleic acid molecule or “isolated polynucleotide” means a DNA or RNA of genomic, mRNA, cDNA, or synthetic origin or some combination thereof which is not associated with all or a portion of a polynucleotide in which the isolated polynucleotide is found in nature, or is linked to a polynucleotide to which it is not linked in nature.
- a nucleic acid molecule comprising a particular nucleotide sequence does not encompass intact chromosomes.
- Isolated nucleic acid molecules “comprising” specified nucleic acid sequences may include, in addition to the specified sequences, coding sequences for up to ten or even up to twenty or more other proteins or portions or fragments thereof, or may include operably linked regulatory sequences that control expression of the coding region of the recited nucleic acid sequences, and/or may include vector sequences.
- control sequences refers to DNA sequences necessary for the expression of an operably linked coding sequence in a particular host organism.
- the control sequences that are suitable for prokaryotes include a promoter, optionally an operator sequence, and a ribosome binding site.
- Eukaryotic cells are known to use promoters, polyadenylation signals, and enhancers.
- a nucleic acid or polynucleotide is “operably linked” when it is placed into a functional relationship with another nucleic acid sequence.
- DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide;
- a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation.
- operably linked means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.
- the expressions “cell,” “cell line,” and “cell culture” are used interchangeably and all such designations include progeny.
- the words “transformants” and “transformed cells” include the primary subject cell and cultures derived therefrom without regard for the number of transfers. It is also understood that not all progeny will have precisely identical DNA content, due to deliberate or inadvertent mutations. Mutant progeny that have the same function or biological activity as screened for in the originally transformed cell are included. Where distinct designations are intended, it will be clear from the context.
- germline sequence refers to a sequence of unrearranged immunoglobulin DNA sequences. Any suitable source of unrearranged immunoglobulin sequences may be used.
- Human germline sequences may be obtained, for example, from JOINSOLVER germline databases on the website for the National Institute of Arthritis and Musculoskeletal and Skin Diseases of the United States National Institutes of Health.
- Mouse germline sequences may be obtained, for example, as described in Giudicelli et al. (2005) Nucleic Acids Res. 33: D256-D261.
- the present invention provides anti-SIRP ⁇ antibodies and antigen-binding fragments thereof having specified structural and functional features, and methods of use of the antibodies or antigen-binding fragments thereof in the treatment or prevention of disease (e.g., cancer or infectious disease).
- disease e.g., cancer or infectious disease.
- the invention provides an antibody or antigen binding fragment thereof that binds to the same epitope of human SIRP ⁇ as an antibody comprising one of the following combinations of heavy chain sequence/light chain sequence (or in each case an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto):
- SEQ ID NO: 10/SEQ ID NO: 20 (referred to herein as hSIRP ⁇ .50A.H1L1)
- SEQ ID NO: 10/SEQ ID NO: 22 (referred to herein as hSIRP ⁇ .50A.H1L2)
- SEQ ID NO: 10/SEQ ID NO: 24 (referred to herein as hSIRP ⁇ .50A.H1L3)
- SEQ ID NO: 10/SEQ ID NO: 26 (referred to herein as hSIRP ⁇ .50A.H1L4)
- SEQ ID NO: 10/SEQ ID NO: 28 (referred to herein as hSIRP ⁇ .50A.H1L5)
- SEQ ID NO: 12/SEQ ID NO: 20 (referred to herein as hSIRP ⁇ .50A.H2L1)
- SEQ ID NO: 12/SEQ ID NO: 22 (referred to herein as hSIRP ⁇ .50A.H2L2)
- SEQ ID NO: 12/SEQ ID NO: 24 (referred to herein as hSIRP ⁇ .50A.H2L3)
- SEQ ID NO: 12/SEQ ID NO: 26 (referred to herein as hSIRP ⁇ .50A.H2L4)
- SEQ ID NO: 12/SEQ ID NO: 28 (referred to herein as hSIRP ⁇ .50A.H2L5)
- SEQ ID NO: 14/SEQ ID NO: 20 (referred to herein as hSIRP ⁇ .50A.H3L1)
- SEQ ID NO: 14/SEQ ID NO: 22 (referred to herein as hSIRP ⁇ .50A.H3L2)
- SEQ ID NO: 14/SEQ ID NO: 24 (referred to herein as hSIRP ⁇ .50A.H3L3)
- SEQ ID NO: 14/SEQ ID NO: 26 (referred to herein as hSIRP ⁇ .50A.H3L4)
- SEQ ID NO: 14/SEQ ID NO: 28 (referred to herein as hSIRP ⁇ .50A.H3L5)
- SEQ ID NO: 16/SEQ ID NO: 20 (referred to herein as hSIRP ⁇ .50A.H4L1)
- SEQ ID NO: 16/SEQ ID NO: 22 (referred to herein as hSIRP ⁇ .50A.H4L2)
- SEQ ID NO: 16/SEQ ID NO: 24 (referred to herein as hSIRP ⁇ .50A.H4L3)
- SEQ ID NO: 16/SEQ ID NO: 26 (referred to herein as hSIRP ⁇ .50A.H4L4)
- SEQ ID NO: 16/SEQ ID NO: 28 (referred to herein as hSIRP ⁇ .50A.H4L5)
- SEQ ID NO: 18/SEQ ID NO: 20 (referred to herein as hSIRP ⁇ .50A.H5L1)
- SEQ ID NO: 18/SEQ ID NO: 22 (referred to herein as hSIRP ⁇ .50A.H5L2)
- SEQ ID NO: 18/SEQ ID NO: 24 (referred to herein as hSIRP ⁇ .50A.H5L3)
- SEQ ID NO: 18/SEQ ID NO: 26 (referred to herein as hSIRP ⁇ .50A.H5L4)
- SEQ ID NO: 18/SEQ ID NO: 28 (referred to herein as hSIRP ⁇ .50A.H5L5)
- SEQ ID NO: 78/SEQ ID NO: 90 (referred to herein as hSIRP ⁇ .40A.H1L1)
- SEQ ID NO: 78/SEQ ID NO: 92 (referred to herein as hSIRP ⁇ .40A.H1L2)
- SEQ ID NO: 78/SEQ ID NO: 94 (referred to herein as hSIRP ⁇ .40A.H1L3)
- SEQ ID NO: 78/SEQ ID NO: 96 (referred to herein as hSIRP ⁇ .40A.H1L4)
- SEQ ID NO: 78/SEQ ID NO: 98 (referred to herein as hSIRP ⁇ .40A.H1L5)
- SEQ ID NO: 78/SEQ ID NO: 100 (referred to herein as hSIRP ⁇ .40A.H1L6)
- SEQ ID NO: 80/SEQ ID NO: 90 (referred to herein as hSIRP ⁇ .40A.H2L1)
- SEQ ID NO: 80/SEQ ID NO: 92 (referred to herein as hSIRP ⁇ .40A.H2L2)
- SEQ ID NO: 80/SEQ ID NO: 94 (referred to herein as hSIRP ⁇ .40A.H2L3)
- SEQ ID NO: 80/SEQ ID NO: 98 (referred to herein as hSIRP ⁇ .40A.H2L5)
- SEQ ID NO: 80/SEQ ID NO: 100 (referred to herein as hSIRP ⁇ .40A.H2L6)
- SEQ ID NO: 82/SEQ ID NO: 90 (referred to herein as hSIRP ⁇ .40A.H3L1)
- SEQ ID NO: 82/SEQ ID NO: 92 (referred to herein as hSIRP ⁇ .40A.H3L2)
- SEQ ID NO: 82/SEQ ID NO: 94 (referred to herein as hSIRP ⁇ .40A.H3L3)
- SEQ ID NO: 82/SEQ ID NO: 96 (referred to herein as hSIRP ⁇ .40A.H3L4)
- SEQ ID NO: 82/SEQ ID NO: 98 (referred to herein as hSIRP ⁇ .40A.H3L5)
- SEQ ID NO: 82/SEQ ID NO: 100 (referred to herein as hSIRP ⁇ .40A.H3L6)
- SEQ ID NO: 84/SEQ ID NO: 90 (referred to herein as hSIRP ⁇ .40A.H4L1)
- SEQ ID NO: 84/SEQ ID NO: 92 (referred to herein as hSIRP ⁇ .40A.H4L2)
- SEQ ID NO: 84/SEQ ID NO: 94 (referred to herein as hSIRP ⁇ .40A.H4L3)
- SEQ ID NO: 84/SEQ ID NO: 96 (referred to herein as hSIRP ⁇ .40A.H4L4)
- SEQ ID NO: 84/SEQ ID NO: 98 (referred to herein as hSIRP ⁇ .40A.H4L5)
- SEQ ID NO: 84/SEQ ID NO: 100 (referred to herein as hSIRP ⁇ .40A.H4L6)
- SEQ ID NO: 86/SEQ ID NO: 90 (referred to herein as hSIRP ⁇ .40A.H5L1)
- SEQ ID NO: 86/SEQ ID NO: 92 (referred to herein as hSIRP ⁇ .40A.H5L2)
- SEQ ID NO: 86/SEQ ID NO: 94 (referred to herein as hSIRP ⁇ .40A.H5L3)
- SEQ ID NO: 86/SEQ ID NO: 96 (referred to herein as hSIRP ⁇ .40A.H5L4)
- SEQ ID NO: 86/SEQ ID NO: 98 (referred to herein as hSIRP ⁇ .40A.H5L5)
- SEQ ID NO: 86/SEQ ID NO: 100 (referred to herein as hSIRP ⁇ .40A.H5L6)
- SEQ ID NO: 88/SEQ ID NO: 90 (referred to herein as hSIRP ⁇ .40A.H6L1)
- SEQ ID NO: 88/SEQ ID NO: 92 (referred to herein as hSIRP ⁇ .40A.H6L2)
- SEQ ID NO: 88/SEQ ID NO: 94 (referred to herein as hSIRP ⁇ .40A.H6L3)
- SEQ ID NO: 88/SEQ ID NO: 96 (referred to herein as hSIRP ⁇ .40A.H6L4)
- SEQ ID NO: 88/SEQ ID NO: 98 (referred to herein as hSIRP ⁇ .40A.H6L5)
- SEQ ID NO: 88/SEQ ID NO: 100 (referred to herein as hSIRP ⁇ .40A.H6L6).
- HDX Hydrophilicity-Specific Spectra-Specific spectrometry
- crosslinking coupled mass spectrometry X-ray crystallography
- pepscan analysis site directed mutagenesis.
- HDX-MS Hydrogen Deuterium Exchange
- HDX-MS relies on the accurate measurement and comparison of the degree of deuterium incorporation by an antigen when incubated in D 2 O on its own and in presence of its antibody at various time intervals.
- Crosslinking coupled mass spectrometry begins by binding the antibody and the antigen with a mass labeled chemical crosslinker. Next the presence of the complex is confirmed using high mass MALDI detection. Because after crosslinking chemistry the Ab/Ag complex is extremely stable, many various enzymes and digestion conditions can be applied to the complex to provide many different overlapping peptides. Identification of these peptides is performed using high resolution mass spectrometry and MS/MS techniques. Identification of the crosslinked peptides is determined using mass tag linked to the cross-linking reagents. After MS/MS fragmentation and data analysis, both epitope and paratope are determined in the same experiment.
- the scope of the present invention also includes isolated anti-SIRP ⁇ antibodies and antigen-binding fragments thereof (e.g., humanized antibodies), comprising a variant of an immunoglobulin chain set forth herein, wherein the variant exhibits one or more of the following properties:
- the invention provides antibodies or antigen-binding fragment thereof that bind human SIRP ⁇ (e.g., humanized antibodies) and have V H domains and V L domains with at least 90% sequence identity with SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 102, 7, 10, 12, 14, 16, 18, and 30; and 76, 90, 92, 94, 96, 98, 100, 104, 8, 20, 22, 24, 26, 28, and 32.
- human SIRP ⁇ e.g., humanized antibodies
- the invention provides antibodies or antigen-binding fragment thereof that bind human SIRP ⁇ (e.g., humanized antibodies) and have V H domains and V L domains with at least 95% sequence identity with SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 102, 7, 10, 12, 14, 16, 18, and 30; and 76, 90, 92, 94, 96, 98, 100, 104, 8, 20, 22, 24, 26, 28, and 32.
- human SIRP ⁇ e.g., humanized antibodies
- the invention provides antibodies or antigen-binding fragment thereof that bind human SIRP ⁇ (e.g., humanized antibodies) and have V H domains and V L domains with at least 97% sequence identity with SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 102, 7, 10, 12, 14, 16, 18, and 30; and 76, 90, 92, 94, 96, 98, 100, 104, 8, 20, 22, 24, 26, 28, and 32.
- human SIRP ⁇ e.g., humanized antibodies
- the invention provides antibodies or antigen-binding fragment thereof that bind human SIRP ⁇ (e.g., humanized antibodies) and have V H domains and V L domains with at least 98% sequence identity with SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 102, 7, 10, 12, 14, 16, 18, and 30; and 76, 90, 92, 94, 96, 98, 100, 104, 8, 20, 22, 24, 26, 28, and 32.
- human SIRP ⁇ e.g., humanized antibodies
- the invention provides antibodies or antigen-binding fragment thereof that bind human SIRP ⁇ (e.g., humanized antibodies) and have V H domains and V L domains with at least 99% sequence identity with SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 102, 7, 10, 12, 14, 16, 18, and 30; and 76, 90, 92, 94, 96, 98, 100, 104, 8, 20, 22, 24, 26, 28, and 32.
- human SIRP ⁇ e.g., humanized antibodies
- sequence differences between SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 102, 7, 10, 12, 14, 16, 18, and 30; and 76, 90, 92, 94, 96, 98, 100, 104, 8, 20, 22, 24, 26, 28, and 32 and the variants consist of conservative substitutions and are most preferably limited to substitutions within the framework residues.
- BLAST ALGORITHMS Camacho, C. et al. (2009): BMC Bioinformatics 10:421; Altschul et al. (2005) FEBS J. 272(20): 5101-5109; Altschul, S. F., et al., (1990) J. Mol. Biol. 215:403-410; Gish, W., et al., (1993) Nature Genet. 3:266-272; Madden, T. L., et al., (1996) Meth. Enzymol. 266:131-141; Altschul, S. F., et al., (1997) Nucleic Acids Res.
- percent identity comparisons are preferably performed by a BLAST algorithm wherein the parameters of the algorithm are selected to give the largest match between the respective sequences over the entire length of the respective reference sequences (e.g. expect threshold: 10; word size: 6; max matches in a query range: 0; BLOSUM 62 matrix; gap costs: existence 11, extension 1; conditional compositional score matrix adjustment).
- Constantly modified variants or “conservative substitution” refers to substitutions of amino acids in a protein with other amino acids having similar characteristics (e.g. charge, side-chain size, hydrophobicity/hydrophilicity, backbone conformation and rigidity, etc.), such that the changes can frequently be made without altering the biological activity of the protein.
- Those of skill in this art recognize that, in general, single amino acid substitutions in non-essential regions of a polypeptide do not substantially alter biological activity (see, e.g., Watson et al. (1987) Molecular Biology of the Gene , The Benjamin/Cummings Pub. Co., p. 224 (4th Ed.)).
- substitutions of structurally or functionally similar amino acids are less likely to disrupt biological activity. Exemplary conservative substitutions are set forth the following Table 1.
- “Function-conservative variants,” as used herein, refers to antibodies or fragments in which one or more amino acid residues have been changed without altering a desired property, such an antigen affinity and/or specificity. Such variants include, but are not limited to, replacement of an amino acid with one having similar properties, such as the conservative amino acid substitutions of Table 1.
- isolated polypeptides comprising the V L domains of the anti-SIRP ⁇ antibodies of the invention (e.g., SEQ ID NOs: 76, 90, 92, 94, 96, 98, 100, 8, 20, 22, 24, 26, 28, and 32), and isolated polypeptides comprising the V H domains of the anti-SIRP ⁇ antibodies of the invention (e.g., SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 7, 10, 12, 14, 16, 18, and 30) having up to 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more amino acid substitutions, and preferably conservative substitutions.
- the present invention further comprises the polynucleotides encoding any of the polypeptides or immunoglobulin chains of anti-SIRP ⁇ antibodies and antigen-binding fragments thereof of the invention.
- the present invention includes the polynucleotides encoding the amino acids described in any one of SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 102, 7, 10, 12, 14, 16, 18, and 30; and SEQ ID NOs: 76, 90, 92, 94, 96, 98, 100, 104, 8, 20, 22, 24, 26, 28, and 32.
- an isolated polynucleotide for example DNA, encoding the polypeptide chains of the isolated antibodies or antigen-binding fragments set forth herein is provided.
- the isolated polynucleotide encodes an antibody or antigen-binding fragment thereof comprising at least one mature immunoglobulin light chain variable (VL) domain according to the invention and/or at least one mature immunoglobulin heavy chain variable (VH) domain according to the invention.
- the isolated polynucleotide encodes both a light chain and a heavy chain on a single polynucleotide molecule, and in other embodiments the light and heavy chains are encoded on separate polynucleotide molecules.
- the polynucleotides further encodes a signal sequence.
- This present invention also provides vectors, e.g., expression vectors, such as plasmids, comprising the isolated polynucleotides of the invention, wherein the polynucleotide is operably linked to control sequences that are recognized by a host cell when the host cell is transfected with the vector.
- vectors e.g., expression vectors, such as plasmids
- host cells comprising a vector of the present invention and methods for producing the antibody or antigen-binding fragment thereof or polypeptide disclosed herein comprising culturing a host cell harboring an expression vector or a nucleic acid encoding the immunoglobulin chains of the antibody or antigen-binding fragment thereof in culture medium, and isolating the antigen or antigen-binding fragment thereof from the host cell or culture medium.
- the antibodies and antigen-binding fragments disclosed herein may bind human SIRP ⁇ bivalently with a K D value of 10 ⁇ 10 ⁇ 9 M or lower) as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g. KinExa or bio-layer interferometry (OCTET)).
- the antibodies and antigen-binding fragments disclosed herein may bind human SIRP ⁇ or bivalently with a K D value of about 5-10 ⁇ 10 ⁇ 9 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g. KinExa or OCTET).
- r/c is plotted on the Y-axis versus r on the X-axis, thus producing a Scatchard plot.
- Antibody affinity measurement by Scatchard analysis is well known in the art. See, e.g., van Erp et al., J. Immunoassay 12: 425-43, 1991; Nelson and Griswold, Comput. Methods Programs Biomed. 27: 65-8, 1988.
- humanness is measured using the T20 score analyzer to quantify the humanness of the variable region of monoclonal antibodies as described in Gao S H, Huang K, Tu H, Adler A S. Monoclonal antibody humanness score and its applications. BMC Biotechnology. 2013: 13:55. doi:10.1186/1472-6750-13-55).
- a web-based tool is provided to calculate the T20 score of antibody sequences using the T20 Cutoff Human Databases: http://abAnalyzer.lakepharma.com.
- T20 score an input VH, VK, or VL variable region protein sequence is first assigned Kabat numbering, and CDR residues are identified. The full-length sequence or the framework only sequence (with CDR residues removed) is compared to every sequence in a respective antibody database using the blastp protein-protein BLAST algorithm. The sequence identity between each pairwise comparison is isolated, and after every sequence in the database has been analyzed, the sequences are sorted from high to low based on the sequence identity to the input sequence. The percent identity of the Top 20 matched sequences is averaged to obtain the T20 score.
- each antibody sequence was scored with its respective database using the T20 score analyzer.
- the T20 score was obtained for the top 20 matched sequences after the input sequence itself was excluded (the percent identity of sequences 2 through 21 were averaged since sequence 1 was always the input antibody itself).
- the T20 scores for each group were sorted from high to low. The decrease in score was roughly linear for most of the sequences; however the T20 scores for the bottom ⁇ 15% of antibodies started decreasing sharply. Therefore, the bottom 15 percent of sequences were removed and the remaining sequences formed the T20 Cutoff Human Databases, where the T20 score cutoff indicates the lowest T20 score of a sequence in the new database.
- a “Human” antibody is one that has a T20 humanness score of at least 79%, and more preferably at least 85%.
- the anti-SIRP ⁇ antibodies or antigen binding fragments of the invention are able to block binding of human SIRP ⁇ to human CD47.
- the ability to block binding of human SIRP ⁇ to human CD47 can be determined using any method known in the art.
- the ability of the antibodies to block binding of human SIRP ⁇ to human CD47 is determined using an ELISA assay.
- the present invention includes methods for making an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the present invention comprising culturing a hybridoma cell that expresses the antibody or fragment under condition favorable to such expression and, optionally, isolating the antibody or fragment from the hybridoma and/or the growth medium (e.g. cell culture medium).
- the growth medium e.g. cell culture medium
- the anti-SIRP ⁇ antibodies disclosed herein may also be produced recombinantly (e.g., in an E. coli /T7 expression system, a mammalian cell expression system or a lower eukaryote expression system).
- nucleic acids encoding the antibody immunoglobulin molecules of the invention e.g., V H or V L
- the present invention includes methods for expressing an antibody or antigen-binding fragment thereof or immunoglobulin chain thereof in a host cell (e.g., bacterial host cell such as E.
- coli such as BL21 or BL21DE3 comprising expressing T7 RNA polymerase in the cell which also includes a polynucleotide encoding an immunoglobulin chain that is operably linked to a T7 promoter.
- a bacterial host cell such as a E. coli , includes a polynucleotide encoding the T7 RNA polymerase gene operably linked to a lac promoter and expression of the polymerase and the chain is induced by incubation of the host cell with IPTG (isopropyl-beta-D-thiogalactopyrano side).
- Transformation can be by any known method for introducing polynucleotides into a host cell.
- Methods for introduction of heterologous polynucleotides into mammalian cells are well known in the art and include dextran-mediated transfection, calcium phosphate precipitation, polybrene-mediated transfection, protoplast fusion, electroporation, encapsulation of the polynucleotide(s) in liposomes, biolistic injection and direct microinjection of the DNA into nuclei.
- nucleic acid molecules may be introduced into mammalian cells by viral vectors. Methods of transforming cells are well known in the art. See, for example, U.S. Pat. Nos. 4,399,216; 4,912,040; 4,740,461 and 4,959,455.
- the present invention includes recombinant methods for making an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the present invention, or an immunoglobulin chain thereof, comprising introducing a polynucleotide encoding one or more immunoglobulin chains of the antibody or fragment (e.g., heavy and/or light immunoglobulin chain); culturing the host cell (e.g., CHO or Pichia or Pichia pastoris ) under condition favorable to such expression and, optionally, isolating the antibody or fragment or chain from the host cell and/or medium in which the host cell is grown.
- a polynucleotide encoding one or more immunoglobulin chains of the antibody or fragment (e.g., heavy and/or light immunoglobulin chain)
- the host cell e.g., CHO or Pichia or Pichia pastoris
- Anti-SIRP ⁇ antibodies can also be synthesized by any of the methods set forth in U.S. Pat. No. 6,331,415.
- Eukaryotic and prokaryotic host cells including mammalian cells as hosts for expression of the antibodies or fragments or immunoglobulin chains disclosed herein are well known in the art and include many immortalized cell lines available from the American Type Culture Collection (ATCC). These include, inter alia, Chinese hamster ovary (CHO) cells, NSO, SP2 cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2), A549 cells, 3T3 cells, HEK-293 cells and a number of other cell lines.
- Mammalian host cells include human, mouse, rat, dog, monkey, pig, goat, bovine, horse and hamster cells.
- Cell lines of particular preference are selected through determining which cell lines have high expression levels.
- Other cell lines that may be used are insect cell lines, such as Sf9 cells, amphibian cells, bacterial cells, plant cells and fungal cells.
- Fungal cells include yeast and filamentous fungus cells including, for example, Pichia pastoris, Pichia finlandica, Pichia trehalophila, Pichia koclamae, Pichia membranaefaciens, Pichia minuta ( Ogataea minuta, Pichia lindneri ), Pichia opuntiae, Pichia thermotolerans, Pichia salictaria, Pichia guercuum, Pichia pijperi, Pichia stiptis, Pichia methanolica, Pichia sp., Saccharomyces cerevisiae, Saccharomyces sp., Hansenula polymorpha, Kluyveromyces sp., Kluyveromy
- Pichia sp. any Saccharomyces sp., Hansenula polymorpha , any Kluyveromyces sp., Candida albicans , any Aspergillus sp., Trichoderma reesei, Chrysosporium lucknowense , any Fusarium sp., Yarrowia lipolytica , and Neurospora crassa .
- the antibodies are produced by culturing the host cells for a period of time sufficient to allow for expression of the antibody or fragment or chain in the host cells or secretion into the culture medium in which the host cells are grown.
- Antibodies and antigen-binding fragments thereof and immunoglobulin chains can be recovered from the culture medium using standard protein purification methods. Further, expression of antibodies and antigen-binding fragments thereof and immunoglobulin chains of the invention (or other moieties therefrom) from production cell lines can be enhanced using a number of known techniques.
- the glutamine synthetase gene expression system (the GS system) is a common approach for enhancing expression under certain conditions. The GS system is discussed in whole or part in connection with European Patent Nos. 0216846, 0256055, and 0323997 and 0338841.
- the mammalian host cells e.g., CHO
- the polynucleotide encoding the immunoglobulin chain comprises a glutamine synthetase gene which complements the lack of the gene in the host cell.
- the present invention includes methods for purifying an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the present invention comprising introducing a sample comprising the antibody or fragment to a purification medium (e.g., cation exchange medium, anion exchange medium, hydrophobic exchange medium, affinity purification medium (e.g., protein-A, protein-G, protein-A/G, protein-L)) and either collecting purified antibody or fragment from the flow-through fraction of said sample that does not bind to the medium; or, discarding the flow-through fraction and eluting bound antibody or fragment from the medium and collecting the eluate.
- a purification medium e.g., cation exchange medium, anion exchange medium, hydrophobic exchange medium, affinity purification medium (e.g., protein-A, protein-G, protein-A/G, protein-L)
- the medium is in a column to which the sample is applied.
- the purification method is conducted following recombinant expression of the antibody or fragment in a host cell, e.g., wherein the host cell is first lysed and, optionally, the lysate is purified of insoluble materials prior to purification on a medium.
- glycoproteins produced in a particular cell line or transgenic animal will have a glycosylation pattern that is characteristic for glycoproteins produced in the cell line or transgenic animal. Therefore, the particular glycosylation pattern of an antibody will depend on the particular cell line or transgenic animal used to produce the antibody.
- all antibodies encoded by the nucleic acid molecules provided herein, or comprising the amino acid sequences provided herein comprise the instant invention, independent of the glycosylation pattern the antibodies may have.
- antibodies with a glycosylation pattern comprising only non-fucosylated N-glycans may be advantageous, because these antibodies have been shown to typically exhibit more potent efficacy than their fucosylated counterparts both in vitro and in vivo (See for example, Shinkawa et al., J. Biol. Chem. 278: 3466-3473 (2003); U.S. Pat. Nos. 6,946,292 and 7,214,775). These antibodies with non-fucosylated N-glycans are not likely to be immunogenic because their carbohydrate structures are a normal component of the population that exists in human serum IgG.
- the present invention includes bispecific and bifunctional antibodies and antigen-binding fragments having a binding specificity for SIRP ⁇ and another antigen such as, for example, CD19, CD20, CD22, CD24, CD25, CD30, CD33, CD38, CD44, CD52, CD56, CD70, CD96, CD97, CD99, CD117, CD123, c-Met, CEA, EGFR, EpCAM, HER2, HER3, PSMA, PTHR2, mesothelin, PD-1, PD-L1, TIM3, and methods of use thereof.
- a bispecific or bifunctional antibody is an artificial hybrid antibody having two different heavy/light chain pairs and two different binding sites.
- Bispecific antibodies can be produced by a variety of methods including fusion of hybridomas or linking of Fab′ fragments. See, e.g., Songsivilai, et al., (1990) Clin. Exp. Immunol. 79: 315-321, Kostelny, et al., (1992) J Immunol. 148:1547-1553.
- bispecific antibodies may be formed as “diabodies” (Holliger, et al., (1993) PNAS USA 90:6444-6448) or as “Janusins” (Traunecker, et al., (1991) EMBO J. 10:3655-3659 and Traunecker, et al., (1992) Int. J.
- Duobodies which are bispecific antibodies with normal IgG structures (Labrijn et al., 2013 , Proc. Natl. Acad. Sci. USA 110 (13): 5145-5150).
- the present invention further includes anti-SIRP ⁇ antigen-binding fragments of the anti-SIRP ⁇ antibodies disclosed herein.
- the antibody fragments include F(ab) 2 fragments, which may be produced by enzymatic cleavage of an IgG by, for example, pepsin.
- Fab fragments may be produced by, for example, reduction of F(ab) 2 with dithiothreitol or mercaptoethylamine.
- Immunoglobulins may be assigned to different classes depending on the amino acid sequences of the constant domain of their heavy chains. In some embodiments, different constant domains may be appended to humanized V L and V H regions derived from the CDRs provided herein. There are at least five major classes of immunoglobulins: IgA, IgD, IgE, IgG and IgM, and several of these may be further divided into subclasses (isotypes), e.g. IgG1, IgG2, IgG3 and IgG4; IgA1 and IgA2.
- the invention comprises antibodies and antigen-binding fragments of any of these classes or subclasses of antibodies.
- the antibody or antigen-binding fragment comprises a heavy chain constant region, e.g. a human constant region, such as ⁇ 1, ⁇ 2, ⁇ 3, or ⁇ 4 human heavy chain constant region or a variant thereof.
- the antibody or antigen-binding fragment comprises a light chain constant region, e.g. a human light chain constant region, such as lambda or kappa human light chain region or variant thereof.
- the human heavy chain constant region can be ⁇ 4 and the human light chain constant region can be kappa.
- the Fc region of the antibody is ⁇ 4 with a Ser228Pro mutation (Schuurman, J et. al., Mol. Immunol. 38: 1-8, 2001).
- the antibody or antigen-binding fragment comprises a heavy chain constant region of the IgG1 subtype. In one embodiment, the antibody or antigen-binding fragment comprises a heavy chain constant region of the IgG2 subtype. In one embodiment, the antibody or antigen-binding fragment comprises a heavy chain constant region of the IgG4 subtype.
- the anti-SIRP ⁇ antibodies and antigen-binding fragments thereof are engineered antibodies to include modifications to framework residues within the variable domains the antibody, e.g. to improve the properties of the antibody or fragment.
- framework modifications are made to decrease the immunogenicity of the antibody or fragment. This is usually accomplished by replacing non-CDR residues in the variable domains (i.e. framework residues) in a parental (e.g. rodent) antibody or fragment with analogous residues from the immune repertoire of the species in which the antibody is to be used, e.g. human residues in the case of human therapeutics.
- a parental antibody or fragment e.g. rodent antibody or fragment with analogous residues from the immune repertoire of the species in which the antibody is to be used, e.g. human residues in the case of human therapeutics.
- Such an antibody or fragment is referred to as a “humanized” antibody or fragment.
- an engineered (e.g. humanized) antibody it is desirable to increase the affinity, or alter the specificity of an engineered (e.g. humanized) antibody.
- One approach is to mutate one or more framework residues to the corresponding germline sequence. More specifically, an antibody or fragment that has undergone somatic mutation can contain framework residues that differ from the germline sequence from which the antibody is derived. Such residues can be identified by comparing the antibody or fragment framework sequences to the germline sequences from which the antibody or fragment is derived.
- Another approach is to revert to the original parental (e.g., rodent) residue at one or more positions of the engineered (e.g. humanized) antibody, e.g. to restore binding affinity that may have been lost in the process of replacing the framework residues. (See, e.g., U.S. Pat. Nos. 5,693,762, 5,585,089 and 5,530,101).
- the anti-SIRP ⁇ antibodies and antigen-binding fragments thereof are engineered (e.g. humanized) to include modifications in the framework and/or CDRs to improve their properties.
- engineered changes can be based on molecular modelling.
- a molecular model for the variable region for the parental (non-human) antibody sequence can be constructed to understand the structural features of the antibody and used to identify potential regions on the antibody that can interact with the antigen.
- Conventional CDRs are based on alignment of immunoglobulin sequences and identifying variable regions.
- CDRs regions classified as “CDRs” and “hypervariable loops”.
- Later studies (Raghunathan et al, (2012) J. Mol Recog. 25, 3, 103-113) analyzed several antibody-antigen crystal complexes and observed that the antigen binding regions in antibodies do not necessarily conform strictly to the “CDR” residues or “hypervariable” loops.
- the molecular model for the variable region of the non-human antibody can be used to guide the selection of regions that can potentially bind to the antigen. In practice the potential antigen binding regions based on the model differ from the conventional “CDR”s or “hypervariable” loops.
- Human frameworks can be selected based on best matches with the non-human sequence both in the frameworks and in the CDRs.
- FR4 framework 4
- VJ regions for the human germlines are compared with the corresponding non-human region.
- FR4 (framework 4) in VL J-kappa and J-Lambda regions of human germline sequences are compared with the corresponding non-human region.
- the CDRs are grafted into the selected human frameworks. In some cases, certain residues in the VL-VH interface can be retained as in the non-human (parental) sequence.
- Molecular models can also be used for identifying residues that can potentially alter the CDR conformations and hence binding to antigen. In some cases, these residues are retained as in the non-human (parental) sequence. Molecular models can also be used to identify solvent exposed amino acids that can result in unwanted effects such as glycosylation, deamidation and oxidation. Developability filters can be introduced early on in the design stage to eliminate/minimize these potential problems.
- Another type of framework modification involves mutating one or more residues within the framework region, or even within one or more CDR regions, to remove T cell epitopes to thereby reduce the potential immunogenicity of the antibody. This approach is also referred to as “deimmunization” and is described in further detail in U.S. Pat. No. 7,125,689.
- the antibodies of the present disclosure do not contain deamidation or asparagine isomerism sites.
- an asparagine (Asn) residue may be changed to Gln or Ala to reduce the potential for formation of isoaspartate at any Asn-Gly sequences, particularly within a CDR.
- a similar problem may occur at a Asp-Gly sequence. Reissner and Aswad (2003) Cell. Mol. Life Sci. 60:1281. Isoaspartate formation may debilitate or completely abrogate binding of an antibody to its target antigen. See, Presta (2005) J. Allergy Clin. Immunol. 116:731 at 734.
- the asparagine is changed to glutamine (Gln).
- any methionine residues may be changed to Lys, Leu, Ala, or Phe or other amino acids in order to reduce the possibility that the methionine sulfur would oxidize, which could reduce antigen-binding affinity and also contribute to molecular heterogeneity in the final antibody preparation. Id.
- Another type of framework modification involves mutating one or more residues within the framework regions to prevent aggregation.
- the risk of an antibody to aggregate can be assessed using the spatial aggregation propensity—See, Chennamsetty, N et al (2010) J. Phys. Chem. 114, 6614-6624.
- the method requires the calculation of the Solvent Accessible Area (SAA) for each atom.
- SAA Solvent Accessible Area
- the molecular aggregation score is then calculated as the sum of all atomic scores. For a given radius and size of molecule, this is an approximate indication of its overall tendency to aggregate. Residues with a high aggregation score are replaced by residues with a lower score (e.g. more hydrophilic amino acids).
- the antibodies (e.g., humanized antibodies) and antigen-binding fragments thereof disclosed herein can also be engineered to include modifications within the Fc region, typically to alter one or more properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding, and/or effector function (e.g., antigen-dependent cellular cytotoxicity).
- the antibodies and antigen-binding fragments thereof disclosed herein can be chemically modified (e.g., one or more chemical moieties can be attached to the antibody) or be modified to alter its glycosylation, again to alter one or more properties of the antibody or fragment.
- the numbering of residues in the Fc region is that of the EU index of Kabat.
- the antibodies and antigen-binding fragments thereof disclosed herein also include antibodies and fragments with modified (or blocked) Fc regions to provide altered effector functions. See, e.g., U.S. Pat. No. 5,624,821; WO2003/086310; WO2005/120571; WO2006/0057702. Such modifications can be used to enhance or suppress various reactions of the immune system, with possible beneficial effects in diagnosis and therapy. Alterations of the Fc region include amino acid changes (substitutions, deletions and insertions), glycosylation or deglycosylation, and adding multiple Fc regions. Changes to the Fc can also alter the half-life of antibodies in therapeutic antibodies, enabling less frequent dosing and thus increased convenience and decreased use of material. See Presta (2005) J. Allergy Clin. Immunol. 116:731 at 734-35.
- the antibody or antigen-binding fragment of the invention is an IgG4 isotype antibody or fragment comprising a Serine to Proline mutation at a position corresponding to position 228 (S228P; EU index; SEQ ID NO: 66) in the hinge region of the heavy chain constant region.
- S228P Serine to Proline mutation at a position corresponding to position 228
- EU index SEQ ID NO: 66
- This mutation has been reported to abolish the heterogeneity of inter-heavy chain disulfide bridges in the hinge region (Angal et al (1993). Mol. Immunol. 30:105-108; position 241 is based on the Kabat numbering system).
- the hinge region of CH1 is modified such that the number of cysteine residues in the hinge region is increased or decreased. This approach is described further in U.S. Pat. No. 5,677,425.
- the number of cysteine residues in the hinge region of CH1 is altered, for example, to facilitate assembly of the light and heavy chains or to increase or decrease the stability of the antibody.
- the Fc hinge region of an antibody or antigen-binding fragment of the invention is mutated to decrease the biological half-life of the antibody or fragment. More specifically, one or more amino acid mutations are introduced into the CH2-CH3 domain interface region of the Fc-hinge fragment such that the antibody or fragment has impaired Staphylococcyl protein A (SpA) binding relative to native Fc-hinge domain SpA binding.
- SpA Staphylococcyl protein A
- the antibody or antigen-binding fragment of the invention is modified to increase its biological half-life.
- Various approaches are possible. For example, one or more of the following mutations can be introduced: T252L, T254S, T256F, as described in U.S. Pat. No. 6,277,375.
- the antibody can be altered within the CH1 or CL region to contain a salvage receptor binding epitope taken from two loops of a CH2 domain of an Fc region of an IgG, as described in U.S. Pat. Nos. 5,869,046 and 6,121,022.
- the Fc region is altered by replacing at least one amino acid residue with a different amino acid residue to alter the effector function(s) of the antibody or antigen-binding fragment.
- one or more amino acids selected from amino acid residues 234, 235, 236, 237, 297, 318, 320 and 322 can be replaced with a different amino acid residue such that the antibody has an altered affinity for an effector ligand and retains the antigen-binding ability of the parent antibody.
- the effector ligand to which affinity is altered can be, for example, an Fc receptor or the C1 component of complement. This approach is described in further detail in U.S. Pat. Nos. 5,624,821 and 5,648,260.
- one or more amino acids selected from amino acid residues 329, 331 and 322 can be replaced with a different amino acid residue such that the antibody has altered C1q binding and/or reduced or abolished complement dependent cytotoxicity (CDC).
- CDC complement dependent cytotoxicity
- one or more amino acid residues within amino acid positions 231 and 239 are altered to thereby alter the ability of the antibody to fix complement. This approach is described further in PCT Publication WO 94/29351.
- the proteins of the invention which are preferably antibodies and most preferably IgG antibodies or fragments thereof, may have altered (e.g., relative to an unmodified antibody) Fc ⁇ R binding properties (examples of binding properties include but are not limited to, binding specificity, equilibrium dissociation constant (K D ), dissociation and association rates (k off and k on respectively), binding affinity and/or avidity) and that certain alterations are more or less desirable.
- binding properties include but are not limited to, binding specificity, equilibrium dissociation constant (K D ), dissociation and association rates (k off and k on respectively), binding affinity and/or avidity
- K D equilibrium dissociation constant
- K a is the reciprocal of K D .
- the affinities and binding properties of an Fc region for its ligand may be determined by a variety of in vitro assay methods (biochemical or immunological based assays) known in the art for determining Fc-Fc ⁇ R interactions, i.e., specific binding of an Fc region to an Fc ⁇ R including but not limited to, equilibrium methods (e.g., enzyme-linked immuno absorbent assay (ELISA) or radioimmunoassay (RIA)), or kinetics (e.g. BIACORE®, Octet®, or KinExa® analysis), and other methods such as indirect binding assays, competitive inhibition assays, fluorescence resonance energy transfer (FRET), gel electrophoresis and chromatography (e.g., gel filtration).
- ELISA enzyme-linked immuno absorbent assay
- RIA radioimmunoassay
- kinetics e.g. BIACORE®, Octet®, or KinExa® analysis
- indirect binding assays e.g
- the proteins of the present invention bind to one or more human Fc ⁇ Rs selected from the group consisting of Fc ⁇ RI, Fc ⁇ RIIB, Fc ⁇ RIIC, Fc ⁇ RIIIA-F158, and Fc ⁇ RIIIA-V158 with an affinity at least 10-fold, preferably at least 30-fold, and more preferably at least 100-fold, less than equivalent protein having a wild-type human IgG1 heavy chain constant domain (SEQ ID NO: 119) Fc region or a wild-type human IgG4 heavy chain constant domain (SEQ ID NO: 66) Fc region.
- the proteins of the invention comprise an immunoglobulin Fc region comprising an immunoglobulin C2 region and an immunoglobulin C3 region and an immunoglobulin hinge region.
- the immunoglobulin Fc region may be an IgG Fc region, an IgE Fc region, or an IgA Fc region.
- the protein comprises two immunoglobulin Fc regions, each immunoglobulin Fc region comprising an immunoglobulin C2 region and an immunoglobulin C3 region and an immunoglobulin hinge region, wherein the hinge region of one of the immunoglobulin Fc regions is bound to the hinge region of the other immunoglobulin Fc region to form a dimeric Fc structure.
- a protein is a human or humanized IgG protein.
- the proteins of the invention comprise a mutated IgG4 Fc region, and preferably the protein is an IgG comprising two mutated IgG4 Fc regions to form a dimeric Fc structure.
- a mutated IgG4 Fc region may comprise one of the mutations, or mutational combinations, recited in Table 3.
- the numbering system of the constant region referred to in this table is that of the EU index as set forth in Kabat et al. (1991, NIH Publication 91-3242, National Technical Information Service, Springfield, Va.).
- the first letter and number represent the unmodified amino acid and its position and the second letter represents the substituted amino acid at said position. For those entries that include combinations of more than one mutation, each mutation in the combination is separated by a “/”.
- the proteins of the invention comprise a mutated IgG1 Fc region, and preferably the protein is an IgG comprising two mutated IgG1 Fc regions to form a dimeric Fc structure.
- a mutated IgG1 Fc region may comprise one of the mutations recited in Table 4.
- the numbering system of the constant region referred to in this table is that of the EU index as set forth in Kabat et al. (1991, NIH Publication 91-3242, National Technical Information Service, Springfield, Va.).
- the first letter and number represent the unmodified amino acid and its position and the second letter represents the substituted amino acid at said position.
- a mutated IgG1 Fc region may comprise one of the mutational combinations recited in Table 5.
- the numbering system of the constant region referred to in this table is that of the EU index as set forth in Kabat et al. (1991, NIH Publication 91-3242, National Technical Information Service, Springfield, Va.).
- the first letter and number represent the unmodified amino acid and its position and the second letter represents the substituted amino acid at said position.
- each mutation in the combination is separated by a “I” and deletions are indicated by a
- the proteins of the invention comprise a wild type or mutated IgG2 Fc region, and preferably the protein is an IgG comprising two wild type or mutated IgG2 Fc regions to form a dimeric Fc structure.
- a mutated IgG2 Fc region may comprise one of the mutations, or mutational combinations, recited in Table 6.
- the numbering system of the constant region referred to in this table is that of the EU index as set forth in Kabat et al. (1991, NIH Publication 91-3242, National Technical Information Service, Springfield, Va.).
- the first letter and number represent the unmodified amino acid and its position and the second letter represents the substituted amino acid at said position. For those entries that include combinations of more than one mutation, each mutation in the combination is separated by a “I”.
- the antibodies or antigen-binding fragments of the invention comprise a particular glycosylation pattern.
- an afucosylated or an aglycosylated antibody or fragment can be made (i.e., the antibody lacks fucose or glycosylation, respectively).
- the glycosylation pattern of an antibody or fragment may be altered to, for example, increase the affinity or avidity of the antibody or fragment for a SIRP ⁇ antigen.
- modifications can be accomplished by, for example, altering one or more of the glycosylation sites within the antibody or fragment sequence.
- one or more amino acid substitutions can be made that result in removal of one or more of the variable region framework glycosylation sites to thereby eliminate glycosylation at that site.
- Such deglycosylation may increase the affinity or avidity of the antibody or fragment for antigen. See, e.g., U.S. Pat. Nos. 5,714,350 and 6,350,861.
- Antibodies and antigen-binding fragments disclosed herein may further include those produced in lower eukaryote host cells, in particular fungal host cells such as yeast and filamentous fungi have been genetically engineered to produce glycoproteins that have mammalian- or human-like glycosylation patterns (See for example, Choi et al, (2003) Proc. Natl. Acad. Sci. 100: 5022-5027; Hamilton et al., (2003) Science 301: 1244-1246; Hamilton et al., (2006) Science 313: 1441-1443; Nett et al., Yeast 28(3):237-52 (2011); Hamilton et al., Curr Opin Biotechnol. 18(5): 387-92 (2007)).
- fungal host cells such as yeast and filamentous fungi have been genetically engineered to produce glycoproteins that have mammalian- or human-like glycosylation patterns
- a particular advantage of these genetically modified host cells over currently used mammalian cell lines is the ability to control the glycosylation profile of glycoproteins that are produced in the cells such that compositions of glycoproteins can be produced wherein a particular N-glycan structure predominates (see, e.g., U.S. Pat. Nos. 7,029,872 and 7,449,308).
- These genetically modified host cells have been used to produce antibodies that have predominantly particular N-glycan structures (See for example, Li et al., (2006) Nat. Biotechnol. 24: 210-215).
- the antibodies and antigen-binding fragments thereof disclosed herein further include those produced in lower eukaryotic host cells and which comprise fucosylated and non-fucosylated hybrid and complex N-glycans, including bisected and multiantennary species, including but not limited to N-glycans such as GlcNAc (1-4 )Man 3 GlcNAc 2 ; Gal (1-4) GlcNAc (1-4) Man 3 GlcNAc 2 ; NANA (1-4) Gal (1-4) GlcNAc (1-4) Man 3 GlcNAc 2 .
- N-glycans such as GlcNAc (1-4 )Man 3 GlcNAc 2 ; Gal (1-4) GlcNAc (1-4) Man 3 GlcNAc 2 ; NANA (1-4) Gal (1-4) GlcNAc (1-4) Man 3 GlcNAc 2 .
- the antibodies and antigen-binding fragments thereof provided herein may comprise antibodies or fragments having at least one hybrid N-glycan selected from the group consisting of GlcNAcMan 5 GlcNAc 2 ; GalGlcNAcMan 5 GlcNAc 2 ; and NANAGalGlcNAcMan 5 GlcNAc 2 .
- the hybrid N-glycan is the predominant N-glycan species in the composition.
- the antibodies and antigen-binding fragments thereof provided herein comprise antibodies and fragments having at least one complex N-glycan selected from the group consisting of GlcNAcMan 3 GlcNAc 2 ; GalGlcNAcMan 3 GlcNAc 2 ; NANAGalGlcNAcMan 3 GlcNAc 2 ; GlcNAc 2 Man 3 GlcNAc 2 ; GalGlcNAc 2 Man 3 GlcNAc 2 ; Gal 2 GlcNAc 2 Man 3 GlcNAc 2 ; NANAGal 2 GlcNAc 2 Man 3 GlcNAc 2 ; and NANA 2 Gal 2 GlcNAc 2 Man 3 GlcNAc 2 .
- N-glycan selected from the group consisting of GlcNAcMan 3 GlcNAc 2 ; GalGlcNAcMan 3 GlcNAc 2 ; NANAGalGlcNAcMan 3 GlcNAc 2 ; and NANA 2 Gal 2 GlcNA
- the complex N-glycan are the predominant N-glycan species in the composition.
- the complex N-glycan is a particular N-glycan species that comprises about 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97%, 98%, 99%, or 100% of the complex N-glycans in the composition.
- the antibody and antigen binding fragments thereof provided herein comprise complex N-glycans, wherein at least 50%, 60%, 70%, 80%, 90%, 95%, 97%, 98%, 99%, or 100% of the complex N-glycans comprise the structure NANA 2 Gal 2 GlcNAc 2 Man 3 GlcNAc 2 , wherein such structure is afucosylated.
- Such structures can be produced, e.g., in engineered Pichia pastoris host cells.
- the N-glycan is fucosylated.
- the fucose is in an ⁇ 1,3-linkage with the GlcNAc at the reducing end of the N-glycan, an ⁇ 1,6-linkage with the GlcNAc at the reducing end of the N-glycan, an ⁇ 1,2-linkage with the Gal at the non-reducing end of the N-glycan, an ⁇ 1,3-linkage with the GlcNac at the non-reducing end of the N-glycan, or an ⁇ 1,4-linkage with a GlcNAc at the non-reducing end of the N-glycan.
- the glycoform is in an ⁇ 1,3-linkage or ⁇ 1,6-linkage fucose to produce a glycoform selected from the group consisting of Man 5 GlcNAc 2 (Fuc), GlcNAcMan 5 GlcNAc 2 (Fuc), Man 3 GlcNAc 2 (Fuc), GlcNAcMan 3 GlcNAc 2 (Fuc), GlcNAc 2 Man 3 GlcNAc 2 (Fuc), GalGlcNAc 2 Man 3 GlcNAc 2 (Fuc), Gal 2 GlcNAc 2 Man 3 GlcNAc 2 (Fuc), NANAGal 2 GlcNAc 2 Man 3 GlcNAc 2 (Fuc), and NANA 2 Gal 2 GlcNAc 2 Man 3 GlcNAc 2 (Fuc); in an ⁇ 1,3 -linkage or ⁇ 1,4 -linkage fucose to produce a glycoform selected from the group consisting of Man 5 GlcNAc 2 (
- the antibodies e.g., humanized antibodies
- antigen-binding fragments thereof comprise high mannose N-glycans, including but not limited to, Man 8 GlcNAc 2 , Man 7 GlcNAc 2 , Man 6 GlcNAc 2 , Man 5 GlcNAc 2 , Man 4 GlcNAc 2 , or N-glycans that consist of the Man 3 GlcNAc 2 N-glycan structure.
- the complex N-glycans further include fucosylated and non-fucosylated bisected and multiantennary species.
- N-glycan and “glycoform” are used interchangeably and refer to an N-linked oligosaccharide, for example, one that is attached by an asparagine-N-acetylglucosamine linkage to an asparagine residue of a polypeptide.
- N-linked glycoproteins contain an N-acetylglucosamine residue linked to the amide nitrogen of an asparagine residue in the protein.
- glycoproteins The predominant sugars found on glycoproteins are glucose, galactose, mannose, fucose, N-acetylgalactosamine (GalNAc), N-acetylglucosamine (GlcNAc) and sialic acid (e.g., N-acetyl-neuraminic acid (NANA)).
- GalNAc N-acetylgalactosamine
- GlcNAc N-acetylglucosamine
- sialic acid e.g., N-acetyl-neuraminic acid (NANA)
- N-glycans have a common pentasaccharide core of Man 3 GlcNAc 2 (“Man” refers to mannose; “Glc” refers to glucose; and “NAc” refers to N-acetyl; GlcNAc refers to N-acetylglucosamine).
- Man refers to mannose
- Glc refers to glucose
- NAc refers to N-acetyl
- GlcNAc refers to N-acetylglucosamine
- N-glycan structures are presented with the non-reducing end to the left and the reducing end to the right.
- the reducing end of the N-glycan is the end that is attached to the Asn residue comprising the glycosylation site on the protein.
- N-glycans differ with respect to the number of branches (antennae) comprising peripheral sugars (e.g., GlcNAc, galactose, fucose and sialic acid) that are added to the Man 3 GlcNAc 2 (“Man3”) core structure which is also referred to as the “trimannose core”, the “pentasaccharide core” or the “paucimannose core”.
- branches comprising peripheral sugars (e.g., GlcNAc, galactose, fucose and sialic acid) that are added to the Man 3 GlcNAc 2 (“Man3”) core structure which is also referred to as the “trimannose core”, the “pentasaccharide core” or the “paucimannose core”.
- Man3 Man 3 GlcNAc 2
- N-glycans are classified according to their branched constituents (e.g., high mannose, complex or hybrid).
- a “complex” type N-glycan typically has at least one GlcNAc attached to the 1,3 mannose arm and at least one GlcNAc attached to the 1,6 mannose arm of a “trimannose” core.
- Complex N-glycans may also have galactose (“Gal”) or N-acetylgalactosamine (“GalNAc”) residues that are optionally modified with sialic acid or derivatives (e.g., “NANA” or “NeuAc”, where “Neu” refers to neuraminic acid and “Ac” refers to acetyl).
- Complex N-glycans may also have intrachain substitutions comprising “bisecting” GlcNAc and core fucose (“Fuc”).
- Complex N-glycans may also have multiple antennae on the “trimannose core,” often referred to as “multiple antennary glycans.”
- a “hybrid” N-glycan has at least one GlcNAc on the terminal of the 1,3 mannose arm of the trimannose core and zero or more mannoses on the 1,6 mannose arm of the trimannose core.
- the various N-glycans are also referred to as “glycoforms.”
- G-2 refers to an N-glycan structure that can be characterized as Man 3 GlcNAc 2
- G-1 refers to an N-glycan structure that can be characterized as GlcNAcMan 3 GlcNAc 2
- GO refers to an N-glycan structure that can be characterized as GlcNAc 2 Man 3 GlcNAc 2
- G1 refers to an N-glycan structure that can be characterized as GalGlcNAc 2 Man 3 GlcNAc 2
- G2 refers to an N-glycan structure that can be characterized as Gal 2 GlcNAc 2 Man 3 GlcNAc 2
- A1 refers to an N-glycan structure that can be characterized as NANAGal 2
- the terms G-2′′, “G-1”, “GO”, “G1”, “G2”, “A1”, and “A2” refer to N-glycan species that lack fucose attached to the GlcNAc residue at the reducing end of the N-glycan.
- the term includes an “F”
- the “F” indicates that the N-glycan species contains a fucose residue on the GlcNAc residue at the reducing end of the N-glycan.
- G0F, G1F, G2F, A1F, and A2F all indicate that the N-glycan further includes a fucose residue attached to the GlcNAc residue at the reducing end of the N-glycan.
- Lower eukaryotes such as yeast and filamentous fungi do not normally produce N-glycans that produce fucose.
- multiantennary N-glycan refers to N-glycans that further comprise a GlcNAc residue on the mannose residue comprising the non-reducing end of the 1,6 arm or the 1,3 arm of the N-glycan or a GlcNAc residue on each of the mannose residues comprising the non-reducing end of the 1,6 arm and the 1,3 arm of the N-glycan.
- multiantennary N-glycans can be characterized by the formulas GlcNAc (2- 4)Man 3 GlcNAc 2 , Gal (1-4) GlcNAc (2-4) Man 3 GlcNAc 2 , or NANA (1-4) Gal (1-4) GlcNAc (2-4 )Man 3 GlcNAc 2 .
- the term “1-4” refers to 1, 2, 3, or 4 residues.
- bisected N-glycan refers to N-glycans in which a GlcNAc residue is linked to the mannose residue at the reducing end of the N-glycan.
- a bisected N-glycan can be characterized by the formula GlcNAc 3 Man 3 GlcNAc 2 wherein each mannose residue is linked at its non-reducing end to a GlcNAc residue.
- a multiantennary N-glycan is characterized as GlcNAc 3 Man 3 GlcNAc 2
- the formula indicates that two GlcNAc residues are linked to the mannose residue at the non-reducing end of one of the two arms of the N-glycans and one GlcNAc residue is linked to the mannose residue at the non-reducing end of the other arm of the N-glycan.
- the proteins of the invention comprise an aglycosylated Fc region.
- an IgG1 Fc region may be aglycosylayed by deleting or substituting residue N297.
- the antibodies and antigen-binding fragments thereof disclosed herein may further contain one or more glycosylation sites in either the light or heavy chain immunoglobulin variable region. Such glycosylation sites may result in increased immunogenicity of the antibody or fragment or an alteration of the pK of the antibody due to altered antigen-binding (Marshall et al. (1972) Annu Rev Biochem 41:673-702; Gala and Morrison (2004) J Immunol 172:5489-94; Wallick et al (1988) J Exp Med 168:1099-109; Spiro (2002) Glycobiology 12:43R-56R; Parekh et al (1985) Nature 316:452-7; Mimura et al. (2000) Mol Immunol 37:697-706). Glycosylation has been known to occur at motifs containing an N-X-S/T sequence.
- Each antibody or antigen-binding fragment will have a unique isoelectric point (pI), which generally falls in the pH range between 6 and 9.5.
- pI isoelectric point
- the pI for an IgG1 antibody typically falls within the pH range of 7-9.5 and the pI for an IgG4 antibody typically falls within the pH range of 6-8.
- each antibody or antigen-binding fragment will have a characteristic melting temperature, with a higher melting temperature indicating greater overall stability in vivo (Krishnamurthy R and Manning M C (2002) Curr Pharm Biotechnol 3:361-71).
- the T M1 (the temperature of initial unfolding) may be greater than 60° C., greater than 65° C., or greater than 70° C.
- the melting point of an antibody or fragment can be measured using differential scanning calorimetry (Chen et al (2003) Pharm Res 20:1952-60; Ghirlando et al (1999) Immunol Lett 68:47-52) or circular dichroism (Murray et al. (2002) J. Chromatogr Sci 40:343-9).
- antibodies and antigen-binding fragments thereof are selected that do not degrade rapidly.
- Degradation of an antibody or fragment can be measured using capillary electrophoresis (CE) and MALDI-MS (Alexander A J and Hughes D E (1995) Anal Chem 67:3626-32).
- antibodies and antigen-binding fragments thereof are selected that have minimal aggregation effects, which can lead to the triggering of an unwanted immune response and/or altered or unfavorable pharmacokinetic properties.
- antibodies and fragments are acceptable with aggregation of 25% or less, 20% or less, 15% or less, 10% or less, or 5% or less.
- Aggregation can be measured by several techniques, including size-exclusion column (SEC), high performance liquid chromatography (HPLC), and light scattering.
- the anti-SIRP ⁇ antibodies and antigen-binding fragments thereof disclosed herein may also be conjugated to a chemical moiety.
- the chemical moiety may be, inter alia, a polymer, a radionucleotide or a cytotoxic factor.
- the chemical moiety is a polymer which increases the half-life of the antibody or fragment in the body of a subject.
- Suitable polymers include, but are not limited to, hydrophilic polymers which include but are not limited to polyethylene glycol (PEG) (e.g., PEG with a molecular weight of 2 kDa, 5 kDa, 10 kDa, 12 kDa, 20 kDa, 30 kDa or 40 kDa), dextran and monomethoxypolyethylene glycol (mPEG).
- PEG polyethylene glycol
- mPEG monomethoxypolyethylene glycol
- the antibodies and antigen-binding fragments thereof disclosed herein may also be conjugated with labels such as 99 Tc, 90 Y, 111 In, 32 P, 14 C, 125 I, 3 H, 131 I, 11 C, 15 O, 13 N, 18 F, 35 S, 51 Cr, 57 To, 226 Ra, 60 Co, 59 Fe, 57 Se, 152 Eu, 67 CU, 217 Ci, 211 At, 212 Pb, 47 Sc, 109 Pd, 234 Th, and 40 K, 157 Gd, 55 Mn, 52 Tr, and 56 Fe.
- labels such as 99 Tc, 90 Y, 111 In, 32 P, 14 C, 125 I, 3 H, 131 I, 11 C, 15 O, 13 N, 18 F, 35 S, 51 Cr, 57 To, 226 Ra, 60 Co, 59 Fe, 57 Se, 152 Eu, 67 CU, 217 Ci, 211 At, 212 Pb, 47 Sc, 109 Pd, 234 Th, and 40 K, 157
- the antibodies and antigen-binding fragments disclosed herein may also be PEGylated, for example to increase its biological (e.g., serum) half-life.
- PEG polyethylene glycol
- the antibody or fragment typically is reacted with a reactive form of polyethylene glycol (PEG), such as a reactive ester or aldehyde derivative of PEG, under conditions in which one or more PEG groups become attached to the antibody or antibody fragment.
- PEG polyethylene glycol
- the PEGylation is carried out via an acylation reaction or an alkylation reaction with a reactive PEG molecule (or an analogous reactive water-soluble polymer).
- polyethylene glycol is intended to encompass any of the forms of PEG that have been used to derivatize other proteins, such as mono (C1-C10) alkoxy- or aryloxy-polyethylene glycol or polyethylene glycol-maleimide.
- the antibody or fragment to be PEGylated is an aglycosylated antibody or fragment. Methods for PEGylating proteins are known in the art and can be applied to the antibodies of the invention. See, e.g., EP 0 154 316 and EP 0 401 384.
- the antibodies and antigen-binding fragments disclosed herein may also be conjugated with fluorescent or chemilluminescent labels, including fluorophores such as rare earth chelates, fluorescein and its derivatives, rhodamine and its derivatives, isothiocyanate, phycoerythrin, phycocyanin, allophycocyanin, o-phthaladehyde, fluorescamine, 152 Eu, dansyl, umbelliferone, luciferin, luminal label, isoluminal label, an aromatic acridinium ester label, an imidazole label, an acridimium salt label, an oxalate ester label, an aequorin label, 2,3-dihydrophthalazinediones, biotin/avidin, spin labels and stable free radicals.
- fluorophores such as rare earth chelates, fluorescein and its derivatives, rhodamine and its derivatives, isothiocyanate,
- the antibodies and antigen-binding fragments thereof of the invention may also be conjugated to a cytotoxic factor such as diptheria toxin, Pseudomonas aeruginosa exotoxin A chain, ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins and compounds (e.g., fatty acids), dianthin proteins, Phytoiacca americana proteins PAPI, PAPII, and PAP-S, Momordica charantia inhibitor, curcin, crotin, Saponaria officinalis inhibitor, mitogellin, restrictocin, phenomycin, and enomycin.
- a cytotoxic factor such as diptheria toxin, Pseudomonas aeruginosa exotoxin A chain, ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins and compounds (
- any method known in the art for conjugating the antibodies and antigen-binding fragments thereof of the invention to the various moieties may be employed, including those methods described by Hunter, et al., (1962) Nature 144:945; David, et al., (1974) Biochemistry 13:1014; Pain, et al., (1981) J. Immunol. Meth. 40:219; and Nygren, J., (1982) Histochem. and Cytochem. 30:407. Methods for conjugating antibodies and fragments are conventional and very well known in the art.
- the cancer is, e.g., osteosarcoma, rhabdomyosarcoma, neuroblastoma, kidney cancer, leukemia, renal transitional cell cancer, bladder cancer, Wilm's cancer, ovarian cancer, pancreatic cancer, breast cancer, prostate cancer, bone cancer, lung cancer (e.g., non-small cell lung cancer), gastric cancer, colorectal cancer, cervical cancer, synovial sarcoma, head and neck cancer, squamous cell carcinoma, multiple myeloma, renal cell cancer, retinoblastoma, hepatoblastoma, hepatocellular carcinoma, melanoma, rhabdoid tumor of the kidney, Ewing's sarcoma, chondrosarcoma, brain cancer, glioblastoma, meningioma, pituitary adenoma, vestibular schwannoma, a primitive neuroec
- Cancers that may be treated by the antibodies or antigen-binding fragments, compositions and methods of the invention include, but are not limited to: Cardiac: sarcoma (angiosarcoma, fibrosarcoma, rhabdomyosarcoma, liposarcoma), myxoma, rhabdomyoma, fibroma, lipoma and teratoma; Lung: bronchogenic carcinoma (squamous cell, undifferentiated small cell, undifferentiated large cell, adenocarcinoma), alveolar (bronchiolar) carcinoma, bronchial adenoma, sarcoma, lymphoma, chondromatous hamartoma, mesothelioma; Gastrointestinal: esophagus (squamous cell carcinoma, adenocarcinoma, leiomyosarcoma, lymphoma), stomach (carcinoma, lymphoma, leiomyos
- cancers that may be treated by the antibodies or antigen-binding fragments thereof disclosed herein, compositions and methods of the invention include, but are not limited to: breast cancer, gastric cancer, esophageal cancer, gastroesophageal junction carcinoma, colorectal cancer, head and neck cancer, non-small cell lung cancer, osteosarcoma, neuroblastoma, bladder cancer, cervical cancer, endometrial cancer, ovarian cancer, lung cancer, squamous cell carcinoma, melanoma, pancreatic cancer, prostate cancer, small cell lung cancer, kidney cancer, renal cell carcinoma, thyroid cancer, glioblastoma multiforme, fallopian tube cancer, peritoneal cancer, angiosarcoma, hepatocellular carcinoma, choriocarcinoma, soft tissue sarcoma, chronic lymphocytic leukemia, chronic myelocytic leukemia, non-Hodgkin's lymphoma, B-cell non-hodgkin's lymphoma
- the antibodies or antigen-binding fragments thereof disclosed herein may be used for the treatment of infections and infectious diseases.
- infection refers to any state in at least one cell of an organism (i.e., a subject) is infected by an infectious agent (e.g., a subject has an intracellular pathogen infection, e.g., a chronic intracellular pathogen infection).
- infectious agent refers to a foreign biological entity (i.e. a pathogen) that induces CD47 expression (e.g., increased CD47 expression) in at least one cell of the infected organism.
- infectious agents include, but are not limited to bacteria, viruses, protozoans, and fungi.
- Intracellular pathogens are of particular interest. Infectious diseases are disorders caused by infectious agents. Some infectious agents cause no recognizable symptoms or disease under certain conditions, but have the potential to cause symptoms or disease under changed conditions.
- the subject methods can be used in the treatment of chronic pathogen infections, for example including but not limited to viral infections, e.g. retrovirus, lentivirus, hepadna virus, herpes viruses, pox viruses, human papilloma viruses, etc.; intracellular bacterial infections, e.g.
- Mycobacterium Chlamydophila, Ehrlichia, Rickettsia, Brucella, Legionella, Francisella, Listeria, Coxiella, Neisseria, Salmonella, Yersinia sp, Helicobacter pylori etc.; and intracellular protozoan pathogens, e.g. Plasmodium sp, Trypanosoma sp., Giardia sp., Toxoplasma sp., Leishmania sp., etc.
- the invention provides methods for treating subjects using an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention, wherein the subject suffers from a viral infection.
- the viral infection is an infection with a virus selected from the group consisting of human immunodeficiency virus (HIV), hepatitis virus (A, B, or C), herpes virus (e.g., VZV, HSV-I, HAV-6, HSV-II, and CMV, Epstein Barr virus), adenovirus, influenza virus, flaviviruses, echovirus, rhinovirus, coxsackie virus, coronavirus, respiratory syncytial virus, mumps virus, rotavirus, measles virus, rubella virus, parvovirus, vaccinia virus, HTLV virus, dengue virus, papillomavirus, molluscum virus, poliovirus, rabies virus, JC virus or arboviral encephalitis virus.
- HCV human immunodeficiency virus
- the invention provides methods for treating subjects using an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention, wherein the subject suffers from a bacterial infection.
- the bacterial infection is infection with a bacteria selected from the group consisting of Chlamydia , rickettsial bacteria, mycobacteria, staphylococci, streptococci, pneumonococci, meningococci and gonococci, klebsiella, proteus, serratia, pseudomonas, Legionella, Corynebacterium diphtheriae, Salmonella , bacilli, Vibrio cholerae, Clostridium tetan, Clostridium botulinum, Bacillus anthricis, Yersinia pestis, Mycobacterium leprae, Mycobacterium lepromatosis , and Borriella.
- the invention provides methods for treating subjects using an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention, wherein the subject suffers from a fungal infection.
- the fungal infection is an infection with a fungus selected from the group consisting of Candida ( albicans, krusei, glabrata, tropicalis , etc.), Cryptococcus neoformans, Aspergillus ( fumigatus, niger , etc.), Genus Mucorales ( mucor, absidia, rhizopus ), Sporothrix schenkii, Blastomyces dermatitidis, Paracoccidioides brasiliensis, Coccidioides immitis and Histoplasma capsulatum.
- Candida albicans, krusei, glabrata, tropicalis , etc.
- Cryptococcus neoformans Aspergillus ( fumigatus, niger , etc.)
- Genus Mucorales mucor, ab
- the invention provides methods for treating subjects using an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention, wherein the subject suffers from a parasitic infection.
- the parasitic infection is infection with a parasite selected from the group consisting of Entamoeba histolytica, Balantidium coli, Naegleria fowleri, Acanthamoeba, Giardia lambia, Cryptosporidium, Pneumocystis carinii, Plasmodium vivax, Babesia microti, Trypanosoma brucei, Trypanosoma cruzi, Leishmania donovani, Toxoplasma gondii and Nippostrongylus brasiliensis.
- a “subject” may be a mammal such as a human, dog, cat, horse, cow, mouse, rat, monkey (e.g., cynomolgous monkey, e.g., Macaca fascicularis ) or rabbit.
- the subject is a human subject.
- an anti-SIRP ⁇ antibody e.g., humanized antibody
- an anti-cancer agent can be formulated into a single composition for simultaneous delivery or formulated separately into two or more compositions (e.g., a kit).
- Each component can be administered to a subject at a different time than when the other component is administered; for example, each administration may be given non-simultaneously (e.g., separately or sequentially) at several intervals over a given period of time.
- the separate components may be administered to a subject by the same or by a different route.
- the antibodies or antigen-binding fragments thereof disclosed herein may be used alone, or in association with other, further therapeutic agents and/or therapeutic procedures, for treating or preventing any disease such as cancer, e.g., as discussed herein, in a subject in need of such treatment or prevention.
- Compositions e.g., pharmaceutical compositions comprising a pharmaceutically acceptable carrier, comprising such antibodies and fragments in association with further therapeutic agents are also part of the present invention.
- the present invention provides a method of treating cancer in a human subject, comprising administering to the subject an effective amount of the antibody or antigen binding fragment disclosed herein, optionally in association with a further therapeutic agent or therapeutic procedure.
- the present invention also provides a method of treating an infection or infectious disease in a human subject, comprising administering to the subject an effective amount of the antibody or antigen binding fragment disclosed herein, optionally in association with a further therapeutic agent or therapeutic procedure.
- the present invention also provides a method of increasing the activity of an immune cell, comprising administering to a subject in need thereof an effective amount of an antibody or antigen binding fragment disclosed herein.
- the method is used for: the treatment of cancer; the treatment of an infection or infectious disease; or as a vaccine adjuvant.
- the antibodies or antigen-binding fragments thereof disclosed herein may be used alone, or in association with tumor vaccines.
- tumor vaccines include but are not limited to vaccines for Human Papillomavirus (HPV) infection caused cancer such as Gardasil®, Gardisil9® and Cervarix®; vaccines that prevent hepatitis B virus caused liver cancer such as Engerix-B® and Recombivax HB®; oncolytic virus therapy that triggers immune response such as Imlygic®; DNA vaccines such as Synchotrope MA2M plasmid DNA vaccine and ZYC101; mammaglobin-a DNA vaccine (see Clinical Cancer Res.
- HPV Human Papillomavirus
- vector based vaccines such as PSA-TRICOM (prostvac), PANVAC-VF, Listeria monocytogenes -based vaccines (see, e.g., Therapeutic Advances in Vaccines, 2014, 2(5) 137-148), Listeria -based vaccines ( Listeria expressing one or more cancer vaccines such as Listeria -mesothelin (e.g., CRS-207), ADXS-HPV, Axalimogene Filolisbac, Listeria -HER2/Neu, Listeria -EGFRvIII), Adeno-CEA; allogeneic vaccines such as GVAX, BLP-25 (anti-Ankara-mucin 1), Belagenpumatucel-L, TG4010, CIMAvax epidermal growth factor vaccine, NY-ESO, GM.CD40L-CCL21; autologous vaccines such as:Adeno-CD40L, BCG, INGN-225, Dendritic cell
- Eat-me signals could be elevated by cytotoxic therapies like radiotherapy or chemotherapeutic agents including, but not limited to anthracyclines (doxorubicin, epirubicin, daunorubicin, idarubicin, mitoxantrone), oxaliplatin, bortezomib, cyclophosphamide, bleomycin, vorinostat, paclitaxel, 5-fluorouracil, cytarabine, prednisolone, docetaxel, mitomycin C, topotecan/camptothecin, etoposide, zoledronic acid, methotrexate, ibrutinib, aflibercept, bevacizumab, toremifene, vinblastine, vincristine, idelalisib, mercaptopurine, thalidomide, sorafenib.
- anthracyclines doxorubicin, epirubicin
- the antibodies or antigen-binding fragments thereof disclosed herein may be used in association with chemotherapeutic agents, in association with radiation therapy, etc.
- the antibodies or antigen-binding fragments thereof disclosed herein may be used alone, or in association with targeted therapies.
- targeted therapies include: hormone therapies, signal transduction inhibitors (e.g., EGFR inhibitors, such as cetuximab (Erbitux) and erlotinib (Tarceva)); CD20 inhibitors (e.g., rituximab (Rituxan) and ofatumumab (Arzerra)); CD38 inhibitors (e.g., daratumumab (DARZALEX)); CD52 inhibitors (e.g., alemtuzumab (Campath)); HER2 inhibitors (e.g., trastuzumab (Herceptin) and pertuzumab (Perjeta)); BCR-ABL inhibitors (such as imatinib (Gleevec) and dasatinib (Sprycel)); ALK inhibitors (such as crizotinib (Xalkori) and ceritinib (Zykadia)); BRAF inhibitors (such as vemurafenib (Zel)
- the antibodies or antigen-binding fragments thereof disclosed herein may preferably find use in association with targeted therapies in which antibodies are employed to mediate ADCC/ADCP.
- Functional bioassays are available to analyze the mode of action of an antibody drug and to distinguish ADCP as a mode of action from ADCC.
- an antibody-dependent cell-mediated cytotoxicity (ADCC) assay typically utilizes normal human peripheral blood mononuclear cells (PBMCs) or effector cells isolated thereof.
- Assay variation can be reduced by using selective donor pools with defined Fc ⁇ receptor Ha (Fc ⁇ RIIa/CD32a), IIIa (Fc ⁇ RIIIa/CD16a) or IIIb (Fc ⁇ RIIIb/CD16b) gene copy number variation (CNV) or genotypes such as Fc ⁇ RIIIa-158 V/V versus V/F or F/F, Fc ⁇ RIIIa-131 H/H versus H/R or R/R, and the Fc ⁇ RIIIb-NA1 and -NA2 polymorphic variants.
- Fc ⁇ receptor Ha Fc ⁇ RIIa/CD32a
- IIIa Fc ⁇ RIIIa/CD16a
- IIIb Fec ⁇ RIIIb/CD16b gene copy number variation
- CNV gene copy number variation
- genotypes such as Fc ⁇ RIIIa-158 V/V versus V/F or F/F, Fc ⁇ RIIIa-131 H/H versus H/R or R/R, and the Fc ⁇ RIIIb-NA1
- effector cells such as PBMCs, PBMC-derived natural killer (NK) cells, granulocytes, monocytes, monocyte-derived macrophages, or dendritic cells (DCs) can be replaced with a Fc ⁇ RIIIa-expressing cell line (for example, engineered NK92).
- PBMCs PBMC-derived natural killer (NK) cells
- NK PBMC-derived natural killer
- DCs dendritic cells
- Killing of the target cells can be assessed by measuring the release of specific probes from pre-labelled target cells, using 51 chromium (Cr 51 ) or fluorescent dyes such as calcein-acetoxymethyl (calcein-AM), carboxyfluorescein succinimidyl ester (CFSE), 2′,7′-bis-(2-carboxyethyl)-5-(and-6)-carboxyfluorescein (BCECF), europium (Eu) or propidium iodide (PI), or by measuring the release of cytosolic enzymes such as lactate dehydrogenase (LDH) or the release of nucleoside triphosphate (ATP).
- Cr 51 51 chromium
- fluorescent dyes such as calcein-acetoxymethyl (calcein-AM), carboxyfluorescein succinimidyl ester (CFSE), 2′,7′-bis-(2-carboxyethyl)-5-(and-6)-carboxyfluorescein (BCECF), euro
- ADCP antibody-dependent cellular phagocytosis
- PBMC-derived cells or myeloid cell lines such as HL-60, THP-1, and U937 cells differentiated into macrophages or granulocytes.
- Stimuli that are commonly used to induce macrophage differentiation in monocytic cell lines include phorbol-12-myristate-13-acetate (PMA), 1,25-dihydroxyvitamin D3 (VD3), and retinoic acid (RA).
- PMA phorbol-12-myristate-13-acetate
- VD3 1,25-dihydroxyvitamin D3
- RA retinoic acid
- RA is also known to induce terminal granulocytic differentiation of for example HL-60 cells.
- Phagocytosis of the target cells can be assessed by monitoring effector cells for the internalization of specific probes from target cells pre-labelled with fluorescent dyes such as cell proliferation dye eFluor450, CFSE, and pH-sensitive dyes including pHrodo and CypHer5E. Phagocytosis is measured by an increase in fluorescently labelled effector cells using flow cytometry or fluorescence microscopy. “Reporter gene” assays are also available to assess ADCP. In order to measure ADCP function in a reporter gene assay, target cells are first incubated with a titration of an antibody of interest. Once the antibody is bound to its cognate target on the target cell surface, engineered Jurkat effector cells are added.
- fluorescent dyes such as cell proliferation dye eFluor450, CFSE, and pH-sensitive dyes including pHrodo and CypHer5E.
- the Jurkat cells produce a luciferase product by expression of the reporter gene NFAT-RE-luc2. Luciferase activity is then measured following a 4-24 hour induction period, after addition of the luciferase assay reagent.
- the dose-dependent response in the microtiter plate-based assay can be used to quantify the relative biological activity of the therapeutic antibody compared to the dose-response curve of a suitable reference item.
- the anti-SIRP ⁇ antibodies or antigen-binding fragments thereof of the invention may be used in combination with an anti-cancer therapeutic agent or immunomodulatory drug such as an immunomodulatory receptor inhibitor, e.g., an antibody or antigen-binding fragment thereof that specifically binds to the receptor.
- an anti-cancer therapeutic agent or immunomodulatory drug such as an immunomodulatory receptor inhibitor, e.g., an antibody or antigen-binding fragment thereof that specifically binds to the receptor.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with one or more of:
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with one or more cyclic dinculeotides or other STING pathway agonists.
- STING (stimulator of interferon genes, also known as TMEM173, MITA, ERIS, and MPYS) is a transmembrane protein localized to the ER that undergoes a conformational change in response to direct binding of cyclic dinucleotides (CDNs), resulting in a downstream signaling cascade involving TBK1 activation, IRF-3 phosphorylation, and production of IFN- ⁇ and other cytokines.
- CDNs cyclic dinucleotides
- the STING pathway in tumor-resident host antigen presenting c3ellss is involved in the induction of a spontaneous CD8+ T cell response against tumor-derived antigens. Activation of this pathway and the subsequent production of IFN- ⁇ also reportedly contributes to the anti-tumor effect of radiation.
- STING agonists and their uses are described in, for example, US20060040887, US20080286296, US20120041057, US20140205653, WO2014179335, WO 2014179760, US20150056224, WO 2015185565, WO 2016096174, WO 2016145102, WO 2017011444, WO 2017027645, WO 2017027646, WO 2017123657, WO 2017123669, WO 2017175147, WO 2017175156, WO 2018045204, WO 2018009648, WO 2018006652, WO 2018013887, WO 2018013908, US20180002369, US20180092937, and US20180093964.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with one or more of: anti-CD47 antibody, anti-PD-1 antibody (e.g., nivolumab, pembrolizumab, anti-PDL1 antibody, anti-TIGIT antibody, anti-APRIL antibody, anti-CTLA4 antibody, anti-CS1 antibody (e.g., elotuzumab), anti-KIR2DL1/2/3 antibody (e.g., lirilumab), anti-CD137 antibody (e.g., urelumab), anti-GITR antibody (e.g., TRX518), anti-PD-L1 antibody (e.g., BMS-936559, MSB0010718C or MPDL3280A), anti-PD-L2 antibody, anti-ILT1 antibody, anti-ILT2 antibody, anti-ILT3 antibody, anti-ILT4 antibody, anti-ILT5 antibody, anti-ILT6 antibody, anti-
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-CD20 antibody (e.g., rituximab, ofatumumab, ocrelizumab, obinutuzumab, ocaratuzumab, ublituximab, veltuzumab, ibritumomab tiuxetan, tositumomab, BVX-20, SCT-400 or PRO131921).
- an anti-CD20 antibody e.g., rituximab, ofatumumab, ocrelizumab, obinutuzumab, ocaratuzumab, ublituximab, veltuzumab, ibritumomab tiuxetan, tositumomab, BVX-20, SCT-400 or PRO13192.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-CD38 antibody (e.g., daratumumab, isatuximab or MOR202).
- an anti-CD38 antibody e.g., daratumumab, isatuximab or MOR202.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-EGFR antibody (e.g., cetuximab, CetuGEX, panitumumab, nimotuzumab, depatuxizumab or AFM-21).
- an anti-EGFR antibody e.g., cetuximab, CetuGEX, panitumumab, nimotuzumab, depatuxizumab or AFM-21.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-HER2 antibody (e.g., trastuzumab, TrasGEX, pertuzumab, margetuximab or ADCT-502).
- an anti-HER2 antibody e.g., trastuzumab, TrasGEX, pertuzumab, margetuximab or ADCT-502).
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-HER3 antibody (e.g., lumretuzumab, patritumab or LJM716).
- an anti-HER3 antibody e.g., lumretuzumab, patritumab or LJM716
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-CD19 antibody (e.g., inebilizumab, blinatumomab, DI-B4, MDX-1342, MEDI-551, MOR208 or 4-G7SDIE).
- an anti-CD19 antibody e.g., inebilizumab, blinatumomab, DI-B4, MDX-1342, MEDI-551, MOR208 or 4-G7SDIE.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-CD52 antibody (e.g., alemtuzumab).
- an anti-CD52 antibody e.g., alemtuzumab
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-EpCAM antibody (e.g., adecatumumab, catumaxomab, edrecolomab or ING-1).
- an anti-EpCAM antibody e.g., adecatumumab, catumaxomab, edrecolomab or ING-1).
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-SLAMF7 antibody (e.g., elotuzumab or ABBV-838).
- an anti-SLAMF7 antibody e.g., elotuzumab or ABBV-838.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-PD-1 antibody (e.g., nivolumab or pembrolizumab).
- an anti-PD-1 antibody e.g., nivolumab or pembrolizumab.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-PD-L1 antibody (e.g., BMS-936559, MSB0010718C or MPDL3280A).
- an anti-PD-L1 antibody e.g., BMS-936559, MSB0010718C or MPDL3280A.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-CTLA4 antibody (e.g., ipilimumab or tremelimumab).
- an anti-CTLA4 antibody e.g., ipilimumab or tremelimumab.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-CD137 antibody (e.g., urelumab).
- an anti-CD137 antibody e.g., urelumab
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-GITR antibody (e.g., TRX518 or FPA154).
- an anti-GITR antibody e.g., TRX518 or FPA154.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-OX40 antibody (e.g., MEDI6469, MOXR0916 or INCAGN1949).
- an anti-OX40 antibody e.g., MEDI6469, MOXR0916 or INCAGN1949.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-CD40 antibody (e.g., lucatumumab, dacetuzmumab, APX005M, ChiLob7/4, CP-870,893 or JNJ-64457107)
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-CS1 antibody.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-KIR2DL1/2/3 antibody.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-CD137 (e.g., urelumab) antibody.
- an anti-CD137 e.g., urelumab
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-GITR (e.g., TRX518) antibody.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-PD-L2 antibody.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-ITL1 antibody.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-ITL2 antibody.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-ITL3 antibody.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-ITL4 antibody.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-ITL5 antibody.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-ITL6 antibody.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-ITL7 antibody.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-ITL8 antibody.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-CD40 antibody.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-OX40 antibody.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-KIR2DL1 antibody.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-KIR2DL2/3 antibody.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-KIR2DL4 antibody.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-KIR2DL5A antibody.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-KIR2DL5B antibody.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-KIR3DL1 antibody.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-KIR3DL2 antibody.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-KIR3DL3 antibody.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-NKG2A antibody.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-NKG2C antibody.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-ICOS antibody.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-4-1BB antibody.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-IL-10 antibody.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with an anti-TSLP antibody.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with IL-10 or PEGylated IL-10.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with one or more of an inhibitor (e.g., a small organic molecule or an antibody or antigen-binding fragment thereof) such as: an MTOR (mammalian target of rapamycin) inhibitor, a cytotoxic agent, a platinum agent, an EGFR inhibitor, a VEGF inhibitor, a microtubule stabilizer, a taxane, a CD20 inhibitor, a CD52 inhibitor, a CD30 inhibitor, a RANK (Receptor activator of nuclear factor kappa-B) inhibitor, a RANKL (Receptor activator of nuclear factor kappa-B ligand) inhibitor, an ERK inhibitor, a MAP Kinase inhibitor, an AKT inhibitor, a MEK inhibitor, a PI3K inhibitor, a HER1 inhibitor, a HER2 inhibitor, a HER3 inhibitor, a HER4 inhibitor, a B
- an inhibitor e
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with any one or more of: 13-cis-retinoic acid, 3-[5-(methylsulfonylpiperadinemethyl)-indolyl]-quinolone, 4-hydroxytamoxifen, 5-deooxyuridine, 5′-deoxy-5-fluorouridine, 5-fluorouracil, 6-mecaptopurine, 7-hydroxystaurosporine, A-443654, abirateroneacetate, abraxane, ABT-578, acolbifene, ADS-100380, ALT-110, altretamine, amifostine, aminoglutethimide, amrubicin, Amsacrine, anagrelide, anastrozole, angiostatin, AP-23573, ARQ-197, arzoxifene, AS-252424, AS-605240, asparaginase, AT-9263, atrasent
- Non-limiting examples of suitable anti-cancer agents to be used in combination with an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention include cytostatic agents, immune modulating imide drugs, cytotoxic agents, targeted therapeutic agents (small molecules, biologics, siRNA and microRNA) against cancer and neoplastic diseases,
- Estrogen receptor modulators refers to compounds that interfere with or inhibit the binding of estrogen to the receptor, regardless of mechanism.
- Examples of estrogen receptor modulators include, but are not limited to, tamoxifen, raloxifene, idoxifene, LY353381, LY117081, toremifene, fulvestrant, 4-[7-(2,2-dimethyl-1-oxopropoxy-4-methyl-2-[4-[2-(1-piperidinyl)ethoxy]phenyl]-2H-1-benzopyran-3-yl]-phenyl-2,2-dimethylpropanoate, 4,4′-dihydroxybenzophenone-2,4-dinitrophenyl-hydrazone, and SH646.
- Androgen receptor modulators refers to compounds which interfere or inhibit the binding of androgens to the receptor, regardless of mechanism.
- Examples of androgen receptor modulators include finasteride and other 5 ⁇ -reductase inhibitors, nilutamide, flutamide, bicalutamide, liarozole, and abiraterone acetate.
- Retinoid receptor modulators refers to compounds which interfere or inhibit the binding of retinoids to the receptor, regardless of mechanism. Examples of such retinoid receptor modulators include bexarotene, tretinoin, 13-cis-retinoic acid, 9-cis-retinoic acid, ⁇ -difluoromethylornithine, ILX23-7553, trans-N-(4′-hydroxyphenyl) retinamide, and N-4-carboxyphenyl retinamide.
- Cytotoxic/cytostatic agents refer to compounds which cause cell death or inhibit cell proliferation primarily by interfering directly with the cell's functioning or inhibit or interfere with cell myosis, including alkylating agents, tumor necrosis factors, intercalators, hypoxia activatable compounds, microtubule inhibitors/microtubule-stabilizing agents, inhibitors of mitotic kinesins, histone deacetylase inhibitors, inhibitors of kinases involved in mitotic progression, inhibitors of kinases involved in growth factor and cytokine signal transduction pathways, antimetabolites, biological response modifiers, hormonal/anti-hormonal therapeutic agents, haematopoietic growth factors, monoclonal antibody targeted therapeutic agents, topoisomerase inhibitors, proteosome inhibitors, ubiquitin ligase inhibitors, and aurora kinase inhibitors.
- cytotoxic/cytostatic agents include, but are not limited to, platinum coordinator compounds, sertenef, cachectin, ifosfamide, tasonermin, lonidamine, carboplatin, altretamine, prednimustine, dibromodulcitol, ranimustine, fotemustine, nedaplatin, oxaliplatin, temozolomide, heptaplatin, estramustine, improsulfan tosilate, trofosfamide, nimustine, dibrospidium chloride, pumitepa, lobaplatin, satraplatin, profiromycin, cisplatin, irofulven, dexifosfamide, cis-aminedichloro(2-methyl-pyridine)platinum, benzylguanine, glufosfamide, GPX100, (trans, trans, trans)-bis-mu-(hexane-1,6
- hypoxia activatable compound is tirapazamine.
- proteosome inhibitors include but are not limited to lactacystin and MLN-341 (Velcade).
- microtubule inhibitors/microtubule-stabilising agents include taxanes in general. Specific compounds include paclitaxel (Taxol®), vindesine sulfate, 3′,4′-didehydro-4′-deoxy-8′-norvincaleukoblastine, docetaxol (Taxotere®), rhizoxin, dolastatin, mivobulin isethionate, auristatin, cemadotin, RPR109881, BMS184476, vinflunine, cryptophycin, 2,3,4,5,6-pentafluoro-N-(3-fluoro-4-methoxyphenyl) benzene sulfonamide, anhydrovinblastine, N,N-dimethyl-L-valyl-L-valyl-N-methyl-L-valyl-L-prolyl-L-proline-t-butylamide, TDX258, the epothilones
- topoisomerase inhibitors are topotecan, hycaptamine, irinotecan, rubitecan, 6-ethoxypropionyl-3′,4′-O-exo-benzylidene-chartreusin, 9-methoxy-N,N-dimethyl-5-nitropyrazolo[3,4,5-kl]acridine-2-(6H) propanamine, 1-amino-9-ethyl-5-fluoro-2,3-dihydro-9-hydroxy-4-methyl-1H,12H-benzo[de]pyrano[3′,4′:b,7]-indolizino[1,2b]quinoline-10,13(9H,15H)dione, lurtotecan, 7-[2-(N-isopropylamino)ethyl]-(20S)camptothecin, BNP1350, BNPI1100, BN80915, BN80942, etoposide phosphate, BNP
- inhibitors of mitotic kinesins include, but are not limited to inhibitors of KSP, inhibitors of MKLP1, inhibitors of CENP-E, inhibitors of MCAK and inhibitors of Rab6-KIFL.
- histone deacetylase inhibitors include, but are not limited to, SAHA, TSA, oxamflatin, PXD101, MG98 and scriptaid. Further reference to other histone deacetylase inhibitors may be found in the following manuscript; Miller, T. A. et al. J. Med. Chem. 46(24):5097-5116 (2003).
- “Inhibitors of kinases involved in mitotic progression” include, but are not limited to, inhibitors of aurora kinase, inhibitors of Polo-like kinases (PLK; in particular inhibitors of PLK-1), inhibitors of bub-1 and inhibitors of bub-R1.
- PLK Polo-like kinases
- An example of an “aurora kinase inhibitor” is VX-680.
- Antiproliferative agents includes antisense RNA and DNA oligonucleotides such as G3139, ODN698, RVASKRAS, GEM231, and INX3001, and antimetabolites such as enocitabine, carmofur, tegafur, pentostatin, doxifluridine, trimetrexate, fludarabine, capecitabine, galocitabine, cytarabine ocfosfate, fosteabine sodium hydrate, raltitrexed, paltitrexid, emitefur, tiazofurin, decitabine, nolatrexed, pemetrexed, nelzarabine, 2′-deoxy-2′-methylidenecytidine, 2′-fluoromethylene-2′-deoxycytidine, N-[5-(2,3-dihydro-benzofuryl)sulfonyl]-N′-(3,4-dichlorophenyl)ure
- monoclonal antibody targeted therapeutic agents include those therapeutic agents which have cytotoxic agents or radioisotopes attached to a cancer cell specific or target cell specific monoclonal antibody. Examples include Bexxar.
- Prenyl-protein transferase inhibitor refers to a compound which inhibits any one or any combination of the prenyl-protein transferase enzymes, including farnesyl-protein transferase (FPTase), geranylgeranyl-protein transferase type I (GGPTase-I), and geranylgeranyl-protein transferase type-II (GGPTase-II, also called Rab GGPTase).
- FPTase farnesyl-protein transferase
- GGPTase-I geranylgeranyl-protein transferase type I
- GGPTase-II geranylgeranyl-protein transferase type-II
- prenyl-protein transferase inhibitors can be found in the following publications and patents: WO 96/30343, WO 97/18813, WO 97/21701, WO 97/23478, WO 97/38665, WO 98/28980, WO 98/29119, WO 95/32987, U.S. Pat. Nos. 5,420,245, 5,523,430, 5,532,359, 5,510,510, 5,589,485, 5,602,098, European Patent Publ. 0 618 221, European Patent Publ. 0 675 112, European Patent Publ. 0 604 181, European Patent Publ.
- Angiogenesis inhibitors refers to compounds that inhibit the formation of new blood vessels, regardless of mechanism.
- angiogenesis inhibitors include, but are not limited to, tyrosine kinase inhibitors, such as inhibitors of the tyrosine kinase receptors Flt-1 (VEGFR1) and Flk-1/KDR (VEGFR2), inhibitors of epidermal-derived, fibroblast-derived, or platelet derived growth factors, MMP (matrix metalloprotease) inhibitors, integrin blockers, interferon-a, interleukin-12, pentosan polysulfate, cyclooxygenase inhibitors, including nonsteroidal anti-inflammatories (NSAIDs) like aspirin and ibuprofen as well as selective cyclooxy-genase-2 inhibitors like celecoxib and rofecoxib ( PNAS , Vol.
- NSAIDs nonsteroidal anti-inflammatories
- NSAIDs nonsteroidal anti
- steroidal anti-inflammatories such as corticosteroids, mineralocorticoids, dexamethasone, prednisone, prednisolone, methylpred, betamethasone), carboxyamidotriazole, combretastatin A-4, squalamine, 6-O-chloroacetyl-carbonyl)-fumagillol, thalidomide, angiostatin, troponin-1, angiotensin II antagonists (see Fernandez et al., J. Lab. Clin. Med.
- angiogenesis inhibitors include, but are not limited to, endostatin, ukrain, ranpirnase, IM862, 5-methoxy-4-[2-methyl-3-(3-methyl-2-butenyl)oxiranyl]-1-oxaspiro[2,5]oct-6-yl(chloroacetyl)carbamate, acetyldinanaline, 5-amino-1-[ [3,5-dichloro-4-(4-chlorobenzoyl)phenyl]methyl]-1H-1,2,3-triazole-4-carboxamide,CM101, squalamine, combretastatin, RPI4610, NX31838, sulfated mannopentaose phosphate, 7,7-(carbonyl-bis[imino-N-methyl-4,2-pyrrolocarbonylimino[N-methyl-4,2-pyrrole]-carbonylimino]-bis-(1,3-naphthalen
- agents that modulate or inhibit angiogenesis and may also be used in combination with the compounds of the instant invention include agents that modulate or inhibit the coagulation and fibrinolysis systems (see review in Clin. Chem . La. Med. 38:679-692 (2000)).
- agents that modulate or inhibit the coagulation and fibrinolysis pathways include, but are not limited to, heparin (see Thromb. Haemost. 80:10-23 (1998)), low molecular weight heparins and carboxypeptidase U inhibitors (also known as inhibitors of active thrombin activatable fibrinolysis inhibitor [TAFIa]) (see Thrombosis Res. 101:329-354 (2001)).
- TAFIa inhibitors have been described in U.S. Ser. Nos. 60/310,927 (filed Aug. 8, 2001) and 60/349,925 (filed Jan. 18, 2002).
- Agents that interfere with cell cycle checkpoints refer to compounds that inhibit protein kinases that transduce cell cycle checkpoint signals, thereby sensitizing the cancer cell to DNA damaging agents.
- agents include inhibitors of ATR, ATM, the CHK11 and CHK12 kinases and cdk and cdc kinase inhibitors and are specifically exemplified by 7-hydroxystaurosporin, flavopiridol, CYC202 (Cyclacel) and BMS-387032.
- agents that interfere with receptor tyrosine kinases refer to compounds that inhibit RTKs and therefore mechanisms involved in oncogenesis and tumor progression. Such agents include inhibitors of c-Kit, Eph, PDGF, Flt3 and c-Met. Further agents include inhibitors of RTKs as described by Bume-Jensen and Hunter, Nature, 411:355-365, 2001.
- “Inhibitors of cell proliferation and survival signalling pathway” refer to compounds that inhibit signal transduction cascades downstream of cell surface receptors. Such agents include inhibitors of serine/threonine kinases (including but not limited to inhibitors of Akt such as described in WO 02/083064, WO 02/083139, WO 02/083140, US 2004-0116432, WO 02/083138, US 2004-0102360, WO 03/086404, WO 03/086279, WO 03/086394, WO 03/084473, WO 03/086403, WO 2004/041162, WO 2004/096131, WO 2004/096129, WO 2004/096135, WO 2004/096130, WO 2005/100356, WO 2005/100344, US 2005/029941, US 2005/44294, US 2005/43361, 60/734188, 60/652737, 60/670469), inhibitors of Raf kinase (for example PLX-4032), inhibitors of
- integrated circuit blockers refers to compounds which selectively antagonize, inhibit or counteract binding of a physiological ligand to the ⁇ v ⁇ 3 integrin, to compounds which selectively antagonize, inhibit or counteract binding of a physiological ligand to the ⁇ v ⁇ 5 integrin, to compounds which antagonize, inhibit or counteract binding of a physiological ligand to both the ⁇ v ⁇ 3 integrin and the ⁇ v ⁇ 5 integrin, and to compounds which antagonize, inhibit or counteract the activity of the particular integrin(s) expressed on capillary endothelial cells.
- the term also refers to antagonists of the ⁇ v ⁇ 6 , ⁇ v ⁇ 8 , ⁇ 1 ⁇ 1 , ⁇ 2 ⁇ 1 , ⁇ 5 ⁇ 1 , ⁇ 6 ⁇ 1 , and ⁇ 6 ⁇ 4 integrins.
- the term also refers to antagonists of any combination of ⁇ v ⁇ 3 , ⁇ v ⁇ 5 , ⁇ v ⁇ 8 , ⁇ 1 ⁇ 1 , ⁇ 2 ⁇ 1 , ⁇ 5 ⁇ 1 , ⁇ 6 ⁇ 1 , and ⁇ 6 ⁇ 4 integrins.
- tyrosine kinase inhibitors include N-(trifluoromethylphenyl)-5-methylisoxazol-4-carboxamide, 3-[(2,4-dimethylpyrrol-5-yl)methylidenyl)indolin-2-one, 17-(allylamino)-17-demethoxygeldanamycin, 4-(3-chloro-4-fluorophenylamino)-7-methoxy-6-[3-(4-morpholinyl)propoxyl]quinazoline, N-(3-ethynylphenyl)-6,7-bis(2-methoxyethoxy)-4-quinazolinamine, BIBX1382, 2,3,9,10,11,12-hexahydro-10-(hydroxymethyl)-10-hydroxy-9-methyl-9,12-epoxy-1H-diindolo[1,2,3-fg:3‘′,2’,1′-kl]pyrrolo[3,4-i][
- Combinations of the instantly claimed antibodies or antigen binding fragments with PPAR- ⁇ (i.e., PPAR-gamma) agonists and PPAR- ⁇ (i.e., PPAR-delta) agonists may be useful in the treatment of certain malignancies.
- PPAR- ⁇ and PPAR- ⁇ are the nuclear peroxisome proliferator-activated receptors ⁇ and ⁇ .
- the expression of PPAR- ⁇ on endothelial cells and its involvement in angiogenesis has been reported in the literature (see J. Cardiovasc. Pharmacol. 1998; 31: 909-913 ; J. Biol. Chem. 1999; 274: 9116-9121 ; Invest. Ophthalmol Vis. Sci. 2000; 41: 2309-2317).
- PPAR- ⁇ agonists have been shown to inhibit the angiogenic response to VEGF in vitro; both troglitazone and rosiglitazone maleate inhibit the development of retinal neovascularization in mice. ( Arch. Ophthamol. 2001; 119: 709-717).
- PPAR- ⁇ agonists and PPAR- ⁇ / ⁇ agonists include, but are not limited to, Lynparza®, Rucaparib®, Talazoparib®, niraparib, Veliparib®, thiazolidinediones (such as DRF2725, CS-011, troglitazone, rosiglitazone, and pioglitazone), fenofibrate, gemfibrozil, clofibrate, GW2570, SB219994, AR-H039242, JTT-501, MCC-555, GW2331, GW409544, NN2344, KRP297, NP0110, DRF4158, NN622, GI262570, PNU182716, DRF552926, 2-[(5,7-dipropyl-3-trifluoromethyl-1,2-benzisoxazol-6-yl)oxy]-2-methylpropionic acid, and 2(R)-7-(3-(3
- the antibody or antigen binding fragment of the instant invention may also be useful for treating or preventing breast cancer in combination with aromatase inhibitors.
- aromatase inhibitors include but are not limited to: anastrozole, letrozole and exemestane.
- the antibody or antigen binding fragment of the instant invention may also be useful for treating cancer in combination with the following chemotherapeutic agents: abarelix (Plenaxis depot®); aldesleukin (Prokine®); Aldesleukin (Proleukin®); Alemtuzumab (Campath®); alitretinoin (Panretin®); allopurinol (Zyloprim®); altretamine (Hexalen®); amifostine (Ethyol®); anastrozole (Arimidex®); arsenic trioxide (Trisenox®); asparaginase (Elspar®); azacitidine (Vidaza®); bendamustine hydrochloride (Treanda®); bevacuzimab (Avastin®); bexarotene capsules (Targretin®); bexarotene gel (Targretin®); bleomycin (Blenoxane®); bortezomib (
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is in association with one or more antiemetics including, but not limited to: casopitant (GlaxoSmithKline), Netupitant (MGI-Helsinn) and other NK-1 receptor antagonists, palonosetron (sold as Aloxi by MGI Pharma), aprepitant (sold as Emend by Merck and Co.; Rahway, N.J.), diphenhydramine (sold as Benadryl® by Pfizer; New York, N.Y.), hydroxyzine (sold as Atarax® by Pfizer; New York, N.Y.), metoclopramide (sold as Reglan® by AH Robins Co,; Richmond, Va.), lorazepam (sold as Ativan® by Wyeth; Madison, N.J.), alprazolam (sold as Xanax® by Pfizer; New York, N.Y.), haloperidol (
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof is in association with an agent which treats or prevents such a deficiency, such as, e.g., filgrastim, PEG-filgrastim, erythropoietin, epoetin alfa or darbepoetin alfa.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention is administered in association with anti-cancer radiation therapy.
- the radiation therapy is external beam therapy (EBT): a method for delivering a beam of high-energy X-rays to the location of the tumor. The beam is generated outside the patient (e.g., by a linear accelerator) and is targeted at the tumor site. These X-rays can destroy the cancer cells and careful treatment planning allows the surrounding normal tissues to be spared. No radioactive sources are placed inside the patient's body.
- the radiation therapy is proton beam therapy: a type of conformal therapy that bombards the diseased tissue with protons instead of X-rays.
- the radiation therapy is conformal external beam radiation therapy: a procedure that uses advanced technology to tailor the radiation therapy to an individual's body structures.
- the radiation therapy is brachytherapy: the temporary placement of radioactive materials within the body, usually employed to give an extra dose—or boost—of radiation to an area.
- a surgical procedure is administered in association with an anti-SIRP ⁇ antibody or antigen-binding fragment thereof is surgical tumorectomy.
- the anti-SIRP ⁇ antibodies and antigen-binding fragments thereof disclosed herein may be used as affinity purification agents.
- the anti-SIRP ⁇ antibodies and antigen-binding fragments thereof are immobilized on a solid phase such a Sephadex, glass or agarose resin or filter paper, using methods well known in the art.
- the immobilized antibody or fragment is contacted with a sample containing the SIRP ⁇ protein (or a fragment thereof) to be purified, and thereafter the support is washed with a suitable solvent that will remove substantially all the material in the sample except the SIRP ⁇ protein, which is bound to the immobilized antibody or fragment. Finally, the support is washed with a solvent which elutes the bound SIRP ⁇ (e.g., protein A).
- a solvent which elutes the bound SIRP ⁇ e.g., protein A
- antigens for generating secondary antibodies which are useful for example for performing Western blots and other immunoassays discussed herein.
- Anti-SIRP ⁇ antibodies e.g., humanized antibodies
- antigen-binding fragments thereof may also be useful in diagnostic assays for SIRP ⁇ protein, e.g., detecting its expression in specific cells, tissues, or serum, e.g., myeloid cells such as monocytes, macrophages, neutrophils, basophils, eosinophils, and dendritic cells.
- Such diagnostic methods may be useful in various disease diagnoses.
- the present invention includes ELISA assays (enzyme-linked immunosorbent assay) incorporating the use of an anti-SIRP ⁇ antibody or antigen-binding fragment thereof disclosed herein.
- such a method comprises the following steps:
- a substrate e.g., surface of a microtiter plate well, e.g., a plastic plate
- anti-SIRP ⁇ antibody or antigen-binding fragment thereof e.g., a sample to be tested for the presence of SIRP ⁇ to the substrate
- a sample to be tested for the presence of SIRP ⁇ to the substrate
- a sample to be tested for the presence of SIRP ⁇ to the substrate
- a sample to be tested for the presence of SIRP ⁇ to the substrate
- detectably labeled antibodies e.g., enzyme-linked antibodies
- wash the substrate so that the unbound, labeled antibodies are removed
- the labeled antibodies are enzyme linked, apply a chemical which is converted by the enzyme into a fluorescent signal
- detect the presence of the labeled antibody e.g., enzyme-linked antibodies
- Detection of the label associated with the substrate indicates the presence of the SIRP ⁇ protein.
- the labeled antibody or antigen-binding fragment thereof is labeled with peroxidase which react with ABTS (e.g., 2,2′-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid)) or 3,3′,5,5′-Tetramethylbenzidine to produce a color change which is detectable.
- ABTS e.g., 2,2′-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid)
- 3,3′,5,5′-Tetramethylbenzidine e.g., 2,2′-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid)
- 3,3′,5,5′-Tetramethylbenzidine e.g., 2,2′-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid)
- 3,3′,5,5′-Tetramethylbenzidine e.g., 2,2′-azino
- An anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention may be used in a Western blot or immune-protein blot procedure.
- a procedure forms part of the present invention and includes e.g.:
- Such a membrane may take the form of a nitrocellulose or vinyl-based (e.g., polyvinylidene fluoride (PVDF)) membrane to which the proteins to be tested for the presence of SIRP ⁇ in a non-denaturing PAGE (polyacrylamide gel electrophoresis) gel or SDS-PAGE (sodium dodecyl sulfate polyacrylamide gel electrophoresis) gel have been transferred (e.g., following electrophoretic separation in the gel).
- PAGE polyacrylamide gel electrophoresis
- SDS-PAGE sodium dodecyl sulfate polyacrylamide gel electrophoresis
- Detection of the bound antibody or fragment indicates that the SIRP ⁇ protein is present on the membrane or substrate and in the sample.
- Detection of the bound antibody or fragment may be by binding the antibody or fragment with a secondary antibody (an anti-immunoglobulin antibody) which is detectably labeled and, then, detecting the presence of the secondary antibody.
- a secondary antibody an anti-immunoglobulin antibody
- anti-SIRP ⁇ antibodies and antigen-binding fragments thereof disclosed herein may also be used for immunohistochemistry.
- Such a method forms part of the present invention and comprises, e.g.,
- the antibody or fragment itself is detectably labeled, it can be detected directly. Alternatively, the antibody or fragment may be bound by a detectably labeled secondary antibody which is detected.
- Certain anti-SIRP ⁇ antibodies and antigen-binding fragments thereof disclosed herein may also be used for in vivo tumor imaging.
- Such a method may include injection of a radiolabeled anti-SIRP ⁇ antibody or antigen-binding fragment thereof into the body of a patient to be tested for the presence of a tumor associated with SIRP ⁇ expression (e.g., which expresses SIRP ⁇ , for example, on the tumor cell surface) followed by nuclear imaging of the body of the patient to detect the presence of the labeled antibody or fragment e.g., at loci comprising a high concentration of the antibody or fragment which are bound to the tumor. The detection of the loci indicates the presence of the SIRP ⁇ + tumor and tumor cells.
- Imaging techniques include SPECT imaging (single photon emission computed tomography) or PET imaging (positron emission tomography).
- Labels include e.g., iodine-123 ( 123 I) and technetium-99m ( 99 mTc), e.g., in conjunction with SPECT imaging or 11 C, 13 N, 15 O or 18 F, e.g., in conjunction with PET imaging or Indium-111 (See e.g., Gordon et al., (2005) International Rev. Neurobiol. 67:385-440).
- the antibody or antigen-binding fragment thereof is admixed with a pharmaceutically acceptable carrier or excipient. See, e.g., Remington's Pharmaceutical Sciences and U.S. Pharmacopeia: National Formulary , Mack Publishing Company, Easton, Pa. (1984).
- Formulations of therapeutic and diagnostic agents may be prepared by mixing with acceptable carriers, excipients, or stabilizers in the form of, e.g., lyophilized powders, slurries, aqueous solutions or suspensions (see, e.g., Hardman, et al. (2001) Goodman and Gilman's The Pharmacological Basis of Therapeutics , McGraw-Hill, New York, N.Y.; Gennaro (2000) Remington: The Science and Practice of Pharmacy , Lippincott, Williams, and Wilkins, New York, N.Y.; Avis, et al.
- Toxicity and therapeutic efficacy of the antibodies of the invention, administered alone or in combination with another therapeutic agent can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD 50 (the dose lethal to 50% of the population) and the ED 50 (the dose therapeutically effective in 50% of the population).
- the dose ratio between toxic and therapeutic effects is the therapeutic index (LD 50 /ED 50 ).
- the data obtained from these cell culture assays and animal studies can be used in formulating a range of dosage for use in human.
- the dosage of such compounds lies preferably within a range of circulating concentrations that include the ED 50 with little or no toxicity.
- the dosage may vary within this range depending upon the dosage form employed and the route of administration.
- a further therapeutic agent that is administered to a subject in association with an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention in accordance with the Physicians' Desk Reference 2003 (Thomson Healthcare; 57th edition (Nov. 1, 2002)).
- the mode of administration can vary. Routes of administration include oral, rectal, transmucosal, intestinal, parenteral; intramuscular, subcutaneous, intradermal, intramedullary, intrathecal, direct intraventricular, intravenous, intraperitoneal, intranasal, intraocular, inhalation, insufflation, topical, cutaneous, transdermal, or intra-arterial.
- the anti-SIRP ⁇ antibodies or antigen-binding fragments thereof of the invention can be administered by an invasive route such as by injection.
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof, or pharmaceutical composition thereof is administered intravenously, subcutaneously, intramuscularly, intraarterially, intratumorally, or by inhalation, aerosol delivery.
- Administration by non-invasive routes e.g., orally; for example, in a pill, capsule or tablet) is also within the scope of the present invention.
- the present invention provides a vessel (e.g., a plastic or glass vial, e.g., with a cap or a chromatography column, hollow bore needle or a syringe cylinder) comprising any of the antibodies or antigen-binding fragments of the invention or a pharmaceutical composition thereof.
- a vessel e.g., a plastic or glass vial, e.g., with a cap or a chromatography column, hollow bore needle or a syringe cylinder
- an injection device comprising any of the antibodies or antigen-binding fragments of the invention or a pharmaceutical composition thereof.
- An injection device is a device that introduces a substance into the body of a patient via a parenteral route, e.g., intramuscular, subcutaneous or intravenous.
- an injection device may be a syringe (e.g., pre-filled with the pharmaceutical composition, such as an auto-injector) which, for example, includes a cylinder or barrel for holding fluid to be injected (e.g., antibody or fragment or a pharmaceutical composition thereof), a needle for piecing skin and/or blood vessels for injection of the fluid; and a plunger for pushing the fluid out of the cylinder and through the needle bore.
- an injection device that comprises an antibody or antigen-binding fragment thereof of the present invention or a pharmaceutical composition thereof is an intravenous (IV) injection device.
- Such a device includes the antibody or fragment or a pharmaceutical composition thereof in a cannula or trocar/needle which may be attached to a tube which may be attached to a bag or reservoir for holding fluid (e.g., saline; or lactated ringer solution comprising NaCl, sodium lactate, KCl, CaCl 2 ) and optionally including glucose) introduced into the body of the patient through the cannula or trocar/needle.
- fluid e.g., saline; or lactated ringer solution comprising NaCl, sodium lactate, KCl, CaCl 2
- glucose e.g., glucose
- the antibody or fragment or a pharmaceutical composition thereof may, in an embodiment of the invention, be introduced into the device once the trocar and cannula are inserted into the vein of a subject and the trocar is removed from the inserted cannula.
- the IV device may, for example, be inserted into a peripheral vein (e.g., in the hand or arm); the superior vena cava or inferior vena cava, or within the right atrium of the heart (e.g., a central IV); or into a subclavian, internal jugular, or a femoral vein and, for example, advanced toward the heart until it reaches the superior vena cava or right atrium (e.g., a central venous line).
- an injection device is an autoinjector; a jet injector or an external infusion pump.
- a jet injector uses a high-pressure narrow jet of liquid which penetrate the epidermis to introduce the antibody or fragment or a pharmaceutical composition thereof to a patient's body.
- External infusion pumps are medical devices that deliver the antibody or fragment or a pharmaceutical composition thereof into a patient's body in controlled amounts. External infusion pumps may be powered electrically or mechanically.
- Different pumps operate in different ways, for example, a syringe pump holds fluid in the reservoir of a syringe, and a moveable piston controls fluid delivery, an elastomeric pump holds fluid in a stretchable balloon reservoir, and pressure from the elastic walls of the balloon drives fluid delivery.
- a set of rollers pinches down on a length of flexible tubing, pushing fluid forward.
- fluids can be delivered from multiple reservoirs at multiple rates.
- the pharmaceutical compositions disclosed herein may also be administered with a needleless hypodermic injection device; such as the devices disclosed in U.S. Pat. Nos. 6,620,135; 6,096,002; 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824 or 4,596,556.
- a needleless hypodermic injection device such as the devices disclosed in U.S. Pat. Nos. 6,620,135; 6,096,002; 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824 or 4,596,556.
- Such needleless devices comprising the pharmaceutical composition are also part of the present invention.
- the pharmaceutical compositions disclosed herein may also be administered by infusion. Examples of well-known implants and modules for administering the pharmaceutical compositions include those disclosed in: U.S. Pat. No. 4,487,603, which discloses an implantable micro
- the liposomes will be targeted to and taken up selectively by the afflicted tissue.
- Such methods and liposomes are part of the present invention.
- the administration regimen depends on several factors, including the serum or tissue turnover rate of the therapeutic antibody or antigen-binding fragment, the level of symptoms, the immunogenicity of the therapeutic antibody, and the accessibility of the target cells in the biological matrix.
- the administration regimen delivers sufficient therapeutic antibody or fragment to effect improvement in the target disease state, while simultaneously minimizing undesired side effects.
- the amount of biologic delivered depends in part on the particular therapeutic antibody and the severity of the condition being treated. Guidance in selecting appropriate doses of therapeutic antibodies or fragments is available (see, e.g., Wawrzynczak (1996) Antibody Therapy , Bios Scientific Pub.
- Determination of the appropriate dose is made by the clinician, e.g., using parameters or factors known or suspected in the art to affect treatment. Generally, the dose begins with an amount somewhat less than the optimum dose and it is increased by small increments thereafter until the desired or optimum effect is achieved relative to any negative side effects.
- Important diagnostic measures include those of symptoms of, e.g., the inflammation or level of inflammatory cytokines produced.
- a biologic that will be used is derived from the same species as the animal targeted for treatment, thereby minimizing any immune response to the reagent.
- humanized and fully human antibodies may be desirable.
- Antibodies or antigen-binding fragments thereof disclosed herein may be provided by continuous infusion, or by doses administered, e.g., daily, 1-7 times per week, weekly, bi-weekly, monthly, bimonthly, quarterly, semiannually, annually etc.
- Doses may be provided, e.g., intravenously, subcutaneously, topically, orally, nasally, rectally, intramuscular, intracerebrally, intraspinally, or by inhalation.
- a total weekly dose is generally at least 0.05 ⁇ g/kg body weight, more generally at least 0.2 ⁇ g/kg, 0.5 ⁇ g/kg, 1 ⁇ g/kg, 10 ⁇ g/kg, 100 ⁇ g/kg, 0.25 mg/kg, 1.0 mg/kg, 2.0 mg/kg, 5.0 mg/mL, 10 mg/kg, 25 mg/kg, 50 mg/kg or more (see, e.g., Yang, et al. (2003) New Engl. J. Med. 349:427-434; Herold, et al. (2002) New Engl. J. Med. 346:1692-1698; Liu, et al. (1999) J. Neurol. Neurosurg. Psych.
- Doses may also be provided to achieve a pre-determined target concentration of anti-SIRP ⁇ antibody in the subject's serum, such as 0.1, 0.3, 1, 3, 10, 30, 100, 300 ⁇ g/mL or more.
- An anti-SIRP ⁇ antibody of the present invention is administered, e.g., subcutaneously or intravenously, on a weekly, biweekly, “every 4 weeks,” monthly, bimonthly, or quarterly basis at 10, 20, 50, 80, 100, 200, 500, 1000 or 2500 mg/subject.
- an effective amount refers to an amount of an anti-SIRP ⁇ or antigen-binding fragment thereof of the invention that, when administered alone or in combination with an additional therapeutic agent to a cell, tissue, or subject, is effective to cause a measurable improvement in one or more symptoms of disease, for example cancer or the progression of cancer.
- An effective dose further refers to that amount of the antibody or fragment sufficient to result in at least partial amelioration of symptoms, e.g., tumor shrinkage or elimination, lack of tumor growth, increased survival time.
- an effective dose refers to that ingredient alone.
- an effective dose refers to combined amounts of the active ingredients that result in the therapeutic effect, whether administered in combination, serially or simultaneously.
- An effective amount of a therapeutic will result in an improvement of a diagnostic measure or parameter by at least 10%; usually by at least 20%; preferably at least about 30%; more preferably at least 40%, and most preferably by at least 50%.
- An effective amount can also result in an improvement in a subjective measure in cases where subjective measures are used to assess disease severity.
- kits comprising one or more components that include, but are not limited to, an anti-SIRP ⁇ antibody or antigen-binding fragment, as discussed herein in association with one or more additional components including, but not limited to a pharmaceutically acceptable carrier and/or a therapeutic agent, as discussed herein.
- the antibody or fragment and/or the therapeutic agent can be formulated as a pure composition or in combination with a pharmaceutically acceptable carrier, in a pharmaceutical composition.
- the kit includes an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention or a pharmaceutical composition thereof in one container (e.g., in a sterile glass or plastic vial) and/or a therapeutic agent and a pharmaceutical composition thereof in another container (e.g., in a sterile glass or plastic vial).
- the kit comprises a combination of the invention, including an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention along with a pharmaceutically acceptable carrier, optionally in combination with one or more therapeutic agents formulated together, optionally, in a pharmaceutical composition, in a single, common container.
- the kit can include a device for performing such administration.
- the kit can include one or more hypodermic needles or other injection devices as discussed above.
- the kit can include a package insert including information concerning the pharmaceutical compositions and dosage forms in the kit.
- information concerning the pharmaceutical compositions and dosage forms in the kit aids patients and physicians in using the enclosed pharmaceutical compositions and dosage forms effectively and safely.
- the following information regarding a combination of the invention may be supplied in the insert: pharmacokinetics, pharmacodynamics, clinical studies, efficacy parameters, indications and usage, contraindications, warnings, precautions, adverse reactions, overdosage, proper dosage and administration, how supplied, proper storage conditions, references, manufacturer/distributor information and patent information.
- the kit can also comprise a second therapeutic, for example one or more of: anti-CD47 antibody, anti-APRIL antibody, anti-PD-1 antibody (e.g., nivolumab, pembrolizumab, anti-PDL1 antibody, anti-TIGIT antibody, anti-CTLA4 antibody, anti-CS1 antibody (e.g., elotuzumab), anti-KIR2DL1/2/3 antibody (e.g., lirilumab), anti-CD137 antibody (e.g., urelumab), anti-GITR antibody (e.g., TRX518), anti-PD-L1 antibody (e.g., BMS-936559, MSB0010718C or MPDL3280A), anti-PD-L2 antibody, anti-ILT1 antibody, anti-ILT2 antibody, anti-ILT3 antibody, anti-ILT4 antibody, anti-ILT5 antibody, anti-ILT6 antibody, anti-ILT7 antibody, anti-ILT8 antibody, anti-CD40 antibody
- an anti-SIRP ⁇ antibody or antigen-binding fragment thereof of the invention can be provided in a kit, i.e., a packaged combination of reagents in predetermined amounts with instructions for performing the diagnostic or detection assay.
- the kit will include substrates and cofactors required by the enzyme (e.g., a substrate precursor which provides the detectable chromophore or fluorophore).
- substrates and cofactors required by the enzyme e.g., a substrate precursor which provides the detectable chromophore or fluorophore.
- other additives may be included such as stabilizers, buffers (e.g., a block buffer or lysis buffer) and the like.
- the relative amounts of the various reagents may be varied widely to provide for concentrations in solution of the reagents which substantially optimize the sensitivity of the assay.
- the reagents may be provided as dry powders, usually lyophilized, including excipients which on dissolution will provide a reagent solution having the appropriate concentration.
- kits comprising one or more such reagents for use in a variety of detection assays, including for example, immunoassays such as ELISA (sandwich-type or competitive format).
- the kit's components may be pre-attached to a solid support, or may be applied to the surface of a solid support when the kit is used.
- the signal generating means may come pre-associated with an antibody or fragment of the invention or may require combination with one or more components, e.g., buffers, antibody-enzyme conjugates, enzyme substrates, or the like, prior to use.
- Kits may also include additional reagents, e.g., blocking reagents for reducing nonspecific binding to the solid phase surface, washing reagents, enzyme substrates, and the like.
- the solid phase surface may be in the form of a tube, a bead, a microtiter plate, a microsphere, or other materials suitable for immobilizing proteins, peptides, or polypeptides.
- an enzyme that catalyzes the formation of a chemilluminescent or chromogenic product or the reduction of a chemilluminescent or chromogenic substrate is a component of the signal generating means. Such enzymes are well known in the art.
- Kits may comprise any of the capture agents and detection reagents described herein.
- the kit may also comprise instructions for carrying out the methods of the invention.
- kits comprising an anti-SIRP ⁇ antibody (e.g., humanized antibody) or antigen-binding fragment thereof packaged in a container, such as a vial or bottle, and further comprising a label attached to or packaged with the container, the label describing the contents of the container and providing indications and/or instructions regarding use of the contents of the container to treat one or more disease states as described herein.
- an anti-SIRP ⁇ antibody e.g., humanized antibody
- a label attached to or packaged with the container, the label describing the contents of the container and providing indications and/or instructions regarding use of the contents of the container to treat one or more disease states as described herein.
- the kit is for treating cancer and comprises an anti-SIRP ⁇ antibody (e.g., humanized antibody) or antigen-binding fragment thereof and a further therapeutic agent or a vaccine.
- the kit may optionally further include a syringe for parenteral, e.g., intravenous, administration.
- the kit comprises an anti-SIRP ⁇ antibody (e.g., humanized antibody) or antigen-binding fragment thereof and a label attached to or packaged with the container describing use of the antibody or fragment with the vaccine or further therapeutic agent.
- the kit comprises the vaccine or further therapeutic agent and a label attached to or packaged with the container describing use of the vaccine or further therapeutic agent with the anti-SIRP ⁇ antibody or fragment.
- an anti-SIRP ⁇ antibody and vaccine or further therapeutic agent are in separate vials or are combined together in the same pharmaceutical composition.
- concurrent administration of two therapeutic agents does not require that the agents be administered at the same time or by the same route, as long as there is an overlap in the time period during which the agents are exerting their therapeutic effect.
- Simultaneous or sequential administration is contemplated, as is administration on different days or weeks.
- the therapeutic and detection kits disclosed herein may also be prepared that comprise at least one of the antibody, peptide, antigen-binding fragment, or polynucleotide disclosed herein and instructions for using the composition as a detection reagent or therapeutic agent.
- Containers for use in such kits may typically comprise at least one vial, test tube, flask, bottle, syringe or other suitable container, into which one or more of the detection and/or therapeutic composition(s) may be placed, and preferably suitably aliquoted.
- the kit may also contain a second distinct container into which this second detection and/or therapeutic composition may be placed.
- kits disclosed herein will also typically include a means for containing the vial(s) in close confinement for commercial sale, such as, e.g., injection or blow-molded plastic containers into which the desired vial(s) are retained.
- the labeling agent may be provided either in the same container as the detection or therapeutic composition itself, or may alternatively be placed in a second distinct container means into which this second composition may be placed and suitably aliquoted.
- the detection reagent and the label may be prepared in a single container means, and in most cases, the kit will also typically include a means for containing the vial(s) in close confinement for commercial sale and/or convenient packaging and delivery.
- a device or apparatus for carrying out the detection or monitoring methods described herein may include a chamber or tube into which sample can be input, a fluid handling system optionally including valves or pumps to direct flow of the sample through the device, optionally filters to separate plasma or serum from blood, mixing chambers for the addition of capture agents or detection reagents, and optionally a detection device for detecting the amount of detectable label bound to the capture agent immunocomplex.
- a fluid handling system optionally including valves or pumps to direct flow of the sample through the device, optionally filters to separate plasma or serum from blood, mixing chambers for the addition of capture agents or detection reagents, and optionally a detection device for detecting the amount of detectable label bound to the capture agent immunocomplex.
- the flow of sample may be passive (e.g., by capillary, hydrostatic, or other forces that do not require further manipulation of the device once sample is applied) or active (e.g., by application of force generated via mechanical pumps, electroosmotic pumps, centrifugal force, or increased air pressure), or by a combination of active and passive forces.
- a processor also provided is a processor, a computer readable memory, and a routine stored on the computer readable memory and adapted to be executed on the processor to perform any of the methods described herein.
- suitable computing systems, environments, and/or configurations include personal computers, server computers, hand-held or laptop devices, multiprocessor systems, microprocessor-based systems, set top boxes, programmable consumer electronics, network PCs, minicomputers, mainframe computers, distributed computing environments that include any of the above systems or devices, or any other systems known in the art.
- Embodiment 1 An antibody or antigen binding fragment thereof that binds to human SIRP ⁇ , wherein the antibody or antigen binding fragment comprises one or more, and optionally each, of:
- Embodiment 3 The antibody or antigen binding fragment of embodiment 2, wherein the antibody or antigen binding fragment comprises one or both of:
- Embodiment 4 The antibody or antigen binding fragment of embodiment 3, wherein the antibody or fragment thereof has the following characteristics:
- Embodiment 5 The antibody or antigen binding fragment of embodiment 1, wherein the antibody or antigen binding fragment thereof comprises one of the following combinations of heavy chain sequence/light chain sequence:
- Embodiment 6 The antibody or antigen binding fragment of one of embodiments 1-5, wherein the antibody is an intact IgG.
- Embodiment 7 The antibody or antigen binding fragment of one of embodiments 1-6, wherein the antibody comprises a wild-type or mutated IgG2 Fc region.
- Embodiment 8 The antibody or antigen binding fragment of one of embodiments 1-6, wherein the antibody comprises a mutated IgG1 Fc region.
- Embodiment 9 The antibody or antigen binding fragment of one of embodiments 1-6, wherein the antibody comprises a mutated IgG4 Fc region.
- Embodiment 10 An antibody or antigen binding fragment thereof that binds to the same epitope of human SIRP ⁇ as an antibody as an antibody according to embodiment 5.
- Embodiment 11 The antibody or antigen binding fragment of any of embodiments 1-10, wherein the antibody or antigen binding fragment is humanized.
- Embodiment 12 The antibody or antigen binding fragment of any of embodiments 1-11 that is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 10 and each light chain comprises SEQ ID NO: 20.
- Embodiment 13 The antibody or antigen binding fragment of any of embodiments 1-11 that is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 16 and each light chain comprises SEQ ID NO: 28.
- Embodiment 14 The antibody or antigen binding fragment of any of embodiments 1-11 that is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 18 and each light chain comprises SEQ ID NO: 20.
- Embodiment 15 The antibody or antigen binding fragment of any of embodiments 1-11 that is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 80 and each light chain comprises SEQ ID NO: 90.
- Embodiment 16 The antibody or antigen binding fragment of any of embodiments 1-11 that is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 80 and each light chain comprises SEQ ID NO: 92.
- Embodiment 17 The antibody or antigen binding fragment of any of embodiments 1-11 that is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 80 and each light chain comprises SEQ ID NO: 95.
- Embodiment 18 The antibody or antigen binding fragment of any one of embodiments 1-17 that comprises a glycosylation pattern characteristic of expression by a mammalian cell, and optionally is glycosylated by expression from a CHO cell.
- Embodiment 19 An isolated polypeptide comprising the amino acid sequence of any one of SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 76, 90, 92, 94, 96, 98, 100, 102, 104, 7, 10, 12, 14, 16, 18, 30, 8, 20, 22, 24, 26, 28, and 32, or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- Embodiment 20 An isolated nucleic acid encoding any one of the antibodies or antigen binding fragments of embodiments 1-18, or any one of the polypeptides of embodiment 19.
- Embodiment 21 An isolated nucleic acid of embodiment 20 comprising:
- Embodiment 22 An expression vector comprising the isolated nucleic acid of embodiment 20 or 21.
- Embodiment 23 An expression vector of embodiment 22, encoding both a heavy chain sequence and a light chain sequence of an anti-SIRP ⁇ antibody, the expression vectors comprising the following a first nucleic acid sequence/second nucleic acid sequence selected from the group consisting of:
- Embodiment 24 A host cell comprising expression vector of embodiment 22 or 23.
- Embodiment 25 A host cell of embodiment 24 which produces a full length anti-SIRP ⁇ antibody.
- Embodiment 26 The host cell of one of embodiments 24 or 25, which is a bacterial cell, a human cell, a mammalian cell, a Pichia cell, a plant cell, an HEK293 cell, or a Chinese hamster ovary cell.
- Embodiment 27 A composition comprising the antibody or antigen binding fragment of any one of embodiments 1-18 and a pharmaceutically acceptable carrier or diluent.
- Embodiment 28 The composition of embodiment 27, further comprising a second antibody or antigen binding fragment thereof that induces ADCC and/or ADCP, wherein said antibody or antigen binding fragment of the invention enhances the antibody-mediated destruction of cells by the second antibody.
- Embodiment 29 The composition according to embodiment 28, wherein the second antibody or antigen binding fragment thereof binds to an antigen selected from the group consisting of AMHR2, AXL, BCMA, CA IX, CD4, CD16, CD19, CD20, CD22, CD30, CD37, CD38, CD40, CD52, CD98, CSF1R, GD2, CCR4, CS1, EpCam, EGFR, EGFRvIII, Endoglin, EPHA2, EphA3, FGFR2b, folate receptor alpha, fucosyl-GM1, HER2, HER3, IL1RAP, kappa myeloma antigen, MS4A1, prolactin receptor, TA-MUC1, and PSMA.
- an antigen selected from the group consisting of AMHR2, AXL, BCMA, CA IX, CD4, CD16, CD19, CD20, CD22, CD30, CD37, CD38, CD40, CD52, CD98, CSF1R, GD2, CCR4,
- Embodiment 30 The composition according to embodiment 29, wherein the second antibody or antigen binding fragment thereof is selected from the group consisting of Rituximab, ublituximab, margetuximab, IMGN-529, SCT400, veltuzumab, Obinutuzumab, ADCT-502, Hul4.18K322A, Hu3F8, Dinituximab, Trastuzumab, Cetuximab, Rituximab-RLI, c.60C3-RLI, Hul4.18-IL2, KM2812, AFM13, (CD20)2xCD16, erlotinib (Tarceva), daratumumab, alemtuzumab, pertuzumab, brentuximab, elotuzumab, ibritumomab, ifabotuzumab, farletuzumab, otlertuzumab, carotuximab, eprat
- Embodiment 31 The composition according to embodiment 28, wherein the second antibody or antigen binding fragment thereof induces ADCP.
- Embodiment 32 The composition according to embodiment 31, wherein the second antibody or antigen binding fragment thereof is selected from the group consisting of Rituximab, ublituximab, margetuximab, IMGN-529, SCT400, veltuzumab, Obinutuzumab, Trastuzumab, Cetuximab, alemtuzumab, ibritumomab, farletuzumab, inebilizumab, lumretuzumab, 4G7SDIE, BMS-986012, BVX-20, mogamulizumab, ChiLob-7/4, GM102, GSK-2857916, PankoMab-GEX, chKM-4927, MDX-1097, MOR202, and MOR-208.
- the second antibody or antigen binding fragment thereof is selected from the group consisting of Rituximab, ublituximab, margetuximab, IMGN
- Embodiment 33 The composition of embodiment 27, further comprising one or more agents selected from the group consisting of anti-CD27 antibody, anti-CD47 antibody, anti-APRIL antibody, anti-PD-1 antibody, anti-PD-L1 antibody, anti-TIGIT antibody, anti-CTLA4 antibody, anti-CS1 antibody, anti-KIR2DL1/2/3 antibody, anti-CD137 antibody, anti-GITR antibody, anti-PD-L2 antibody, anti-ILT1 antibody, anti-ILT2 antibody, anti-ILT3 antibody, anti-ILT4 antibody, anti-ILT5 antibody, anti-ILT6 antibody, anti-ILT7 antibody, anti-ILT8 antibody, anti-CD40 antibody, anti-OX40 antibody, anti-ICOS, anti-KIR2DL1 antibody, anti-KIR2DL2/3 antibody, anti-KIR2DL4 antibody, anti-KIR2DL5A antibody, anti-KIR2DL5B antibody, anti-KIR3DL1 antibody, anti-KIR3DL2 antibody, anti-KIR3DL3
- Embodiment 34 A method of producing an antibody or antigen binding fragment comprising:
- Embodiment 35 A method for detecting the presence of a SIRP ⁇ peptide or a fragment thereof in a sample comprising contacting the sample with an antibody or fragment of any of embodiments 1-18 and detecting the presence of a complex between the antibody or fragment and the peptide; wherein detection of the complex indicates the presence of the SIRP ⁇ peptide.
- Embodiment 36 An antibody or antigen binding fragment according to any one of embodiments 1-18 or a composition according to any one of embodiments 21-25, for the treatment of cancer or an infectious disease.
- Embodiment 37 An antibody or antigen binding fragment of embodiments 1-18 or a composition according to any one of embodiments 27-33 for decreasing SIRP ⁇ /CD47 signalling in a human subject.
- Embodiment 38 A method of treating cancer in a human subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment of any one of embodiments 1-18, or an expression vector according to one of embodiments 22 or 23, or a host cell according to one of embodiments 24-26, or a composition according one of embodiments 27-33, optionally in association with a further therapeutic agent or therapeutic procedure.
- Embodiment 39 A method of treating cancer in a human subject, comprising:
- Embodiment 40 The method according to embodiment 39, wherein the antibody or antigen binding fragment thereof that induces ADCC and/or ADCP binds to an antigen selected from the group consisting of AMHR2, AXL, BCMA, CA IX, CD4, CD16, CD19, CD20, CD22, CD30, CD37, CD38, CD40, CD52, CD98, CSF1R, GD2, CCR4, CS1, EpCam, EGFR, EGFRvIII, Endoglin, EPHA2, EphA3, FGFR2b, folate receptor alpha, fucosyl-GM1, HER2, HER3, IL1RAP, kappa myeloma antigen, MS4A1, prolactin receptor, TA-MUC1, and PSMA.
- an antigen selected from the group consisting of AMHR2, AXL, BCMA, CA IX, CD4, CD16, CD19, CD20, CD22, CD30, CD37, CD38, CD40, CD52, CD98, C
- Embodiment 41 The method according to embodiment 40, wherein the antibody or antigen binding fragment thereof that induces ADCC and/or ADCP is selected from the group consisting of Rituximab, ublituximab, margetuximab, IMGN-529, SCT400, veltuzumab, Obinutuzumab, ADCT-502, Hul4.18K322A, Hu3F8, Dinituximab, Trastuzumab, Cetuximab, Rituximab-RLI, c.60C3-RLI, Hul4.18-IL2, KM2812, AFM13, (CD20)2xCD16, erlotinib (Tarceva), daratumumab, alemtuzumab, pertuzumab, brentuximab, elotuzumab, ibritumomab, ifabotuzumab, farletuzumab, otlertuzumab, ca
- Embodiment 42 The method according to embodiment 39 or 40, wherein the second antibody or antigen binding fragment thereof induces ADCP.
- Embodiment 43 The method according to embodiment 42, wherein the second antibody or antigen binding fragment thereof is selected from the group consisting of Rituximab, ublituximab, margetuximab, IMGN-529, SCT400, veltuzumab, Obinutuzumab, Trastuzumab, Cetuximab, alemtuzumab, ibritumomab, farletuzumab, inebilizumab, lumretuzumab, 4G7SDIE, BMS-986012, BVX-20, mogamulizumab, ChiLob-7/4, GM102, GSK-2857916, PankoMab-GEX, chKM-4927, MDX-1097, MOR202, and MOR-208.
- the second antibody or antigen binding fragment thereof is selected from the group consisting of Rituximab, ublituximab, margetuximab, IM
- Embodiment 44 A method of treating an infection or infectious disease in a human subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment of any one of embodiments 1-18, or an expression vector according to one of embodiments 22 or 23, or a host cell according to one of embodiments 24-26, or a composition according one of embodiments 27-33, optionally in association with a further therapeutic agent or therapeutic procedure.
- Embodiment 45 An antibody having one or more of the following characteristics:
- Embodiment 46 The antibody or antigen binding fragment of embodiment 45 that binds human SIRP ⁇ V1 protein having the sequence of SEQ ID NO: 34 with an EC 50 ⁇ 1 nM; exhibits at least a 100-fold higher EC 50 for SIRP ⁇ V1(P74A) having the sequence of SEQ ID NO: 62; and exhibits at least a 100-fold higher EC 50 for human SIRP ⁇ 1 protein having the sequence of SEQ ID NO: 38.
- Embodiment 47 The antibody or antigen binding fragment of embodiment 45 or 46 that comprises one or two light chains comprising SEQ ID NO: 20 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto and one or two heavy chains comprising SEQ ID NO: 10 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- Embodiment 48 The antibody or antigen binding fragment of embodiment 45 or 46 that comprises one or two light chains comprising SEQ ID NO: 28 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto and one or two heavy chains comprising SEQ ID NO: 16 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- Embodiment 49 The antibody or antigen binding fragment of embodiment 45 or 46 that comprises one or two light chains comprising SEQ ID NO: 20 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto and and one or two heavy chains comprising SEQ ID NO: 18 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- Embodiment 50 The antibody or antigen binding fragment of embodiment 45 or 46 that comprises one or two light chains comprising SEQ ID NO: 90 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto and one or two heavy chains comprising SEQ ID NO: 80 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- Embodiment 51 The antibody or antigen binding fragment of embodiment 45 or 46 that comprises one or two light chains comprising SEQ ID NO: 92 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto and one or two heavy chains comprising SEQ ID NO: 80 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- Embodiment 52 The antibody or antigen binding fragment of embodiment 45 or 46 that comprises one or two light chains comprising SEQ ID NO: 96 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto and and one or two heavy chains comprising SEQ ID NO: 80 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- Embodiment 53 The antibody or antigen binding fragment of one of embodiments 45-52, wherein the antibody is an intact IgG.
- Embodiment 54 The antibody or antigen binding fragment of one of embodiments 45-52, wherein the antibody comprises a wild-type or mutated IgG2 Fc region.
- Embodiment 55 The antibody or antigen binding fragment of one of embodiments 45-52, wherein the antibody comprises a mutated IgG1 Fc region.
- Embodiment 56 The antibody or antigen binding fragment of one of embodiments 45-52, wherein the antibody comprises a mutated IgG4 Fc region.
- Embodiment 57 An antibody or antigen binding fragment thereof that binds to the same epitope of human SIRP ⁇ as an antibody as an antibody according to one of embodiments 45-52.
- Embodiment 58 The antibody or antigen binding fragment of any of embodiments 45-52, wherein the antibody or antigen binding fragment is humanized.
- Embodiment 59 A composition comprising the antibody or antigen binding fragment of any one of embodiments 45-52 and a pharmaceutically acceptable carrier or diluent.
- Embodiment 60 An antibody or antigen binding fragment according to any one of embodiments 45-52 or a composition according to embodiment 59, for the treatment of cancer or an infectious disease.
- Embodiment 61 An antibody or antigen binding fragment according to any one of embodiments 45-52 or a composition according to embodiment 59 for decreasing SIRP ⁇ /CD47 signalling in a human subject.
- Embodiment 62 A method of treating cancer in a human subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment according to any one of embodiments 45-52 or a composition according to embodiment 59, optionally in association with a further therapeutic agent or therapeutic procedure.
- Embodiment 63 A method of treating an infection or infectious disease in a human subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment according to any one of embodiments 45-52 or a composition according to embodiment 59, optionally in association with a further therapeutic agent or therapeutic procedure.
- Monoclonal, polyclonal, and humanized antibodies can be prepared (see, e.g., Sheperd and Dean (eds.) (2000) Monoclonal Antibodies, Oxford Univ. Press , New York, N.Y.; Kontermann and Dubel (eds.) (2001) Antibody Engineering , Springer-Verlag, New York; Harlow and Lane (1988) Antibodies A Laboratory Manual , Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., pp. 139-243; Carpenter, et al. (2000) J. Immunol. 165:6205; He, et al. (1998) J. Immunol. 160:1029; Tang et al. (1999) J. Biol. Chem.
- Bispecific antibodies are also provided (see, e.g., Azzoni et al. (1998) J. Immunol. 161:3493; Kita et al. (1999) J. Immunol. 162:6901; Merchant et al. (2000) J. Biol. Chem. 74:9115; Pandey et al. (2000) J. Biol. Chem. 275:38633; Zheng et al. (2001) J. Biol Chem. 276:12999; Propst et al. (2000) J. Immunol. 165:2214; Long (1999) Ann. Rev. Immunol. 17:875). Purification of antigen is not necessary for the generation of antibodies.
- Animals can be immunized with cells bearing the antigen of interest. Splenocytes can then be isolated from the immunized animals, and the splenocytes can fused with a myeloma cell line to produce a hybridoma (see, e.g., Meyaard et al. (1997) Immunity 7:283-290; Wright et al. (2000) Immunity 13:233-242; Preston et al., supra; Kaithamana et al. (1999) J. Immunol. 163:5157-5164).
- Antibodies can be conjugated, e.g., to small drug molecules, enzymes, liposomes, polyethylene glycol (PEG). Antibodies are useful for therapeutic, diagnostic, kit or other purposes, and include antibodies coupled, e.g., to dyes, radioisotopes, enzymes, or metals, e.g., colloidal gold (see, e.g., Le Doussal et al. (1991) J. Immunol. 146:169-175; Gibellini et al. (1998) J. Immunol. 160:3891-3898; Hsing and Bishop (1999) J. Immunol. 162:2804-2811; Everts et al. (2002) J. Immunol. 168:883-889).
- PEG polyethylene glycol
- Fluorescent reagents suitable for modifying nucleic acids including nucleic acid primers and probes, polypeptides, and antibodies, for use, e.g., as diagnostic reagents, are available (Molecular Probes (2003) Catalogue , Molecular Probes, Inc., Eugene, Oreg.; Sigma-Aldrich (2003) Catalogue , St. Louis, Mo.).
- CHO-K1 cells ATCC CCL-61 that had been transiently transfected, using Lipofectamine 2000, with cDNA encoding the full length open reading frame of hSIRP ⁇ V1, hSIRP ⁇ V2, hSIRP ⁇ 1, hSIRP ⁇ L, and hSIRP ⁇ subcloned into the pCI-neo vector (Promega, Madison, Wis.).
- CHO-K1.hSIRP ⁇ V1, CHO-K1.hSIRP ⁇ V2, CHO-K1.hSIRP ⁇ 1, CHO-K1.hSIRP ⁇ L, and CHO-K1.hSIRP ⁇ cells were seeded in culture medium (DMEM-F12 (Gibco) supplemented with 5% New Born Calf Serum (BioWest) and Pen/Strep (Gibco)) in 96-well flat-bottom tissue culture plates and incubated at 37° C., 5% CO 2 and 95% humidity for 24 hours.
- culture medium DMEM-F12 (Gibco) supplemented with 5% New Born Calf Serum (BioWest) and Pen/Strep (Gibco)
- culture medium was removed and cells were incubated for 1 hour at 37° C., 5% CO 2 and 95% humidity with purified hSIRP ⁇ antibodies (used at 10 ⁇ g/mL and dilutions thereof).
- purified hSIRP ⁇ antibodies used at 10 ⁇ g/mL and dilutions thereof.
- cells were washed with PBS-T and incubated for 1 hour at 37° C., 5% CO 2 and 95% humidity with goat-anti-mouse IgG-HRP (Southern Biotech).
- hSIRP ⁇ V1, hSIRP ⁇ V2, hSIRP ⁇ 1, hSIRP ⁇ L, and hSIRP ⁇ was visualized with TMB Stabilized Chromogen (Invitrogen). Reactions were stopped with 0.5 M H 2 SO 4 and absorbances were read at 450 and 610 nm. EC 50 values, the concentration at which 50% of the total binding signal is observed, were calculated using GraphPad Prism 6 (GraphPad Software, Inc.).
- hSIRP ⁇ antibodies cross-react with at least hSIRP ⁇ 1, hSIRP ⁇ L, or hSIRP ⁇ or demonstrate allele-specific binding to hSIRP ⁇ V2.
- the KWAR23 antibody cross-reacts with all members of the SIRP receptor family tested: it binds to hSIRP ⁇ V1, hSIRP ⁇ V2, hSIRP ⁇ 1, hSIRP ⁇ L, and hSIRP ⁇ .
- mice were immunized with a pCI-neo expression construct encoding hSIRP ⁇ V1 and hSIRP ⁇ V2. Mice were immunized by gene gun immunization using a Helios Gene gun (BioRad, Hercules, Calif.) and DNA coated gold bullets (BioRad) following manufacturer's instructions.
- CHO-K1.hSIRP ⁇ V1, CHO-K1.hSIRP ⁇ V2, CHO-K1.hSIRP ⁇ 1, and CHO-K1.hCD47 stable cell lines were generated by transfecting CHO-K1 cells with pCI-neo vector encoding the full length open reading frame of hSIRP ⁇ V1, hSIRP ⁇ V2, hSIRP ⁇ 1, and hCD47 (NCBI accession: NM_001777.3) (SEQ ID NO: 42), respectively. Stable clones were obtained by limiting dilution.
- Antibody titer was assessed by CELISA, using the CHO-K1.hSIRP ⁇ V1 and CHO-K1.hSIRP ⁇ V2 stable cell lines. These hSIRP ⁇ -expressing CHO-K1 cell lines were maintained in DMEM-F12 (Gibco) supplemented with 10% Fetal Bovine Serum (Hyclone) and 80U Pen/Strep (Gibco). Cells were seeded into 96-well flat-bottom tissue culture plates at 8 ⁇ 10 4 cells/well and cultured at 37° C., 5% CO 2 and 95% humidity until cell layers were confluent. Cells were incubated with each sample of the diluted mouse sera for 1 hour at 37° C., 5% CO 2 and 95% humidity.
- mice that demonstrated reactivity against hSIRP ⁇ V1 and hSIRP ⁇ V2 were immunized for a final, third time and sacrificed 14 days later.
- Erythrocyte-depleted spleen and lymph-node cell populations were prepared as described previously (Steenbakkers et al., 1992 , J. Immunol. Meth. 152: 69-77; Steenbakkers et al., 1994 , Mol. Biol. Rep. 19: 125-134) and frozen at ⁇ 180° C.
- a selection strategy was designed and developed that preferentially bound B-cells expressing antibodies that bind to hSIRP ⁇ V1 and hSIRP ⁇ V2.
- Splenocytes and lymph nodes were harvested from the hSIRP ⁇ V1/V2 immunized mice and isolated cells were incubated with CHO-K1.hSIRP ⁇ 1 that were seeded into T25 culture flasks and irradiated at 30 Gray. After 1 hour unbound cells were gently removed by moving the flask back and forth. Medium containing unbound cells was then transferred to a new T25 flask containing irradiated CHO-K1.hSIRP ⁇ 1 cells.
- Bound B-cells were cultured, as described by Steenbakkers et al., 1994 , Mol. Biol. Rep. 19: 125-134. Briefly, selected B-cells were mixed with 10% (v/v) T-cell supernatant and 50,000 irradiated (25 Gray) EL-4 B5 feeder cells in a final volume of 200 ⁇ l medium in 96-well flat-bottom tissue culture plates. On day eight, supernatants were screened for hSIRP ⁇ V1 and hSIRP ⁇ V2 reactivity by CELISA as described below.
- CHO-K1.hSIRP ⁇ V1, CHO-K1.hSIRP ⁇ V2, and CHO-K1.hSIRP ⁇ 1 were seeded in culture medium (DMEM-F12 (Gibco) supplemented with 10% Fetal Bovine Serum (Hyclone) and 80U Pen/Strep (Gibco)) in 96-well flat-bottom tissue culture plates and cultured at 37° C., 5% CO 2 and 95% humidity until they were confluent. Subsequently, culture medium was removed and cells were incubated for 1 hour at 37° C., 5% CO 2 and 95% humidity with supernatants from the B-cell cultures.
- culture medium DMEM-F12 (Gibco) supplemented with 10% Fetal Bovine Serum (Hyclone) and 80U Pen/Strep (Gibco)
- Immunoreactivity to human SIRP ⁇ was assessed by ELISA using recombinant hSIRP ⁇ /Fc-protein (R&D Systems, Cat.#4486-SB-050; SEQ ID NO: 108) coated 96-well MaxiSorp flat-bottom plates. Protein coated 96-well plates were blocked in PBS/1% bovine serum albumin (BSA) for 1 hour at room temperature (RT). PBS/1% BSA was removed and plates were incubated for 1 hour at RT with supernatants from the B-cell cultures. Next, plates were washed with PBS-T and incubated for 1 hour at RT with goat-anti-mouse IgG-HRP conjugate (Southern Biotech).
- BSA bovine serum albumin
- B-cell clones from the hSIRP ⁇ reactive supernatants, which were not or which were minimally reactive to hSIRP ⁇ 1 were immortalized by mini-electrofusion following published procedures (Steenbakkers et al., 1992 , J. Immunol. Meth. 152: 69-77; Steenbakkers et al., 1994 , Mol. Biol. Rep. 19:125-34) with some minor deviations (e.g. pronase reaction was omitted). Briefly, B-cells were mixed with 10 6 Sp2/0-Ag14 murine myeloma cells (ATCC CRL-1581) in Electrofusion Isomolar Buffer (Eppendorf).
- Electrofusions were performed in a 50 ⁇ L fusion chamber by an alternating electric field of 15 s, 1 MHz, 23 Vrms AC followed by a square, high field DC pulse of 10 ⁇ s, 180 Volt DC and again by an alternating electric field of 15 s, 1 MHz, 23 Vrms AC. Content of the chamber was transferred to hybridoma selective medium and plated in a 96-well plate under limiting dilution conditions. On day 10 following the electrofusion, hybridoma supernatants were screened for hSIRP ⁇ V1, hSIRP ⁇ V2, hSIRP ⁇ 1, and hSIRP ⁇ binding activity by CELISA and ELISA, as described above.
- Hybridomas that secreted antibodies in the supernatant that specifically bound hSIRP ⁇ V1 and hSIRP ⁇ V2 were both frozen at ⁇ 180° C. (-1 batch) and subcloned by limited dilution to safeguard their integrity and stability. Stable hybridomas were frozen at ⁇ 180° C. (-LD1 batch) until cell layers were confluent.
- hybridomas Further selection of the hybridomas was performed by assessing the blocking abilities of the hSIRP ⁇ V1/hCD47 interaction in CELISA format.
- hCD47 blockade CHO-K1.hCD47 cells were seeded in 384-well flat-bottom tissue culture plates and incubated at 37° C., 5% CO 2 and 95% humidity in culture medium.
- Recombinant hSIRP ⁇ /Fc-protein (R&D Systems, Cat.#4546-SA-050; SEQ ID NO: 107) was pre-incubated with a dilution series of the hybridoma supernatants containing hSIRP ⁇ reactive antibodies and control antibodies (at 10 ⁇ g/mL and dilutions thereof) for 30 minutes at 37° C., 5% CO 2 and 95% humidity.
- Confluent CHO-K1.hCD47 cells were washed with PBS-T and incubated for 1 hour with the mixtures containing hSIRP ⁇ reactive antibodies and recombinant hSIRP ⁇ /Fc-protein at 37° C., 5% CO 2 and 95% humidity.
- Selected stable hybridomas were cultured in serum-free media for 7 days; supernatants were harvested and antibodies were purified using MabSelect Sure Protein A resin according to the manufacturer's instructions (GE Healthcare). Antibody concentrations were quantified using spectrophotometry. Supernatants of the hybridoma cultures were used to isotype the hybridomas. In short, isotyping was done using a mouse monoclonal antibody isotyping kit (Biorad) based on a dipstick with immobilized goat-anti-mouse antibody bands to each of the common mouse isotypes and light chains. Recovered antibodies were all identified as mouse IgG1.
- Antibody sequences were elucidated by sequencing of variable regions of the mouse IgG1 hybridoma material performed at LakePharma, using the following method: the total RNA of the hybridoma cells was extracted, which allowed cDNA synthesis. Rapid Amplification of cDNA Ends (RACE) was performed that allowed cloning of positive fragments in a TOPO (Thermo Fisher Scientific) vector. TOPO clones were sequenced and sequences were annotated using VBASE2 (Retter et al., VBASE2, an integrative V gene database. Nucleic Acids Res. 2005 Jan. 1; 33(Database issue):D671-4).
- RACE Rapid Amplification of cDNA Ends
- hSIRP ⁇ .50A to hSIRP ⁇ was compared antibody KWAR23 (Canadian Patent 2939293 A1), in a CELISA format.
- CHO-K1 cells were transiently transfected with hSIRP ⁇ V1, hSIRP ⁇ V2, hSIRP ⁇ 1, and hSIRP ⁇ (GenBank accession: NM_018556.3) (SEQ ID NO: 39) cDNAs. Subsequently, hSIRP ⁇ binding was assessed by CELISA using CHO-K1.hSIRP ⁇ V1, CHO-K1.hSIRP ⁇ V2, CHO-K1.hSIRP ⁇ 1, and CHO-K1.hSIRP ⁇ cells.
- KWAR23 (SEQ ID NO: 130; SEQ ID NO: 131) was expressed as a chimeric human IgG4 kappa antibody in CHO cells. As shown in FIG. 2 and the following Table 9, KWAR23 antibody cross-reacts with all members of the SIRP receptor family tested: it binds to hSIRP ⁇ V1, hSIRP ⁇ V2, hSIRP ⁇ 1, and hSIRP ⁇ .
- EC 50 values represent the concentration at which 50% of the total binding signal is observed (average and SD were calculated from values of two independent experiments).
- hSIRP ⁇ .50A binding was assessed using CHO-K1 cells that were transiently transfected with cDNAs encoding full length hSIRP ⁇ V1, hSIRP ⁇ V2, hSIRP ⁇ V3 (NA07056_V3) (SEQ ID NO: 43), hSIRP ⁇ V4 (NA11832_V4) (SEQ ID NO: 45), hSIRP ⁇ V5 (NA18502_V5) (SEQ ID NO: 47), hSIRP ⁇ V6 (NA18507_V6) (SEQ ID NO: 49), hSIRP ⁇ V8 (NA18570_V8) (SEQ ID NO: 51), and hSIRP ⁇ V9 (NA18943_V9) (SEQ ID NO: 53).
- FIG. 3 and the following Table 10 demonstrate the reactivity of antibody clone hSIRP ⁇ .50A for each of these hSIRP ⁇ alleles.
- EC50 values represent the concentration at which 50% of the total binding signal is observed (average and SD were calculated from values of two independent experiments).
- the hSIRP ⁇ .50A antibody was analyzed by flow cytometry for its ability to block recombinant hCD47/Fc-protein (R&D Systems, Cat.#4670-CD-050; SEQ ID NO: 109) binding to cell surface expressed hSIRP ⁇ .
- hCD47/Fc-protein R&D Systems, Cat.#4670-CD-050; SEQ ID NO: 109 binding to cell surface expressed hSIRP ⁇ .
- THP-1 ATCC TIB-202
- U-937 ATCC CRL-1593.2
- THP-1 and U-937 cells were seeded in 96-well round bottomed tissue culture plates and incubated for 45 minutes with FcR Blocking Reagent (Miltenyi Biotec) and hSIRP ⁇ .50A antibody (200 ⁇ g/mL and dilutions thereof) in PBS/1% BSA at 4° C. Next, cells were washed three times with PBS/1% BSA and incubated with DyLight 488-labeled recombinant hCD47/Fc-protein for 30 minutes at 4° C.
- FcR Blocking Reagent Miltenyi Biotec
- hSIRP ⁇ .50A antibody 200 ⁇ g/mL and dilutions thereof
- hSIRP ⁇ .50A As depicted in FIG. 4 and the following Table 11, binding of recombinant hCD47 fused to an Fc domain of human IgG1 was monitored in the presence of increasing amounts of the hSIRP ⁇ .50A antibody. Antibody hSIRP ⁇ .50A blocked the hSIRP ⁇ /hCD47 interaction, using the flow cytometry-based method described above. IC50 values for the blockade of hCD47 were calculated from this data. IC50 values represent the concentration at which half of the inhibition is observed.
- hSIRP ⁇ .50A binding of hSIRP ⁇ .50A to hSIRP ⁇ expressed on primary human CD14 + monocytes was investigated.
- CD14+ monocytes were isolated from Ficoll-purified human peripheral blood mononuclear cells (PBMCs) using RosetteSep human monocyte enrichment cocktail (Stemcell).
- the percentage of monocytes present after the enrichment was determined by flow cytometry on the FACSVerse (BD Biosciences) based on CD14 staining using an APC-Cy7-conjugated mouse-anti-human CD14 detection antibody (BD Biosciences). Subsequently, CD14+ enriched PBMCs were seeded in 96-well round bottomed tissue culture plates and incubated for 40 minutes with FcR Blocking Reagent (Miltenyi Biotec) containing hSIRP ⁇ .50A antibody (25 ⁇ g/mL and dilutions thereof) in PBS/1% BSA at 4° C.
- FcR Blocking Reagent Miltenyi Biotec
- FIGS. 5A and B and the following Table 12 indicates that hSIRP ⁇ .50A binds to primary human CD14+ enriched monocytes.
- EC50 values represent the concentration at which 50% of the total binding signal is observed.
- CD14+ enriched monocytes cells were seeded in 96-well round bottomed tissue culture plates and incubated for 45 minutes with FcR Blocking Reagent (Miltenyi Biotec) and hSIRP ⁇ .50A antibody (200m/mL and dilutions thereof) in PBS/1% BSA at 4° C.
- FIGS. 5 C and D and the following Table 12 demonstrates the ability of antibody hSIRP ⁇ .50A to block the hSIRP ⁇ /hCD47 interaction. IC50 values for the blockade of hCD47 were calculated from this data. IC50 values represent the concentration at which half of the inhibition is observed.
- Example 5 Functionality of hSIRP ⁇ .50A mAb in the Human Granulocyte Phagocytosis Assay
- granulocytes e.g. effector cells
- EDTA blood was pooled and centrifuged at 300 g for 6 minutes at 20° C.
- plasma was removed by aspiration, and the remaining blood cells were gently resuspended.
- Cells were recovered in red blood cell (RBC) lysis buffer (155 mM NH4C1; 10 mM KHCO3) and incubated for 10 minutes on ice. Next, cells were centrifuged at 300 g for 7 minutes.
- RBC red blood cell
- erythrocyte-lysed blood cells were resuspended in assay medium containing 10 ng/mL IFN ⁇ and cells were incubated for 1 hour at 37° C., 5% CO 2 and 95% humidity.
- Non-adherent blood cells containing human granulocytes were collected by mild washing of the tissue culture plate with assay medium (monocytes are depleted due to adherence to the plastic surface). The percentage of granulocytes present in the cell suspension was determined by flow cytometry on the FACSCanto II (BD Biosciences) based on high forward scatter (FSC) and side scatter (SSC).
- Binding of hSIRP ⁇ .50A to human granulocytes was assessed by incubating the cells for 30 minutes at 4° C. with hSIRP ⁇ .50A antibody (25 ⁇ g/mL and dilutions thereof) in PBS/1% BSA containing 10% autologous serum (PBS/1% BSA/10% serum). Next, cells were washed three times with PBS/1% BSA/10% serum and incubated for 30 minutes at 4° C. with a FITC-labeled goat-anti-mouse Ig (BD Biosciences) detection antibody.
- FIG. 6A shows that hSIRP ⁇ .50A binds to primary human granulocytes. EC50 values represent the concentration at which 50% of the total binding signal is observed.
- target cells were fluorescently labeled with either cell proliferation dye eFluor450 (eBioscience) in the case of Raji (ECACC 85011429), Daudi (ECACC 85011437), Ramos (ECACC 85030802), and BJAB (DSMZ ACC-757) lymphoma cells or, alternatively, with Vybrant DiD cell-labeling solution (Thermo Fisher Scientific) for FaDu cells. Labeling was performed according to manufacturer's instructions.
- cell proliferation dye eFluor450 eBioscience
- Labeled target cells were co-cultured for 2-3 hours at 37° C., 5% CO 2 and 95% humidity with isolated primary human granulocytes in a 1:1 ratio (7.5*10 4 cells of each target and effector per well of a 96-well round bottomed tissue culture plate) in the presence of 0.1 ⁇ g/mL rituximab (anti-hCD20).
- rituximab anti-hCD20
- cells were co-cultured with 0.1 ⁇ g/mL rituximab in presence of 10 ⁇ g/mL hSIRP ⁇ .50A.
- Phagocytosis was assayed by determining the percentage of granulocytes positive for eFluor450 (or DID) using flow cytometry on the FACSCanto II (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC).
- hSIRP ⁇ .50A potently enhances tumor cell phagocytosis induced by rituximab ( FIG. 6B ).
- the same procedure was followed with other existing therapeutic antibodies such as 0.05 ⁇ g/mL daratumumab (anti-hCD38), 0.1 ⁇ g/mL alemtuzumab (anti-hCD52), and 0.1 ⁇ g/mL cetuximab (anti-hEGFR) ( FIG. 6C-E ).
- hSIRP ⁇ .50A enhances antibody-mediated tumor cell phagocytosis by human granulocytes.
- Blockade of CD47 by hSIRP ⁇ .50A enhances the phagocytosis of human lymphoma cells tumor cells by human macrophages.
- Human macrophages were generated by first enriching CD14+ monocytes from Ficoll-purified human peripheral blood mononuclear cells (PBMCs) using RosetteSep human monocyte enrichment cocktail (Stemcell).
- Monocytes were seeded into CellCarrier 96-well flat-bottom microplates (Perkin Elmer) and cultured in macrophage medium (IMDM (Gibco) supplemented with 8.5% Fetal Bovine Serum (Gibco) and Pen/Strep (Gibco)) containing 50 ng/mL human monocyte colony stimulating factor (M-CSF) for 7 days at 37° C., 5% CO 2 and 95% humidity to promote differentiation into macrophages. These monocyte-derived macrophages (MDMs) become adherent allowing other cells to be washed away.
- IMDM macrophage medium
- M-CSF human monocyte colony stimulating factor
- lymphoma cells Human Raji, Daudi, Ramos, and BJAB lymphoma cells were counted and labeled with cell proliferation dye eFluor450 (eBioscience) following manufacturer's instructions. After labeling, the lymphoma cells were mixed with assay medium (RPMI (Gibco) supplemented with 10% Fetal Bovine Serum (Gibco) and Pen/Strep (Gibco)) containing 10 ⁇ g/mL anti-hSIRP ⁇ antibodies, respective isotype controls and either 0.1 ⁇ g/mL rituximab (anti-hCD20) or 0.05 ⁇ g/mL daratumumab (anti-hCD38).
- assay medium RPMI (Gibco) supplemented with 10% Fetal Bovine Serum (Gibco) and Pen/Strep (Gibco)
- the lymphoma cells were then added to the individual wells containing MDMs at a ratio of 2.5:1 tumor cells per phagocyte, mixed and incubated at 37° C., 5% CO 2 and 95% humidity for 2 hours. After the incubation, the wells were washed with PBS to remove most of the non-phagocytosed tumor cells, and cells were fixed with 2% formaldehyde for 10 min at RT. The wells were then washed and maintained in PBS/3% BSA in dark at 4° C. overnight.
- Lymphoma cells present in the wells were stained with biotin-conjugated anti-human CD19 clone HIB19 (eBioscience) for 1 hour at RT, and subsequently were counterstained with Alexa Fluor 488-conjugated streptavidin (Thermo Fisher Scientific) for 1 hour at RT. Next, nuclei were stained with DRAQ5 (Thermo Fisher Scientific) for 10 minutes at RT, mixture was removed, and PBS was added to each well. Cells were analysed with the Operetta automated fluorescence microscope (Perkin Elmer). Data were processed and analysed with Columbus V2.6 software.
- hSIRP ⁇ .50A enhances rituximab and daratumumab-mediated phagocytosis activity.
- the phagocytosis of human lymphoma cells was quantified using a phagocytosis index, as follows: (number of tumor cells inside macrophages/number of macrophages)*100; counting at least 200 macrophages per sample.
- the mouse hSIRP ⁇ .50A antibody was humanized using CDR-grafting technology (see e.g. U.S. Pat. No. 5,225,539 and Williams, D. G. et al., 2010 , Antibody Engineering , volume 1, Chapter 21).
- a database was constructed containing all human sequences available in the IMGT database (Lefranc, M.-P. et al., 1999 , Nucleic Acid Res. 27:209-212) identifying 85,848 individual sequences. These sequences were queried using TBLASTN (2.2.31+) to identify template sequences that demonstrated the highest identify to the framework of hSIRP ⁇ .50A VH and VL sequences. Three VH and three VL sequences were identified that demonstrated a similarity score of 75% or higher and that displayed similar CDR lengths, preferably identical to those in hSIRP ⁇ .50A VH CDR1, CDR2, CDR3 and VL CDR1, CDR2 and CDR3, respectively.
- the frameworks encoded by GenBank (Benson, D. A. et al., 2013, Nucleic Acids Res. 41(D1): D36-42) accession # AB066948, AB067235, and U84168 were selected as templates for straight grafting of the hSIRP ⁇ .50A VH CDRs, resulting in the following cDNA constructs: SEQ ID NO: 9, 11 and 13, respectively.
- the frameworks encoded by GenBank accession # JF894288, AB363321, and L12101 were selected as templates for straight grafting of the hSIRP ⁇ .50A VL CDRs, resulting in the following cDNA constructs: SEQ ID NO: 19, 21 and 23.
- Framework and CDR definition were those as described by Kabat et al. (“Sequences of Proteins of Immunological Interest”, Kabat, E., et al., US Department of Health and Human Services, (1983)).
- a homology model of the mouse hSIRP ⁇ .50A Fv was made using the ‘Antibody Modeling Cascade’ (default parameters) within Discovery Studio 4.5.
- the homology model was built on basis of PDB ID 1CIC, for the light chain and Fv, and PDB ID 4QOX for the heavy chain.
- the CDRs were grafted in silico to study residues that are close to any of the CDRs and which might affect the loop conformation, referred as Vernier residues. Residues that might affect the loop conformation, and which are within ⁇ 5 ⁇ to the CDR surface were identified and substituted with the mouse amino acid at this position.
- the resulting templates were checked for the presence of post translational modification (PTM) motifs using Discovery Studio 4.5 and where possible (i.e. non-CDR, non-Vernier residues) changed to prevent a PTM.
- PTM post translational modification
- SEQ ID NO: 27 For the light chain the PTM removal resulted in the following construct: SEQ ID NO: 27.
- CDRs were grafted on each of the identified templates, expressed as a human IgG4 (SEQ ID NO: 65), kappa (SEQ ID NO: 63) antibody cloned in the pcDNA3.1(+) vector (Thermo Fisher Scientific) and for transient transfection in FreeStyle 293-F human embryonic kidney cells (HEK293T/17, ATCC CRL-11268).
- a human IgG4 SEQ ID NO: 65
- kappa SEQ ID NO: 63
- FreeStyle 293-F human embryonic kidney cells HEK293T/17, ATCC CRL-11268
- an IgG4 version carrying the stabilizing Adair mutation Angal S. et al., 1993, Mol Immunol. 30: 105-108
- Serine 228 is converted to Proline
- Plasmids encoding the heavy chain and light chain constructs were mixed in a 1:1 ratio (30m in total) and transiently expressed by transfection into FreeStyle 293-F cells using 293fectin transfection reagent (Invitrogen) following the manufacturer's instructions.
- Supernatants (30 ml) were harvested after 7 days and antibodies were purified using MabSelect Sure Protein A resin according to the manufacturer's instructions (GE Healthcare). Buffer was exchanged for 10 mM Histidine, 100 mM NaCl pH 5.5 buffer using Zeba desalting columns (Thermo Fisher Scientific). The concentration of purified antibodies was determined based on OD280 (Nanodrop ND-1000). Endotoxin level was determined by LAL-test according to the manufacturer's instructions (Lonza).
- Binding of the hSIRP ⁇ antibodies to human SIRP ⁇ V1, SIRP ⁇ V2, hSIRP ⁇ 1, and hSIRP ⁇ was confirmed using CHO-K1 cells that had been transiently transfected with cDNA encoding the full length open reading frame of each of these respective targets subcloned into the pCI-neo vector.
- CHO-K1.hSIRP ⁇ V1, CHO-K1.hSIRP ⁇ V2, CHO-K1.hSIRP ⁇ 1, and CHO-K1.hSIRP ⁇ cells were seeded in culture medium (DMEM-F12 (Gibco) supplemented with 5% New Born Calf Serum (BioWest) and Pen/Strep (Gibco)) in 96-well flat-bottom tissue culture plates and incubated at 37° C., 5% CO 2 and 95% humidity until cell layers were confluent. Subsequently, culture medium was removed and cells were incubated for 1 hour at 37° C., 5% CO 2 and 95% humidity with purified hSIRP ⁇ antibodies (10m/mL and dilutions thereof).
- culture medium DMEM-F12 (Gibco) supplemented with 5% New Born Calf Serum (BioWest) and Pen/Strep (Gibco)
- Table 13 Binding of humanized and parental hSIRP ⁇ .50A antibodies to CHO-K1.hSIRP ⁇ V1, CHO-K1.hSIRP ⁇ V2, CHO-K1.hSIRP ⁇ 1, and CHO-K1.hSIRP ⁇ cells.
- EC50 values represent the concentration at which 50% of the total binding signal is observed (average and SD were calculated from values of two independent experiments).
- NK-92MI cells ATCC CRL-2408
- IL-2 interleukin-2
- NK-92MI cells were seeded in 96-well round bottomed tissue culture plates and incubated for 30 minutes with the humanized hSIRP ⁇ .50A antibody variants (100m/mL and dilutions thereof) in PBS/1% BSA at 4° C. Next, cells were washed three times with PBS/1% BSA and incubated for 30 minutes at 4° C.
- Example 10 Blockade of hCD47 Binding to hSIRP ⁇ by Humanized hSIRP ⁇ .50A Antibodies
- hCD47 blockade was assessed by flow cytometry for the full panel of humanized hSIRP ⁇ .50A antibodies.
- HEK293 cells ATCC CRL-1573
- Lipofectamine 2000 Invitrogen
- the transfected cells were cultured at 37° C., 5% CO 2 and 95% humidity in medium (DMEM-F12 (Gibco) with 10% Fetal Bovine Serum (Gibco) and Pen/Strep (Gibco)) until confluent.
- cells were dissociated and seeded in 96-well round bottomed tissue culture plates and incubated for 30 minutes with the humanized hSIRP ⁇ .50A antibody variants (100m/mL and dilutions thereof) in PBS/1% BSA at 4° C.
- cells were washed three times with PBS/1% BSA and incubated with recombinant hCD47/Fc-protein (ModiQuest; SEQ ID NO: 42) for 30 minutes at 4° C.
- cells were washed three times with PBS/1% BSA and incubated for 30 minutes at 4° C. with a mouse-anti-human IgG1 Hinge-FITC (Southern Biotech) detection antibody.
- binding of recombinant hCD47 fused to an Fc domain of human IgG1 was monitored in the presence of increasing amounts of the humanized hSIRP ⁇ .50A antibody variants. All antibody variants blocked the hSIRP ⁇ /hCD47 interaction.
- Ig-like V-type IgV
- IgC1 Ig-like C1-type
- IgC2 Ig-like C2-type domain.
- IgV domain is also known as the ligand-binding N-terminal domain of SIRP ⁇ (which binds to CD47).
- the human SIRP ⁇ V1/31 mutants were designed on the basis of the full length hSIRP ⁇ V1 sequence (SEQ ID NO: 33) and each individual Ig-like domain was substituted for the equivalent domain of human SIRP ⁇ 1 (SEQ ID NO: 37).
- the cDNAs encoding the constructs, hSIRP ⁇ -V ⁇ C1 ⁇ C2 ⁇ (SEQ ID NO: 55), hSIRP ⁇ -V ⁇ C1 ⁇ C2 ⁇ (SEQ ID NO: 57), and hSIRP ⁇ -V ⁇ C1 ⁇ C2 ⁇ (GeneArt) and subcloned into the pCI-neo vector.
- CHO-K1 cells were transiently transfected, using Lipofectamine 2000, with the pCI-neo vectors encoding hSIRP ⁇ V1, hSIRP ⁇ V2, hSIRP ⁇ 1, hSIRP ⁇ -V ⁇ C1 ⁇ C2 ⁇ , hSIRP ⁇ -V ⁇ C1 ⁇ C2 ⁇ , and hSIRP ⁇ -VaC1 ⁇ C2 ⁇ , respectively.
- the transfected cells were cultured at 37° C., 5% CO 2 and 95% humidity in medium (DMEM-F12 (Gibco) with 5% New Born Calf serum (Biowest) and Pen/Strep (Gibco)) until confluent. Subsequently, cells were trypsinized and seeded in 96-well flat-bottom tissue culture plates and cultured at 37° C., 5% CO 2 and 95% humidity in culture medium until confluent. Then, culture medium was removed and cells were incubated for 1 hour at 37° C., 5% CO 2 and 95% humidity with hSIRP ⁇ .50A and anti-hSIRP ⁇ clone SE5A5 antibodies.
- medium DMEM-F12 (Gibco) with 5% New Born Calf serum (Biowest) and Pen/Strep (Gibco)
- the antibody of the present invention demonstrated loss of binding to the hSIRP ⁇ -V ⁇ C1 ⁇ C2 ⁇ mutant, indicating that hSIRP ⁇ .50A binds to the IgV domain of hSIRP ⁇ ( FIG. 9 ; Table 14).
- EC50 values represent the concentration at which 50% of the total binding signal is observed (average and SD were calculated from values of two independent experiments).
- FIG. 10A shows an alignment of the hSIRP ⁇ and hSIRP ⁇ 1 IgV domain. Amino acids in the hSIRP ⁇ IgV domain that are altered in hSIRP ⁇ 1 were mutated by using the QuikChange II Site-Directed Mutagenesis Kit (Stratagene) and the full length hSIRP ⁇ V1 sequence (SEQ ID NO: 33) as donor cDNA.
- hSIRP ⁇ .50A Binding of hSIRP ⁇ .50A to hSIRP ⁇ V1 point mutants was tested using CELISA.
- CHO-K1 cells were transiently transfected, using Lipofectamine 2000, with cDNA encoding the full length open reading frame of hSIRP ⁇ V1 and mutants thereof, and hSIRP ⁇ 1 subcloned into the pCI-neo vector.
- Transfected cells were seeded in culture medium (DMEM-F12 (Gibco) supplemented with 5% New Born Calf Serum (BioWest) and Pen/Strep (Gibco)) in 96-well flat-bottom tissue culture plates and incubated at 37° C., 5% CO 2 and 95% humidity for 24 hours. Subsequently, culture medium was removed and cells were incubated for 1 hour at 37° C., 5% CO 2 and 95% humidity with purified hSIRP ⁇ antibodies (used at 10m/mL and dilutions thereof).
- culture medium DMEM-F12 (Gibco) supplemented with 5% New Born Calf Serum (BioWest) and Pen/Strep (Gibco)
- culture medium was removed and cells were incubated for 1 hour at 37° C., 5% CO 2 and 95% humidity with purified hSIRP ⁇ antibodies (used at 10m/mL and dilutions thereof).
- EC50 values the concentration at which 50% of the total binding signal is observed, were calculated using GraphPad Prism 6 (GraphPad Software, Inc.) (average and SD were calculated from values of two independent experiments).
- the Proline at position 74 constitutes a crucial amino acid for the specific binding of hSIRP ⁇ .50A to hSIRP ⁇ V1.
- hSIRP ⁇ .40A and hSIRP ⁇ .50A to hSIRP ⁇ were compared in a CELISA format.
- CHO-K1 cells were transiently transfected with hSIRP ⁇ V1, hSIRP ⁇ V2, hSIRP ⁇ 1, hSIRP ⁇ L, and hSIRP ⁇ cDNAs.
- hSIRP ⁇ binding was assessed by CELISA using CHO-K1.hSIRP ⁇ V1, CHO-K1.hSIRP ⁇ V2, CHO-K1.hSIRP ⁇ 1, CHO-K1.hSIRP ⁇ 3L, and CHO-K1.hSIRP ⁇ cells.
- hSIRP ⁇ .40A and hSIRP ⁇ .50A antibodies bind to hSIRP ⁇ V1, hSIRP ⁇ V2, hSIRP ⁇ L, and hSIRP ⁇ , but do not display detectable hSIRP ⁇ 1 binding.
- EC 50 values represent the concentration at which 50% of the total binding signal is observed (average and SD were calculated from values of two independent experiments).
- hSIRP ⁇ .40A binding was assessed using CHO-K1 cells that were transiently transfected with cDNAs encoding full length hSIRP ⁇ V1, hSIRP ⁇ V2, hSIRP ⁇ V3 (NA07056_V3) (SEQ ID NO: 44), hSIRP ⁇ V4 (NA11832_V4) (SEQ ID NO: 46), hSIRP ⁇ V5 (NA18502_V5) (SEQ ID NO: 48), hSIRP ⁇ V6 (NA18507_V6) (SEQ ID NO: 50), hSIRP ⁇ V8 (NA18570_V8) (SEQ ID NO: 52), and hSIRP ⁇ V9 (NA18943_V9) (SEQ ID NO: 54).
- FIG. 12 and the following Table 17 demonstrates the reactivity of antibody clone hSIRP ⁇ .40A for each of these hSIRP ⁇ alleles.
- EC50 values represent the concentration at which 50% of the total binding signal is observed (average and SD were calculated from values of two independent experiments).
- the hSIRP ⁇ .40A antibody was analyzed by flow cytometry for its ability to block recombinant hCD47/Fc-protein (R&D Systems, Cat.#4670-CD-050; SEQ ID NO: 109) binding to cell surface expressed hSIRP ⁇ .
- hCD47/Fc-protein R&D Systems, Cat.#4670-CD-050; SEQ ID NO: 109 binding to cell surface expressed hSIRP ⁇ .
- THP-1 ATCC TIB-202
- U-937 ATCC CRL-1593.2
- THP-1 and U-937 cells were seeded in 96-well round bottomed tissue culture plates and incubated for 45 minutes with FcR Blocking Reagent (Miltenyi Biotec) and hSIRP ⁇ .40A antibody (100 ⁇ g/mL and dilutions thereof) in PBS/1% BSA at 4° C. Next, cells were washed three times with PBS/1% BSA and incubated with DyLight 488-labeled recombinant hCD47/Fc-protein for 30 minutes at 4° C.
- FcR Blocking Reagent Miltenyi Biotec
- hSIRP ⁇ .40A antibody 100 ⁇ g/mL and dilutions thereof
- hSIRP ⁇ .40A As depicted in FIG. 13 and the following Table 18, binding of recombinant hCD47 fused to an Fc domain of human IgG1 was monitored in the presence of increasing amounts of the hSIRP ⁇ .40A antibody. Antibody hSIRP ⁇ .40A blocked the hSIRP ⁇ /hCD47 interaction, using the flow cytometry-based method described above. IC50 values for the blockade of hCD47 were calculated from this data. IC50 values represent the concentration at which half of the inhibition is observed.
- hSIRP ⁇ .40A binding of hSIRP ⁇ .40A to hSIRP ⁇ expressed on primary human CD14 + monocytes was investigated.
- CD14+ monocytes were isolated from Ficoll-purified human peripheral blood mononuclear cells (PBMCs) using RosetteSep human monocyte enrichment cocktail (Stemcell).
- the percentage of monocytes present after the enrichment was determined by flow cytometry on the FACSVerse (BD Biosciences) based on CD14 staining using an APC-Cy7-conjugated mouse-anti-human CD14 detection antibody (BD Biosciences). Subsequently, CD14+ enriched PBMCs were seeded in 96-well round bottomed tissue culture plates and incubated for 40 minutes with FcR Blocking Reagent (Miltenyi Biotec) containing hSIRP ⁇ .40A antibody (20m/mL and dilutions thereof) in PBS/1% BSA at 4° C.
- FcR Blocking Reagent Miltenyi Biotec
- FIGS. 14A and B shows that hSIRP ⁇ .40A binds to primary human CD14+ enriched monocytes.
- EC50 values represent the concentration at which 50% of the total binding signal is observed.
- CD14+ enriched monocytes cells were seeded in 96-well round bottomed tissue culture plates and incubated for 45 minutes with FcR Blocking Reagent (Miltenyi Biotec) and hSIRP ⁇ .40A antibody (20m/mL and dilutions thereof) in PBS/1% BSA at 4° C.
- FIGS. 14 C and D demonstrates the ability of antibody hSIRP ⁇ .40A to block the hSIRP ⁇ /hCD47 interaction. IC50 values for the blockade of hCD47 were calculated from this data. IC50 values represent the concentration at which half of the inhibition is observed.
- Example 14 Functionality of hSIRP ⁇ .40A mAb in the Human Granulocyte Phagocytosis Assay
- granulocytes e.g. effector cells
- EDTA blood was pooled and centrifuged at 300 g for 6 minutes at 20° C.
- plasma was removed by aspiration, and the remaining blood cells were gently resuspended.
- Cells were recovered in red blood cell (RBC) lysis buffer (155 mM NH4C1; 10 mM KHCO3) and incubated for 10 minutes on ice. Next, cells were centrifuged at 300 g for 7 minutes.
- RBC red blood cell
- erythrocyte-lysed blood cells were resuspended in assay medium containing 10 ng/mL IFN ⁇ and cells were incubated for 1 hour at 37° C., 5% CO 2 and 95% humidity.
- Non-adherent blood cells containing human granulocytes were collected by mild washing of the tissue culture plate with assay medium (monocytes are depleted due to adherence to the plastic surface). The percentage of granulocytes present in the cell suspension was determined by flow cytometry on the FACSCanto II (BD Biosciences) based on high forward scatter (FSC) and side scatter (SSC).
- Binding of hSIRP ⁇ .40A to human granulocytes was assessed by incubating the cells for 30 minutes at 4° C. with hSIRP ⁇ .40A antibody (25 ⁇ g/mL and dilutions thereof) in PBS/1% BSA containing 10% autologous serum (PBS/1% BSA/10% serum). Next, cells were washed three times with PBS/1% BSA/10% serum and incubated for 30 minutes at 4° C. with a FITC-labeled goat-anti-mouse Ig (BD Biosciences) detection antibody.
- FIG. 15A and the following Table 19 shows that hSIRP ⁇ .40A binds to primary human granulocytes. EC50 values represent the concentration at which 50% of the total binding signal is observed.
- Ramos ECACC 85030802 target cells were fluorescently labeled with cell proliferation dye eFluor450 (eBioscience). Labeling was performed according to manufacturer's instructions. Labeled target cells were co-cultured for 2-3 hours at 37° C., 5% CO 2 and 95% humidity with isolated primary human granulocytes in a 1:1 ratio (7.5*10 4 cells of each target and effector per well of a 96-well round bottomed tissue culture plate) in the presence of 0.1 ⁇ g/mL rituximab (anti-hCD20). In addition, cells were co-cultured with 0.1 ⁇ g/mL rituximab in presence of 10 ⁇ g/mL hSIRP ⁇ .40A.
- Phagocytosis was assayed by determining the percentage of granulocytes positive for eFluor450 using flow cytometry on the FACSCanto II (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC).
- hSIRP ⁇ .40A potently enhances tumor cell phagocytosis induced by rituximab ( FIG. 15B ).
- Example 15 Functionality of hSIRP ⁇ .40A mAb in the Human Macrophage Phagocytosis Assay
- Blockade of CD47 by hSIRP ⁇ .40A enhances the phagocytosis of human lymphoma cells tumor cells by human macrophages.
- Human macrophages were generated by first enriching CD14+ monocytes from Ficoll-purified human peripheral blood mononuclear cells (PBMCs) using RosetteSep human monocyte enrichment cocktail (Stemcell).
- Monocytes were seeded into CellCarrier 96-well flat-bottom microplates (Perkin Elmer) and cultured in macrophage medium (IMDM (Gibco) supplemented with 8.5% Fetal Bovine Serum (Gibco) and Pen/Strep (Gibco)) containing 50 ng/mL human monocyte colony stimulating factor (M-CSF) for 7 days at 37° C., 5% CO 2 and 95% humidity to promote differentiation into macrophages. These monocyte-derived macrophages (MDMs) become adherent allowing other cells to be washed away. Human Raji lymphoma cells were counted and labeled with cell proliferation dye eFluor450 (eBioscience) following manufacturer's instructions.
- IMDM Manton fetaluor450
- eBioscience cell proliferation dye
- the lymphoma cells were mixed with assay medium (RPMI (Gibco) supplemented with 10% Fetal Bovine Serum (Gibco) and Pen/Strep (Gibco)) containing 100 ⁇ g/mL anti-hSIRP ⁇ antibodies and dilutions thereof, the respective isotype control antibody, and 1 ⁇ g/mL rituximab (anti-hCD20).
- assay medium RPMI (Gibco) supplemented with 10% Fetal Bovine Serum (Gibco) and Pen/Strep (Gibco)
- the lymphoma cells were then added to the individual wells containing MDMs at a ratio of 2.5:1 tumor cells per phagocyte, mixed and incubated at 37° C., 5% CO 2 and 95% humidity for 2 hours.
- the wells were washed with PBS to remove most of the non-phagocytosed tumor cells, and cells were fixed with 2% formaldehyde for 10 min at RT. The wells were then washed and maintained in PBS/3% BSA in dark at 4° C. overnight. Lymphoma cells present in the wells were stained with biotin-conjugated anti-human CD19 clone HIB19 (eBioscience) for 1 hour at RT, and subsequently were counterstained with Alexa Fluor 488-conjugated streptavidin (Thermo Fisher Scientific) for 1 hour at RT.
- biotin-conjugated anti-human CD19 clone HIB19 eBioscience
- Alexa Fluor 488-conjugated streptavidin Thermo Fisher Scientific
- nuclei were stained with DRAQ5 (Thermo Fisher Scientific) for 10 minutes at RT, mixture was removed, and PBS was added to each well. Cells were analysed with the Operetta automated fluorescence microscope (Perkin Elmer). Data were processed and analysed with Columbus V2.6 software.
- hSIRP ⁇ .40A enhances rituximab-mediated phagocytosis activity.
- the phagocytosis of human lymphoma cells was quantified using a phagocytosis index, as follows: (number of tumor cells inside macrophages/number of macrophages)*100; counting at least 200 macrophages per sample.
- the mouse hSIRP ⁇ .40A antibody was humanized using CDR-grafting technology (see e.g. U.S. Pat. No. 5,225,539 and Williams, D. G. et al., 2010, Antibody Engineering, volume 1, Chapter 21).
- human germline sequences were identified using IgBLAST (Ye J. et al., Nucleic Acids Res. 41:W34-40 (2013).
- VH human germline sequence V-gene IGHV1-46*01 was identified (62.2% identity) and for the VL human germline sequence IGKV1-39*01 was identified (68.4% identity).
- a database was constructed containing all human sequences available in the IMGT database (Lefranc, M.-P. et al., Nucleic Acid Res. 27:209-212 (1999)) identifying 85,848 individual sequences. These sequences were queried using TBLASTN (2.2.31+) to identify template sequences that demonstrated the highest identify to the framework of hSIRP ⁇ .40A VH and VL sequences. Four VH and four VL sequences were identified that demonstrated a similarity score of 80% or higher and that displayed similar CDR lengths, preferably identical to those in hSIRP ⁇ .40A VH CDR1, CDR2, CDR3 and VL CDR1, CDR2 and CDR3, respectively.
- the frameworks encoded by GenBank (Benson, D. A. et al., Nucleic Acids Res. 41(D1):D36-42 (2013)) accession # L39130, DJ031925, DJ326840, and EF177968 were selected as templates for grafting of the hSIRP ⁇ .40A VH CDRs, resulting in the following cDNA constructs: SEQ ID NO: 77, 79, 81 and 83, respectively.
- the frameworks encoded by GenBank accession # AY731031, DQ840993, AY942002 and DQ535171 were selected as templates for straight grafting of the hSIRP ⁇ .40A VL CDRs, resulting in the following cDNA constructs: SEQ ID NO: 89, 91, 93 and 95. Additionally, a database was constructed containing all humanized antibody sequences available in the public domain, identifying 300 sequences. These sequences were queried using BLASTP (2.2.31+) to identify template sequences that demonstrated the highest identify to the framework of hSIRP ⁇ .40A VH and VL sequences.
- the framework of Gemtuzumab was selected as template, for grafting of the hSIRP ⁇ .40A VH CDRs, resulting in the following cDNA construct: SEQ ID NO: 85.
- the framework of Alacizumab was selected as template, for grafting of the hSIRP ⁇ .40A VL CDRs, resulting in the following cDNA construct: SEQ ID NO: 97
- a homology model of the mouse hSIRP ⁇ .40A Fv was made using the ‘Antibody Modeling Cascade’ (default parameters) within Discovery Studio 4.5.
- the homology model was built on basis of PDB ID 3UMT, for the light chain, PDB ID 1EHL for the heavy chain, and PDB ID 3BGF for the Fv.
- the CDRs were grafted in silico to study residues that are close to any of the CDRs and which might affect the loop conformation, referred to as Vernier residues. Residues that might affect the loop conformation, and which are within ⁇ 5 ⁇ to the CDR surface were identified and substituted with the mouse amino acid at this position.
- the resulting templates were checked for the presence of post translational modification (PTM) motifs using Discovery Studio 4.5 and where possible (i.e. non-CDR, non-Vernier residues) changed to prevent a PTM.
- PTM post translational modification
- the VH CDR2 contained a glycosylation site that was removed by an aspargine to serine mutation.
- CDRs were grafted on each of the identified templates, expressed as a human IgG2 (SEQ ID NO: 68), kappa (SEQ ID NO: 64) antibody cloned in the pcDNA3.1(+) vector (Thermo Fisher Scientific) and for transient transfection in FreeStyle 293-F human embryonic kidney cells (HEK293T/17, ATCC CRL-11268).
- Plasmids encoding the heavy chain and light chain humanized constructs were mixed in a 1:1 ratio (30m in total) and transiently expressed by transfection into FreeStyle 293-F cells using 293fectin transfection reagent (Invitrogen) following the manufacturer's instructions.
- Supernatants (30 ml) were harvested after 7 days, filtered over a 0.22 ⁇ m filter, and antibodies were purified using MabSelect Sure Protein A resin according to the manufacturer's instructions (GE Healthcare). Buffer was exchanged for 10 mM Histidine, 100 mM NaCl pH 5.5 buffer using Zeba desalting columns (Thermo Fisher Scientific). The concentration of purified antibodies was determined based on OD280 (Nanodrop ND-1000). Endotoxin level was determined by LAL-test according to the manufacturer's instructions (Lonza).
- Binding of the parental and humanized antibodies to hSIRP ⁇ was assessed by flow cytometry using the CHO-K1.hSIRP ⁇ V1 stable cell line.
- CHO-K1.hSIRP ⁇ V1 cells were seeded in 96-well round bottomed tissue culture plates and incubated for 40 minutes with the humanized hSIRP ⁇ .40A antibody variants (20 ⁇ g/mL and dilutions thereof) in PBS/1% BSA at 4° C. Next, cells were washed three times with PBS/1% BSA and incubated for 40 minutes at 4° C.
- Example 19 Blockade of hCD47 Binding to hSIRP ⁇ by Humanized hSIRP ⁇ .40A Antibodies
- hCD47 blockade was assessed by flow cytometry for the full panel of humanized hSIRP ⁇ .40A antibodies.
- the U-937 (ATCC CRL-1593.2) monocyte cell line was used as the source of hSIRP ⁇ in the assay.
- U-937 cells were seeded in 96-well round bottomed tissue culture plates and incubated for 45 minutes with FcR Blocking Reagent (Miltenyi Biotec) and the parental or humanized hSIRP ⁇ .40A antibody variants (20 ⁇ g/mL and dilutions thereof) in PBS/1% BSA at 4° C.
- binding of recombinant hCD47 fused to an Fc domain of human IgG1 was monitored in the presence of increasing amounts of the humanized hSIRP ⁇ .40A antibody variants.
- Humanized hSIRP ⁇ .40A blocked the hSIRP ⁇ /hCD47 interaction, using the flow cytometry-based method described above.
- IC50 values for the blockade of hCD47 were calculated from this data. IC50 values represent the concentration at which half of the inhibition is observed.
- Example 20 Binding domain of hSIRP ⁇ .40A
- Ig-like (immunoglobulin-like) V-type (IgV), Ig-like C1-type (IgC1), and Ig-like C2-type (IgC2) domain Ig-like C1-type (IgC1)
- Ig-like C2-type (IgC2) domain Ig-like C2-type domain.
- the IgV domain is also known as the ligand-binding N-terminal domain of SIRP ⁇ and SIRP ⁇ (which binds to CD47).
- the human SIRP ⁇ 1/ ⁇ mutants were designed based on the full length hSIRP ⁇ 1 sequence (SEQ ID NO: 38) and each individual Ig-like domain was substituted for the equivalent domain of human SIRP ⁇ (SEQ ID NO: 40).
- the cDNAs encoding the constructs, hSIRP-V ⁇ C1 ⁇ C2 ⁇ (SEQ ID NO: 110), hSIRP-V ⁇ C1 ⁇ C2 ⁇ (SEQ ID NO: 112), and hSIRP-V ⁇ C1 ⁇ C2 ⁇ (SEQ ID NO: 114) were synthesized (GeneArt) and subcloned into the pCI-neo vector. Binding of hSIRP ⁇ .40A to the exchange mutants was tested using CELIS A.
- CHO-K1 cells were transiently transfected, using Lipofectamine 2000, with the pCI-neo vectors encoding hSIRP ⁇ V1, hSIRP ⁇ V2, hSIRP ⁇ 1, hSIRP-V ⁇ C1 ⁇ C2 ⁇ , hSIRP-V ⁇ C1 ⁇ C2 ⁇ , and hSIRP-V ⁇ C1 ⁇ C2 ⁇ , respectively.
- the transfected cells were cultured at 37° C., 5% CO 2 and 95% humidity in medium (DMEM-F12 (Gibco) with 5% New Born Calf serum (Biowest) and Pen/Strep (Gibco)) until confluent.
- cells were trypsinized and seeded in 96-well flat-bottom tissue culture plates and cultured at 37° C., 5% CO 2 and 95% humidity in culture medium until confluent. Then, culture medium was removed and cells were incubated for 1 hour at 37° C., 5% CO 2 and 95% humidity with hSIRP ⁇ .40A, hSIRP ⁇ .50A, and anti-hSIRP ⁇ clone SE5A5 antibodies. Next, cells were washed with PBS-T and incubated for 1 hour at 37° C., 5% CO 2 and 95% humidity with goat-anti-mouse IgG-HRP conjugate (Southern Biotech).
- the antibody of the present invention demonstrated gain of binding to the hSIRP-V ⁇ C1 ⁇ C2 ⁇ mutant, indicating that hSIRP ⁇ .40A binds to the IgV domain of hSIRP ⁇ and hSIRP ⁇ ( FIG. 19 and Table 22).
- EC50 values represent the concentration at which 50% of the total binding signal is observed (average and SD were calculated from values of two independent experiments).
- hSIRP ⁇ IgV domain Amino acids in the hSIRP ⁇ IgV domain that are altered in hSIRP ⁇ 1 were mutated by using the QuikChange II Site-Directed Mutagenesis Kit (Stratagene) and the full length hSIRP ⁇ V1 sequence (SEQ ID NO: 33) as donor cDNA. Binding of hSIRP ⁇ .40A to hSIRP ⁇ V1 point mutants was tested using CELISA. To this end, CHO-K1 cells were transiently transfected, using Lipofectamine 2000, with cDNA encoding the full length open reading frame of hSIRP ⁇ V1 and mutants thereof, and hSIRP ⁇ 1 subcloned into the pCI-neo vector.
- Transfected cells were seeded in culture medium (DMEM-F12 (Gibco) supplemented with 5% New Born Calf Serum (BioWest) and Pen/Strep (Gibco)) in 96-well flat-bottom tissue culture plates and incubated at 37° C., 5% CO 2 and 95% humidity for 24 hours. Subsequently, culture medium was removed and cells were incubated for 1 hour at 37° C., 5% CO 2 and 95% humidity with purified hSIRP ⁇ antibodies (used at 10m/mL and dilutions thereof).
- culture medium DMEM-F12 (Gibco) supplemented with 5% New Born Calf Serum (BioWest) and Pen/Strep (Gibco)
- culture medium was removed and cells were incubated for 1 hour at 37° C., 5% CO 2 and 95% humidity with purified hSIRP ⁇ antibodies (used at 10m/mL and dilutions thereof).
- the Proline at position 74 constitutes a crucial amino acid for the specific binding of hSIRP ⁇ .40A to hSIRP ⁇ V1.
- This proline is not present in the IgV domain sequence of hSIRP ⁇ 1, and could play a role in the correct conformation of the IgV domain.
- Example 21 Functionality of Chimeric hSIRP ⁇ .40A mAb Variants in the Human Macrophage Phagocytosis Assay
- hSIRP ⁇ .40A variable domains grafted on different Fc constant domains
- experimental conditions for the human macrophage phagocytosis assay were similar as explained in Example 15 above.
- Labelled Raji lymphoma cells were mixed with assay medium containing either 10 ⁇ g/mL or 1 ⁇ g/mL chimeric hSIRP ⁇ .40A antibody variants and 1 ⁇ g/mL rituximab and then added to MDMs at a ratio of 2.5:1 tumor cells per phagocyte.
- Cells were incubated at 37° C., 5% CO 2 and 95% humidity for 2 hours.
- phagocytosis of human lymphoma cells was quantified using a phagocytosis index, as follows: (number of tumor cells inside macrophages/number of macrophages)*100; counting at least 200 macrophages per sample.
- the wild-type (WT) chimeric hSIRP ⁇ .40A.hIgG4 antibody does not enhance rituximab-mediated phagocytosis
- inert chimeric hSIRP ⁇ .40A.hIgG1 SEQ ID NO: 119
- antibody variants containing N297Q SEQ ID NO: 126
- L234A.L235A LALA
- L234A.L235A.P329G LALAPG
- hSIRP ⁇ .40A.hIgG2 and the inert chimeric hSIRP ⁇ .40A.hIgG2 antibody variant containing V234A.G237A.P238S.H268A.V309L.A330S.P331S (Sigma) (SEQ ID NO: 122) mutations enhance rituximab-mediated phagocytosis activity in a concentration-dependent manner.
- Example 22 Functionality of Humanized hSIRP ⁇ .40A mAb Variants in the Human Macrophage Phagocytosis Assay
- the humanized hSIRP ⁇ .40A antibody variants enhance rituximab-mediated phagocytosis activity in a concentration-dependent manner similar to antibody KWAR23 grafted on a hIgG2 Fc.
- Example 23 Functionality of Chimeric hSIRP ⁇ .50A mAb Variants in the Human Macrophage Phagocytosis Assay
- hSIRP ⁇ .50A variable domains grafted on different Fc constant domains
- FIG. 23A the chimeric hSIRP ⁇ .50A.hIgG4 antibody marginally enhances rituximab-mediated phagocytosis
- the chimeric hSIRP ⁇ .50A.hIgG2 antibody enhances rituximab-mediated phagocytosis activity similar to the murine hSIRP ⁇ .50A.mIgG1 (SEQ ID NO: 120) antibody.
- hSIRP ⁇ .50A.hIgG2 antibody potently enhances tumor cell phagocytosis induced by rituximab in a concentration-dependent manner as compared to the human IgG2 isotype control.
- hSIRP ⁇ .50A.hIgG2 enhanced daratumumab-mediated phagocytosis (anti-hCD38, used at 0.05 ⁇ g/mL) ( FIG. 23C ).
- hSIRP ⁇ .50A.hIgG2 also enhanced rituximab-mediated phagocytosis in human granulocytes.
- the chimeric hSIRP ⁇ .50A.hIgG2 antibody enhances phagocytosis activity induced by rituximab to a similar extend as the murine hSIRP ⁇ .50A.mIgG1 antibody.
- FIG. 23D the chimeric hSIRP ⁇ .50A.hIgG2 antibody enhances phagocytosis activity induced by rituximab to a similar extend as the murine hSIRP ⁇ .50A.mIgG1 antibody.
- the chimeric hSIRP ⁇ .50A.hIgG1.N297Q, hSIRP ⁇ .50A.hIgG4.N297Q (SEQ ID NO: 127) or hSIRP ⁇ .50A.hIgG2 antibodies enhance rituximab-mediated phagocytosis activity by human MDMs to a similar extent as the murine hSIRP ⁇ .50A.mIgG1 antibody (rituximab used at 1 ⁇ g/mL). Similar observations were made in FIG. 24B when phagocytosis was induced by daratumumab (0.05 ⁇ g/mL). As shown in FIG.
- the chimeric hSIRP ⁇ .50A.hIgG1.N297Q and hSIRP ⁇ .50A hIgG1.L234A.L235A.P329G antibodies also enhance rituximab-mediated phagocytosis activity by human MDMs to a similar extent as the or hSIRP ⁇ .50A.hIgG2 antibody (rituximab used at 1 ⁇ g/mL).
- Chimeric variants of hSIRP ⁇ .50A mAb containing a wild-type hIgG1 or hIgG4 Fc region did not enhance tumor cell phagocytosis.
- Example 24 Comparison of KWAR23, Clone 18D5, hSIRP ⁇ .50A, and hSIRP ⁇ .40A Antibodies
- CHO-K1 cells ATCC CCL-61 expressing a cDNA encoding the full length open reading frame of hSIRP ⁇ V1, hSIRP ⁇ V1(P74A), hSIRP ⁇ V2, and hSIRP ⁇ 1 subcloned into the pCI-neo vector (Promega, Madison, Wis.).
- CHO-K1.hSIRP ⁇ V1, CHO-K1.hSIRP ⁇ V1(P74A), CHO-K1.hSIRP ⁇ V2, and CHO-K1.hSIRP ⁇ 1 cells were seeded in culture medium (DMEM-F12 (Gibco) supplemented with 5% New Born Calf Serum (BioWest) and Pen/Strep (Gibco)) in 96-well flat-bottom tissue culture plates and incubated at 37° C., 5% CO 2 and 95% humidity for 24 hours.
- culture medium DMEM-F12 (Gibco) supplemented with 5% New Born Calf Serum (BioWest) and Pen/Strep (Gibco)
- hSIRP ⁇ antibodies used at 10m/mL and dilutions thereof.
- cells were washed with PBS-T and incubated for 1 hour at 37° C., 5% CO 2 and 95% humidity with goat-anti-mouse IgG-HRP (Southern Biotech).
- PBS-T immunoreactivity against hSIRP ⁇ V1, hSIRP ⁇ V1(P74A), hSIRP ⁇ V2, and hSIRP ⁇ 1 was visualized with TMB Stabilized Chromogen (Invitrogen).
- Binding to hSIRP ⁇ was assessed by flow cytometry using the Jurkat E6.1 T cell leukemia cell line (ECACC 88042803).
- Jurkat cells were seeded in 96-well round bottomed tissue culture plates and incubated for 40 minutes with the anti-hSIRP ⁇ antibodies (20m/mL and dilutions thereof) in PBS/1% BSA at 4° C. Next, cells were washed three times with PBS/1% BSA and incubated for 40 minutes at 4° C. with an Alexa Fluor 647-labeled goat-anti-mouse IgG (Invitrogen) detection antibody in PBS/1% BSA.
- an Alexa Fluor 647-labeled goat-anti-mouse IgG Invitrogen
- KWAR23 and clone 18D5 antibodies cross-react with at least hSIRP ⁇ 1 and the P74A variant of hSIRP ⁇ V1.
- the hSIRP ⁇ .50A, and hSIRP ⁇ .40A antibodies of the present invention do not bind to either hSIRP ⁇ 1 or the P74A variant of hSIRP ⁇ V1 under the tested conditions.
- the hSIRP ⁇ .50A, and hSIRP ⁇ .40A antibodies of the present invention similarly distinguish from antibody clone SIRP29 from WO2013/056352.
- hCD47 blockade for the KWAR23, clone 18D5, and hSIRP ⁇ .40A antibodies was assessed by flow cytometry.
- THP-1 ATCC TIB-202
- U-937 ATCC CRL-1593.2 monocyte cell lines were used as the source of hSIRP ⁇ in the assay.
- THP-1 and U-937 cells were seeded in 96-well round bottomed tissue culture plates and incubated for 45 minutes with FcR Blocking Reagent (Miltenyi Biotec) and indicated anti-hSIRP ⁇ antibodies (20 ⁇ g/mL and dilutions thereof) in PBS/1% BSA at 4° C.
- IC50 values for the blockade of hCD47 were calculated from this data. IC50 values represent the concentration at which half of the inhibition is observed.
- hSIRP ⁇ .40A, hSIRP ⁇ .50A, and KWAR23 antibodies block rhCD47/Fc binding to both the THP-1 and U-937 monocyte cell lines which express the hSIRP ⁇ V2 and hSIRP ⁇ V1 allele, respectively.
- Antibody clone 18D5 blocks rhCD47/Fc binding to the U-937 monocyte cell line but does not block rhCD47/Fc binding to the THP-1 monocyte cell line, in line with the observation that 18D5 does not bind to hSIRP ⁇ V2 (Table 24).
- the hSIRP ⁇ .50A, and hSIRP ⁇ .40A antibodies of the present invention similarly distinguish from antibody clone 18D5.
- Example 25 Mapping the Interaction Interface Between hSIRP ⁇ -hSIRP ⁇ .40A and hSIRP ⁇ -hSIRP ⁇ .50A
- hSIRP ⁇ The amino acids on hSIRP ⁇ that are bound by hSIRP ⁇ .40A or hSIRP ⁇ .50A were elucidated by a procedure that involves deuterated chemical cross-linking followed by enzymatic digestion and detection using mass spectrometry.
- antibody hSIRP ⁇ .40A and antigen rhSIRP ⁇ -HIS (SinoBiological 11612-H08H-100, SEQ ID NO: 132), or antibody hSIRP ⁇ .50A and antigen rhSIRP ⁇ -HIS were incubated to promote binding and integrity and aggregation level were verified by Ultraflex III MALDI TOF mass spectrometer (Bruker) equipped with a HM4 interaction module (CovalX).
- a mixture was made with an excess of antigen (antigen:antibody ratio for rhSIRP ⁇ -HIS:hSIRP ⁇ .40A 10.8 ⁇ M:8.5 ⁇ M, and antigen:antibody ratio for rhSIRP ⁇ -HIS:hSIRP ⁇ .50A 5.4 ⁇ M:2.13 ⁇ M).
- antigen:antibody ratio for rhSIRP ⁇ -HIS:hSIRP ⁇ .50A 5.4 ⁇ M:2.13 ⁇ M.
- the detected mass of the antibody and antigen corresponds to the molecular weight as detected previously.
- the antigen-antibody complexes after cross-linking, were detected as two non-covalent complexes with a 1:1 (195.24 kDa) and 2:1 (240.48 kDa) stoichiometry for rhSIRP ⁇ -HIS:hSIRP ⁇ .40A, and as one non-covalent complex with a 1:1 (198.24 kDa) stoichiometry for rhSIRP ⁇ -HIS:hSIRP ⁇ .50A.
- Antibody and antigen bound non-covalent; non-covalent aggregates or non-specific multimers were not detected.
- peptide mass fingerprinting of rhSIRP ⁇ -HIS was performed.
- Samples were submitted to ASP-N, trypsin, chymotrypsin, elastase and thermolysin (Roche Diagnostic) proteolysis, following manufacturer's instructions followed by analysis by nLC-LTQ Orbitrap MS/MS using an Ultimate 3000 (Dionex) system in line with a LTQ Orbitrap XL mass spectrometer (Thermo Scientific). This proteolysis array resulted in 98% of the sequence being covered by the identified peptides.
- the antigen-antibody complex (rhSIRP ⁇ -HIS:hSIRP ⁇ .40A ratio 10.8 ⁇ M:8.5 ⁇ M, rhSIRP ⁇ -HIS:hSIRP ⁇ .50A ratio 5.4 ⁇ M:2.13 ⁇ M) was incubated with deuterated cross-linkers d0/d12 (K200 MALDI Kit) for 180 minutes and subjected to multi-enzymatic cleavage with the enzymes ASP-N, trypsin, chymotrypsin, elastase and thermolysin.
- the C-alpha distance between residue P74 and the identified cross-linked residues was measured in Discovery Studio using the crystal structure of SIRP ⁇ (PDB ID 4CMM).
- the cross-linked residues identified for hSIRP ⁇ .50A are within 14.0 to 21.4 angstrom C-alpha atom distance from residue P74; the cross-linked residues identified for hSIRP ⁇ .40A are within 16.2 to 33.5 angstrom C-alpha atom distance from residue P74.
- the C-alpha distances fit within the expected range for an epitope-paratope surface area of 700 ⁇ 2 (Rowley et al., Biotech. Ann. Rev. 10:151-188 (2004)).
- Example 26 Comparison of hSIRP ⁇ Antibodies for Binding to hSIRP ⁇ V1, hSIRP ⁇ V1(P74A), and hSIRP ⁇ 1
- hSIRP ⁇ antibodies e.g., including the hSIRP ⁇ antibodies known in the art, KWAR23 (U.S. Patent CA2939293 A1), 18D5 (Patent WO2017/178653 A2), and various commercially available hSIRP ⁇ antibodies
- KWAR23 U.S. Patent CA2939293 A1
- 18D5 Patent WO2017/178653 A2
- various commercially available hSIRP ⁇ antibodies for binding to hSIRP ⁇ V1, hSIRP ⁇ V1(P74A), and hSIRP ⁇ 1 was evaluated by CELISA.
Abstract
The present invention relates to anti-SIRPα antibodies, as well as use of these antibodies in the treatment of diseases such as cancer and infectious disease.
Description
- The present application is a divisional of U.S. patent application Ser. No. 17/107,334, filed on Nov. 30, 2020, which is a divisional of U.S. patent application Ser. No. 15/953,201, filed Apr. 13, 2018, now U.S. Pat. No. 10,851,164, which claims the benefit of Netherlands Patent Application No. 2018708, filed Apr. 13, 2017, and of Netherlands Patent Application No. 2019166, filed Jul. 3, 2017, each of which is hereby incorporated by reference in its entirety including all tables, figures, and claims.
- This application includes an electronically submitted sequence listing in .txt format. The .txt file contains a sequence listing entitled “ABE-0007-DV2_SeqListing.txt” created on Jan. 14, 2022, and is 233 kilobytes in size. The sequence listing contained in this .txt file is part of the specification and is hereby incorporated by reference herein in its entirety.
- The present invention relates to anti-SIRPα antibodies, as well as use of these antibodies in the treatment of diseases.
- Signal regulatory protein alpha (SIRPα) is membrane glycoprotein from the SIRP family. Members of the SIRP family share certain common structural motifs. These include a transmembrane segment and an N-terminal extracellular domain that contains three Ig-like loops connected by three pairs of disulfide bonds. The C-terminal intracellular domain, however, differs between SIRP family members. SIRPα has an extended intracellular domain containing four tyrosine residues that form two immunoreceptor tyrosine-based inhibitory motifs (ITIMs), while SIRPβ1 contains a lysine residue in the transmembrane domain followed by a short intracellular tail lacking ITIMs serving as a receptor for DAP12. Eight SIRPα single nucleotide polymorphisms have been identified, with the most prevalent being SIRPαV1 and SIRPαV2 (Takenaka et al., Nat. Immunol. 2007, 8:1313-23).
- “Eat-me” signals (i.e. “altered self′) are extracellular players specifically produced by and displayed on the surface of apoptotic cells, but not healthy cells, and are key to the initiation of phagocytosis by activating phagocytic receptors and subsequent signaling cascades. Eat-me signals require extracellular trafficking in order to be displayed on apoptotic cells. A particular category of eat-me signals is provided by membrane-anchored proteins such as phosphatidylserine (PtdSer) and calreticulin (CRT). Externalized PtdSer binds to its receptors on phagocytes to facilitate clearance of apoptotic cells (a process known as efferocytosis). Likewise, CRT is upregulated on the surface of apoptotic cells and binds to LDL-receptor-related protein 1 (LRP1) on the phagocyte thereby mediating engulfment.
- SIRPα is broadly expressed on phagocytes (e.g., macrophages, granulocytes, and dendritic cells) and acts as an inhibitory receptor through its interaction with a transmembrane protein CD47. This interaction mediates a response referred to as the “don't eat me” signal. This interaction negatively regulates effector function of innate immune cells such as host cell phagocytosis. As CD47 is often present on tumor cells, this “don't eat me” signal is thought to contribute to the resistance of tumors to phagocyte-dependent clearance. Despite the similarities in the extracellular domains of SIRPα and SIRPβ1 functional differences exist among the SIRP family members. For example, SIRPβ1 does not bind CD47 at detectable levels and so does not mediate the “don't eat me” signal. Instead, SIRPβ1 is involved in the activation of myeloid cells.
- Disruption of CD47-SIRPα signalling (e.g., by antagonistic monoclonal antibodies that bind to either CD47 or SIRPα) reportedly results in enhanced phagocytosis of both solid and hematopoietic tumor cells, including increased phagocytosis of glioblastoma cells in vitro and significant anti-tumor activity in vivo.
- In a first aspect, the invention provides anti-SIRPα antibodies and antigen binding fragments thereof comprising the structural and functional features specified below.
- In various embodiments, the invention provides an antibody or antigen binding fragment thereof that binds to human SIRPα comprising one, two, or all three of (i), (ii) and (iii): (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1 or an amino acid sequence differing from SEQ ID NO: 1 by 1, 2, 3, or more conservative substitutions; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2 or an amino acid sequence differing from SEQ ID NO: 2 by 1, 2, 3, or more conservative substitutions; and/or (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3 or an amino acid sequence differing from SEQ ID NO: 3 by 1, 2, 3, or more conservative substitutions.
- In various other embodiments, the invention provides an antibody or antigen binding fragment thereof that binds to human SIRPα comprising one, two, or all three of (i), (ii) and (iii): (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 69 or an amino acid sequence differing from SEQ ID NO: 1 by 1, 2, 3, or more conservative substitutions; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 70 or an amino acid sequence differing from SEQ ID NO: 2 by 1, 2, 3, or more conservative substitutions; and/or (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 71 or an amino acid sequence differing from SEQ ID NO: 3 by 1, 2, 3, or more conservative substitutions.
- In certain embodiments, the antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising an amino acid sequence selected from the group consisting of:
-
- SEQ ID NO: 75 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 78 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 80 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 82 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 84 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 86 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 88 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- SEQ ID NO: 102 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- SEQ ID NO: 7 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 10 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 12 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 14 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 16 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 18 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto, and
- SEQ ID NO: 30 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto.
- In various embodiments, the invention also provides an antibody or antigen binding fragment thereof that binds to human SIRPα comprising one, two, or all three of (i), (ii) and (iii): (i) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4 or an amino acid sequence differing from SEQ ID NO: 4 by 1, 2, 3, or more conservative substitutions; (ii) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5 or an amino acid sequence differing from SEQ ID NO: 5 by 1, 2, 3, or more conservative substitutions; and/or (iii) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6 or an amino acid sequence differing from SEQ ID NO: 6 by 1, 2, 3, or more conservative substitutions.
- In various other embodiments, the invention also provides an antibody or antigen binding fragment thereof that binds to human SIRPα comprising one, two, or all three of (i), (ii) and (iii): (i) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 72 or an amino acid sequence differing from SEQ ID NO: 4 by 1, 2, 3, or more conservative substitutions; (ii) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 73 or an amino acid sequence differing from SEQ ID NO: 5 by 1, 2, 3, or more conservative substitutions; and/or (iii) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 74 or an amino acid sequence differing from SEQ ID NO: 6 by 1, 2, 3, or more conservative substitutions.
- In certain embodiments, the antibody or antigen binding fragment thereof comprises a light chain variable region comprising an amino acid sequence selected from the group consisting of:
-
- SEQ ID NO: 76 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 90 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 92 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 94 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 96 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 98 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 100 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 104 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- SEQ ID NO: 8 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 20 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 22 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 24 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 26 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 28 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto, and
- SEQ ID NO: 32 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto.
- In various embodiments, the invention provides an antibody or antigen binding fragment thereof that binds to human SIRPα comprising:
-
- (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1 or an amino acid sequence differing from SEQ ID NO: 1 by 1, 2, 3, or more conservative substitutions; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2 or an amino acid sequence differing from SEQ ID NO: 2 by 1, 2, 3, or more conservative substitutions; and/or (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3 or an amino acid sequence differing from SEQ ID NO: 3 by 1, 2, 3, or more conservative substitutions;
- and
- (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4 or an amino acid sequence differing from SEQ ID NO: 4 by 1, 2, 3, or more conservative substitutions; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5 or an amino acid sequence differing from SEQ ID NO: 5 by 1, 2, 3, or more conservative substitutions; and/or (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6 or an amino acid sequence differing from SEQ ID NO: 6 by 1, 2, 3, or more conservative substitutions.
- In various other embodiments, the invention provides an antibody or antigen binding fragment thereof that binds to human SIRPα comprising:
-
- (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 69 or an amino acid sequence differing from SEQ ID NO: 1 by 1, 2, 3, or more conservative substitutions; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 70 or an amino acid sequence differing from SEQ ID NO: 2 by 1, 2, 3, or more conservative substitutions; and/or (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 71 or an amino acid sequence differing from SEQ ID NO: 3 by 1, 2, 3, or more conservative substitutions;
- and
- (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 72 or an amino acid sequence differing from SEQ ID NO: 4 by 1, 2, 3, or more conservative substitutions; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 73 or an amino acid sequence differing from SEQ ID NO: 5 by 1, 2, 3, or more conservative substitutions; and/or (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6 or an amino acid sequence differing from SEQ ID NO: 74 by 1, 2, 3, or more conservative substitutions.
- In still other embodiments, the invention provides an antibody or antigen binding fragment thereof that binds to human SIRPα comprising:
- a heavy chain variable region comprising an amino acid sequence selected from the group consisting of:
-
- SEQ ID NO: 7 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 10 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 12 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 14 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 16 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 18 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto, and
- SEQ ID NO: 30 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto;
and
a light chain variable region comprising an amino acid sequence selected from the group consisting of: - SEQ ID NO: 8 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 20 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 22 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 24 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 26 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto, and
- SEQ ID NO: 28 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto, and
- SEQ ID NO: 32 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto.
- In still other embodiments, the invention provides an antibody or antigen binding fragment thereof that binds to human SIRPα comprising:
-
- a heavy chain variable region comprising an amino acid sequence selected from the group consisting of:
- SEQ ID NO: 75 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 78 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 80 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 82 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 84 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 86 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 88 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto; and
- SEQ ID NO: 102 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
and
- a light chain variable region comprising an amino acid sequence selected from the group consisting of:
- SEQ ID NO: 76 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 90 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 92 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 94 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 96 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 98 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 100 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto, and
- SEQ ID NO: 104 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- a heavy chain variable region comprising an amino acid sequence selected from the group consisting of:
- In this context, “sequence similarity” is based on the extent of identity combined with the extent of conservative changes. The percentage of “sequence similarity” is the percentage of amino acids or nucleotides which is either identical or conservatively changed viz. “sequence similarity”=percent sequence identity)+percent conservative changes). Thus, for the purpose of this invention “conservative changes” and “identity” are considered to be species of the broader term “similarity”. Thus, whenever the term sequence “similarity” is used it embraces sequence “identity” and “conservative changes”. According to certain embodiments the conservative changes are disregarded and the percent sequence similarity refers to percent sequence identity. In certain embodiments, the changes in a sequence permitted by the referenced percent sequence identity are all or nearly all conservative changes; that is, when a sequence is 90% identical, the remaining 10% are all or nearly all conservative changes. The term “nearly all” in this context refers to at least 75% of the permitted sequence changes are conservative changes, more preferably at least 85%, still more preferably at least 90%, and most preferably at least 95%. In certain embodiments of antibody heavy and/or light chains, the permitted sequence changes are within the framework regions and not in the CDRs.
- Preferably said antibody has a heavy chain according to SEQ ID NO: 7. Further preferably said antibody has a light chain according to SEQ ID NO: 8. More preferably, the heavy chain is chosen from any of SEQ ID NO: 10, 12, 14, 16, 18, or 30. More preferably, the light chain is chosen from any of SEQ ID NO: 20, 22, 24, 26, 28, or 32.
- Alternatively, said antibody has a heavy chain according to SEQ ID NO: 75. Further preferably said antibody has a light chain according to SEQ ID NO: 76. More preferably, the heavy chain is chosen from any of SEQ ID NO: 78, 80, 82, 84, 86, 88 or 102. More preferably, the light chain is chosen from any of SEQ ID NO: 90, 92, 94, 96, 98, 100 or 104.
- In any of the above embodiments, the antibody or antigen binding fragment thereof may be isolated, as that term is defined herein.
- In any of the above embodiments, the antibody or antigen binding fragment thereof is a recombinant antibody, as that term is defined herein.
- In any of the above embodiments, the antibody or antigen binding fragment thereof is a full-length antibody, as that term is defined herein.
- Antibodies or antigen binding fragments of the present invention may be obtained from a variety of species. For example, the antibodies of the present invention may comprise immunoglobulin sequences which are rabbit, mouse, rat, guinea pig, chicken, goat, sheep, donkey, human, llama or camelid sequences, or combinations of such sequences (so-called chimeric antibodies). Most preferably, the antibodies or antigen binding fragments are human or humanized antibodies or antigen binding fragments.
- The term antibody includes antigen-binding portions, i.e., “antigen binding sites,” (e.g., fragments, subsequences, complementarity determining regions (CDRs)) that retain capacity to bind antigen, including (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and
C H1 domains; (ii) a F(ab′)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH andC H1 domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a VH domain; and (vi) an isolated complementarity determining region (CDR). Single chain antibodies are also included by reference in the term “antibody.” Preferred therapeutic antibodies are intact IgG antibodies. The term “intact IgG” as used herein is meant as a polypeptide belonging to the class of antibodies that are substantially encoded by a recognized immunoglobulin gamma gene. In humans this class comprises IgG1, IgG2, IgG3, and IgG4. In mice this class comprises IgG1, IgG2a, IgG2b, and IgG3. The known Ig domains in the IgG class of antibodies are VH, Cγ1, Cγ2, Cγ3, VL, and CL. - In any of the above embodiments, the antibody or antigen binding fragment thereof is a human or humanized antibody comprising two heavy chains and two light chains. In one embodiment, the antibody is an IgG. In preferred embodiments, antibody is an IgG1, IgG2, or IgG4, and preferably a human IgG1, IgG2, or IgG4.
- In any of the above-mentioned embodiments, the antibody or antigen binding fragment thereof of the invention can comprise any of the light chain variable regions described above and a human kappa or lambda light chain constant domain and an IgG1, IgG2, or IgG4 heavy chain constant domain. Exemplary light (kappa) and heavy (IgG2 and IgG4) constant region sequences which may be used in accordance with the invention are recited in SEQ ID NOs: 63, 65, 67 (each a nucleotide sequence), 64, 66, and 68 (each a polypeptide sequence).
- By way of example only, in various embodiments such antibody or antigen binding fragment thereof comprises one of the following combinations of heavy chain sequence/light chain variable region sequences:
- SEQ ID NO: 10/SEQ ID NO: 20 (referred to herein as hSIRPα.50A.H1L1)
SEQ ID NO: 10/SEQ ID NO: 22 (referred to herein as hSIRPα.50A.H1L2)
SEQ ID NO: 10/SEQ ID NO: 24 (referred to herein as hSIRPα.50A.H1L3)
SEQ ID NO: 10/SEQ ID NO: 26 (referred to herein as hSIRPα.50A.H1L4)
SEQ ID NO: 10/SEQ ID NO: 28 (referred to herein as hSIRPα.50A.H1L5)
SEQ ID NO: 12/SEQ ID NO: 20 (referred to herein as hSIRPα.50A.H2L1)
SEQ ID NO: 12/SEQ ID NO: 22 (referred to herein as hSIRPα.50A.H2L2)
SEQ ID NO: 12/SEQ ID NO: 24 (referred to herein as hSIRPα.50A.H2L3)
SEQ ID NO: 12/SEQ ID NO: 26 (referred to herein as hSIRPα.50A.H2L4)
SEQ ID NO: 12/SEQ ID NO: 28 (referred to herein as hSIRPα.50A.H2L5)
SEQ ID NO: 14/SEQ ID NO: 20 (referred to herein as hSIRPα.50A.H3L1)
SEQ ID NO: 14/SEQ ID NO: 22 (referred to herein as hSIRPα.50A.H3L2)
SEQ ID NO: 14/SEQ ID NO: 24 (referred to herein as hSIRPα.50A.H3L3)
SEQ ID NO: 14/SEQ ID NO: 26 (referred to herein as hSIRPα.50A.H3L4)
SEQ ID NO: 14/SEQ ID NO: 28 (referred to herein as hSIRPα.50A.H3L5)
SEQ ID NO: 16/SEQ ID NO: 20 (referred to herein as hSIRPα.50A.H4L1)
SEQ ID NO: 16/SEQ ID NO: 22 (referred to herein as hSIRPα.50A.H4L2)
SEQ ID NO: 16/SEQ ID NO: 24 (referred to herein as hSIRPα.50A.H4L3)
SEQ ID NO: 16/SEQ ID NO: 26 (referred to herein as hSIRPα.50A.H4L4)
SEQ ID NO: 16/SEQ ID NO: 28 (referred to herein as hSIRPα.50A.H4L5)
SEQ ID NO: 18/SEQ ID NO: 20 (referred to herein as hSIRPα.50A.H5L1)
SEQ ID NO: 18/SEQ ID NO: 22 (referred to herein as hSIRPα.50A.H5L2)
SEQ ID NO: 18/SEQ ID NO: 24 (referred to herein as hSIRPα.50A.H5L3)
SEQ ID NO: 18/SEQ ID NO: 26 (referred to herein as hSIRPα.50A.H5L4)
SEQ ID NO: 18/SEQ ID NO: 28 (referred to herein as hSIRPα.50A.H5L5)
SEQ ID NO: 78/SEQ ID NO: 90 (referred to herein as hSIRPα.40A.H1L1)
SEQ ID NO: 78/SEQ ID NO: 92 (referred to herein as hSIRPα.40A.H1L2)
SEQ ID NO: 78/SEQ ID NO: 94 (referred to herein as hSIRPα.40A.H1L3)
SEQ ID NO: 78/SEQ ID NO: 96 (referred to herein as hSIRPα.40A.H1L4)
SEQ ID NO: 78/SEQ ID NO: 98 (referred to herein as hSIRPα.40A.H1L5)
SEQ ID NO: 78/SEQ ID NO: 100 (referred to herein as hSIRPα.40A.H1L6)
SEQ ID NO: 80/SEQ ID NO: 90 (referred to herein as hSIRPα.40A.H2L1)
SEQ ID NO: 80/SEQ ID NO: 92 (referred to herein as hSIRPα.40A.H2L2)
SEQ ID NO: 80/SEQ ID NO: 94 (referred to herein as hSIRPα.40A.H2L3)
SEQ ID NO: 80/SEQ ID NO: 96 (referred to herein as hSIRPα.40A.H2L4)
SEQ ID NO: 80/SEQ ID NO: 98 (referred to herein as hSIRPα.40A.H2L5)
SEQ ID NO: 80/SEQ ID NO: 100 (referred to herein as hSIRPα.40A.H2L6)
SEQ ID NO: 82/SEQ ID NO: 90 (referred to herein as hSIRPα.40A.H3L1)
SEQ ID NO: 82/SEQ ID NO: 92 (referred to herein as hSIRPα.40A.H3L2)
SEQ ID NO: 82/SEQ ID NO: 94 (referred to herein as hSIRPα.40A.H3L3)
SEQ ID NO: 82/SEQ ID NO: 96 (referred to herein as hSIRPα.40A.H3L4)
SEQ ID NO: 82/SEQ ID NO: 98 (referred to herein as hSIRPα.40A.H3L5)
SEQ ID NO: 82/SEQ ID NO: 100 (referred to herein as hSIRPα.40A.H3L6)
SEQ ID NO: 84/SEQ ID NO: 90 (referred to herein as hSIRPα.40A.H4L1)
SEQ ID NO: 84/SEQ ID NO: 92 (referred to herein as hSIRPα.40A.H4L2)
SEQ ID NO: 84/SEQ ID NO: 94 (referred to herein as hSIRPα.40A.H4L3)
SEQ ID NO: 84/SEQ ID NO: 96 (referred to herein as hSIRPα.40A.H4L4)
SEQ ID NO: 84/SEQ ID NO: 98 (referred to herein as hSIRPα.40A.H4L5)
SEQ ID NO: 84/SEQ ID NO: 100 (referred to herein as hSIRPα.40A.H4L6)
SEQ ID NO: 86/SEQ ID NO: 90 (referred to herein as hSIRPα.40A.H5L1)
SEQ ID NO: 86/SEQ ID NO: 92 (referred to herein as hSIRPα.40A.H5L2)
SEQ ID NO: 86/SEQ ID NO: 94 (referred to herein as hSIRPα.40A.H5L3)
SEQ ID NO: 86/SEQ ID NO: 96 (referred to herein as hSIRPα.40A.H5L4)
SEQ ID NO: 86/SEQ ID NO: 98 (referred to herein as hSIRPα.40A.H5L5)
SEQ ID NO: 86/SEQ ID NO: 100 (referred to herein as hSIRPα.40A.H5L6)
SEQ ID NO: 88/SEQ ID NO: 90 (referred to herein as hSIRPα.40A.H6L1)
SEQ ID NO: 88/SEQ ID NO: 92 (referred to herein as hSIRPα.40A.H6L2)
SEQ ID NO: 88/SEQ ID NO: 94 (referred to herein as hSIRPα.40A.H6L3)
SEQ ID NO: 88/SEQ ID NO: 96 (referred to herein as hSIRPα.40A.H6L4)
SEQ ID NO: 88/SEQ ID NO: 98 (referred to herein as hSIRPα.40A.H6L5)
SEQ ID NO: 88/SEQ ID NO: 100 (referred to herein as hSIRPα.40A.H6L6)
or, in each case, at least 90%, 95%, 97%, 98%, or 99% similar or identical to a respective SEQ ID NO. - In some preferred embodiments, the antibody or antigen binding fragment is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 10 and each light chain comprises SEQ ID NO: 20, or, in each case, at least 90%, 95%, 97%, 98%, or 99% similar or identical to a respective SEQ ID NO, and most preferably each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG1, IgG2, or IgG4 constant region.
- In other preferred embodiments, the antibody or antigen binding fragment is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 16 and each light chain comprises SEQ ID NO: 28, or, in each case, at least 90%, 95%, 97%, 98%, or 99% similar or identical to a respective SEQ ID NO, and most preferably each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG1, IgG2, or IgG4 constant region.
- In still other preferred embodiments, the antibody or antigen binding fragment is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 18 and each light chain comprises SEQ ID NO: 20, or, in each case, at least 90%, 95%, 97%, 98%, or 99% similar or identical to a respective SEQ ID NO, and most preferably each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG1, IgG2, or IgG4 constant region.
- In some preferred embodiments, the antibody or antigen binding fragment is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 80 and each light chain comprises SEQ ID NO: 90, or, in each case, at least 90%, 95%, 97%, 98%, or 99% similar or identical to a respective SEQ ID NO, and most preferably each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG1, IgG2, or IgG4 constant region.
- In some preferred embodiments, the antibody or antigen binding fragment is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 80 and each light chain comprises SEQ ID NO: 92, or, in each case, at least 90%, 95%, 97%, 98%, or 99% similar or identical to a respective SEQ ID NO, and most preferably each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG1, IgG2, or IgG4 constant region.
- In some preferred embodiments, the antibody or antigen binding fragment is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 80 and each light chain comprises SEQ ID NO: 96, or, in each case, at least 90%, 95%, 97%, 98%, or 99% similar or identical to a respective SEQ ID NO, and most preferably each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG1, IgG2, or IgG4 constant region.
- In one embodiment, the anti-SIRPα antibody of the invention comprises a full length antibody structure having two light chains and two heavy chains as recited above, wherein each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG1 constant region.
- In one embodiment, the anti-SIRPα antibody of the invention comprises a full length antibody structure having two light chains and two heavy chains as recited above, wherein each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG2 constant region.
- In one embodiment, the anti-SIRPα antibody of the invention comprises a full-length antibody structure having two light chains and two heavy chains as recited above, wherein each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG4 constant region.
- In certain embodiments, the antibodies or antigen binding fragments of the present invention have one, two, three, four, or more, and preferably each of, the following functional characteristics:
- binds human SIRPαV1 protein having the sequence of SEQ ID NO: 34 with an EC50<1 nM; and exhibits at least a 100-fold higher EC50 for SIRPαV1(P74A) having the sequence of SEQ ID NO: 62; and optionally also at least a 100-fold higher EC50 for human SIRPβ1 protein having the sequence of SEQ ID NO: 38 (in each case wherein the reduced EC50 is relative to the EC50 for human SIRPαV1 protein having the sequence of
-
- SEQ ID NO: 34, and in each case preferably when measured by cellular ELISA (CELISA) as described hereinafter;
- binds to a cell expressing human SIRPαV1 protein with an EC50<10 nM, preferably <5 nM, more preferably <1.5 nM, still more preferably <1.0 nM, even more preferably <0.5 nM, and most preferably about 0.3 nM or less;
- binds to a cell expressing human SIRPαV2 protein with an EC50<10 nM, preferably <5 nM, more preferably <1.5 nM, still more preferably <1.0 nM, even more preferably <0.5 nM, and most preferably about 0.3 nM or less;
- does not appreciably bind to SIRPβ1 protein at an antibody concentration of 50 nM, preferably 67 nM, and more preferably 100 nM; or alternatively at a concentration that is 10-fold greater, preferably 50-fold greater, more preferably 100-fold greater, and still more preferably 200-fold greater than the antibody's EC50 for SIRPαV1 or SIRPαV2;
- inhibits binding between human SIRPα and CD47 with an IC50<10.0 nM, more preferably <5.0 nM, still more preferably <2.5 nM, and most preferably about 1.0 nM or less; and
- exhibits a T20 “humanness” score of at least 79, and more preferably 85.
- Preferably, the anti-SIRPα antibodies or antigen binding fragments of the invention do not appreciably bind to one or both of SIRPαV1(P74A) and SIRPβ1 protein at an antibody concentration of 100 nM or alternatively at an antibody concentration that is 200-fold greater than the antibody's EC50 for SIRPαV1 or SIRPαV2, while binding to a cell expressing human SIRPαV1 protein with an EC50<10 nM. Most preferably, each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG1, IgG2, or IgG4 constant region.
- In certain embodiments, the anti-SIRPα antibody or antigen binding fragment thereof of the invention can be conjugated to at least one therapeutic agent. In one embodiment, the therapeutic agent is a second antibody or fragment thereof, an immunomodulator, a hormone, a cytotoxic agent, an enzyme, a radionuclide, or a second antibody conjugated to at least one immunomodulator, enzyme, radioactive label, hormone, antisense oligonucleotide, or cytotoxic agent, or a combination thereof.
- The invention also provides isolated polypeptides comprising the amino acid sequence of any one of SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 76, 90, 92, 94, 96, 98, 100, 102, 104, 7, 10, 12, 14, 16, 18, 30, 8, 20, 22, 24, 26, 28, and 32 or a fragment of any said sequences, or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- The invention also provides isolated nucleic acids encoding anyone of the anti-SIRPα antibodies or antigen binding fragments of the invention.
- In one embodiment, the invention provides an isolated nucleic acid which encodes an amino acid sequence selected from the group consisting of:
-
- SEQ ID NO: 75 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 78 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 80 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 82 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 84 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 86 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 88 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 102 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 10 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 12 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 14 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 16 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 18 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto, and
- SEQ ID NO: 30 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto.
- In certain embodiments, the amino acid sequence of SEQ ID NO: 10 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 9 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- In certain embodiments, the amino acid sequence of SEQ ID NO: 12 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 11 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- In certain embodiments, the amino acid sequence of SEQ ID NO: 14 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 13 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- In certain embodiments, the amino acid sequence of SEQ ID NO: 16 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 15 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- In certain embodiments, the amino acid sequence of SEQ ID NO: 18 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 17 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- In certain embodiments, the amino acid sequence of SEQ ID NO: 30 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 29 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- In certain embodiments, the amino acid sequence of SEQ ID NO: 78 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 77 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- In certain embodiments, the amino acid sequence of SEQ ID NO: 80 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 79 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- In certain embodiments, the amino acid sequence of SEQ ID NO: 82 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 81 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- In certain embodiments, the amino acid sequence of SEQ ID NO: 84 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 83 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- In certain embodiments, the amino acid sequence of SEQ ID NO: 86 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 85 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- In certain embodiments, the amino acid sequence of SEQ ID NO: 88 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 87 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- In certain embodiments, the amino acid sequence of SEQ ID NO: 102 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 101 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- In one embodiment, the invention provides an isolated nucleic acid which encodes an amino acid sequence selected from the group consisting of:
-
- SEQ ID NO: 76 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 90 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 92 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 94 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 96 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 98 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 100 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 104 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 8 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 20 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 22 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 24 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 26 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,
- SEQ ID NO: 28 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto, and
- SEQ ID NO: 32 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto.
- In certain embodiments, the amino acid sequence of SEQ ID NO: 20 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 19 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- In certain embodiments, the amino acid sequence of SEQ ID NO: 22 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 21 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- In certain embodiments, the amino acid sequence of SEQ ID NO: 24 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 23 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- In certain embodiments, the amino acid sequence of SEQ ID NO: 26 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 25 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- In certain embodiments, the amino acid sequence of SEQ ID NO: 28 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 27 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- In certain embodiments, the amino acid sequence of SEQ ID NO: 32 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 31 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- In certain embodiments, the amino acid sequence of SEQ ID NO: 90 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 89 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- In certain embodiments, the amino acid sequence of SEQ ID NO: 92 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 91 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- In certain embodiments, the amino acid sequence of SEQ ID NO: 94 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 93 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- In certain embodiments, the amino acid sequence of SEQ ID NO: 96 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 95 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- In certain embodiments, the amino acid sequence of SEQ ID NO: 98 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 97 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- In certain embodiments, the amino acid sequence of SEQ ID NO: 100 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 99 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- In certain embodiments, the amino acid sequence of SEQ ID NO: 104 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 103 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- In certain embodiments, the isolated nucleic acids of the present invention can optionally comprise a leader sequence.
- Such nucleic acids can comprise one or more of the following nucleic acid sequences:
-
- a nucleic acid sequence of SEQ ID NO: 77 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 79 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 81 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 83 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 85 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 87 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 101 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 89 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 91 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 93 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 95 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 97 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 99 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 101 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 103 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 9 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 11 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 13 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 15 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 17 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 29 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 19 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 21 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 23 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 25 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 27 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto, and/or
- a nucleic acid sequence of SEQ ID NO: 31 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- In certain embodiments, the nucleic acid can encode a human or humanized antibody, and includes nucleic acid sequences for both heavy and light chains. In one embodiment, the antibody is an IgG. In preferred embodiments, antibody is an IgG1, IgG2, or IgG4, and preferably a human IgG1, IgG2, or IgG4. In certain embodiments, the light chain sequence comprises a human kappa light chain or a human lambda light chain constant domain sequence; and each heavy chain sequence comprises a human IgG1, IgG2, or IgG4 constant region sequence.
- Preferably, such nucleic acids comprise the following combination heavy chain and light chain variable region nucleic acid sequences:
- SEQ ID NO: 9/SEQ ID NO: 19 (referred to herein as hSIRPα.50A.H1L1)
SEQ ID NO: 9/SEQ ID NO: 21 (referred to herein as hSIRPα.50A.H1L2)
SEQ ID NO: 9/SEQ ID NO: 23 (referred to herein as hSIRPα.50A.H1L3)
SEQ ID NO: 9/SEQ ID NO: 25 (referred to herein as hSIRPα.50A.H1L4)
SEQ ID NO: 9/SEQ ID NO: 27 (referred to herein as hSIRPα.50A.H1L5)
SEQ ID NO: 11/SEQ ID NO: 19 (referred to herein as hSIRPα.50A.H2L1)
SEQ ID NO: 11/SEQ ID NO: 21 (referred to herein as hSIRPα.50A.H2L2)
SEQ ID NO: 11/SEQ ID NO: 23 (referred to herein as hSIRPα.50A.H2L3)
SEQ ID NO: 11/SEQ ID NO: 25 (referred to herein as hSIRPα.50A.H2L4)
SEQ ID NO: 11/SEQ ID NO: 27 (referred to herein as hSIRPα.50A.H2L5)
SEQ ID NO: 13/SEQ ID NO: 19 (referred to herein as hSIRPα.50A.H3L1)
SEQ ID NO: 13/SEQ ID NO: 21 (referred to herein as hSIRPα.50A.H3L2)
SEQ ID NO: 13/SEQ ID NO: 23 (referred to herein as hSIRPα.50A.H3L3)
SEQ ID NO: 13/SEQ ID NO: 25 (referred to herein as hSIRPα.50A.H3L4)
SEQ ID NO: 13/SEQ ID NO: 27 (referred to herein as hSIRPα.50A.H3L5)
SEQ ID NO: 15/SEQ ID NO: 19 (referred to herein as hSIRPα.50A.H4L1)
SEQ ID NO: 15/SEQ ID NO: 21 (referred to herein as hSIRPα.50A.H4L2)
SEQ ID NO: 15/SEQ ID NO: 23 (referred to herein as hSIRPα.50A.H4L3)
SEQ ID NO: 15/SEQ ID NO: 25 (referred to herein as hSIRPα.50A.H4L4)
SEQ ID NO: 15/SEQ ID NO: 27 (referred to herein as hSIRPα.50A.H4L5)
SEQ ID NO: 17/SEQ ID NO: 19 (referred to herein as hSIRPα.50A.H5L1)
SEQ ID NO: 17/SEQ ID NO: 21 (referred to herein as hSIRPα.50A.H5L2)
SEQ ID NO: 17/SEQ ID NO: 23 (referred to herein as hSIRPα.50A.H5L3)
SEQ ID NO: 17/SEQ ID NO: 25 (referred to herein as hSIRPα.50A.H5L4)
SEQ ID NO: 17/SEQ ID NO: 27 (referred to herein as hSIRPα.50A.H5L5)
SEQ ID NO: 77/SEQ ID NO: 89 (referred to herein as hSIRPα.40A.H1L1)
SEQ ID NO: 77/SEQ ID NO: 91 (referred to herein as hSIRPα.40A.H1L2)
SEQ ID NO: 77/SEQ ID NO: 93 (referred to herein as hSIRPα.40A.H1L3)
SEQ ID NO: 77/SEQ ID NO: 95 (referred to herein as hSIRPα.40A.H1L4)
SEQ ID NO: 77/SEQ ID NO: 97 (referred to herein as hSIRPα.40A.H1L5)
SEQ ID NO: 77/SEQ ID NO: 99 (referred to herein as hSIRPα.40A.H1L6)
SEQ ID NO: 79/SEQ ID NO: 89 (referred to herein as hSIRPα.40A.H2L1)
SEQ ID NO: 79/SEQ ID NO: 91 (referred to herein as hSIRPα.40A.H2L2)
SEQ ID NO: 79/SEQ ID NO: 93 (referred to herein as hSIRPα.40A.H2L3)
SEQ ID NO: 79/SEQ ID NO: 95 (referred to herein as hSIRPα.40A.H2L4)
SEQ ID NO: 79/SEQ ID NO: 97 (referred to herein as hSIRPα.40A.H2L5)
SEQ ID NO: 79/SEQ ID NO: 99 (referred to herein as hSIRPα.40A.H2L6)
SEQ ID NO: 81/SEQ ID NO: 89 (referred to herein as hSIRPα.40A.H3L1)
SEQ ID NO: 81/SEQ ID NO: 91 (referred to herein as hSIRPα.40A.H3L2)
SEQ ID NO: 81/SEQ ID NO: 93 (referred to herein as hSIRPα.40A.H3L3)
SEQ ID NO: 81/SEQ ID NO: 95 (referred to herein as hSIRPα.40A.H3L4)
SEQ ID NO: 81/SEQ ID NO: 97 (referred to herein as hSIRPα.40A.H3L5)
SEQ ID NO: 81/SEQ ID NO: 99 (referred to herein as hSIRPα.40A.H3L6)
SEQ ID NO: 83/SEQ ID NO: 89 (referred to herein as hSIRPα.40A.H4L1)
SEQ ID NO: 83/SEQ ID NO: 91 (referred to herein as hSIRPα.40A.H4L2)
SEQ ID NO: 83/SEQ ID NO: 93 (referred to herein as hSIRPα.40A.H4L3)
SEQ ID NO: 83/SEQ ID NO: 95 (referred to herein as hSIRPα.40A.H4L4)
SEQ ID NO: 83/SEQ ID NO: 97 (referred to herein as hSIRPα.40A.H4L5)
SEQ ID NO: 83/SEQ ID NO: 99 (referred to herein as hSIRPα.40A.H4L6)
SEQ ID NO: 85/SEQ ID NO: 89 (referred to herein as hSIRPα.40A.H5L1)
SEQ ID NO: 85/SEQ ID NO: 91 (referred to herein as hSIRPα.40A.H5L2)
SEQ ID NO: 85/SEQ ID NO: 93 (referred to herein as hSIRPα.40A.H5L3)
SEQ ID NO: 85/SEQ ID NO: 95 (referred to herein as hSIRPα.40A.H5L4)
SEQ ID NO: 85/SEQ ID NO: 97 (referred to herein as hSIRPα.40A.H5L5)
SEQ ID NO: 85/SEQ ID NO: 99 (referred to herein as hSIRPα.40A.H5L6)
SEQ ID NO: 87/SEQ ID NO: 89 (referred to herein as hSIRPα.40A.H6L1)
SEQ ID NO: 87/SEQ ID NO: 91 (referred to herein as hSIRPα.40A.H6L2)
SEQ ID NO: 87/SEQ ID NO: 93 (referred to herein as hSIRPα.40A.H6L3)
SEQ ID NO: 87/SEQ ID NO: 95 (referred to herein as hSIRPα.40A.H6L4)
SEQ ID NO: 87/SEQ ID NO: 97 (referred to herein as hSIRPα.40A.H6L5)
SEQ ID NO: 87/SEQ ID NO: 99 (referred to herein as hSIRPα.40A.H6L6)
or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO. - In some preferred embodiments, the nucleic acid comprises SEQ ID NO: 9 and SEQ ID NO: 19 or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO.
- In some preferred embodiments, the nucleic acid comprises SEQ ID NO: 15 and SEQ ID NO: 27 or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO.
- In some preferred embodiments, the nucleic acid comprises SEQ ID NO: 17 and SEQ ID NO: 19 or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO.
- In some preferred embodiments, the nucleic acid comprises SEQ ID NO: 79 and SEQ ID NO: 89 or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO.
- In some preferred embodiments, the nucleic acid comprises SEQ ID NO: 79 and SEQ ID NO: 91 or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO.
- In some preferred embodiments, the nucleic acid comprises SEQ ID NO: 79 and SEQ ID NO: 95 or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO.
- The invention also provides expression vectors comprising one or more nucleic acids of the present invention. An expression vector is a DNA molecule comprising the regulatory elements necessary for transcription of a target nucleic acid in a host cell. Typically, the target nucleic acid is placed under the control of certain regulatory elements including constitutive or inducible promoters, tissue-specific regulatory elements, and enhancer elements. Such a target nucleic acid is said to be “operably linked to” the regulatory elements when the regulating element controls the expression of the gene.
- These isolated nucleic acids and the expression vectors comprising them may be used to express the antibodies of the invention or antigen binding fragments thereof in recombinant host cells. Thus, the invention also provides host cells comprising an expression vector of the present invention.
- Such expression vectors can comprise one or more of the following nucleic acid sequences operably linked to regulatory elements:
-
- a nucleic acid sequence of SEQ ID NO: 77 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 79 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 81 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 83 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 85 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 87 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 101 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 89 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 91 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 93 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 95 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 97 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 99 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 103 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 11 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 13 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 15 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 17 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 29 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 19 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 21 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 23 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 25 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 27 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto, and/or
- a nucleic acid sequence of SEQ ID NO: 31 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- In certain embodiments, the expression vector comprises nucleic acid sequences encoding both a heavy chain sequence and a light chain sequence of an anti-SIRPα antibody of the present invention. Preferably, such expression vectors comprise the following combination heavy chain and light chain variable region nucleic acid sequences:
- SEQ ID NO: 9/SEQ ID NO: 19 (referred to herein as hSIRPα.50A.H1L1)
SEQ ID NO: 9/SEQ ID NO: 21 (referred to herein as hSIRPα.50A.H1L2)
SEQ ID NO: 9/SEQ ID NO: 23 (referred to herein as hSIRPα.50A.H1L3)
SEQ ID NO: 9/SEQ ID NO: 25 (referred to herein as hSIRPα.50A.H1L4)
SEQ ID NO: 9/SEQ ID NO: 27 (referred to herein as hSIRPα.50A.H1L5)
SEQ ID NO: 11/SEQ ID NO: 19 (referred to herein as hSIRPα.50A.H2L1)
SEQ ID NO: 11/SEQ ID NO: 21 (referred to herein as hSIRPα.50A.H2L2)
SEQ ID NO: 11/SEQ ID NO: 23 (referred to herein as hSIRPα.50A.H2L3)
SEQ ID NO: 11/SEQ ID NO: 25 (referred to herein as hSIRPα.50A.H2L4)
SEQ ID NO: 11/SEQ ID NO: 27 (referred to herein as hSIRPα.50A.H2L5)
SEQ ID NO: 13/SEQ ID NO: 19 (referred to herein as hSIRPα.50A.H3L1)
SEQ ID NO: 13/SEQ ID NO: 21 (referred to herein as hSIRPα.50A.H3L2)
SEQ ID NO: 13/SEQ ID NO: 23 (referred to herein as hSIRPα.50A.H3L3)
SEQ ID NO: 13/SEQ ID NO: 25 (referred to herein as hSIRPα.50A.H3L4)
SEQ ID NO: 13/SEQ ID NO: 27 (referred to herein as hSIRPα.50A.H3L5)
SEQ ID NO: 15/SEQ ID NO: 19 (referred to herein as hSIRPα.50A.H4L1)
SEQ ID NO: 15/SEQ ID NO: 21 (referred to herein as hSIRPα.50A.H4L2)
SEQ ID NO: 15/SEQ ID NO: 23 (referred to herein as hSIRPα.50A.H4L3)
SEQ ID NO: 15/SEQ ID NO: 25 (referred to herein as hSIRPα.50A.H4L4)
SEQ ID NO: 15/SEQ ID NO: 27 (referred to herein as hSIRPα.50A.H4L5)
SEQ ID NO: 17/SEQ ID NO: 19 (referred to herein as hSIRPα.50A.H5L1)
SEQ ID NO: 17/SEQ ID NO: 21 (referred to herein as hSIRPα.50A.H5L2)
SEQ ID NO: 17/SEQ ID NO: 23 (referred to herein as hSIRPα.50A.H5L3)
SEQ ID NO: 17/SEQ ID NO: 25 (referred to herein as hSIRPα.50A.H5L4)
SEQ ID NO: 17/SEQ ID NO: 27 (referred to herein as hSIRPα.50A.H5L5)
SEQ ID NO: 77/SEQ ID NO: 89 (referred to herein as hSIRPα.40A.H1L1)
SEQ ID NO: 77/SEQ ID NO: 91 (referred to herein as hSIRPα.40A.H1L2)
SEQ ID NO: 77/SEQ ID NO: 93 (referred to herein as hSIRPα.40A.H1L3)
SEQ ID NO: 77/SEQ ID NO: 95 (referred to herein as hSIRPα.40A.H1L4)
SEQ ID NO: 77/SEQ ID NO: 97 (referred to herein as hSIRPα.40A.H1L5)
SEQ ID NO: 77/SEQ ID NO: 99 (referred to herein as hSIRPα.40A.H1L6)
SEQ ID NO: 79/SEQ ID NO: 89 (referred to herein as hSIRPα.40A.H2L1)
SEQ ID NO: 79/SEQ ID NO: 91 (referred to herein as hSIRPα.40A.H2L2)
SEQ ID NO: 79/SEQ ID NO: 93 (referred to herein as hSIRPα.40A.H2L3)
SEQ ID NO: 79/SEQ ID NO: 95 (referred to herein as hSIRPα.40A.H2L4)
SEQ ID NO: 79/SEQ ID NO: 97 (referred to herein as hSIRPα.40A.H2L5)
SEQ ID NO: 79/SEQ ID NO: 99 (referred to herein as hSIRPα.40A.H2L6)
SEQ ID NO: 81/SEQ ID NO: 89 (referred to herein as hSIRPα.40A.H3L1)
SEQ ID NO: 81/SEQ ID NO: 91 (referred to herein as hSIRPα.40A.H3L2)
SEQ ID NO: 81/SEQ ID NO: 93 (referred to herein as hSIRPα.40A.H3L3)
SEQ ID NO: 81/SEQ ID NO: 95 (referred to herein as hSIRPα.40A.H3L4)
SEQ ID NO: 81/SEQ ID NO: 97 (referred to herein as hSIRPα.40A.H3L5)
SEQ ID NO: 81/SEQ ID NO: 99 (referred to herein as hSIRPα.40A.H3L6)
SEQ ID NO: 83/SEQ ID NO: 89 (referred to herein as hSIRPα.40A.H4L1)
SEQ ID NO: 83/SEQ ID NO: 91 (referred to herein as hSIRPα.40A.H4L2)
SEQ ID NO: 83/SEQ ID NO: 93 (referred to herein as hSIRPα.40A.H4L3)
SEQ ID NO: 83/SEQ ID NO: 95 (referred to herein as hSIRPα.40A.H4L4)
SEQ ID NO: 83/SEQ ID NO: 97 (referred to herein as hSIRPα.40A.H4L5)
SEQ ID NO: 83/SEQ ID NO: 99 (referred to herein as hSIRPα.40A.H4L6)
SEQ ID NO: 85/SEQ ID NO: 89 (referred to herein as hSIRPα.40A.H5L1)
SEQ ID NO: 85/SEQ ID NO: 91 (referred to herein as hSIRPα.40A.H5L2)
SEQ ID NO: 85/SEQ ID NO: 93 (referred to herein as hSIRPα.40A.H5L3)
SEQ ID NO: 85/SEQ ID NO: 95 (referred to herein as hSIRPα.40A.H5L4)
SEQ ID NO: 85/SEQ ID NO: 97 (referred to herein as hSIRPα.40A.H5L5)
SEQ ID NO: 85/SEQ ID NO: 99 (referred to herein as hSIRPα.40A.H5L6)
SEQ ID NO: 87/SEQ ID NO: 89 (referred to herein as hSIRPα.40A.H6L1)
SEQ ID NO: 87/SEQ ID NO: 91 (referred to herein as hSIRPα.40A.H6L2)
SEQ ID NO: 87/SEQ ID NO: 93 (referred to herein as hSIRPα.40A.H6L3)
SEQ ID NO: 87/SEQ ID NO: 95 (referred to herein as hSIRPα.40A.H6L4)
SEQ ID NO: 87/SEQ ID NO: 97 (referred to herein as hSIRPα.40A.H6L5)
SEQ ID NO: 87/SEQ ID NO: 99 (referred to herein as hSIRPα.40A.H6L6)
or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO. - In any of the above embodiments, the expression vector can encode for expression a human or humanized antibody, and includes nucleic acid sequences for both heavy and light chains. In one embodiment, the antibody is an IgG. In preferred embodiments, antibody is an IgG1, IgG2, or IgG4, and preferably a human IgG1, IgG2, or IgG4. In certain embodiments, the light chain sequence comprises a human kappa light chain or a human lambda light chain constant domain sequence; and each heavy chain sequence comprises a human IgG4 constant region sequence.
- In some preferred embodiments, the expression vector encodes for expression a human or humanized antibody, wherein the heavy chain nucleic acid sequence comprises SEQ ID NO: 9 and the light chain nucleic acid sequence comprises SEQ ID NO: 19, or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO, and is most preferably an IgG1, IgG2, or IgG4 isotype.
- In some preferred embodiments, the expression vector encodes for expression a human or humanized antibody, wherein the heavy chain nucleic acid sequence comprises SEQ ID NO: 15 and the light chain nucleic acid sequence comprises SEQ ID NO: 27, or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO, and is most preferably an IgG1, IgG2, or IgG4 isotype.
- In some preferred embodiments, the expression vector encodes for expression a human or humanized antibody, wherein the heavy chain nucleic acid sequence comprises SEQ ID NO: 17 and the light chain nucleic acid sequence comprises SEQ ID NO: 19, or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO, and is most preferably an IgG1, IgG2, or IgG4 isotype.
- In some preferred embodiments, the expression vector encodes for expression a human or humanized antibody, wherein the heavy chain nucleic acid sequence comprises SEQ ID NO: 79 and the light chain nucleic acid sequence comprises SEQ ID NO: 89, or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO, and is most preferably an IgG1, IgG2, or IgG4 isotype.
- In some preferred embodiments, the expression vector encodes for expression a human or humanized antibody, wherein the heavy chain nucleic acid sequence comprises SEQ ID NO: 79 and the light chain nucleic acid sequence comprises SEQ ID NO: 91, or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO, and is most preferably an IgG1, IgG2, or IgG4 isotype.
- In some preferred embodiments, the expression vector encodes for expression a human or humanized antibody, wherein the heavy chain nucleic acid sequence comprises SEQ ID NO: 79 and the light chain nucleic acid sequence comprises SEQ ID NO: 95, or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO, and is most preferably an IgG1, IgG2, or IgG4 isotype.
- In one embodiment, the host cell is Chinese hamster ovary (CHO) cell. In one embodiment, the host cell is a mammalian cell (e.g., a human cell such as an HEK293 cell, a hamster cell such as a CHO cell, etc.), a bacterial cell (e.g., an E. coli cell) a yeast cell (e.g., a Pichia pastoris cell, etc.), a plant cell (e.g., a Nicotiana benthamiana cell), etc. . . . Mammalian cells are preferred due to glycosylation patterns that are most favorable.
- The invention also provides pharmaceutical compositions comprising an antibody or antigen binding fragment of the invention and a pharmaceutically acceptable carrier or diluent.
- In one embodiment, the composition comprises one or more further therapeutic agents. In one embodiment, the further therapeutic agent is selected from the group consisting of: an anti-CD27 antibody or an antigen binding fragment thereof; an anti-LAG3 antibody or an antigen binding fragment thereof; an anti-APRIL antibody or an antigen binding fragment thereof; an anti-TIGIT antibody or antigen biding fragment thereof; an anti-VISTA antibody or an antigen binding fragment thereof; an anti-BTLA antibody or an antigen binding fragment thereof; an anti-TIM3 antibody or an antigen binding fragment thereof; an anti-CTLA4 antibody or an antigen binding fragment thereof; an anti-HVEM antibody or an antigen binding fragment thereof; an anti-CD70 antibody or an antigen binding fragment thereof; an anti-CD137 antibody or an antigen binding fragment thereof; an anti-OX40 antibody or an antigen binding fragment thereof; an anti-CD28 antibody or an antigen binding fragment thereof; thereof; an anti-PD1 antibody or an antigen binding fragment thereof; an anti-PDL1 antibody or an antigen binding fragment thereof; an anti-PDL2 antibody or an antigen binding fragment thereof; an anti-GITR antibody or an antigen binding fragment thereof; an anti-ICOS antibody or an antigen binding fragment thereof; an anti-ILT2 antibody or antigen binding fragment thereof; an anti-ILT3 antibody or antigen binding fragment thereof; an anti-ILT4 antibody or antigen binding fragment thereof; and an anti-ILT5 antibody or an antigen binding fragment thereof; an anti 4-1BB antibody or an antigen binding fragment thereof; an anti-NKG2A antibody or an antigen binding fragment thereof; an anti-NKG2C antibody or an antigen binding fragment thereof; an anti-NKG2E antibody or an antigen binding fragment thereof; an anti-TSLP antibody or an antigen binding fragment thereof; an anti-IL-10 antibody or an antigen binding fragment thereof; IL-10 or PEGylated IL-10; an agonist (e.g., an agonistic antibody or antigen-binding fragment thereof, or a soluble fusion) of a TNF receptor protein; an Immunoglobulin-like protein; a cytokine receptor; an integrin; a signaling lymphocytic activation molecules (SLAM proteins); an activating NK cell receptor; a Toll like receptor; OX40; CD2; CD7; CD27; CD28; CD30; CD40; ICAM-1; LFA-1 (CD1 1a/CD18); 4-1BB (CD137); B7-H3; ICOS (CD278); GITR; BAFFR; LIGHT; HVEM (LIGHTR); KIRDS2; SLAMF7; NKp80 (KLRF1); NKp44; NKp30; NKp46; CD19; CD4; CD8alpha; CD8beta; IL2R beta; IL2R gamma; IL7R alpha; ITGA4; VLA1; CD49a; ITGA4; IA4; CD49D; ITGA6; VLA-6; CD49f; ITGAD; CD1 1d; ITGAE; CD103; ITGAL; ITGAM; CD1 1b; ITGAX; CD1 1c; ITGB1; CD29; ITGB2; CD18; ITGB7; NKG2D; NKG2C; TNFR2; TRANCE/RANKL; DNAM1 (CD226); SLAMF4 (CD244; 2B4); CD84; CD96 (Tactile); CEACAM1; CRTAM; Ly9 (CD229); CD160 (BY55); PSGL1; CD100 (SEMA4D); CD69; SLAMF6 (NTB-A; Ly108); SLAM (SLAMF1, CD150, IPO-3); SLAM7; BLAME (SLAMF8); SELPLG (CD162); LTBR; LAT; GADS; PAG/Cbp; CD19a; a ligand that specifically binds with CD83; an inhibitor of CD47, PD-1; PD-L2; CTLA4; TIM3; LAG3; CEACAM (e.g.; CEACAM-1, -3 and/or -5); VISTA; BTLA; TIGIT; LAIR1; IDO; TDO; CD160; TGFR beta; and a cyclic dinculeotide or other STING pathway agonist.
- The invention also comprises a combination comprising an antibody or antigen binding fragment of the invention and a second antibody that induces ADCC, wherein said antibody or antigen binding fragment of the invention enhances the antibody-mediated destruction of cells by the second antibody. Antibody-dependent cell-mediated cytotoxicity (ADCC) is a mechanism of cell-mediated immune defense whereby an effector cell of the immune system actively lyses a target cell, whose membrane-surface antigens have been bound by specific antibodies. ADCC is often thought of as being mediated by natural killer (NK) cells, but dendritic cells, macrophages, monocytes, and granulocytes can also mediate ADCC.
- The invention also comprises a combination comprising an antibody or antigen binding fragment of the invention and a second antibody that induces ADCP, wherein said antibody or antigen binding fragment of the invention enhances the antibody-mediated phagocytosis of cells by the second antibody. Antibody-dependent cell-mediated phagocytosis (ADCP) is a mechanism of cell-mediated immune defense whereby target cells are killed via granulocyte, monocyte, dendritic cell, or macrophage-mediated phagocytosis.
- Natural killer (NK) cells play a major role in cancer immunotherapies that involve tumor-antigen targeting by monoclonal antibodies (mAbs). In the context of targeting cells, NK cells can be “specifically activated” through certain Fc receptors that are expressed on their cell surface. NK cells can express FcγRIIIA and/or FcγRIIC, which can bind to the Fc portion of immunoglobulins, transmitting activating signals within NK cells. Once activated through Fc receptors by antibodies bound to target cells, NK cells are able to lyse target cells without priming, and secrete cytokines like interferon gamma to recruit adaptive immune cells. Likewise, tumor-associated macrophages (TAMs) express surface receptors that bind the Fc fragment of antibodies and enable them to engage in Ab-dependent cellular cytotoxicity/phagocytosis (ADCC/ADCP). Because SIRPα/CD47 signalling induces a “don't eat me” response that reduces ADCC/ADCP, blocking of this signaling by the anti-SIRPα antibodies or antigen binding fragments of the invention can enhance ADCC of tumor cells bearing the antigenic determinant to which the therapeutic antibody is directed.
- This ADCC/ADCP as a mode of action may be utilized in the treatment of various cancers and infectious diseases. An exemplary list of ADCC/ADCP-inducing antibodies and antibody conjugates that can be combined with the antibodies or antigen binding fragments of the present invention includes, but is not limited to, Rituximab, ublituximab, margetuximab, IMGN-529, SCT400, veltuzumab, Obinutuzumab, ADCT-502, Hul4.18K322A, Hu3F8, Dinituximab, Trastuzumab, Cetuximab, Rituximab-RLI, c.60C3-RLI, Hul4.18-IL2, KM2812, AFM13, and (CD20)2xCD16, erlotinib (Tarceva), daratumumab, alemtuzumab, pertuzumab, brentuximab, elotuzumab, ibritumomab, ifabotuzumab, farletuzumab, otlertuzumab, carotuximab, epratuzumab, inebilizumab, lumretuzumab, 4G7SDIE, AFM21, AFM22, LY-3022855, SNDX-6352, AFM-13, BI-836826, BMS-986012, BVX-20, mogamulizumab, ChiLob-7/4, leukotuximab, isatuximab, DS-8895, FPA144, GM102, GSK-2857916, IGN523, IT1208, ADC-1013, CAN-04, XOMA-213, PankoMab-GEX, chKM-4927, IGN003, IGN004, IGN005, MDX-1097, MOR202, MOR-208, oportuzumab, ensituximab, vedotin (Adcetris), ibritumomab tiuxetan, ABBV-838, HuMax-AXL-ADC, and ado-trastuzumab emtansine (Kadcyla). An exemplary list of target antigens for such ADCC/ADCP-inducing antibodies includes, but is not limited to, AMHR2, AXL, BCMA, CA IX, CD4, CD16, CD19, CD20, CD22, CD30, CD37, CD38, CD40, CD52, CD98, CSF1R, GD2, CCR4, CS1, EpCam, EGFR, EGFRvIII, Endoglin, EPHA2, EphA3, FGFR2b, folate receptor alpha, fucosyl-GM1, HER2, HER3, IL1RAP, kappa myeloma antigen, MS4A1, prolactin receptor, TA-MUC1, and PSMA.
- In certain embodiments, the second antibody or antigen binding fragment thereof induces ADCP. By way of example only, such antibodies may be selected from the group consisting of Rituximab, ublituximab, margetuximab, IMGN-529, SCT400, veltuzumab, Obinutuzumab, Trastuzumab, Cetuximab, alemtuzumab, ibritumomab, farletuzumab, inebilizumab, lumretuzumab, 4G7SDIE, BMS-986012, BVX-20, mogamulizumab, ChiLob-7/4, GM102, GSK-2857916, PankoMab-GEX, chKM-4927, MDX-1097, MOR202, and MOR-208.
- In embodiments where the antibodies or antigen binding fragments of the present invention are combined with one or more ADCC/ADCP-inducing antibodies and antibody conjugates, such combinations may also be used optionally in association with a further therapeutic agent or therapeutic procedure. In one embodiment, the further therapeutic agent is selected from the group consisting of: an anti-LAG3 antibody or an antigen binding fragment thereof; an anti-APRIL antibody or an antigen binding fragment thereof; an anti-TIGIT antibody or an antigen binding fragment thereof; an anti-VISTA antibody or an antigen binding fragment thereof; an anti-BTLA antibody or an antigen binding fragment thereof; an anti-TIM3 antibody or an antigen binding fragment thereof; an anti-CTLA4 antibody or an antigen binding fragment thereof; an anti-HVEM antibody or an antigen binding fragment thereof; an anti-CD70 antibody or an antigen binding fragment thereof; an anti-CD137 antibody or an antigen binding fragment thereof; an anti-OX40 antibody or an antigen binding fragment thereof; an anti-CD28 antibody or an antigen binding fragment thereof; thereof; an anti-PD1 antibody or an antigen binding fragment thereof; an anti-PDL1 antibody or an antigen binding fragment thereof; an anti-PDL2 antibody or an antigen binding fragment thereof; an anti-GITR antibody or an antigen binding fragment thereof; an anti-ICOS antibody or an antigen binding fragment thereof; an anti-ILT2 antibody or antigen binding fragment thereof; an anti-ILT3 antibody or antigen binding fragment thereof; an anti-ILT4 antibody or antigen binding fragment thereof; an anti-ILT5 antibody or an antigen binding fragment thereof; and an anti-4-1BB antibody or an antigen binding fragment thereof; an anti-NKG2A antibody or an antigen binding fragment thereof; an anti-NKG2C antibody or an antigen binding fragment thereof; an anti-NKG2E antibody or an antigen binding fragment thereof; an anti-TSLP antibody or an antigen binding fragment thereof; an anti-IL-10 antibody or an antigen binding fragment thereof; and IL-10 or PEGylated IL-10.
- The invention also provides a vessel or injection device comprising anyone of the anti-SIRPα antibodies or antigen binding fragments of the invention.
- The invention also provides a method of producing an anti-SIRPα antibody or antigen binding fragment of the invention comprising: culturing a host cell comprising a polynucleotide encoding a heavy chain and/or light chain of an antibody of the invention (or an antigen binding fragment thereof) under conditions favorable to expression of the polynucleotide; and optionally, recovering the antibody or antigen binding fragment from the host cell and/or culture medium. In one embodiment, the polynucleotide encoding the heavy chain and the polynucleotide encoding the light chain are in a single vector. In another embodiment, the polynucleotide encoding the heavy chain and the polynucleotide encoding the light chain are in different vectors.
- The invention also provides a method of treating cancer in a subject in need thereof, comprising administering to the subject an effective amount of an anti-SIRPα antibody or antigen binding fragment of the invention, optionally in association with a further therapeutic agent or therapeutic procedure.
- In one embodiment, the subject to be treated is a human subject. In one embodiment, the further therapeutic agent is selected from the group consisting of: an anti-LAG3 antibody or an antigen binding fragment thereof; an anti-APRIL antibody or an antigen binding fragment thereof; an an anti-TIGIT antibody or an antigen binding fragment thereof; an anti-VISTA antibody or an antigen binding fragment thereof; an anti-BTLA antibody or an antigen binding fragment thereof; an anti-TIM3 antibody or an antigen binding fragment thereof; an anti-CTLA4 antibody or an antigen binding fragment thereof; an anti-HVEM antibody or an antigen binding fragment thereof; an anti-CD70 antibody or an antigen binding fragment thereof; an anti-CD137 antibody or an antigen binding fragment thereof; an anti-OX40 antibody or an antigen binding fragment thereof; an anti-CD28 antibody or an antigen binding fragment thereof; thereof; an anti-PD1 antibody or an antigen binding fragment thereof; an anti-PDL1 antibody or an antigen binding fragment thereof; an anti-PDL2 antibody or an antigen binding fragment thereof; an anti-GITR antibody or an antigen binding fragment thereof; an anti-ICOS antibody or an antigen binding fragment thereof; an anti-ILT2 antibody or antigen binding fragment thereof; an anti-ILT3 antibody or antigen binding fragment thereof; an anti-ILT4 antibody or antigen binding fragment thereof; an anti-ILT5 antibody or an antigen binding fragment thereof; and an anti-4-1BB antibody or an antigen binding fragment thereof; an anti-NKG2A antibody or an antigen binding fragment thereof; an anti-NKG2C antibody or an antigen binding fragment thereof; an anti-NKG2E antibody or an antigen binding fragment thereof; an anti-TSLP antibody or an antigen binding fragment thereof; an anti-IL-10 antibody or an antigen binding fragment thereof; and IL-10 or PEGylated IL-10.
- The invention also provides a method of treating an infection or infectious disease in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment of the invention, optionally in association with a further therapeutic agent or therapeutic procedure. In one embodiment, the subject to be treated is a human subject.
- In one embodiment, the further therapeutic agent is selected from the group consisting of: an anti-LAG3 antibody or an antigen binding fragment thereof; an anti-APRIL antibody or an antigen binding fragment thereof; an an anti-TIGIT antibody or an antigen binding fragment thereof; an anti-VISTA antibody or an antigen binding fragment thereof; an anti-BTLA antibody or an antigen binding fragment thereof; an anti-TIM3 antibody or an antigen binding fragment thereof; an anti-CTLA4 antibody or an antigen binding fragment thereof; an anti-HVEM antibody or an antigen binding fragment thereof; an anti-CD70 antibody or an antigen binding fragment thereof; an anti-CD137 antibody or an antigen binding fragment thereof; an anti-OX40 antibody or an antigen binding fragment thereof; an anti-CD28 antibody or an antigen binding fragment thereof; thereof; an anti-PD1 antibody or an antigen binding fragment thereof; an anti-PDL1 antibody or an antigen binding fragment thereof; an anti-PDL2 antibody or an antigen binding fragment thereof; an anti-GITR antibody or an antigen binding fragment thereof; an anti-ICOS antibody or an antigen binding fragment thereof; an anti-ILT2 antibody or antigen binding fragment thereof; an anti-ILT3 antibody or antigen binding fragment thereof; an anti-ILT4 antibody or antigen binding fragment thereof; an anti-ILT5 antibody or an antigen binding fragment thereof; and an anti-4-1BB antibody or an antigen binding fragment thereof; an anti-NKG2A antibody or an antigen binding fragment thereof; an anti-NKG2C antibody or an antigen binding fragment thereof; an anti-NKG2E antibody or an antigen binding fragment thereof; an anti-TSLP antibody or an antigen binding fragment thereof; an anti-IL-10 antibody or an antigen binding fragment thereof; and IL-10 or PEGylated IL-10.
- The invention also provides a method for detecting the presence of a SIRPα peptide or a fragment thereof in a sample comprising contacting the sample with an antibody or antigen binding fragment thereof of the invention and detecting the presence of a complex between the antibody or fragment and the peptide; wherein detection of the complex indicates the presence of the SIRPα peptide.
-
FIG. 1 depicts cross-reactivity of commercially available anti-hSIRPα antibodies with hSIRPβ1 and allele-specific binding to hSIRPαV1 and hSIRPαV2. -
FIG. 2 depicts reactivity of KWAR23 antibody with hSIRPαV1, hSIRPαV2, hSIRPβ1, and hSIRPγ. -
FIG. 3 depicts reactivity of antibody clone hSIRPα.50A for various hSIRPα alleles. -
FIG. 4 depicts the ability of hSIRPα.50A antibody to block recombinant hCD47/Fc-protein binding to cell surface expressed hSIRPα. -
FIG. 5A depicts binding of hSIRP?0.50A antibody to primary CD14+ enriched monocytes from a human donor. -
FIG. 5B depicts binding of hSIRP?0.50A antibody to primary CD14+ enriched monocytes from a second human donor. -
FIG. 5C depicts the ability of hSIRP?0.50A antibody to block hCD47 binding to to primary CD14+ enriched monocytes from a human donor. -
FIG. 5D depicts the ability of hSIRP?0.50A antibody to block hCD47 binding to to primary CD14+ enriched monocytes from a second human donor. -
FIG. 6A depicts binding of hSIRPα.50A antibody to primary human granulocytes. -
FIG. 6B depicts phagocytosis of tumor cells by primary human granulocytes in the presence of rituximab plus or minus the hSIRPα.50A antibody. -
FIG. 6C depicts phagocytosis of tumor cells by primary human granulocytes in the presence of daratumumab plus or minus the hSIRPα.50A antibody. -
FIG. 6D depicts phagocytosis of tumor cells by primary human granulocytes in the presence of alemtuzumab plus or minus the hSIRPα.50A antibody. -
FIG. 6E depicts phagocytosis of tumor cells by primary human granulocytes in the presence of cetuximab plus or minus the hSIRPα.50A antibody. -
FIG. 7 depicts phagocytosis of tumor cells by human macrophages in the presence of the indicated antibody (rituximab or daratumumab) plus or minus the hSIRPα.50A antibody. -
FIG. 8 depicts blocking of the hSIRPα/hCD47 interaction by mouse hSIRPα.50A and humanized hSIRPα.50A antibodies to hSIRPα. -
FIG. 9 depicts depicts hSIRPα.50A antibody binding to hSIRPαV1, hSIRPαV2, hSIRPβ1, hSIRPα-VβC1αC2α, hSIRPα-VαC1βC2α, and hSIRPα-VαC1αC2β. -
FIG. 10A depicts an alignment of the hSIRPα and hSIRPβ1 IgV domain amino acid sequences (SEQ ID NOS: 133-135). -
FIG. 10B depicts loss of hSIRPα.50A antibody binding to hSIRPαV1(P74A). -
FIG. 11 depicts binding of hSIRPα.40A and hSIRPα.50A antibodies to hSIRPαV1, hSIRPαV2, hSIRPβ1, hSIRPβL, and hSIRPγ. -
FIG. 12 depicts binding of hSIRPα.40A and hSIRPα.50A antibodies to hSIRPαV1, hSIRPαV2, hSIRPαV3, hSIRPαV4, hSIRPαV5, hSIRPαV6, hSIRPαV8, and hSIRPαV9. -
FIG. 13 depicts the ability of hSIRPα.40A and hSIRPα.50A antibodies to block recombinant hCD47/Fc-protein binding to cell surface expressed hSIRPα. -
FIG. 14A depicts binding of hSIRP?0.40A antibody to primary CD14+ enriched monocytes from a human donor. -
FIG. 14B depicts binding of hSIRP?0.40A antibody to primary CD14+ enriched monocytes from a second human donor. -
FIG. 14C depicts the ability of hSIRP?0.40A antibody to block hCD47 binding to to primary CD14+ enriched monocytes from a human donor. -
FIG. 14D depicts the ability of hSIRP?0.40A antibody to block hCD47 binding to to primary CD14+ enriched monocytes from a second human donor. -
FIG. 15A depicts binding of hSIRPα.40A and hSIRPα.50A antibodies to primary human granulocytes. -
FIG. 15B depicts phagocytosis of Ramos cells by primary human granulocytes in the presence of rituximab plus or minus the hSIRPα.40A and hSIRPα.50A antibodies. -
FIG. 16 depicts enhancement of rituximab-induced Raji cell phagocytosis by hSIRPα.40A and hSIRPα.50A antibodies. -
FIG. 17 depicts binding of mouse hSIRPα.40A and humanized hSIRPα.40A antibodies to hSIRPα. -
FIG. 18 depicts the blockade of hCD47 binding to hSIRPα in the presence of humanized hSIRPα.40A antibody variants. -
FIG. 19 depicts binding of hSIRPα.40A and hSIRPα.50A antibodies to hSIRPαV1, hSIRPαV2, hSIRPβ1, hSIRP-VγC1βC2β, hSIRP-VβC1γC2β, and hSIRP-VβC1βC2γ. -
FIG. 20 depicts loss of hSIRPα.40A and hSIRPα.50A antibody binding to hSIRPαV1(P74A). -
FIG. 21 depicts the ability of chimeric hSIRPα.40A antibody variants to affect rituximab-mediated phagocytosis. -
FIG. 22 depicts the ability of humanized hSIRPα.40A antibody variants to affect rituximab-mediated phagocytosis. -
FIG. 23A depicts the ability of mouse hSIRPα.50A and chimeric hSIRPα.50A hIgG2 and hIgG4 antibody variants to affect rituximab-mediated phagocytosis. -
FIG. 23B depicts the ability of chimeric hSIRPα.50A hIgG2 and hIgG4 antibody variants to affect rituximab-mediated phagocytosis. -
FIG. 23C depicts the ability of chimeric hSIRPα.50A hIgG2 and hIgG4 antibody variants to affect daratumumab-mediated phagocytosis. -
FIG. 23D depicts the ability of mouse hSIRPα.50A and chimeric hSIRPα.50A hIgG2 antibody variants to affect rituximab-mediated phagocytosis in granulocytes. -
FIG. 24A depicts the ability of mouse hSIRPα.50A and chimeric hSIRPα.50A.hIgG 1.N297Q, hSIRPα.50A.hIgG4.N297Q or hSIRPα.50A.hIgG2 antibody variants to affect rituximab-mediated phagocytosis. -
FIG. 24B depicts the ability of mouse hSIRPα.50A and chimeric hSIRPα.50A.hIgG 1.N297Q, hSIRPα.50A.hIgG4.N297Q or hSIRPα.50A.hIgG2 antibody variants to affect daratumumab-mediated phagocytosis. -
FIG. 25 depicts the ability of chimeric hSIRPα.50A.hIgG1.N297Q, hSIRPα.50A hIgG1.L234A.L235A.P329G, and hSIRPα.50A hIgG2 or hIgG4 antibody variants to affect rituximab-mediated phagocytosis. - Throughout the detailed description and examples of the invention the following abbreviations will be used:
- ADCC Antibody-dependent cellular cytotoxicity
- ADCP Antibody-dependent cellular phagocytosis
- CDC Complement-dependent cytotoxicity
- CDR Complementarity determining region in the immunoglobulin variable regions, defined using the Kabat numbering system
- CHO Chinese hamster ovary
- EC50 Concentration at which 50% of the total binding signal is observed
- ELISA Enzyme-linked immunosorbant assay
- FR Antibody framework region: the immunoglobulin variable regions excluding the CDR regions.
- HRP Horseradish peroxidase
- IFN interferon
- IC50 concentration resulting in 50% inhibition
- IgG Immunoglobulin G
- Kabat An immunoglobulin alignment and numbering system pioneered by Elvin A. Kabat ((1991) Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md.)
- mAb or Mab or MAb Monoclonal antibody
- SEB Staphylococcus Enterotoxin B
- TT Tetanus toxoid
- V region The segment of Ig chains which is variable in sequence between different antibodies. It extends to Kabat residue 109 in the light chain and 113 in the heavy chain.
- VH Immunoglobulin heavy chain variable region
- VK Immunoglobulin kappa light chain variable region
- VL Immunoglobulin light chain variable region
- So that the invention may be more readily understood, certain technical and scientific terms are specifically defined below. Unless specifically defined elsewhere in this document, all other technical and scientific terms used herein have the meaning commonly understood by one of ordinary skill in the art to which this invention belongs.
- As used herein, including the appended claims, the singular forms of words such as “a,” “an,” and “the,” include their corresponding plural references unless the context clearly dictates otherwise.
- “Administration” and “treatment,” as it applies to an animal, human, experimental subject, cell, tissue, organ, or biological fluid, refers to contact of an exogenous pharmaceutical, therapeutic, diagnostic agent, or composition to the animal, human, subject, cell, tissue, organ, or biological fluid. Treatment of a cell encompasses contact of a reagent to the cell, as well as contact of a reagent to a fluid, where the fluid is in contact with the cell. “Administration” and “treatment” also means in vitro and ex vivo treatments, e.g., of a cell, by a reagent, diagnostic, binding compound, or by another cell.
- “Treat” or “treating” means to administer a therapeutic agent, such as a composition containing any of the antibodies or antigen-binding fragments of the present invention, internally or externally to a subject or patient having one or more disease symptoms, or being suspected of having a disease, for which the agent has therapeutic activity. Typically, the agent is administered in an amount effective to alleviate one or more disease symptoms in the treated subject or population, whether by inducing the regression of or inhibiting the progression of such symptom(s) by any clinically measurable degree. The amount of a therapeutic agent that is effective to alleviate any particular disease symptom may vary according to factors such as the disease state, age, and weight of the patient, and the ability of the drug to elicit a desired response in the subject. Whether a disease symptom has been alleviated can be assessed by any clinical measurement typically used by physicians or other skilled healthcare providers to assess the severity or progression status of that symptom.
- “Recombinant expression” of a protein means the transcription and translation of an exogenous gene in a host organism to generate the protein, which is referred to herein as a “recombinant protein.”
- SIRPα belongs to a class of membrane proteins known as “paired receptors” that contain several genes coding for proteins (e.g., SIRPα, SIRPβ1, and SIRPγ) with similar extracellular regions but different transmembrane and/or cytoplasmic regions having opposite (activating or inhibitory) signaling abilities. Like SIRPα, there are several examples of paired receptors on NK cells and some on myeloid cells, including the SIRP and CD200 receptor families (Hatherley et al., Mol Cell. 2008; 31: 266-277).
- SIRPα contains an extracellular region that can be subdivided into three separate domains: the Ig-like (immunoglobulin-like) V-type (IgV), Ig-like C1-type (IgC1), and Ig-like C2-type (IgC2) domain. The IgV domain is also known as the ligand-binding N-terminal domain of SIRPα. Like SIRPα, also the related proteins SIRPβ1 and SIRPγ comprise an extracellular region that can be subdivided into an IgV, IgC1, and IgC2 domain. However, SIRPα, SIRPβ1 and SIRPγ have different cytoplasmic regions. SIRPβ1 has a very short cytoplasmic region of only 6 amino acids and lacks signalling motifs for association with phosphatases. Instead, this protein associates with DNAX activation protein 12 (DAP12), a dimeric adaptor protein that binds an amino acid with a basic side chain in the transmembrane region of SIRPβ1 and is able to transmit activating signals through its immunoreceptor tyrosine-based activation motif (ITAM). SIRPγ also has a short cytoplasmic region of 4 amino acids, but it lacks a charged amino-acid side chain in the transmembrane region and therefore does not associate with DAP12. Hence, SIRPγ is annotated as a non-signalling protein (Barclay, A. N. and Brown, M. H., Nat Rev Immunol. 2006; 6: 457-464).
- The major ligand of SIRPγ is CD47, which consists of one extracellular IgV domain, a five times transmembrane-spanning domain, and a short cytoplasmic tail. CD47 functions as a cellular ligand with binding mediated through the NH2-terminal IgV domain of SIRPγ. Evidence that CD47 contributes to recognition of self comes from the observation that splenic macrophages derived from CD47-expressing mice clear infused blood cells from CD47−/− mice (Oldenborg et al., Science. 2000; 288: 2051-2054).
- In addition to CD47, two other SIRPγ ligands have been reported, known as surfactant proteins A and D (Sp-A and Sp-D), both of which belong to the collectin family. Sp-D has been reported to bind to the membrane-proximal IgC2 domain of SIRPγ in a calcium- and saccharide-dependent manner. It is thought that Sp-A and Sp-D help maintain an anti-inflammatory environment in the lung by stimulating SIRPγ on alveolar macrophages (Gardai et al., Cell. 2003; 115: 13-23).
- The amino acid sequence of eight human SIRPγ variants are listed in SEQ ID NOs: 34, 36, 44, 46, 48, 50, 52, and 54; exemplary nucleic acid sequences encoding these variants are listed in SEQ ID NOs: 33, 35, 43, 45, 47, 49, 51, and 53, respectively.
- For comparison, the amino acid sequence of human SIRPβ1 and SIRPγ are listed in SEQ ID NOs: 38 and 40, respectively, and exemplary nucleic acid sequences in SEQ ID NOs: 37 and 39, respectively.
- The amino acid sequence of human CD47 is listed in SEQ ID NO: 42, and an exemplary nucleic acid sequence in SEQ ID NO: 41.
- Modified SIRPγ polypeptides hSIRPα-VβC1αC2α, hSIRPα-VαC1βC2α, hSIRPα-VαC1αC2β, and hSIRPαV1(P74A) discussed hereinafter are listed in SEQ ID NOs: 56, 58, 60, and 62; exemplary nucleic acid sequences encoding these variants are listed in SEQ ID NOs: 55, 57, 59, and 61, respectively.
- The present invention provides antibodies or antigen-binding fragments thereof that bind human SIRPα and uses of such antibodies or fragments. In some embodiments, the anti-SIRPα antibodies are isolated.
- Whether an antibody specifically binds to a polypeptide sequence (e.g., human SIRPα, hSIRPβ1, etc.) can be determined using any assay known in the art. Examples of assays known in the art to determining binding affinity include surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g. KinExa or OCTET).
- As used herein, the term “antibody” refers to any form of antibody that exhibits the desired biological activity. The term antibody includes antigen-binding portions, i.e., “antigen binding sites,” (e.g., fragments, subsequences, complementarity determining regions (CDRs)) that retain capacity to bind antigen, including (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and
C H1 domains; (ii) a F(ab′)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH andC H1 domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a VH domain; and (vi) an isolated complementarity determining region (CDR). Single chain antibodies are also included by reference in the term “antibody.” Preferred therapeutic antibodies are intact IgG antibodies. The term “intact IgG” as used herein is meant as a polypeptide belonging to the class of antibodies that are substantially encoded by a recognized immunoglobulin gamma gene. In humans this class comprises IgG1, IgG2, IgG3, and IgG4. In mice this class comprises IgG1, IgG2a, IgG2b, IgG3. The known Ig domains in the IgG class of antibodies are VH, Cγ1, Cγ2, Cγ3, VL, and CL. - The present invention includes anti-SIRPα antigen-binding fragments and methods of use thereof.
- As used herein, a “full length antibody” is, in the case of an IgG, a bivalent molecule comprising two heavy chains and two light chains. Each heavy chain comprises a VH domain followed by a constant domain (CH1), a hinge region, and two more constant (CH2 and CH3) domains; while each light chain comprises one VL domain and one constant (CL) domain. A full length antibody in the case of an IgM is a decavalent or dodecavalent molecule comprising 5 or 6 linked immunoglobulins in which immunoglobulin each monomer has two antigen binding sites formed of a heavy and light chain.
- As used herein, unless otherwise indicated, “antibody fragment” or “antigen-binding fragment” refers to antigen-binding fragments of antibodies, i.e. antibody fragments that retain the ability to bind specifically to the antigen bound by the full-length antibody, e.g. fragments that retain one or more CDR regions. Examples of antigen-binding fragments include, but are not limited to, Fab, Fab′, F(ab′)2, and Fv fragments; diabodies; linear antibodies; single-chain antibody molecules, e.g., sc-Fv; nanobodies and multispecific antibodies formed from antibody fragments.
- The present invention includes anti-SIRPα Fab fragments and methods of use thereof. A “Fab fragment” is comprised of one light chain and the
C H1 and variable regions of one heavy chain. The heavy chain of a Fab molecule cannot form a disulfide bond with another heavy chain molecule. A “Fab fragment” can be the product of papain cleavage of an antibody. - The present invention includes anti-SIRPα antibodies and antigen-binding fragments thereof which comprise an Fc region and methods of use thereof. An “Fc” region contains two heavy chain fragments comprising the
C H3 andC H2 domains of an antibody. The two heavy chain fragments are held together by two or more disulfide bonds and by hydrophobic interactions of theC H3 domains. - The present invention includes anti-SIRPα Fab′ fragments and methods of use thereof. A “Fab′ fragment” contains one light chain and a portion or fragment of one heavy chain that contains the VH domain and the
C H1 domain and also the region between theC H1 and C H2 domains, such that an interchain disulfide bond can be formed between the two heavy chains of two Fab′ fragments to form a F(ab′) 2 molecule. - The present invention includes anti-SIRPα F(ab′)2 fragments and methods of use thereof. A “F(ab′)2 fragment” contains two light chains and two heavy chains containing a portion of the constant region between the
C H1 andC H2 domains, such that an interchain disulfide bond is formed between the two heavy chains. A F(ab′) 2 fragment thus is composed of two Fab′ fragments that are held together by a disulfide bond between the two heavy chains. An “F(ab′)2 fragment” can be the product of pepsin cleavage of an antibody. - The present invention includes anti-SIRPα Fv fragments and methods of use thereof. The “Fv region” comprises the variable regions from both the heavy and light chains, but lacks the constant regions.
- The present invention includes anti-SIRPα scFv fragments and methods of use thereof. The term “single-chain Fv” or “scFv” antibody refers to antibody fragments comprising the VH and VL domains of an antibody, wherein these domains are present in a single polypeptide chain. Generally, the Fv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the scFv to form the desired structure for antigen-binding. For a review of scFv, see Pluckthun (1994) THE PHARMACOLOGY OF MONOCLONAL ANTIBODIES, vol. 113, Rosenburg and Moore eds. Springer-Verlag, New York, pp. 269-315. See also, International Patent Application Publication No. WO 88/01649 and U.S. Pat. Nos. 4,946,778 and 5,260,203.
- The present invention includes anti-SIRPα domain antibodies and methods of use thereof. A “domain antibody” is an immunologically functional immunoglobulin fragment containing only the variable region of a heavy chain or the variable region of a light chain. In some instances, two or more VH regions are covalently joined with a peptide linker to create a bivalent domain antibody. The two VH regions of a bivalent domain antibody may target the same or different antigens.
- The present invention includes anti-SIRPα bivalent antibodies and methods of use thereof. A “bivalent antibody” comprises two antigen-binding sites. In some instances, the two binding sites have the same antigen specificities. However, bivalent antibodies may be bispecific (see below).
- The present invention includes anti-SIRPα diabodies and methods of use thereof. As used herein, the term “diabodies” refers to small antibody fragments with two antigen-binding sites, which fragments comprise a heavy chain variable domain (VH) connected to a light chain variable domain (VL) in the same polypeptide chain (VH-VL or VL-VH). By using a linker that is too short to allow pairing between the two domains on the same chain, the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites. Diabodies are described more fully in, e.g., EP 404,097; WO 93/11161; and Holliger et al. (1993) Proc. Natl. Acad. Sci. USA 90: 6444-6448. Duobodies are described in Labrijn et al., 2013, Proc. Natl. Acad. Sci. USA 110 (13): 5145-5150. For a review of engineered antibody variants generally see Holliger and Hudson (2005) Nat. Biotechnol. 23:1126-1136.
- Typically, an antibody or antigen-binding fragment of the invention which is modified in some way retains at least 10% of its binding activity (when compared to the parental antibody) when that activity is expressed on a molar basis. Preferably, an antibody or antigen-binding fragment of the invention retains at least 20%, 50%, 70%, 80%, 90%, 95% or 100% or more of the SIRPα binding affinity as the parental antibody. It is also intended that an antibody or antigen-binding fragment of the invention can include conservative or non-conservative amino acid substitutions (referred to as “conservative variants” or “function conserved variants” of the antibody) that do not substantially alter its biologic activity.
- The present invention includes isolated anti-SIRPα antibodies and antigen-binding fragments thereof and methods of use thereof. Herein, the term “isolated” is not intended to refer to a complete absence of such biological molecules or to an absence of water, buffers, or salts or to components of a pharmaceutical formulation that includes the antibodies or fragments. An “isolated” antibody, antigen-binding fragment, nucleic acid, etc., is one which has been identified and separated and/or recovered from one or more components of its natural environment. In preferred embodiments, the antibody, antigen-binding fragment, nucleic acid, etc., is purified to 75% by weight or more, more preferably to 90% by weight or more, still more preferably to 95% by weight or more, an still more preferably to 98% by weight or more. Thus, “isolated” biological molecules are at least partially free of other biological molecules from the cells or cell cultures in which they are produced. Such biological molecules include nucleic acids, proteins, lipids, carbohydrates, or other material such as cellular debris and growth medium. An isolated antibody or antigen-binding fragment may further be at least partially free of expression system components such as biological molecules from a host cell or of the growth medium thereof.
- The present invention includes anti-SIRPα chimeric antibodies (e.g., human constant domain/mouse variable domain) and methods of use thereof. As used herein, a “chimeric antibody” is an antibody having the variable domain from a first antibody and the constant domain from a second antibody, where the first and second antibodies are from different species. (U.S. Pat. No. 4,816,567; and Morrison et al., (1984) Proc. Natl. Acad. Sci. USA 81: 6851-6855). Typically, the variable domains are obtained from an antibody from an experimental animal (the “parental antibody”), such as a rodent, and the constant domain sequences are obtained from human antibodies, so that the resulting chimeric antibody will be less likely to elicit an adverse immune response in a human subject than the parental (e.g., mouse) antibody.
- The present invention includes anti-SIRPα humanized antibodies and antigen-binding fragments thereof (e.g., rat or mouse antibodies that have been humanized) and methods of use thereof. As used herein, the term “humanized antibody” refers to forms of antibodies that contain sequences from both human and non-human (e.g., mouse or rat) antibodies. In general, the humanized antibody will comprise substantially of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin, and all or substantially all of the framework (FR) regions are those of a human immunoglobulin sequence. The humanized antibody may optionally comprise at least a portion of a human immunoglobulin constant region (Fc). For more details about humanized antibodies, see, e.g., Jones et al., Nature, 321:522-525 (1986); Reichmann et al., Nature, 332:323-329 (1988); Presta, Curr. Op. Struct. Biol., 2:593-596 (1992); and Clark, Immunol. Today 21: 397-402 (2000).
- In general, the basic antibody structural unit comprises a tetramer. Each tetramer includes two identical pairs of polypeptide chains, each pair having one “light” (about 25 kDa) and one “heavy” chain (about 50-70 kDa). The amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition. The carboxy-terminal portion of the heavy chain may define a constant region primarily responsible for effector function. Typically, human light chains are classified as kappa and lambda light chains. Furthermore, human heavy chains are typically classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively. Within light and heavy chains, the variable and constant regions are joined by a “J” region of about 12 or more amino acids, with the heavy chain also including a “D” region of about 10 more amino acids. See generally, Fundamental Immunology Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989).
- The variable regions of each light/heavy chain pair form the antibody binding site. Thus, in general, an intact antibody has two binding sites. Except in bifunctional or bispecific antibodies, the two binding sites are, in general, the same.
- Typically, the variable domains of both the heavy and light chains comprise three hypervariable regions, also called complementarity determining regions (CDRs), located within relatively conserved framework regions (FR). The CDRs are usually aligned by the framework regions, enabling binding to a specific epitope. In general, from N-terminal to C-terminal, both light and heavy chains variable domains comprise FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. The assignment of amino acids to each domain is, generally, in accordance with the definitions of Sequences of Proteins of Immunological Interest, Kabat, et al.; National Institutes of Health, Bethesda, Md.; 5th ed.; NIH Publ. No. 91-3242 (1991); Kabat (1978) Adv. Prot. Chem. 32:1-75; Kabat, et al., (1977) J. Biol. Chem. 252:6609-6616; Chothia, et al., (1987) J Mol. Biol. 196:901-917 or Chothia, et al., (1989) Nature 342:878-883.
- As used herein, the term “hypervariable region” refers to the amino acid residues of an antibody or antigen-binding fragment thereof that are responsible for antigen-binding. The hypervariable region comprises amino acid residues from a “complementarity determining region” or “CDR” (i.e. CDRL1, CDRL2 and CDRL3 in the light chain variable domain and CDRH1, CDRH2 and CDRH3 in the heavy chain variable domain). See Kabat et al. (1991) Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (defining the CDR regions of an antibody by sequence); see also Chothia and Lesk (1987) J. Mol. Biol. 196: 901-917 (defining the CDR regions of an antibody by structure). As used herein, the term “framework” or “FR” residues refers to those variable domain residues other than the hypervariable region residues defined herein as CDR residues.
- “Isolated nucleic acid molecule” or “isolated polynucleotide” means a DNA or RNA of genomic, mRNA, cDNA, or synthetic origin or some combination thereof which is not associated with all or a portion of a polynucleotide in which the isolated polynucleotide is found in nature, or is linked to a polynucleotide to which it is not linked in nature. For purposes of this disclosure, it should be understood that “a nucleic acid molecule comprising” a particular nucleotide sequence does not encompass intact chromosomes. Isolated nucleic acid molecules “comprising” specified nucleic acid sequences may include, in addition to the specified sequences, coding sequences for up to ten or even up to twenty or more other proteins or portions or fragments thereof, or may include operably linked regulatory sequences that control expression of the coding region of the recited nucleic acid sequences, and/or may include vector sequences.
- The phrase “control sequences” refers to DNA sequences necessary for the expression of an operably linked coding sequence in a particular host organism. The control sequences that are suitable for prokaryotes, for example, include a promoter, optionally an operator sequence, and a ribosome binding site. Eukaryotic cells are known to use promoters, polyadenylation signals, and enhancers.
- A nucleic acid or polynucleotide is “operably linked” when it is placed into a functional relationship with another nucleic acid sequence. For example, DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation. Generally, but not always, “operably linked” means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.
- As used herein, the expressions “cell,” “cell line,” and “cell culture” are used interchangeably and all such designations include progeny. Thus, the words “transformants” and “transformed cells” include the primary subject cell and cultures derived therefrom without regard for the number of transfers. It is also understood that not all progeny will have precisely identical DNA content, due to deliberate or inadvertent mutations. Mutant progeny that have the same function or biological activity as screened for in the originally transformed cell are included. Where distinct designations are intended, it will be clear from the context.
- As used herein, “germline sequence” refers to a sequence of unrearranged immunoglobulin DNA sequences. Any suitable source of unrearranged immunoglobulin sequences may be used. Human germline sequences may be obtained, for example, from JOINSOLVER germline databases on the website for the National Institute of Arthritis and Musculoskeletal and Skin Diseases of the United States National Institutes of Health. Mouse germline sequences may be obtained, for example, as described in Giudicelli et al. (2005) Nucleic Acids Res. 33: D256-D261.
- Physical and Functional Properties of the Exemplary Anti-SIRPα Antibodies
- The present invention provides anti-SIRPα antibodies and antigen-binding fragments thereof having specified structural and functional features, and methods of use of the antibodies or antigen-binding fragments thereof in the treatment or prevention of disease (e.g., cancer or infectious disease).
- As stated above, antibodies and fragments that bind to the same epitope as any of the anti-SIRPα antibodies or antigen-binding fragments thereof of the present invention also form part of the present invention. In one embodiment, the invention provides an antibody or antigen binding fragment thereof that binds to the same epitope of human SIRPα as an antibody comprising one of the following combinations of heavy chain sequence/light chain sequence (or in each case an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto):
- SEQ ID NO: 10/SEQ ID NO: 20 (referred to herein as hSIRPα.50A.H1L1)
- SEQ ID NO: 10/SEQ ID NO: 22 (referred to herein as hSIRPα.50A.H1L2)
- SEQ ID NO: 10/SEQ ID NO: 24 (referred to herein as hSIRPα.50A.H1L3)
- SEQ ID NO: 10/SEQ ID NO: 26 (referred to herein as hSIRPα.50A.H1L4)
- SEQ ID NO: 10/SEQ ID NO: 28 (referred to herein as hSIRPα.50A.H1L5)
- SEQ ID NO: 12/SEQ ID NO: 20 (referred to herein as hSIRPα.50A.H2L1)
- SEQ ID NO: 12/SEQ ID NO: 22 (referred to herein as hSIRPα.50A.H2L2)
- SEQ ID NO: 12/SEQ ID NO: 24 (referred to herein as hSIRPα.50A.H2L3)
- SEQ ID NO: 12/SEQ ID NO: 26 (referred to herein as hSIRPα.50A.H2L4)
- SEQ ID NO: 12/SEQ ID NO: 28 (referred to herein as hSIRPα.50A.H2L5)
- SEQ ID NO: 14/SEQ ID NO: 20 (referred to herein as hSIRPα.50A.H3L1)
- SEQ ID NO: 14/SEQ ID NO: 22 (referred to herein as hSIRPα.50A.H3L2)
- SEQ ID NO: 14/SEQ ID NO: 24 (referred to herein as hSIRPα.50A.H3L3)
- SEQ ID NO: 14/SEQ ID NO: 26 (referred to herein as hSIRPα.50A.H3L4)
- SEQ ID NO: 14/SEQ ID NO: 28 (referred to herein as hSIRPα.50A.H3L5)
- SEQ ID NO: 16/SEQ ID NO: 20 (referred to herein as hSIRPα.50A.H4L1)
- SEQ ID NO: 16/SEQ ID NO: 22 (referred to herein as hSIRPα.50A.H4L2)
- SEQ ID NO: 16/SEQ ID NO: 24 (referred to herein as hSIRPα.50A.H4L3)
- SEQ ID NO: 16/SEQ ID NO: 26 (referred to herein as hSIRPα.50A.H4L4)
- SEQ ID NO: 16/SEQ ID NO: 28 (referred to herein as hSIRPα.50A.H4L5)
- SEQ ID NO: 18/SEQ ID NO: 20 (referred to herein as hSIRPα.50A.H5L1)
- SEQ ID NO: 18/SEQ ID NO: 22 (referred to herein as hSIRPα.50A.H5L2)
- SEQ ID NO: 18/SEQ ID NO: 24 (referred to herein as hSIRPα.50A.H5L3)
- SEQ ID NO: 18/SEQ ID NO: 26 (referred to herein as hSIRPα.50A.H5L4)
- SEQ ID NO: 18/SEQ ID NO: 28 (referred to herein as hSIRPα.50A.H5L5)
- SEQ ID NO: 78/SEQ ID NO: 90 (referred to herein as hSIRPα.40A.H1L1)
- SEQ ID NO: 78/SEQ ID NO: 92 (referred to herein as hSIRPα.40A.H1L2)
- SEQ ID NO: 78/SEQ ID NO: 94 (referred to herein as hSIRPα.40A.H1L3)
- SEQ ID NO: 78/SEQ ID NO: 96 (referred to herein as hSIRPα.40A.H1L4)
- SEQ ID NO: 78/SEQ ID NO: 98 (referred to herein as hSIRPα.40A.H1L5)
- SEQ ID NO: 78/SEQ ID NO: 100 (referred to herein as hSIRPα.40A.H1L6)
- SEQ ID NO: 80/SEQ ID NO: 90 (referred to herein as hSIRPα.40A.H2L1)
- SEQ ID NO: 80/SEQ ID NO: 92 (referred to herein as hSIRPα.40A.H2L2)
- SEQ ID NO: 80/SEQ ID NO: 94 (referred to herein as hSIRPα.40A.H2L3)
- SEQ ID NO: 80/SEQ ID NO: 96 (referred to herein as hSIRPα.40A.H2L4)
- SEQ ID NO: 80/SEQ ID NO: 98 (referred to herein as hSIRPα.40A.H2L5)
- SEQ ID NO: 80/SEQ ID NO: 100 (referred to herein as hSIRPα.40A.H2L6)
- SEQ ID NO: 82/SEQ ID NO: 90 (referred to herein as hSIRPα.40A.H3L1)
- SEQ ID NO: 82/SEQ ID NO: 92 (referred to herein as hSIRPα.40A.H3L2)
- SEQ ID NO: 82/SEQ ID NO: 94 (referred to herein as hSIRPα.40A.H3L3)
- SEQ ID NO: 82/SEQ ID NO: 96 (referred to herein as hSIRPα.40A.H3L4)
- SEQ ID NO: 82/SEQ ID NO: 98 (referred to herein as hSIRPα.40A.H3L5)
- SEQ ID NO: 82/SEQ ID NO: 100 (referred to herein as hSIRPα.40A.H3L6)
- SEQ ID NO: 84/SEQ ID NO: 90 (referred to herein as hSIRPα.40A.H4L1)
- SEQ ID NO: 84/SEQ ID NO: 92 (referred to herein as hSIRPα.40A.H4L2)
- SEQ ID NO: 84/SEQ ID NO: 94 (referred to herein as hSIRPα.40A.H4L3)
- SEQ ID NO: 84/SEQ ID NO: 96 (referred to herein as hSIRPα.40A.H4L4)
- SEQ ID NO: 84/SEQ ID NO: 98 (referred to herein as hSIRPα.40A.H4L5)
- SEQ ID NO: 84/SEQ ID NO: 100 (referred to herein as hSIRPα.40A.H4L6)
- SEQ ID NO: 86/SEQ ID NO: 90 (referred to herein as hSIRPα.40A.H5L1)
- SEQ ID NO: 86/SEQ ID NO: 92 (referred to herein as hSIRPα.40A.H5L2)
- SEQ ID NO: 86/SEQ ID NO: 94 (referred to herein as hSIRPα.40A.H5L3)
- SEQ ID NO: 86/SEQ ID NO: 96 (referred to herein as hSIRPα.40A.H5L4)
- SEQ ID NO: 86/SEQ ID NO: 98 (referred to herein as hSIRPα.40A.H5L5)
- SEQ ID NO: 86/SEQ ID NO: 100 (referred to herein as hSIRPα.40A.H5L6)
- SEQ ID NO: 88/SEQ ID NO: 90 (referred to herein as hSIRPα.40A.H6L1)
- SEQ ID NO: 88/SEQ ID NO: 92 (referred to herein as hSIRPα.40A.H6L2)
- SEQ ID NO: 88/SEQ ID NO: 94 (referred to herein as hSIRPα.40A.H6L3)
- SEQ ID NO: 88/SEQ ID NO: 96 (referred to herein as hSIRPα.40A.H6L4)
- SEQ ID NO: 88/SEQ ID NO: 98 (referred to herein as hSIRPα.40A.H6L5)
- SEQ ID NO: 88/SEQ ID NO: 100 (referred to herein as hSIRPα.40A.H6L6).
- There are several methods available for mapping antibody epitopes on target antigens, including: H/D-Ex mass spectrometry, crosslinking coupled mass spectrometry, X-ray crystallography, pepscan analysis and site directed mutagenesis. For example, HDX (Hydrogen Deuterium Exchange) coupled with proteolysis and mass spectrometry can be used to determine the epitope of an antibody on a specific antigen Y. HDX-MS relies on the accurate measurement and comparison of the degree of deuterium incorporation by an antigen when incubated in D2O on its own and in presence of its antibody at various time intervals. Deuterium is exchanged with hydrogen on the amide backbone of the proteins in exposed areas whereas regions of the antigen bound to the antibody will be protected and will show less or no exchange after analysis by LC-MS/MS of proteolytic fragments. Crosslinking coupled mass spectrometry begins by binding the antibody and the antigen with a mass labeled chemical crosslinker. Next the presence of the complex is confirmed using high mass MALDI detection. Because after crosslinking chemistry the Ab/Ag complex is extremely stable, many various enzymes and digestion conditions can be applied to the complex to provide many different overlapping peptides. Identification of these peptides is performed using high resolution mass spectrometry and MS/MS techniques. Identification of the crosslinked peptides is determined using mass tag linked to the cross-linking reagents. After MS/MS fragmentation and data analysis, both epitope and paratope are determined in the same experiment.
- The scope of the present invention also includes isolated anti-SIRPα antibodies and antigen-binding fragments thereof (e.g., humanized antibodies), comprising a variant of an immunoglobulin chain set forth herein, wherein the variant exhibits one or more of the following properties:
-
- binds human SIRPαV1 protein having the sequence of SEQ ID NO: 34 with an EC50<1 nM; and exhibits at least a 100-fold higher EC50 for SIRPαV1(P74A) having the sequence of SEQ ID NO: 62; and optionally also at least a 100-fold higher EC50 for human SIRPβ1 protein having the sequence of SEQ ID NO: 38 (in each case wherein the reduced EC50 is relative to the EC50 for human SIRPαV1 protein having the sequence of
- SEQ ID NO: 34, and in each case preferably when measured by cellular ELISA (CELISA) as described hereinafter;
- binds to a cell expressing human SIRPαV1 protein with an EC50<10 nM, preferably <5 nM, more preferably <1.5 nM, still more preferably <1.0 nM, even more preferably <0.5 nM, and most preferably about 0.3 nM or less;
- binds to a cell expressing human SIRPαV2 protein with an EC50<10 nM, preferably <5 nM, more preferably <1.5 nM, still more preferably <1.0 nM, even more preferably <0.5 nM, and most preferably about 0.3 nM or less;
- does not appreciably bind to SIRPβ1 protein at an antibody concentration of 50 nM, preferably 67 nM, and more preferably 100 nM; or alternatively at a concentration that is 10-fold greater, preferably 50-fold greater, more preferably 100-fold greater, and still more preferably 200-fold greater than the antibody's EC50 for SIRPαV1 or SIRPαV2;
- inhibits binding between human SIRPα and CD47 with an IC50<10.0 nM, more preferably <5.0 nM, still more preferably <2.5 nM, and most preferably about 1.0 nM or less; and
- exhibits a T20 “humanness” of at least 79, and more preferably 85%.
- In other embodiments, the invention provides antibodies or antigen-binding fragment thereof that bind human SIRPα (e.g., humanized antibodies) and have VH domains and VL domains with at least 90% sequence identity with SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 102, 7, 10, 12, 14, 16, 18, and 30; and 76, 90, 92, 94, 96, 98, 100, 104, 8, 20, 22, 24, 26, 28, and 32. In other embodiments, the invention provides antibodies or antigen-binding fragment thereof that bind human SIRPα (e.g., humanized antibodies) and have VH domains and VL domains with at least 95% sequence identity with SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 102, 7, 10, 12, 14, 16, 18, and 30; and 76, 90, 92, 94, 96, 98, 100, 104, 8, 20, 22, 24, 26, 28, and 32. In other embodiments, the invention provides antibodies or antigen-binding fragment thereof that bind human SIRPα (e.g., humanized antibodies) and have VH domains and VL domains with at least 97% sequence identity with SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 102, 7, 10, 12, 14, 16, 18, and 30; and 76, 90, 92, 94, 96, 98, 100, 104, 8, 20, 22, 24, 26, 28, and 32. In other embodiments, the invention provides antibodies or antigen-binding fragment thereof that bind human SIRPα (e.g., humanized antibodies) and have VH domains and VL domains with at least 98% sequence identity with SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 102, 7, 10, 12, 14, 16, 18, and 30; and 76, 90, 92, 94, 96, 98, 100, 104, 8, 20, 22, 24, 26, 28, and 32. In other embodiments, the invention provides antibodies or antigen-binding fragment thereof that bind human SIRPα (e.g., humanized antibodies) and have VH domains and VL domains with at least 99% sequence identity with SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 102, 7, 10, 12, 14, 16, 18, and 30; and 76, 90, 92, 94, 96, 98, 100, 104, 8, 20, 22, 24, 26, 28, and 32. Preferably, in each case, the sequence differences between SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 102, 7, 10, 12, 14, 16, 18, and 30; and 76, 90, 92, 94, 96, 98, 100, 104, 8, 20, 22, 24, 26, 28, and 32 and the variants consist of conservative substitutions and are most preferably limited to substitutions within the framework residues.
- The following references relate to BLAST algorithms often used for sequence analysis: BLAST ALGORITHMS: Camacho, C. et al. (2009): BMC Bioinformatics 10:421; Altschul et al. (2005) FEBS J. 272(20): 5101-5109; Altschul, S. F., et al., (1990) J. Mol. Biol. 215:403-410; Gish, W., et al., (1993) Nature Genet. 3:266-272; Madden, T. L., et al., (1996) Meth. Enzymol. 266:131-141; Altschul, S. F., et al., (1997) Nucleic Acids Res. 25:3389-3402; Zhang, J., et al., (1997) Genome Res. 7:649-656; Wootton, J. C., et al., (1993) Comput. Chem. 17:149-163; Hancock, J. M. et al., (1994) Comput. Appl. Biosci. 10:67-70; ALIGNMENT SCORING SYSTEMS: Dayhoff, M. O., et al., “A model of evolutionary change in proteins.” in Atlas of Protein Sequence and Structure, (1978) vol. 5, suppl. 3. M. O. Dayhoff (ed.), pp. 345-352, Natl. Biomed. Res. Found., Washington, D.C.; Schwartz, R. M., et al., “Matrices for detecting distant relationships.” in Atlas of Protein Sequence and Structure, (1978) vol. 5, suppl. 3.” M. O. Dayhoff (ed.), pp. 353-358, Natl. Biomed. Res. Found., Washington, D.C.; Altschul, S.F., (1991) J. Mol. Biol. 219:555-565; States, D. J., et al., (1991) Methods 3:66-70; Henikoff, S., et al., (1992) Proc. Natl. Acad. Sci. USA 89:10915-10919; Altschul, S. F., et al., (1993) J. Mol. Evol. 36:290-300; ALIGNMENT STATISTICS: Karlin, S., et al., (1990) Proc. Natl. Acad. Sci. USA 87:2264-2268; Karlin, S., et al., (1993) Proc. Natl. Acad. Sci. USA 90:5873-5877; Dembo, A., et al., (1994) Ann. Prob. 22:2022-2039; and Altschul, S.F. “Evaluating the statistical significance of multiple distinct local alignments.” in Theoretical and Computational Methods in Genome Research (S. Suhai, ed.), (1997) pp. 1-14, Plenum, New York. In the present application, percent identity comparisons are preferably performed by a BLAST algorithm wherein the parameters of the algorithm are selected to give the largest match between the respective sequences over the entire length of the respective reference sequences (e.g. expect threshold: 10; word size: 6; max matches in a query range: 0; BLOSUM 62 matrix; gap costs: existence 11,
extension 1; conditional compositional score matrix adjustment). - “Conservatively modified variants” or “conservative substitution” refers to substitutions of amino acids in a protein with other amino acids having similar characteristics (e.g. charge, side-chain size, hydrophobicity/hydrophilicity, backbone conformation and rigidity, etc.), such that the changes can frequently be made without altering the biological activity of the protein. Those of skill in this art recognize that, in general, single amino acid substitutions in non-essential regions of a polypeptide do not substantially alter biological activity (see, e.g., Watson et al. (1987) Molecular Biology of the Gene, The Benjamin/Cummings Pub. Co., p. 224 (4th Ed.)). In addition, substitutions of structurally or functionally similar amino acids are less likely to disrupt biological activity. Exemplary conservative substitutions are set forth the following Table 1.
-
TABLE 1 Exemplary Conservative Amino Acid Substitutions Original residue Conservative substitution Ala (A) Gly; Ser Arg (R) Lys; His Asn (N) Gln; His Asp (D) Glu; Asn Cys (C) Ser; Ala Gln (Q) Asn Glu (E) Asp; Gln Gly (G) Ala His (H) Asn; Gln Ile (I) Leu; Val Leu (L) Ile; Val Lys (K) Arg; His Met (M) Leu; Ile; Tyr Phe (F) Tyr; Met; Leu Pro (P) Ala Ser (S) Thr Thr (T) Ser Trp (W) Tyr; Phe Tyr (Y) Trp; Phe Val (V) Ile; Leu - Function-conservative variants of the antibodies of the invention are also contemplated by the present invention. “Function-conservative variants,” as used herein, refers to antibodies or fragments in which one or more amino acid residues have been changed without altering a desired property, such an antigen affinity and/or specificity. Such variants include, but are not limited to, replacement of an amino acid with one having similar properties, such as the conservative amino acid substitutions of Table 1. Also provided are isolated polypeptides comprising the VL domains of the anti-SIRPα antibodies of the invention (e.g., SEQ ID NOs: 76, 90, 92, 94, 96, 98, 100, 8, 20, 22, 24, 26, 28, and 32), and isolated polypeptides comprising the VH domains of the anti-SIRPα antibodies of the invention (e.g., SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 7, 10, 12, 14, 16, 18, and 30) having up to 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more amino acid substitutions, and preferably conservative substitutions.
- The present invention further comprises the polynucleotides encoding any of the polypeptides or immunoglobulin chains of anti-SIRPα antibodies and antigen-binding fragments thereof of the invention. For example, the present invention includes the polynucleotides encoding the amino acids described in any one of SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 102, 7, 10, 12, 14, 16, 18, and 30; and SEQ ID NOs: 76, 90, 92, 94, 96, 98, 100, 104, 8, 20, 22, 24, 26, 28, and 32.
- In one embodiment, an isolated polynucleotide, for example DNA, encoding the polypeptide chains of the isolated antibodies or antigen-binding fragments set forth herein is provided. In one embodiment, the isolated polynucleotide encodes an antibody or antigen-binding fragment thereof comprising at least one mature immunoglobulin light chain variable (VL) domain according to the invention and/or at least one mature immunoglobulin heavy chain variable (VH) domain according to the invention. In some embodiments, the isolated polynucleotide encodes both a light chain and a heavy chain on a single polynucleotide molecule, and in other embodiments the light and heavy chains are encoded on separate polynucleotide molecules. In another embodiment, the polynucleotides further encodes a signal sequence.
- This present invention also provides vectors, e.g., expression vectors, such as plasmids, comprising the isolated polynucleotides of the invention, wherein the polynucleotide is operably linked to control sequences that are recognized by a host cell when the host cell is transfected with the vector. Also provided are host cells comprising a vector of the present invention and methods for producing the antibody or antigen-binding fragment thereof or polypeptide disclosed herein comprising culturing a host cell harboring an expression vector or a nucleic acid encoding the immunoglobulin chains of the antibody or antigen-binding fragment thereof in culture medium, and isolating the antigen or antigen-binding fragment thereof from the host cell or culture medium.
- By way of example, and not limitation, the antibodies and antigen-binding fragments disclosed herein may bind human SIRPα bivalently with a KD value of 10×10−9M or lower) as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g. KinExa or bio-layer interferometry (OCTET)). In one embodiment, the antibodies and antigen-binding fragments disclosed herein may bind human SIRPα or bivalently with a KD value of about 5-10×10−9 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g. KinExa or OCTET). Affinity is calculated as KD=koff/kon (koff is the dissociation rate constant, K. is the association rate constant and KD is the equilibrium constant). Affinity can be determined at equilibrium by measuring the fraction bound (r) of labeled ligand at various concentrations (c). The data are graphed using the Scatchard equation: r/c=K(n−r): where r=moles of bound ligand/mole of receptor at equilibrium; c=free ligand concentration at equilibrium; K=equilibrium association constant; and n=number of ligand binding sites per receptor molecule. By graphical analysis, r/c is plotted on the Y-axis versus r on the X-axis, thus producing a Scatchard plot. Antibody affinity measurement by Scatchard analysis is well known in the art. See, e.g., van Erp et al., J. Immunoassay 12: 425-43, 1991; Nelson and Griswold, Comput. Methods Programs Biomed. 27: 65-8, 1988.
- For purposes of this document, “humanness” is measured using the T20 score analyzer to quantify the humanness of the variable region of monoclonal antibodies as described in Gao S H, Huang K, Tu H, Adler A S. Monoclonal antibody humanness score and its applications. BMC Biotechnology. 2013: 13:55. doi:10.1186/1472-6750-13-55).
- A web-based tool is provided to calculate the T20 score of antibody sequences using the T20 Cutoff Human Databases: http://abAnalyzer.lakepharma.com. In computing a T20 score, an input VH, VK, or VL variable region protein sequence is first assigned Kabat numbering, and CDR residues are identified. The full-length sequence or the framework only sequence (with CDR residues removed) is compared to every sequence in a respective antibody database using the blastp protein-protein BLAST algorithm. The sequence identity between each pairwise comparison is isolated, and after every sequence in the database has been analyzed, the sequences are sorted from high to low based on the sequence identity to the input sequence. The percent identity of the
Top 20 matched sequences is averaged to obtain the T20 score. - For each chain type (VH, VK, VL) and sequence length (full-length or framework only) in the “All Human Databases,” each antibody sequence was scored with its respective database using the T20 score analyzer. The T20 score was obtained for the top 20 matched sequences after the input sequence itself was excluded (the percent identity of
sequences 2 through 21 were averaged sincesequence 1 was always the input antibody itself). The T20 scores for each group were sorted from high to low. The decrease in score was roughly linear for most of the sequences; however the T20 scores for the bottom ˜15% of antibodies started decreasing sharply. Therefore, the bottom 15 percent of sequences were removed and the remaining sequences formed the T20 Cutoff Human Databases, where the T20 score cutoff indicates the lowest T20 score of a sequence in the new database. - As used herein, a “Human” antibody is one that has a T20 humanness score of at least 79%, and more preferably at least 85%.
- In some embodiments, the anti-SIRPα antibodies or antigen binding fragments of the invention are able to block binding of human SIRPα to human CD47. The ability to block binding of human SIRPα to human CD47 can be determined using any method known in the art. In one embodiment, the ability of the antibodies to block binding of human SIRPα to human CD47 is determined using an ELISA assay.
- Thus, the present invention includes methods for making an anti-SIRPα antibody or antigen-binding fragment thereof of the present invention comprising culturing a hybridoma cell that expresses the antibody or fragment under condition favorable to such expression and, optionally, isolating the antibody or fragment from the hybridoma and/or the growth medium (e.g. cell culture medium).
- The anti-SIRPα antibodies disclosed herein may also be produced recombinantly (e.g., in an E. coli/T7 expression system, a mammalian cell expression system or a lower eukaryote expression system). In this embodiment, nucleic acids encoding the antibody immunoglobulin molecules of the invention (e.g., VH or VL) may be inserted into a pET-based plasmid and expressed in the E. coli/T7 system. For example, the present invention includes methods for expressing an antibody or antigen-binding fragment thereof or immunoglobulin chain thereof in a host cell (e.g., bacterial host cell such as E. coli such as BL21 or BL21DE3) comprising expressing T7 RNA polymerase in the cell which also includes a polynucleotide encoding an immunoglobulin chain that is operably linked to a T7 promoter. For example, in an embodiment of the invention, a bacterial host cell, such as a E. coli, includes a polynucleotide encoding the T7 RNA polymerase gene operably linked to a lac promoter and expression of the polymerase and the chain is induced by incubation of the host cell with IPTG (isopropyl-beta-D-thiogalactopyrano side).
- There are several methods by which to produce recombinant antibodies which are known in the art. One example of a method for recombinant production of antibodies is disclosed in U.S. Pat. No. 4,816,567.
- Transformation can be by any known method for introducing polynucleotides into a host cell. Methods for introduction of heterologous polynucleotides into mammalian cells are well known in the art and include dextran-mediated transfection, calcium phosphate precipitation, polybrene-mediated transfection, protoplast fusion, electroporation, encapsulation of the polynucleotide(s) in liposomes, biolistic injection and direct microinjection of the DNA into nuclei. In addition, nucleic acid molecules may be introduced into mammalian cells by viral vectors. Methods of transforming cells are well known in the art. See, for example, U.S. Pat. Nos. 4,399,216; 4,912,040; 4,740,461 and 4,959,455.
- Thus, the present invention includes recombinant methods for making an anti-SIRPα antibody or antigen-binding fragment thereof of the present invention, or an immunoglobulin chain thereof, comprising introducing a polynucleotide encoding one or more immunoglobulin chains of the antibody or fragment (e.g., heavy and/or light immunoglobulin chain); culturing the host cell (e.g., CHO or Pichia or Pichia pastoris) under condition favorable to such expression and, optionally, isolating the antibody or fragment or chain from the host cell and/or medium in which the host cell is grown.
- Anti-SIRPα antibodies can also be synthesized by any of the methods set forth in U.S. Pat. No. 6,331,415.
- Eukaryotic and prokaryotic host cells, including mammalian cells as hosts for expression of the antibodies or fragments or immunoglobulin chains disclosed herein are well known in the art and include many immortalized cell lines available from the American Type Culture Collection (ATCC). These include, inter alia, Chinese hamster ovary (CHO) cells, NSO, SP2 cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2), A549 cells, 3T3 cells, HEK-293 cells and a number of other cell lines. Mammalian host cells include human, mouse, rat, dog, monkey, pig, goat, bovine, horse and hamster cells. Cell lines of particular preference are selected through determining which cell lines have high expression levels. Other cell lines that may be used are insect cell lines, such as Sf9 cells, amphibian cells, bacterial cells, plant cells and fungal cells. Fungal cells include yeast and filamentous fungus cells including, for example, Pichia pastoris, Pichia finlandica, Pichia trehalophila, Pichia koclamae, Pichia membranaefaciens, Pichia minuta (Ogataea minuta, Pichia lindneri), Pichia opuntiae, Pichia thermotolerans, Pichia salictaria, Pichia guercuum, Pichia pijperi, Pichia stiptis, Pichia methanolica, Pichia sp., Saccharomyces cerevisiae, Saccharomyces sp., Hansenula polymorpha, Kluyveromyces sp., Kluyveromyces lactis, Candida albicans, Aspergillus nidulans, Aspergillus niger, Aspergillus oryzae, Trichoderma reesei, Chrysosporium lucknowense, Fusarium sp., Fusarium gramineum, Fusarium venenatum, Physcomitrella patens and Neurospora crassa. Pichia sp., any Saccharomyces sp., Hansenula polymorpha, any Kluyveromyces sp., Candida albicans, any Aspergillus sp., Trichoderma reesei, Chrysosporium lucknowense, any Fusarium sp., Yarrowia lipolytica, and Neurospora crassa. When recombinant expression vectors encoding the heavy chain or antigen-binding portion or fragment thereof, and/or the light chain or antigen-binding fragment thereof are introduced into mammalian host cells, the antibodies are produced by culturing the host cells for a period of time sufficient to allow for expression of the antibody or fragment or chain in the host cells or secretion into the culture medium in which the host cells are grown.
- Antibodies and antigen-binding fragments thereof and immunoglobulin chains can be recovered from the culture medium using standard protein purification methods. Further, expression of antibodies and antigen-binding fragments thereof and immunoglobulin chains of the invention (or other moieties therefrom) from production cell lines can be enhanced using a number of known techniques. For example, the glutamine synthetase gene expression system (the GS system) is a common approach for enhancing expression under certain conditions. The GS system is discussed in whole or part in connection with European Patent Nos. 0216846, 0256055, and 0323997 and 0338841. Thus, in an embodiment of the invention, the mammalian host cells (e.g., CHO) lack a glutamine synthetase gene and are grown in the absence of glutamine in the medium wherein, however, the polynucleotide encoding the immunoglobulin chain comprises a glutamine synthetase gene which complements the lack of the gene in the host cell.
- The present invention includes methods for purifying an anti-SIRPα antibody or antigen-binding fragment thereof of the present invention comprising introducing a sample comprising the antibody or fragment to a purification medium (e.g., cation exchange medium, anion exchange medium, hydrophobic exchange medium, affinity purification medium (e.g., protein-A, protein-G, protein-A/G, protein-L)) and either collecting purified antibody or fragment from the flow-through fraction of said sample that does not bind to the medium; or, discarding the flow-through fraction and eluting bound antibody or fragment from the medium and collecting the eluate. In an embodiment of the invention, the medium is in a column to which the sample is applied. In an embodiment of the invention, the purification method is conducted following recombinant expression of the antibody or fragment in a host cell, e.g., wherein the host cell is first lysed and, optionally, the lysate is purified of insoluble materials prior to purification on a medium.
- In general, glycoproteins produced in a particular cell line or transgenic animal will have a glycosylation pattern that is characteristic for glycoproteins produced in the cell line or transgenic animal. Therefore, the particular glycosylation pattern of an antibody will depend on the particular cell line or transgenic animal used to produce the antibody. However, all antibodies encoded by the nucleic acid molecules provided herein, or comprising the amino acid sequences provided herein, comprise the instant invention, independent of the glycosylation pattern the antibodies may have. Similarly, in particular embodiments, antibodies with a glycosylation pattern comprising only non-fucosylated N-glycans may be advantageous, because these antibodies have been shown to typically exhibit more potent efficacy than their fucosylated counterparts both in vitro and in vivo (See for example, Shinkawa et al., J. Biol. Chem. 278: 3466-3473 (2003); U.S. Pat. Nos. 6,946,292 and 7,214,775). These antibodies with non-fucosylated N-glycans are not likely to be immunogenic because their carbohydrate structures are a normal component of the population that exists in human serum IgG.
- The present invention includes bispecific and bifunctional antibodies and antigen-binding fragments having a binding specificity for SIRPα and another antigen such as, for example, CD19, CD20, CD22, CD24, CD25, CD30, CD33, CD38, CD44, CD52, CD56, CD70, CD96, CD97, CD99, CD117, CD123, c-Met, CEA, EGFR, EpCAM, HER2, HER3, PSMA, PTHR2, mesothelin, PD-1, PD-L1, TIM3, and methods of use thereof. A bispecific or bifunctional antibody is an artificial hybrid antibody having two different heavy/light chain pairs and two different binding sites. Bispecific antibodies can be produced by a variety of methods including fusion of hybridomas or linking of Fab′ fragments. See, e.g., Songsivilai, et al., (1990) Clin. Exp. Immunol. 79: 315-321, Kostelny, et al., (1992) J Immunol. 148:1547-1553. In addition, bispecific antibodies may be formed as “diabodies” (Holliger, et al., (1993) PNAS USA 90:6444-6448) or as “Janusins” (Traunecker, et al., (1991) EMBO J. 10:3655-3659 and Traunecker, et al., (1992) Int. J. Cancer Suppl. 7:51-52). Included are “Duobodies,” which are bispecific antibodies with normal IgG structures (Labrijn et al., 2013, Proc. Natl. Acad. Sci. USA 110 (13): 5145-5150).
- The present invention further includes anti-SIRPα antigen-binding fragments of the anti-SIRPα antibodies disclosed herein. The antibody fragments include F(ab)2 fragments, which may be produced by enzymatic cleavage of an IgG by, for example, pepsin. Fab fragments may be produced by, for example, reduction of F(ab)2 with dithiothreitol or mercaptoethylamine.
- Immunoglobulins may be assigned to different classes depending on the amino acid sequences of the constant domain of their heavy chains. In some embodiments, different constant domains may be appended to humanized VL and VH regions derived from the CDRs provided herein. There are at least five major classes of immunoglobulins: IgA, IgD, IgE, IgG and IgM, and several of these may be further divided into subclasses (isotypes), e.g. IgG1, IgG2, IgG3 and IgG4; IgA1 and IgA2. The invention comprises antibodies and antigen-binding fragments of any of these classes or subclasses of antibodies.
- In one embodiment, the antibody or antigen-binding fragment comprises a heavy chain constant region, e.g. a human constant region, such as γ1, γ2, γ3, or γ4 human heavy chain constant region or a variant thereof. In another embodiment, the antibody or antigen-binding fragment comprises a light chain constant region, e.g. a human light chain constant region, such as lambda or kappa human light chain region or variant thereof. By way of example, and not limitation the human heavy chain constant region can be γ4 and the human light chain constant region can be kappa. In an alternative embodiment, the Fc region of the antibody is γ4 with a Ser228Pro mutation (Schuurman, J et. al., Mol. Immunol. 38: 1-8, 2001).
- In one embodiment, the antibody or antigen-binding fragment comprises a heavy chain constant region of the IgG1 subtype. In one embodiment, the antibody or antigen-binding fragment comprises a heavy chain constant region of the IgG2 subtype. In one embodiment, the antibody or antigen-binding fragment comprises a heavy chain constant region of the IgG4 subtype.
- Antibody Engineering
- Further included are embodiments in which the anti-SIRPα antibodies and antigen-binding fragments thereof are engineered antibodies to include modifications to framework residues within the variable domains the antibody, e.g. to improve the properties of the antibody or fragment. Typically, such framework modifications are made to decrease the immunogenicity of the antibody or fragment. This is usually accomplished by replacing non-CDR residues in the variable domains (i.e. framework residues) in a parental (e.g. rodent) antibody or fragment with analogous residues from the immune repertoire of the species in which the antibody is to be used, e.g. human residues in the case of human therapeutics. Such an antibody or fragment is referred to as a “humanized” antibody or fragment. In some cases, it is desirable to increase the affinity, or alter the specificity of an engineered (e.g. humanized) antibody. One approach is to mutate one or more framework residues to the corresponding germline sequence. More specifically, an antibody or fragment that has undergone somatic mutation can contain framework residues that differ from the germline sequence from which the antibody is derived. Such residues can be identified by comparing the antibody or fragment framework sequences to the germline sequences from which the antibody or fragment is derived. Another approach is to revert to the original parental (e.g., rodent) residue at one or more positions of the engineered (e.g. humanized) antibody, e.g. to restore binding affinity that may have been lost in the process of replacing the framework residues. (See, e.g., U.S. Pat. Nos. 5,693,762, 5,585,089 and 5,530,101).
- In certain embodiments, the anti-SIRPα antibodies and antigen-binding fragments thereof are engineered (e.g. humanized) to include modifications in the framework and/or CDRs to improve their properties. Such engineered changes can be based on molecular modelling. A molecular model for the variable region for the parental (non-human) antibody sequence can be constructed to understand the structural features of the antibody and used to identify potential regions on the antibody that can interact with the antigen. Conventional CDRs are based on alignment of immunoglobulin sequences and identifying variable regions. Kabat et al., (1991) Sequences of Proteins of Immunological Interest, Kabat, et al.; National Institutes of Health, Bethesda, Md.; 5th ed.; NIH Publ. No. 91-3242; Kabat (1978) Adv. Prot. Chem. 32:1-75; Kabat, et al., (1977) J. Biol. Chem. 252:6609-6616. Chothia and coworkers carefully examined conformations of the loops in crystal structures of antibodies and proposed hypervariable loops. Chothia, et al., (1987) J Mol. Biol. 196:901-917 or Chothia, et al., (1989) Nature 342:878-883. There are variations between regions classified as “CDRs” and “hypervariable loops”. Later studies (Raghunathan et al, (2012) J. Mol Recog. 25, 3, 103-113) analyzed several antibody-antigen crystal complexes and observed that the antigen binding regions in antibodies do not necessarily conform strictly to the “CDR” residues or “hypervariable” loops. The molecular model for the variable region of the non-human antibody can be used to guide the selection of regions that can potentially bind to the antigen. In practice the potential antigen binding regions based on the model differ from the conventional “CDR”s or “hypervariable” loops. Commercial scientific software such as Discovery Studio (BIOVIA, Dassault Systems)) can be used for molecular modeling. Human frameworks can be selected based on best matches with the non-human sequence both in the frameworks and in the CDRs. For FR4 (framework 4) in VH, VJ regions for the human germlines are compared with the corresponding non-human region. In the case of FR4 (framework 4) in VL, J-kappa and J-Lambda regions of human germline sequences are compared with the corresponding non-human region. Once suitable human frameworks are identified, the CDRs are grafted into the selected human frameworks. In some cases, certain residues in the VL-VH interface can be retained as in the non-human (parental) sequence. Molecular models can also be used for identifying residues that can potentially alter the CDR conformations and hence binding to antigen. In some cases, these residues are retained as in the non-human (parental) sequence. Molecular models can also be used to identify solvent exposed amino acids that can result in unwanted effects such as glycosylation, deamidation and oxidation. Developability filters can be introduced early on in the design stage to eliminate/minimize these potential problems.
- Another type of framework modification involves mutating one or more residues within the framework region, or even within one or more CDR regions, to remove T cell epitopes to thereby reduce the potential immunogenicity of the antibody. This approach is also referred to as “deimmunization” and is described in further detail in U.S. Pat. No. 7,125,689.
- In particular embodiments, it will be desirable to change certain amino acids containing exposed side-chains to another amino acid residue in order to provide for greater chemical stability of the final antibody, so as to avoid deamidation or isomerization. The deamidation of asparagine may occur on NG, DG, NG, NS, NA, NT, QG or QS sequences and result in the creation of an isoaspartic acid residue that introduces a kink into the polypeptide chain and decreases its stability (isoaspartic acid effect). Isomerization can occur at DG, DS, DA or DT sequences. In certain embodiments, the antibodies of the present disclosure do not contain deamidation or asparagine isomerism sites.
- For example, an asparagine (Asn) residue may be changed to Gln or Ala to reduce the potential for formation of isoaspartate at any Asn-Gly sequences, particularly within a CDR. A similar problem may occur at a Asp-Gly sequence. Reissner and Aswad (2003) Cell. Mol. Life Sci. 60:1281. Isoaspartate formation may debilitate or completely abrogate binding of an antibody to its target antigen. See, Presta (2005) J. Allergy Clin. Immunol. 116:731 at 734. In one embodiment, the asparagine is changed to glutamine (Gln). It may also be desirable to alter an amino acid adjacent to an asparagine (Asn) or glutamine (Gln) residue to reduce the likelihood of deamidation, which occurs at greater rates when small amino acids occur adjacent to asparagine or glutamine. See, Bischoff & Kolbe (1994) J. Chromatog. 662:261. In addition, any methionine residues (typically solvent exposed Met) in CDRs may be changed to Lys, Leu, Ala, or Phe or other amino acids in order to reduce the possibility that the methionine sulfur would oxidize, which could reduce antigen-binding affinity and also contribute to molecular heterogeneity in the final antibody preparation. Id. Additionally, in order to prevent or minimize potential scissile Asn-Pro peptide bonds, it may be desirable to alter any Asn-Pro combinations found in a CDR to Gln-Pro, Ala-Pro, or Asn-Ala. Antibodies with such substitutions are subsequently screened to ensure that the substitutions do not decrease the affinity or specificity of the antibody for SIRPα, or other desired biological activity to unacceptable levels.
-
TABLE 2 Exemplary stabilizing CDR variants CDR Residue Stabilizing Variant Sequence Asn-Gly Gln-Gly, Ala-Gly, or Asn-Ala (N-G) (Q-G), (A-G), or (N-A) Asp-Gly Glu-Gly, Ala-Gly or Asp-Ala (D-G) (E-G), (A-G), or (D-A) Met Lys, Leu, Ala, or Phe (M) (K), (L), (A), or (F) Asn Gln or Ala (N) (Q) or (A) Asn-Pro Gin-Pro, Ala-Pro, or Asn-Ala (N-P) (Q-P), (A-P), or (N-A) - Another type of framework modification involves mutating one or more residues within the framework regions to prevent aggregation. The risk of an antibody to aggregate can be assessed using the spatial aggregation propensity—See, Chennamsetty, N et al (2010) J. Phys. Chem. 114, 6614-6624. The method requires the calculation of the Solvent Accessible Area (SAA) for each atom. The molecular aggregation score is then calculated as the sum of all atomic scores. For a given radius and size of molecule, this is an approximate indication of its overall tendency to aggregate. Residues with a high aggregation score are replaced by residues with a lower score (e.g. more hydrophilic amino acids).
- The antibodies (e.g., humanized antibodies) and antigen-binding fragments thereof disclosed herein can also be engineered to include modifications within the Fc region, typically to alter one or more properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding, and/or effector function (e.g., antigen-dependent cellular cytotoxicity). Furthermore, the antibodies and antigen-binding fragments thereof disclosed herein can be chemically modified (e.g., one or more chemical moieties can be attached to the antibody) or be modified to alter its glycosylation, again to alter one or more properties of the antibody or fragment. Each of these embodiments is described in further detail below. The numbering of residues in the Fc region is that of the EU index of Kabat.
- The antibodies and antigen-binding fragments thereof disclosed herein also include antibodies and fragments with modified (or blocked) Fc regions to provide altered effector functions. See, e.g., U.S. Pat. No. 5,624,821; WO2003/086310; WO2005/120571; WO2006/0057702. Such modifications can be used to enhance or suppress various reactions of the immune system, with possible beneficial effects in diagnosis and therapy. Alterations of the Fc region include amino acid changes (substitutions, deletions and insertions), glycosylation or deglycosylation, and adding multiple Fc regions. Changes to the Fc can also alter the half-life of antibodies in therapeutic antibodies, enabling less frequent dosing and thus increased convenience and decreased use of material. See Presta (2005) J. Allergy Clin. Immunol. 116:731 at 734-35.
- In one embodiment, the antibody or antigen-binding fragment of the invention is an IgG4 isotype antibody or fragment comprising a Serine to Proline mutation at a position corresponding to position 228 (S228P; EU index; SEQ ID NO: 66) in the hinge region of the heavy chain constant region. This mutation has been reported to abolish the heterogeneity of inter-heavy chain disulfide bridges in the hinge region (Angal et al (1993). Mol. Immunol. 30:105-108; position 241 is based on the Kabat numbering system).
- In one embodiment of the invention, the hinge region of CH1 is modified such that the number of cysteine residues in the hinge region is increased or decreased. This approach is described further in U.S. Pat. No. 5,677,425. The number of cysteine residues in the hinge region of CH1 is altered, for example, to facilitate assembly of the light and heavy chains or to increase or decrease the stability of the antibody.
- In another embodiment, the Fc hinge region of an antibody or antigen-binding fragment of the invention is mutated to decrease the biological half-life of the antibody or fragment. More specifically, one or more amino acid mutations are introduced into the CH2-CH3 domain interface region of the Fc-hinge fragment such that the antibody or fragment has impaired Staphylococcyl protein A (SpA) binding relative to native Fc-hinge domain SpA binding. This approach is described in further detail in U.S. Pat. No. 6,165,745.
- In another embodiment, the antibody or antigen-binding fragment of the invention is modified to increase its biological half-life. Various approaches are possible. For example, one or more of the following mutations can be introduced: T252L, T254S, T256F, as described in U.S. Pat. No. 6,277,375. Alternatively, to increase the biological half-life, the antibody can be altered within the CH1 or CL region to contain a salvage receptor binding epitope taken from two loops of a CH2 domain of an Fc region of an IgG, as described in U.S. Pat. Nos. 5,869,046 and 6,121,022.
- In yet other embodiments, the Fc region is altered by replacing at least one amino acid residue with a different amino acid residue to alter the effector function(s) of the antibody or antigen-binding fragment. For example, one or more amino acids selected from amino acid residues 234, 235, 236, 237, 297, 318, 320 and 322 can be replaced with a different amino acid residue such that the antibody has an altered affinity for an effector ligand and retains the antigen-binding ability of the parent antibody. The effector ligand to which affinity is altered can be, for example, an Fc receptor or the C1 component of complement. This approach is described in further detail in U.S. Pat. Nos. 5,624,821 and 5,648,260.
- In another example, one or more amino acids selected from amino acid residues 329, 331 and 322 can be replaced with a different amino acid residue such that the antibody has altered C1q binding and/or reduced or abolished complement dependent cytotoxicity (CDC). This approach is described in further detail in U.S. Pat. No. 6,194,551.
- In another example, one or more amino acid residues within amino acid positions 231 and 239 are altered to thereby alter the ability of the antibody to fix complement. This approach is described further in PCT Publication WO 94/29351.
- The proteins of the invention, which are preferably antibodies and most preferably IgG antibodies or fragments thereof, may have altered (e.g., relative to an unmodified antibody) FcγR binding properties (examples of binding properties include but are not limited to, binding specificity, equilibrium dissociation constant (KD), dissociation and association rates (koff and kon respectively), binding affinity and/or avidity) and that certain alterations are more or less desirable. It is known in the art that the equilibrium dissociation constant (KD) is defined as koff/kon, and Ka is the reciprocal of KD.
- The affinities and binding properties of an Fc region for its ligand, may be determined by a variety of in vitro assay methods (biochemical or immunological based assays) known in the art for determining Fc-FcγR interactions, i.e., specific binding of an Fc region to an FcγR including but not limited to, equilibrium methods (e.g., enzyme-linked immuno absorbent assay (ELISA) or radioimmunoassay (RIA)), or kinetics (e.g. BIACORE®, Octet®, or KinExa® analysis), and other methods such as indirect binding assays, competitive inhibition assays, fluorescence resonance energy transfer (FRET), gel electrophoresis and chromatography (e.g., gel filtration). These and other methods may utilize a label on one or more of the components being examined and/or employ a variety of detection methods including but not limited to chromogenic, fluorescent, luminescent, or isotopic labels.
- In certain embodiments, the proteins of the present invention bind to one or more human FcγRs selected from the group consisting of FcγRI, FcγRIIB, FcγRIIC, FcγRIIIA-F158, and FcγRIIIA-V158 with an affinity at least 10-fold, preferably at least 30-fold, and more preferably at least 100-fold, less than equivalent protein having a wild-type human IgG1 heavy chain constant domain (SEQ ID NO: 119) Fc region or a wild-type human IgG4 heavy chain constant domain (SEQ ID NO: 66) Fc region.
- In various embodiments, the proteins of the invention comprise an immunoglobulin Fc region comprising an immunoglobulin C2 region and an immunoglobulin C3 region and an immunoglobulin hinge region. By way of example, the immunoglobulin Fc region may be an IgG Fc region, an IgE Fc region, or an IgA Fc region. In certain preferred embodiments, the protein comprises two immunoglobulin Fc regions, each immunoglobulin Fc region comprising an immunoglobulin C2 region and an immunoglobulin C3 region and an immunoglobulin hinge region, wherein the hinge region of one of the immunoglobulin Fc regions is bound to the hinge region of the other immunoglobulin Fc region to form a dimeric Fc structure. Most preferably, such a protein is a human or humanized IgG protein.
- In certain embodiments, the proteins of the invention comprise a mutated IgG4 Fc region, and preferably the protein is an IgG comprising two mutated IgG4 Fc regions to form a dimeric Fc structure. By way of example, a mutated IgG4 Fc region may comprise one of the mutations, or mutational combinations, recited in Table 3. The numbering system of the constant region referred to in this table is that of the EU index as set forth in Kabat et al. (1991, NIH Publication 91-3242, National Technical Information Service, Springfield, Va.). In the table, the first letter and number represent the unmodified amino acid and its position and the second letter represents the substituted amino acid at said position. For those entries that include combinations of more than one mutation, each mutation in the combination is separated by a “/”.
-
TABLE 3 N297Q L235E N297Q/L235E F234A Q268A F234A/L235A/G237A/ P238A F234A/L235A/ΔG236/ F234A/L235A/G237A/ F234A/L235A/ΔG236/ G237A/P238A P238A/Q268A G237A/P238A/Q268A F234A/L235A L235E/P329G L235A/G237A/E318A F234A/L235A/G237A/ F234A/L235A/ΔG236/ F234A/L235A/G237A/ P238S G237A/P238S P238S/Q268A F234A/L235A/ΔG236/ G237A/P238S/Q268A - In certain embodiments, the proteins of the invention comprise a mutated IgG1 Fc region, and preferably the protein is an IgG comprising two mutated IgG1 Fc regions to form a dimeric Fc structure. By way of example, a mutated IgG1 Fc region may comprise one of the mutations recited in Table 4. The numbering system of the constant region referred to in this table is that of the EU index as set forth in Kabat et al. (1991, NIH Publication 91-3242, National Technical Information Service, Springfield, Va.). In the table, the first letter and number represent the unmodified amino acid and its position and the second letter represents the substituted amino acid at said position.
-
TABLE 4 K222Y P232K A231K E233N E233Q E233R E233S E233T E233H E233A E233V E233L E233F E233M E233Y E233W E233G L234D L234E L234N L234Q L234T L234H L234F L234K L234R L234S L234A L234M L234V L235E L235T L235F L235K L235R L235A L235M L235W L235N L235Q L235H L235V G236A G236N G236R G236H G236L G236F G236P G237A G237E G237N G237Q G237K G237R G237S G237T G237H G237L G237I G237F G237M G237Y G237P P238K P238N P238R P238S P238T P238Y P238G P238A S239A S239N S239F S239K S239R S239V S239W S239P S239H S239Y D249H V240A F241W F241L F243W F243L F243E P244H P245A P247V P247G V253I V263I V263T V263M V264D V264E V264K V264F V264M V264H V264W V264G V264Q V264A V264L D265A D265E D265Q D265S D265H D265V D265L D265F D265M D265Y D265N D265G V266T V266M V266A S267G S267H S267N S267P S267R S267T S267F S267W E269A E269K E269S E269V E269F E269I E269M E269W E269H E269T E269L E269N E269Y E269R E269P E269G D270A D270N D270E D270Q D270T D270H D270R D270S D270L D270I D270F D270W D270P D270G P271H P271Q P271K P271R P271S P271V P271F P271W D280L D280W D280P E293F E294A E293Y E294K E294R E294S E294V E294L E294F Q295A Q295W Q295P Q295G Y296E Y296Q Y296D Y296N Y296S Y296T Y296L Y296I Y296A Y296V Y296M N297S N297D N297Q N297A S298T S298N S298K S298R T299A T299H T299D T299E T299N T299Q T299K T299R T299I T299F T299M T299Y T299W T299S T299V T299P T299G Y300E Y300K Y300R Y300S Y300P Y300W V303A V303D W313F E318A E318V E318Q E318H E318L E318Y K320A K322A K322E N325A N325V N325H N325K N325Y N325W N325P N325G N325Q N325D N325E N325L N325I A327Q A327E A327N A327L A327I A327F A327W L328N L328F L328H L328R L328T L328V L328I L328P L328M L328E L328A P329A P329F P329D P329N P329Q P329K P329S P329T P329H P329V P329L P329M P329Y P329W P329G P329R A330L A330R A330P A330T A330V A330F A330H P331A P331S P331N P331E I332K I332N I332Q I332T I332H I332Y I332A I332R E333N E333R I336E I336Y S337H - In certain embodiments, a mutated IgG1 Fc region may comprise one of the mutational combinations recited in Table 5. The numbering system of the constant region referred to in this table is that of the EU index as set forth in Kabat et al. (1991, NIH Publication 91-3242, National Technical Information Service, Springfield, Va.). In the table, the first letter and number represent the unmodified amino acid and its position and the second letter represents the substituted amino acid at said position. For each of the combinations of more than one mutation, each mutation in the combination is separated by a “I” and deletions are indicated by a
-
TABLE 5 C220S/C226S/C229S/P238S C226S/C229S/E233P/L234V/ E233P/L234V/L235A L235A E233P/L234V/L235A/ΔG236 E233P/L234V/L235A/ΔG236/ L234A/L235A A327G/A330S/P331S L235A/G237A L235A/G237A/E318S/K320S/ L235A/G237A/P331A K322S L234F/L235E L234F/L235E/D265A L234F/L235E/D265A/ N297Q/P331S L234F/L235E/N297Q L234F/L235E/P329G L234F/L235A/K322Q/ M252Y/S254T/T256E L234F/L235Q/K322Q/M252Y/ L234F/L235Q/P331G/M252Y/ G236R/L328R S254T/T256E S254T/T256E S239D/D265I/N297D/I332E S239D/D265L/N297D/I332E S239D/D265F/N297D/I332E S239D/D265Y/N297D/I332E S239D/D265T/N297D/I332E S239D/N297D/A330Y/I332E S239D/F241S/F243H/V262T/ V264E/N297D/I332E D265A/P331S V264T/N297D/K326E/I332E D265A/N297Q N297D/D265Y/T299L/I332E N297D/D265Y/I332E N297D/I332E/Y296D N297D/I332E N297D/I332E/Y296E N297D/I332E/Y296N N297D/I332E/Y296Q N297D/I332E/Y296H N297D/I332E/Y296T N297D/I332E/T299V N297D/I332E/T299I N297D/I332E/T299L N297D/I332E/T299F N297D/I332E/T299H N297D/I332E/T299E N297D/I332E/A330Y N297D/I332E/S298A/A330Y N297E/D265F/I332E N297E/I332E F241E/F243R/V262E/V264R F241E/F243Q/V262T/V264E F241L/F243L/V262I/V264I F241W/F243W F241W/F243W/V262A/V264A F241L/V262I F243L/V262I/V264W F241Y/F243Y/V262T/V264T F241E/F243R/V262E/V264R F241E/F243Q/V262T/V264E F241R/F243Q/V262T/V264R F241E/F243Y/V262T/V264R P244H/P245A/P247V F241E/F243R/V262E/V264R/ F241E/F243Y/V262T/V264R F241E/F243Y/V262T/V264R/ I332E I332E S239E/D265G S239E/D265N S239E/D265Q M252Y/S254T/T256E S267Q/A327S S267L/A327S N297S/I332E S239N/I332N S239N/I332Q S239Q/I332N S239Q/I332Q S298N/Y300S S298N/T299A/Y300S N297Q/S298N/Y300S E318S/K320S/K322S E318S/K320S/K322S/P311A L328E/I332E L328N/I332E L234A/L235A/G237A/P238A/ L234A/L235A/G237A/P238S/ L234A/L235A/G237A/P238A/ H268A/A330S/P331S H268A/A330S/P331S H268A/A330S/P331S L328Q/I332E L328H/I332E - In certain embodiments, the proteins of the invention comprise a wild type or mutated IgG2 Fc region, and preferably the protein is an IgG comprising two wild type or mutated IgG2 Fc regions to form a dimeric Fc structure. A mutated IgG2 Fc region may comprise one of the mutations, or mutational combinations, recited in Table 6. The numbering system of the constant region referred to in this table is that of the EU index as set forth in Kabat et al. (1991, NIH Publication 91-3242, National Technical Information Service, Springfield, Va.). In the table, the first letter and number represent the unmodified amino acid and its position and the second letter represents the substituted amino acid at said position. For those entries that include combinations of more than one mutation, each mutation in the combination is separated by a “I”.
-
TABLE 6 V234A G237A A235E/G237A V234A/A235E/G237A V234A/G237A V234A/G237A/P238S H268Q/V309L/A330S/P331S V234A/G237A/H268A/V309L/ V234A/G237A/H268Q/V309L/ A330S/P331S A330S/P331S V234A/G237A/P238S/H268A/ P233S/V234A/G237A/P238S P233S/V234A/G237A/H268A/ V309L/A330S/P331S V309L/A330S/P331S P233S/V234A/G237A/H268Q/ P233S/V234A/G237A/P238S/ V309L/A330S/P331S H268A/V309L/A330S/P331S - In still another embodiment, the antibodies or antigen-binding fragments of the invention comprise a particular glycosylation pattern. For example, an afucosylated or an aglycosylated antibody or fragment can be made (i.e., the antibody lacks fucose or glycosylation, respectively). The glycosylation pattern of an antibody or fragment may be altered to, for example, increase the affinity or avidity of the antibody or fragment for a SIRPα antigen. Such modifications can be accomplished by, for example, altering one or more of the glycosylation sites within the antibody or fragment sequence. For example, one or more amino acid substitutions can be made that result in removal of one or more of the variable region framework glycosylation sites to thereby eliminate glycosylation at that site. Such deglycosylation may increase the affinity or avidity of the antibody or fragment for antigen. See, e.g., U.S. Pat. Nos. 5,714,350 and 6,350,861.
- Antibodies and antigen-binding fragments disclosed herein may further include those produced in lower eukaryote host cells, in particular fungal host cells such as yeast and filamentous fungi have been genetically engineered to produce glycoproteins that have mammalian- or human-like glycosylation patterns (See for example, Choi et al, (2003) Proc. Natl. Acad. Sci. 100: 5022-5027; Hamilton et al., (2003) Science 301: 1244-1246; Hamilton et al., (2006) Science 313: 1441-1443; Nett et al., Yeast 28(3):237-52 (2011); Hamilton et al., Curr Opin Biotechnol. 18(5): 387-92 (2007)). A particular advantage of these genetically modified host cells over currently used mammalian cell lines is the ability to control the glycosylation profile of glycoproteins that are produced in the cells such that compositions of glycoproteins can be produced wherein a particular N-glycan structure predominates (see, e.g., U.S. Pat. Nos. 7,029,872 and 7,449,308). These genetically modified host cells have been used to produce antibodies that have predominantly particular N-glycan structures (See for example, Li et al., (2006) Nat. Biotechnol. 24: 210-215).
- In particular embodiments, the antibodies and antigen-binding fragments thereof disclosed herein further include those produced in lower eukaryotic host cells and which comprise fucosylated and non-fucosylated hybrid and complex N-glycans, including bisected and multiantennary species, including but not limited to N-glycans such as GlcNAc(1-4)Man3GlcNAc2; Gal(1-4)GlcNAc(1-4)Man3GlcNAc2; NANA(1-4)Gal(1-4)GlcNAc(1-4)Man3GlcNAc2.
- In particular embodiments, the antibodies and antigen-binding fragments thereof provided herein may comprise antibodies or fragments having at least one hybrid N-glycan selected from the group consisting of GlcNAcMan5GlcNAc2; GalGlcNAcMan5GlcNAc2; and NANAGalGlcNAcMan5GlcNAc2. In particular aspects, the hybrid N-glycan is the predominant N-glycan species in the composition.
- In particular embodiments, the antibodies and antigen-binding fragments thereof provided herein comprise antibodies and fragments having at least one complex N-glycan selected from the group consisting of GlcNAcMan3GlcNAc2; GalGlcNAcMan3GlcNAc2; NANAGalGlcNAcMan3GlcNAc2; GlcNAc2Man3GlcNAc2; GalGlcNAc2Man3GlcNAc2; Gal2GlcNAc2Man3GlcNAc2; NANAGal2GlcNAc2Man3GlcNAc2; and NANA2Gal2GlcNAc2Man3GlcNAc2. In particular aspects, the complex N-glycan are the predominant N-glycan species in the composition. In further aspects, the complex N-glycan is a particular N-glycan species that comprises about 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97%, 98%, 99%, or 100% of the complex N-glycans in the composition. In one embodiment, the antibody and antigen binding fragments thereof provided herein comprise complex N-glycans, wherein at least 50%, 60%, 70%, 80%, 90%, 95%, 97%, 98%, 99%, or 100% of the complex N-glycans comprise the structure NANA2Gal2GlcNAc2Man3GlcNAc2, wherein such structure is afucosylated. Such structures can be produced, e.g., in engineered Pichia pastoris host cells.
- In particular embodiments, the N-glycan is fucosylated. In general, the fucose is in an α1,3-linkage with the GlcNAc at the reducing end of the N-glycan, an α1,6-linkage with the GlcNAc at the reducing end of the N-glycan, an α1,2-linkage with the Gal at the non-reducing end of the N-glycan, an α1,3-linkage with the GlcNac at the non-reducing end of the N-glycan, or an α1,4-linkage with a GlcNAc at the non-reducing end of the N-glycan.
- Therefore, in particular aspects of the above the glycoprotein compositions, the glycoform is in an α1,3-linkage or α1,6-linkage fucose to produce a glycoform selected from the group consisting of Man5GlcNAc2(Fuc), GlcNAcMan5GlcNAc2(Fuc), Man3GlcNAc2(Fuc), GlcNAcMan3GlcNAc2(Fuc), GlcNAc2Man3GlcNAc2(Fuc), GalGlcNAc2Man3GlcNAc2(Fuc), Gal2GlcNAc2Man3GlcNAc2(Fuc), NANAGal2GlcNAc2Man3GlcNAc2(Fuc), and NANA2Gal2GlcNAc2Man3GlcNAc2(Fuc); in an α1,3-linkage or α1,4-linkage fucose to produce a glycoform selected from the group consisting of GlcNAc(Fuc)Man5GlcNAc2, GlcNAc(Fuc)Man3GlcNAc2, GlcNAc2(Fuc1-2)Man3GlcNAc2, GalGlcNAc2(Fuc1-2)Man3GlcNAc2, Gal2GlcNAc2(Fuc1-2)Man3GlcNAc2, NANAGal2GlcNAc2(Fuc1-2)Man3GlcNAc2, and NANA2Gal2GlcNAc2(Fuc1-2)Man3GlcNAc2; or in an α1,2-linkage fucose to produce a glycoform selected from the group consisting of Gal(Fuc)GlcNAc2Man3GlcNAc2, Gal2(Fuc1-2)GlcNAc2Man3GlcNAc2, NANAGal2(Fuc1-2)GlcNAc2Man3GlcNAc2, and NANA2Gal2(Fuc1-2)GlcNAc2Man3GlcNAc2.
- In further aspects, the antibodies (e.g., humanized antibodies) or antigen-binding fragments thereof comprise high mannose N-glycans, including but not limited to, Man8GlcNAc2, Man7GlcNAc2, Man6GlcNAc2, Man5GlcNAc2, Man4GlcNAc2, or N-glycans that consist of the Man3GlcNAc2 N-glycan structure.
- In further aspects of the above, the complex N-glycans further include fucosylated and non-fucosylated bisected and multiantennary species.
- As used herein, the terms “N-glycan” and “glycoform” are used interchangeably and refer to an N-linked oligosaccharide, for example, one that is attached by an asparagine-N-acetylglucosamine linkage to an asparagine residue of a polypeptide. N-linked glycoproteins contain an N-acetylglucosamine residue linked to the amide nitrogen of an asparagine residue in the protein. The predominant sugars found on glycoproteins are glucose, galactose, mannose, fucose, N-acetylgalactosamine (GalNAc), N-acetylglucosamine (GlcNAc) and sialic acid (e.g., N-acetyl-neuraminic acid (NANA)). The processing of the sugar groups occurs co-translationally in the lumen of the ER and continues post-translationally in the Golgi apparatus for N-linked glycoproteins.
- N-glycans have a common pentasaccharide core of Man3GlcNAc2 (“Man” refers to mannose; “Glc” refers to glucose; and “NAc” refers to N-acetyl; GlcNAc refers to N-acetylglucosamine). Usually, N-glycan structures are presented with the non-reducing end to the left and the reducing end to the right. The reducing end of the N-glycan is the end that is attached to the Asn residue comprising the glycosylation site on the protein. N-glycans differ with respect to the number of branches (antennae) comprising peripheral sugars (e.g., GlcNAc, galactose, fucose and sialic acid) that are added to the Man3GlcNAc2 (“Man3”) core structure which is also referred to as the “trimannose core”, the “pentasaccharide core” or the “paucimannose core”. N-glycans are classified according to their branched constituents (e.g., high mannose, complex or hybrid). A “high mannose” type N-glycan has five or more mannose residues. A “complex” type N-glycan typically has at least one GlcNAc attached to the 1,3 mannose arm and at least one GlcNAc attached to the 1,6 mannose arm of a “trimannose” core. Complex N-glycans may also have galactose (“Gal”) or N-acetylgalactosamine (“GalNAc”) residues that are optionally modified with sialic acid or derivatives (e.g., “NANA” or “NeuAc”, where “Neu” refers to neuraminic acid and “Ac” refers to acetyl). Complex N-glycans may also have intrachain substitutions comprising “bisecting” GlcNAc and core fucose (“Fuc”). Complex N-glycans may also have multiple antennae on the “trimannose core,” often referred to as “multiple antennary glycans.” A “hybrid” N-glycan has at least one GlcNAc on the terminal of the 1,3 mannose arm of the trimannose core and zero or more mannoses on the 1,6 mannose arm of the trimannose core. The various N-glycans are also referred to as “glycoforms.”
- With respect to complex N-glycans, the terms “G-2”, “G-1”, “GO”, “G1”, “G2”, “A1”, and “A2” mean the following. “G-2” refers to an N-glycan structure that can be characterized as Man3GlcNAc2; the term “G-1” refers to an N-glycan structure that can be characterized as GlcNAcMan3GlcNAc2; the term “GO” refers to an N-glycan structure that can be characterized as GlcNAc2Man3GlcNAc2; the term “G1” refers to an N-glycan structure that can be characterized as GalGlcNAc2Man3GlcNAc2; the term “G2” refers to an N-glycan structure that can be characterized as Gal2GlcNAc2Man3GlcNAc2; the term “A1” refers to an N-glycan structure that can be characterized as NANAGal2GlcNAc2Man3GlcNAc2; and, the term “A2” refers to an N-glycan structure that can be characterized as NANA2Gal2GlcNAc2Man3GlcNAc2. Unless otherwise indicated, the terms G-2″, “G-1”, “GO”, “G1”, “G2”, “A1”, and “A2” refer to N-glycan species that lack fucose attached to the GlcNAc residue at the reducing end of the N-glycan. When the term includes an “F”, the “F” indicates that the N-glycan species contains a fucose residue on the GlcNAc residue at the reducing end of the N-glycan. For example, G0F, G1F, G2F, A1F, and A2F all indicate that the N-glycan further includes a fucose residue attached to the GlcNAc residue at the reducing end of the N-glycan. Lower eukaryotes such as yeast and filamentous fungi do not normally produce N-glycans that produce fucose.
- With respect to multiantennary N-glycans, the term “multiantennary N-glycan” refers to N-glycans that further comprise a GlcNAc residue on the mannose residue comprising the non-reducing end of the 1,6 arm or the 1,3 arm of the N-glycan or a GlcNAc residue on each of the mannose residues comprising the non-reducing end of the 1,6 arm and the 1,3 arm of the N-glycan. Thus, multiantennary N-glycans can be characterized by the formulas GlcNAc(2-4)Man3GlcNAc2, Gal(1-4)GlcNAc(2-4)Man3GlcNAc2, or NANA(1-4)Gal(1-4)GlcNAc(2-4)Man3GlcNAc2. The term “1-4” refers to 1, 2, 3, or 4 residues.
- With respect to bisected N-glycans, the term “bisected N-glycan” refers to N-glycans in which a GlcNAc residue is linked to the mannose residue at the reducing end of the N-glycan. A bisected N-glycan can be characterized by the formula GlcNAc3Man3GlcNAc2 wherein each mannose residue is linked at its non-reducing end to a GlcNAc residue. In contrast, when a multiantennary N-glycan is characterized as GlcNAc3Man3GlcNAc2, the formula indicates that two GlcNAc residues are linked to the mannose residue at the non-reducing end of one of the two arms of the N-glycans and one GlcNAc residue is linked to the mannose residue at the non-reducing end of the other arm of the N-glycan.
- In certain embodiments, the proteins of the invention comprise an aglycosylated Fc region. By way of example, an IgG1 Fc region may be aglycosylayed by deleting or substituting residue N297.
- The antibodies and antigen-binding fragments thereof disclosed herein may further contain one or more glycosylation sites in either the light or heavy chain immunoglobulin variable region. Such glycosylation sites may result in increased immunogenicity of the antibody or fragment or an alteration of the pK of the antibody due to altered antigen-binding (Marshall et al. (1972) Annu Rev Biochem 41:673-702; Gala and Morrison (2004) J Immunol 172:5489-94; Wallick et al (1988) J Exp Med 168:1099-109; Spiro (2002) Glycobiology 12:43R-56R; Parekh et al (1985) Nature 316:452-7; Mimura et al. (2000) Mol Immunol 37:697-706). Glycosylation has been known to occur at motifs containing an N-X-S/T sequence.
- Each antibody or antigen-binding fragment will have a unique isoelectric point (pI), which generally falls in the pH range between 6 and 9.5. The pI for an IgG1 antibody typically falls within the pH range of 7-9.5 and the pI for an IgG4 antibody typically falls within the pH range of 6-8.
- Each antibody or antigen-binding fragment will have a characteristic melting temperature, with a higher melting temperature indicating greater overall stability in vivo (Krishnamurthy R and Manning M C (2002) Curr Pharm Biotechnol 3:361-71). In general, the TM1 (the temperature of initial unfolding) may be greater than 60° C., greater than 65° C., or greater than 70° C. The melting point of an antibody or fragment can be measured using differential scanning calorimetry (Chen et al (2003) Pharm Res 20:1952-60; Ghirlando et al (1999) Immunol Lett 68:47-52) or circular dichroism (Murray et al. (2002) J. Chromatogr Sci 40:343-9).
- In a further embodiment, antibodies and antigen-binding fragments thereof are selected that do not degrade rapidly. Degradation of an antibody or fragment can be measured using capillary electrophoresis (CE) and MALDI-MS (Alexander A J and Hughes D E (1995) Anal Chem 67:3626-32).
- In a further embodiment, antibodies and antigen-binding fragments thereof are selected that have minimal aggregation effects, which can lead to the triggering of an unwanted immune response and/or altered or unfavorable pharmacokinetic properties. Generally, antibodies and fragments are acceptable with aggregation of 25% or less, 20% or less, 15% or less, 10% or less, or 5% or less. Aggregation can be measured by several techniques, including size-exclusion column (SEC), high performance liquid chromatography (HPLC), and light scattering.
- The anti-SIRPα antibodies and antigen-binding fragments thereof disclosed herein may also be conjugated to a chemical moiety. The chemical moiety may be, inter alia, a polymer, a radionucleotide or a cytotoxic factor. In particular embodiments, the chemical moiety is a polymer which increases the half-life of the antibody or fragment in the body of a subject. Suitable polymers include, but are not limited to, hydrophilic polymers which include but are not limited to polyethylene glycol (PEG) (e.g., PEG with a molecular weight of 2 kDa, 5 kDa, 10 kDa, 12 kDa, 20 kDa, 30 kDa or 40 kDa), dextran and monomethoxypolyethylene glycol (mPEG). Lee, et al., (1999) (Bioconj. Chem. 10:973-981) discloses PEG conjugated single-chain antibodies. Wen, et al., (2001) (Bioconj. Chem. 12:545-553) disclose conjugating antibodies with PEG which is attached to a radiometal chelator (diethylenetriaminpentaacetic acid (DTPA)).
- The antibodies and antigen-binding fragments thereof disclosed herein may also be conjugated with labels such as 99Tc, 90Y, 111In, 32P, 14C, 125I, 3H, 131I, 11C, 15O, 13N, 18F, 35S, 51Cr, 57To, 226Ra, 60Co, 59Fe, 57Se, 152Eu, 67CU, 217Ci, 211At, 212Pb, 47Sc, 109Pd, 234Th, and 40K, 157Gd, 55Mn, 52Tr, and 56Fe.
- The antibodies and antigen-binding fragments disclosed herein may also be PEGylated, for example to increase its biological (e.g., serum) half-life. To PEGylate an antibody or fragment, the antibody or fragment, typically is reacted with a reactive form of polyethylene glycol (PEG), such as a reactive ester or aldehyde derivative of PEG, under conditions in which one or more PEG groups become attached to the antibody or antibody fragment. In particular embodiments, the PEGylation is carried out via an acylation reaction or an alkylation reaction with a reactive PEG molecule (or an analogous reactive water-soluble polymer). As used herein, the term “polyethylene glycol” is intended to encompass any of the forms of PEG that have been used to derivatize other proteins, such as mono (C1-C10) alkoxy- or aryloxy-polyethylene glycol or polyethylene glycol-maleimide. In certain embodiments, the antibody or fragment to be PEGylated is an aglycosylated antibody or fragment. Methods for PEGylating proteins are known in the art and can be applied to the antibodies of the invention. See, e.g.,
EP 0 154 316 andEP 0 401 384. - The antibodies and antigen-binding fragments disclosed herein may also be conjugated with fluorescent or chemilluminescent labels, including fluorophores such as rare earth chelates, fluorescein and its derivatives, rhodamine and its derivatives, isothiocyanate, phycoerythrin, phycocyanin, allophycocyanin, o-phthaladehyde, fluorescamine, 152Eu, dansyl, umbelliferone, luciferin, luminal label, isoluminal label, an aromatic acridinium ester label, an imidazole label, an acridimium salt label, an oxalate ester label, an aequorin label, 2,3-dihydrophthalazinediones, biotin/avidin, spin labels and stable free radicals.
- The antibodies and antigen-binding fragments thereof of the invention may also be conjugated to a cytotoxic factor such as diptheria toxin, Pseudomonas aeruginosa exotoxin A chain, ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins and compounds (e.g., fatty acids), dianthin proteins, Phytoiacca americana proteins PAPI, PAPII, and PAP-S, Momordica charantia inhibitor, curcin, crotin, Saponaria officinalis inhibitor, mitogellin, restrictocin, phenomycin, and enomycin.
- Any method known in the art for conjugating the antibodies and antigen-binding fragments thereof of the invention to the various moieties may be employed, including those methods described by Hunter, et al., (1962) Nature 144:945; David, et al., (1974) Biochemistry 13:1014; Pain, et al., (1981) J. Immunol. Meth. 40:219; and Nygren, J., (1982) Histochem. and Cytochem. 30:407. Methods for conjugating antibodies and fragments are conventional and very well known in the art.
- Further provided are methods for treating subjects, including human subjects, in need of treatment with the isolated antibodies or antigen-binding fragments thereof disclosed herein. In one embodiment of the invention, such subject suffers from an infection or an infectious disease.
- In another embodiment of the invention, such subject suffers from cancer. In one embodiment the cancer is, e.g., osteosarcoma, rhabdomyosarcoma, neuroblastoma, kidney cancer, leukemia, renal transitional cell cancer, bladder cancer, Wilm's cancer, ovarian cancer, pancreatic cancer, breast cancer, prostate cancer, bone cancer, lung cancer (e.g., non-small cell lung cancer), gastric cancer, colorectal cancer, cervical cancer, synovial sarcoma, head and neck cancer, squamous cell carcinoma, multiple myeloma, renal cell cancer, retinoblastoma, hepatoblastoma, hepatocellular carcinoma, melanoma, rhabdoid tumor of the kidney, Ewing's sarcoma, chondrosarcoma, brain cancer, glioblastoma, meningioma, pituitary adenoma, vestibular schwannoma, a primitive neuroectodermal tumor, medulloblastoma, astrocytoma, anaplastic astrocytoma, oligodendroglioma, ependymoma, choroid plexus papilloma, polycythemia vera, thrombocythemia, idiopathic myelfibrosis, soft tissue sarcoma, thyroid cancer, endometrial cancer, carcinoid cancer or liver cancer, breast cancer or gastric cancer. In an embodiment of the invention, the cancer is metastatic cancer, e.g., of the varieties described above.
- Cancers that may be treated by the antibodies or antigen-binding fragments, compositions and methods of the invention include, but are not limited to: Cardiac: sarcoma (angiosarcoma, fibrosarcoma, rhabdomyosarcoma, liposarcoma), myxoma, rhabdomyoma, fibroma, lipoma and teratoma; Lung: bronchogenic carcinoma (squamous cell, undifferentiated small cell, undifferentiated large cell, adenocarcinoma), alveolar (bronchiolar) carcinoma, bronchial adenoma, sarcoma, lymphoma, chondromatous hamartoma, mesothelioma; Gastrointestinal: esophagus (squamous cell carcinoma, adenocarcinoma, leiomyosarcoma, lymphoma), stomach (carcinoma, lymphoma, leiomyosarcoma), pancreas (ductal adenocarcinoma, insulinoma, glucagonoma, gastrinoma, carcinoid tumors, vipoma), small bowel (adenocarcinoma, lymphoma, carcinoid tumors, Karposi's sarcoma, leiomyoma, hemangioma, lipoma, neurofibroma, fibroma), large bowel (adenocarcinoma, tubular adenoma, villous adenoma, hamartoma, leiomyoma) colorectal; Genitourinary tract: kidney (adenocarcinoma, Wilm's tumor [nephroblastoma], lymphoma, leukemia), bladder and urethra (squamous cell carcinoma, transitional cell carcinoma, adenocarcinoma), prostate (adenocarcinoma, sarcoma), testis (seminoma, teratoma, embryonal carcinoma, teratocarcinoma, choriocarcinoma, sarcoma, interstitial cell carcinoma, fibroma, fibroadenoma, adenomatoid tumors, lipoma); Liver: hepatoma (hepatocellular carcinoma), cholangiocarcinoma, hepatoblastoma, angiosarcoma, hepatocellular adenoma, hemangioma; Bone: osteogenic sarcoma (osteosarcoma), fibrosarcoma, malignant fibrous histiocytoma, chondrosarcoma, Ewing's sarcoma, malignant lymphoma (reticulum cell sarcoma), multiple myeloma, malignant giant cell tumor chordoma, osteochronfroma (osteocartilaginous exostoses), benign chondroma, chondroblastoma, chondromyxofibroma, osteoid osteoma and giant cell tumors; Nervous system: skull (osteoma, hemangioma, granuloma, xanthoma, osteitis deformans), meninges (meningioma, meningiosarcoma, gliomatosis), brain (astrocytoma, medulloblastoma, glioma, ependymoma, germinoma [pinealoma], glioblastoma multiform, oligodendroglioma, schwannoma, retinoblastoma, congenital tumors), spinal cord neurofibroma, meningioma, glioma, sarcoma); Gynecological: uterus (endometrial carcinoma), cervix (cervical carcinoma, pre tumor cervical dysplasia), ovaries (ovarian carcinoma [serous cystadenocarcinoma, mucinous cystadenocarcinoma, unclassified carcinoma], granulosa thecal cell tumors, Sertoli-Leydig cell tumors, dysgerminoma, malignant teratoma), vulva (squamous cell carcinoma, intraepithelial carcinoma, adenocarcinoma, fibrosarcoma, melanoma), vagina (clear cell carcinoma, squamous cell carcinoma, botryoid sarcoma (embryonal rhabdomyosarcoma), fallopian tubes (carcinoma), breast; Hematologic: blood (myeloid leukemia [acute and chronic], acute lymphoblastic leukemia, chronic lymphocytic leukemia, myeloproliferative diseases, multiple myeloma, myelodysplastic syndrome), Hodgkin's disease, non Hodgkin's lymphoma [malignant lymphoma]; Skin: malignant melanoma, basal cell carcinoma, squamous cell carcinoma, Karposi's sarcoma, moles dysplastic nevi, lipoma, angioma, dermatofibroma, keloids, psoriasis; and Adrenal glands: neuroblastoma. Thus, the term “cancerous cell” as provided herein, includes a cell afflicted by any one of the above-identified conditions.
- In one embodiment, cancers that may be treated by the antibodies or antigen-binding fragments thereof disclosed herein, compositions and methods of the invention include, but are not limited to: breast cancer, gastric cancer, esophageal cancer, gastroesophageal junction carcinoma, colorectal cancer, head and neck cancer, non-small cell lung cancer, osteosarcoma, neuroblastoma, bladder cancer, cervical cancer, endometrial cancer, ovarian cancer, lung cancer, squamous cell carcinoma, melanoma, pancreatic cancer, prostate cancer, small cell lung cancer, kidney cancer, renal cell carcinoma, thyroid cancer, glioblastoma multiforme, fallopian tube cancer, peritoneal cancer, angiosarcoma, hepatocellular carcinoma, choriocarcinoma, soft tissue sarcoma, chronic lymphocytic leukemia, chronic myelocytic leukemia, non-Hodgkin's lymphoma, B-cell non-hodgkin's lymphoma, diffuse large B-cell lymphoma, follicular lymphoma, mantle cell lymphoma, myelodysplastic syndrome, acute myelocytic leukemia, T-cell lymphoma, natural killer cell lymphoma, extranodal marginal zone B-cell lymphoma, acute lymphocytic leukemia, multiple myeloma.
- In one embodiment, the antibodies or antigen-binding fragments thereof disclosed herein may be used for the treatment of infections and infectious diseases. As used herein, the term “infection” refers to any state in at least one cell of an organism (i.e., a subject) is infected by an infectious agent (e.g., a subject has an intracellular pathogen infection, e.g., a chronic intracellular pathogen infection). As used herein, the term “infectious agent” refers to a foreign biological entity (i.e. a pathogen) that induces CD47 expression (e.g., increased CD47 expression) in at least one cell of the infected organism. For example, infectious agents include, but are not limited to bacteria, viruses, protozoans, and fungi.
- Intracellular pathogens are of particular interest. Infectious diseases are disorders caused by infectious agents. Some infectious agents cause no recognizable symptoms or disease under certain conditions, but have the potential to cause symptoms or disease under changed conditions. The subject methods can be used in the treatment of chronic pathogen infections, for example including but not limited to viral infections, e.g. retrovirus, lentivirus, hepadna virus, herpes viruses, pox viruses, human papilloma viruses, etc.; intracellular bacterial infections, e.g. Mycobacterium, Chlamydophila, Ehrlichia, Rickettsia, Brucella, Legionella, Francisella, Listeria, Coxiella, Neisseria, Salmonella, Yersinia sp, Helicobacter pylori etc.; and intracellular protozoan pathogens, e.g. Plasmodium sp, Trypanosoma sp., Giardia sp., Toxoplasma sp., Leishmania sp., etc.
- In an embodiment, the invention provides methods for treating subjects using an anti-SIRPα antibody or antigen-binding fragment thereof of the invention, wherein the subject suffers from a viral infection. In one embodiment, the viral infection is an infection with a virus selected from the group consisting of human immunodeficiency virus (HIV), hepatitis virus (A, B, or C), herpes virus (e.g., VZV, HSV-I, HAV-6, HSV-II, and CMV, Epstein Barr virus), adenovirus, influenza virus, flaviviruses, echovirus, rhinovirus, coxsackie virus, coronavirus, respiratory syncytial virus, mumps virus, rotavirus, measles virus, rubella virus, parvovirus, vaccinia virus, HTLV virus, dengue virus, papillomavirus, molluscum virus, poliovirus, rabies virus, JC virus or arboviral encephalitis virus.
- In an embodiment, the invention provides methods for treating subjects using an anti-SIRPα antibody or antigen-binding fragment thereof of the invention, wherein the subject suffers from a bacterial infection. In one embodiment, the bacterial infection is infection with a bacteria selected from the group consisting of Chlamydia, rickettsial bacteria, mycobacteria, staphylococci, streptococci, pneumonococci, meningococci and gonococci, klebsiella, proteus, serratia, pseudomonas, Legionella, Corynebacterium diphtheriae, Salmonella, bacilli, Vibrio cholerae, Clostridium tetan, Clostridium botulinum, Bacillus anthricis, Yersinia pestis, Mycobacterium leprae, Mycobacterium lepromatosis, and Borriella.
- In an embodiment, the invention provides methods for treating subjects using an anti-SIRPα antibody or antigen-binding fragment thereof of the invention, wherein the subject suffers from a fungal infection. In one embodiment, the fungal infection is an infection with a fungus selected from the group consisting of Candida (albicans, krusei, glabrata, tropicalis, etc.), Cryptococcus neoformans, Aspergillus (fumigatus, niger, etc.), Genus Mucorales (mucor, absidia, rhizopus), Sporothrix schenkii, Blastomyces dermatitidis, Paracoccidioides brasiliensis, Coccidioides immitis and Histoplasma capsulatum.
- In an embodiment, the invention provides methods for treating subjects using an anti-SIRPα antibody or antigen-binding fragment thereof of the invention, wherein the subject suffers from a parasitic infection. In one embodiment, the parasitic infection is infection with a parasite selected from the group consisting of Entamoeba histolytica, Balantidium coli, Naegleria fowleri, Acanthamoeba, Giardia lambia, Cryptosporidium, Pneumocystis carinii, Plasmodium vivax, Babesia microti, Trypanosoma brucei, Trypanosoma cruzi, Leishmania donovani, Toxoplasma gondii and Nippostrongylus brasiliensis.
- A “subject” may be a mammal such as a human, dog, cat, horse, cow, mouse, rat, monkey (e.g., cynomolgous monkey, e.g., Macaca fascicularis) or rabbit. In preferred embodiments of the invention, the subject is a human subject.
- The term “in association with” indicates that the components administered in a method of the present invention (e.g., an anti-SIRPα antibody (e.g., humanized antibody) or antigen-binding fragment thereof along with an anti-cancer agent can be formulated into a single composition for simultaneous delivery or formulated separately into two or more compositions (e.g., a kit). Each component can be administered to a subject at a different time than when the other component is administered; for example, each administration may be given non-simultaneously (e.g., separately or sequentially) at several intervals over a given period of time. Moreover, the separate components may be administered to a subject by the same or by a different route.
- In particular embodiments, the antibodies or antigen-binding fragments thereof disclosed herein may be used alone, or in association with other, further therapeutic agents and/or therapeutic procedures, for treating or preventing any disease such as cancer, e.g., as discussed herein, in a subject in need of such treatment or prevention. Compositions, e.g., pharmaceutical compositions comprising a pharmaceutically acceptable carrier, comprising such antibodies and fragments in association with further therapeutic agents are also part of the present invention.
- Therefore, the present invention provides a method of treating cancer in a human subject, comprising administering to the subject an effective amount of the antibody or antigen binding fragment disclosed herein, optionally in association with a further therapeutic agent or therapeutic procedure. The present invention also provides a method of treating an infection or infectious disease in a human subject, comprising administering to the subject an effective amount of the antibody or antigen binding fragment disclosed herein, optionally in association with a further therapeutic agent or therapeutic procedure. The present invention also provides a method of increasing the activity of an immune cell, comprising administering to a subject in need thereof an effective amount of an antibody or antigen binding fragment disclosed herein. In one embodiment, the method is used for: the treatment of cancer; the treatment of an infection or infectious disease; or as a vaccine adjuvant.
- In particular embodiments, the antibodies or antigen-binding fragments thereof disclosed herein may be used alone, or in association with tumor vaccines. Examples of tumor vaccines include but are not limited to vaccines for Human Papillomavirus (HPV) infection caused cancer such as Gardasil®, Gardisil9® and Cervarix®; vaccines that prevent hepatitis B virus caused liver cancer such as Engerix-B® and Recombivax HB®; oncolytic virus therapy that triggers immune response such as Imlygic®; DNA vaccines such as Synchotrope MA2M plasmid DNA vaccine and ZYC101; mammaglobin-a DNA vaccine (see Clinical Cancer Res. 2014 20(23):5964-75); vector based vaccines such as PSA-TRICOM (prostvac), PANVAC-VF, Listeria monocytogenes-based vaccines (see, e.g., Therapeutic Advances in Vaccines, 2014, 2(5) 137-148), Listeria-based vaccines (Listeria expressing one or more cancer vaccines such as Listeria-mesothelin (e.g., CRS-207), ADXS-HPV, Axalimogene Filolisbac, Listeria-HER2/Neu, Listeria-EGFRvIII), Adeno-CEA; allogeneic vaccines such as GVAX, BLP-25 (anti-Ankara-mucin 1), Belagenpumatucel-L, TG4010, CIMAvax epidermal growth factor vaccine, NY-ESO, GM.CD40L-CCL21; autologous vaccines such as:Adeno-CD40L, BCG, INGN-225, Dendritic cell vaccines such as Provenge(Sipuleucel-T), rF-CEA-MUC1-TRICOM (panvac-DC); antigen vaccines such as MUC-1 (stimuvax), NY-ESO-1, GP-100, MAGE-A3 (melanoma antigen encoding gene A3), INGN-225 (see Pharmacology & Therapeutics 153 (2015) 1-9).
- Eat-me signals could be elevated by cytotoxic therapies like radiotherapy or chemotherapeutic agents including, but not limited to anthracyclines (doxorubicin, epirubicin, daunorubicin, idarubicin, mitoxantrone), oxaliplatin, bortezomib, cyclophosphamide, bleomycin, vorinostat, paclitaxel, 5-fluorouracil, cytarabine, prednisolone, docetaxel, mitomycin C, topotecan/camptothecin, etoposide, zoledronic acid, methotrexate, ibrutinib, aflibercept, bevacizumab, toremifene, vinblastine, vincristine, idelalisib, mercaptopurine, thalidomide, sorafenib. Thus, in certain embodiments, the antibodies or antigen-binding fragments thereof disclosed herein may be used in association with chemotherapeutic agents, in association with radiation therapy, etc. In particular embodiments, the antibodies or antigen-binding fragments thereof disclosed herein may be used alone, or in association with targeted therapies. Examples of targeted therapies include: hormone therapies, signal transduction inhibitors (e.g., EGFR inhibitors, such as cetuximab (Erbitux) and erlotinib (Tarceva)); CD20 inhibitors (e.g., rituximab (Rituxan) and ofatumumab (Arzerra)); CD38 inhibitors (e.g., daratumumab (DARZALEX)); CD52 inhibitors (e.g., alemtuzumab (Campath)); HER2 inhibitors (e.g., trastuzumab (Herceptin) and pertuzumab (Perjeta)); BCR-ABL inhibitors (such as imatinib (Gleevec) and dasatinib (Sprycel)); ALK inhibitors (such as crizotinib (Xalkori) and ceritinib (Zykadia)); BRAF inhibitors (such as vemurafenib (Zelboraf) and dabrafenib (Tafinlar)), gene expression modulators (e.g., decitabine (Dacogen) and Vorinostat (Zolinza)), apoptosis inducers (e.g., bortezomib (Velcade) and carfilzomib (Kyprolis)), angiogenesis inhibitors (e.g., bevacizumab (Avastin) and ramucirumab (Cyramza)), immunomodulatory imide drugs (e.g., thalidomide, lenalidomide, pomalidomide, and apremilast), monoclonal antibodies attached to toxins (e.g., brentuximab vedotin (Adcetris) and ado-trastuzumab emtansine (Kadcyla)).
- The antibodies or antigen-binding fragments thereof disclosed herein may preferably find use in association with targeted therapies in which antibodies are employed to mediate ADCC/ADCP. Functional bioassays are available to analyze the mode of action of an antibody drug and to distinguish ADCP as a mode of action from ADCC. By way of example, an antibody-dependent cell-mediated cytotoxicity (ADCC) assay typically utilizes normal human peripheral blood mononuclear cells (PBMCs) or effector cells isolated thereof. Assay variation can be reduced by using selective donor pools with defined Fcγ receptor Ha (FcγRIIa/CD32a), IIIa (FcγRIIIa/CD16a) or IIIb (FcγRIIIb/CD16b) gene copy number variation (CNV) or genotypes such as FcγRIIIa-158 V/V versus V/F or F/F, FcγRIIIa-131 H/H versus H/R or R/R, and the FcγRIIIb-NA1 and -NA2 polymorphic variants. Alternatively, effector cells such as PBMCs, PBMC-derived natural killer (NK) cells, granulocytes, monocytes, monocyte-derived macrophages, or dendritic cells (DCs) can be replaced with a FcγRIIIa-expressing cell line (for example, engineered NK92). Killing of the target cells can be assessed by measuring the release of specific probes from pre-labelled target cells, using 51chromium (Cr51) or fluorescent dyes such as calcein-acetoxymethyl (calcein-AM), carboxyfluorescein succinimidyl ester (CFSE), 2′,7′-bis-(2-carboxyethyl)-5-(and-6)-carboxyfluorescein (BCECF), europium (Eu) or propidium iodide (PI), or by measuring the release of cytosolic enzymes such as lactate dehydrogenase (LDH) or the release of nucleoside triphosphate (ATP).
- In contrast, antibody-dependent cellular phagocytosis (ADCP) may be assessed by measuring the destruction of target cells via granulocyte, monocyte, dendritic cell, or macrophage-mediated phagocytosis. ADCP assays use PBMC-derived cells or myeloid cell lines such as HL-60, THP-1, and U937 cells differentiated into macrophages or granulocytes. Stimuli that are commonly used to induce macrophage differentiation in monocytic cell lines include phorbol-12-myristate-13-acetate (PMA), 1,25-dihydroxyvitamin D3 (VD3), and retinoic acid (RA). RA is also known to induce terminal granulocytic differentiation of for example HL-60 cells. Phagocytosis of the target cells can be assessed by monitoring effector cells for the internalization of specific probes from target cells pre-labelled with fluorescent dyes such as cell proliferation dye eFluor450, CFSE, and pH-sensitive dyes including pHrodo and CypHer5E. Phagocytosis is measured by an increase in fluorescently labelled effector cells using flow cytometry or fluorescence microscopy. “Reporter gene” assays are also available to assess ADCP. In order to measure ADCP function in a reporter gene assay, target cells are first incubated with a titration of an antibody of interest. Once the antibody is bound to its cognate target on the target cell surface, engineered Jurkat effector cells are added. If ADCP pathway activation ensues, the Jurkat cells produce a luciferase product by expression of the reporter gene NFAT-RE-luc2. Luciferase activity is then measured following a 4-24 hour induction period, after addition of the luciferase assay reagent. The dose-dependent response in the microtiter plate-based assay can be used to quantify the relative biological activity of the therapeutic antibody compared to the dose-response curve of a suitable reference item.
- In particular embodiments, the anti-SIRPα antibodies or antigen-binding fragments thereof of the invention may be used in combination with an anti-cancer therapeutic agent or immunomodulatory drug such as an immunomodulatory receptor inhibitor, e.g., an antibody or antigen-binding fragment thereof that specifically binds to the receptor.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with one or more of:
-
- an agonist (e.g., an agonistic antibody or antigen-binding fragment thereof, or a soluble fusion) of a TNF receptor protein, an Immunoglobulin-like protein, a cytokine receptor, an integrin, a signaling lymphocytic activation molecules (SLAM proteins), an activating NK cell receptor, a Toll like receptor, OX40, CD2, CD7, CD27, CD28, CD30, CD40, ICAM-1, LFA-1 (CD1 1a/CD18), 4-1BB (CD137), B7-H3, ICOS (CD278), GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD19, CD4, CD8alpha, CD8beta, IL2R beta, IL2R gamma, IL7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD1 1d, ITGAE, CD103, ITGAL, ITGAM, CD1 1b, ITGAX, CD1 1c, ITGB1, CD29, ITGB2, CD18, ITGB7, NKG2D, NKG2C, TNFR2, TRANCE/RANKL, DNAM1 (CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1, CRTAM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), SLAM7, BLAME (SLAMF8), SELPLG (CD162), LTBR, LAT, GADS, PAG/Cbp, CD19a, and a ligand that specifically binds with CD83; or
- an inhibitor of CD47, PD-1, PD-L1, PD-L2, CTLA4, TIM3, LAGS, CEACAM (e.g., CEACAM-1, -3 and/or -5), VISTA, BTLA, TIGIT, LAIR1, IDO, TDO, CD160 and/or TGFR beta.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with one or more cyclic dinculeotides or other STING pathway agonists. STING (stimulator of interferon genes, also known as TMEM173, MITA, ERIS, and MPYS) is a transmembrane protein localized to the ER that undergoes a conformational change in response to direct binding of cyclic dinucleotides (CDNs), resulting in a downstream signaling cascade involving TBK1 activation, IRF-3 phosphorylation, and production of IFN-β and other cytokines. The STING pathway in tumor-resident host antigen presenting c3ellss is involved in the induction of a spontaneous CD8+ T cell response against tumor-derived antigens. Activation of this pathway and the subsequent production of IFN-β also reportedly contributes to the anti-tumor effect of radiation. STING agonists and their uses are described in, for example, US20060040887, US20080286296, US20120041057, US20140205653, WO2014179335, WO 2014179760, US20150056224, WO 2015185565, WO 2016096174, WO 2016145102, WO 2017011444, WO 2017027645, WO 2017027646, WO 2017123657, WO 2017123669, WO 2017175147, WO 2017175156, WO 2018045204, WO 2018009648, WO 2018006652, WO 2018013887, WO 2018013908, US20180002369, US20180092937, and US20180093964.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with one or more of: anti-CD47 antibody, anti-PD-1 antibody (e.g., nivolumab, pembrolizumab, anti-PDL1 antibody, anti-TIGIT antibody, anti-APRIL antibody, anti-CTLA4 antibody, anti-CS1 antibody (e.g., elotuzumab), anti-KIR2DL1/2/3 antibody (e.g., lirilumab), anti-CD137 antibody (e.g., urelumab), anti-GITR antibody (e.g., TRX518), anti-PD-L1 antibody (e.g., BMS-936559, MSB0010718C or MPDL3280A), anti-PD-L2 antibody, anti-ILT1 antibody, anti-ILT2 antibody, anti-ILT3 antibody, anti-ILT4 antibody, anti-ILT5 antibody, anti-ILT6 antibody, anti-ILT7 antibody, anti-ILT8 antibody, anti-CD40 antibody, anti-OX40 antibody, anti-ICOS, anti-KIR2DL1 antibody, anti-KIR2DL2/3 antibody, anti-KIR2DL4 antibody, anti-KIR2DL5A antibody, anti-KIR2DL5B antibody, anti-KIR3DL1 antibody, anti-KIR3DL2 antibody, anti-KIR3DL3 antibody, anti-NKG2A antibody, anti-NKG2C antibody, anti-NKG2E antibody, anti-4-1BB antibody (e.g., PF-05082566), anti-TSLP antibody, anti-IL-10 antibody, IL-10 or PEGylated IL-10, or any small organic molecule inhibitor of such targets.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-CD20 antibody (e.g., rituximab, ofatumumab, ocrelizumab, obinutuzumab, ocaratuzumab, ublituximab, veltuzumab, ibritumomab tiuxetan, tositumomab, BVX-20, SCT-400 or PRO131921).
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-CD38 antibody (e.g., daratumumab, isatuximab or MOR202).
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-EGFR antibody (e.g., cetuximab, CetuGEX, panitumumab, nimotuzumab, depatuxizumab or AFM-21).
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-HER2 antibody (e.g., trastuzumab, TrasGEX, pertuzumab, margetuximab or ADCT-502).
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-HER3 antibody (e.g., lumretuzumab, patritumab or LJM716).
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-CD19 antibody (e.g., inebilizumab, blinatumomab, DI-B4, MDX-1342, MEDI-551, MOR208 or 4-G7SDIE).
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-CD52 antibody (e.g., alemtuzumab).
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-EpCAM antibody (e.g., adecatumumab, catumaxomab, edrecolomab or ING-1).
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-SLAMF7 antibody (e.g., elotuzumab or ABBV-838).
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-PD-1 antibody (e.g., nivolumab or pembrolizumab).
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-PD-L1 antibody (e.g., BMS-936559, MSB0010718C or MPDL3280A).
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-CTLA4 antibody (e.g., ipilimumab or tremelimumab).
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-CD137 antibody (e.g., urelumab).
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-GITR antibody (e.g., TRX518 or FPA154).
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-OX40 antibody (e.g., MEDI6469, MOXR0916 or INCAGN1949).
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-CD40 antibody (e.g., lucatumumab, dacetuzmumab, APX005M, ChiLob7/4, CP-870,893 or JNJ-64457107) In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-CS1 antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-KIR2DL1/2/3 antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-CD137 (e.g., urelumab) antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-GITR (e.g., TRX518) antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-PD-L2 antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-ITL1 antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-ITL2 antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-ITL3 antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-ITL4 antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-ITL5 antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-ITL6 antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-ITL7 antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-ITL8 antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-CD40 antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-OX40 antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-KIR2DL1 antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-KIR2DL2/3 antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-KIR2DL4 antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-KIR2DL5A antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-KIR2DL5B antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-KIR3DL1 antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-KIR3DL2 antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-KIR3DL3 antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-NKG2A antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-NKG2C antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-ICOS antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-4-1BB antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-IL-10 antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with an anti-TSLP antibody.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with IL-10 or PEGylated IL-10.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with one or more of an inhibitor (e.g., a small organic molecule or an antibody or antigen-binding fragment thereof) such as: an MTOR (mammalian target of rapamycin) inhibitor, a cytotoxic agent, a platinum agent, an EGFR inhibitor, a VEGF inhibitor, a microtubule stabilizer, a taxane, a CD20 inhibitor, a CD52 inhibitor, a CD30 inhibitor, a RANK (Receptor activator of nuclear factor kappa-B) inhibitor, a RANKL (Receptor activator of nuclear factor kappa-B ligand) inhibitor, an ERK inhibitor, a MAP Kinase inhibitor, an AKT inhibitor, a MEK inhibitor, a PI3K inhibitor, a HER1 inhibitor, a HER2 inhibitor, a HER3 inhibitor, a HER4 inhibitor, a Bcl2 inhibitor, a CD22 inhibitor, a CD79b inhibitor, an ErbB2 inhibitor, or a farnesyl protein transferase inhibitor.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with any one or more of: 13-cis-retinoic acid, 3-[5-(methylsulfonylpiperadinemethyl)-indolyl]-quinolone, 4-hydroxytamoxifen, 5-deooxyuridine, 5′-deoxy-5-fluorouridine, 5-fluorouracil, 6-mecaptopurine, 7-hydroxystaurosporine, A-443654, abirateroneacetate, abraxane, ABT-578, acolbifene, ADS-100380, ALT-110, altretamine, amifostine, aminoglutethimide, amrubicin, Amsacrine, anagrelide, anastrozole, angiostatin, AP-23573, ARQ-197, arzoxifene, AS-252424, AS-605240, asparaginase, AT-9263, atrasentan, axitinib, AZD1152, Bacillus Calmette-Guerin (BCG) vaccine, batabulin, BC-210, besodutox, bevacizumab, bicalutamide, Bio111, BIO140, bleomycin, BMS-214662, BMS-247550, BMS-275291, BMS-310705, bortezomib, buserelin, busulfan, calcitriol, camptothecin, canertinib, capecitabine, carboplatin, carmustine, CC8490, Cediranib, CG-1521, CG-781, chlamydocin, chlorambucil, chlorotoxin, cilengitide, cimitidine, cisplatin, cladribine, clodronate, COL-3, CP-724714, cyclophosphamide, cyproterone, cyproteroneacetate, cytarabine, cytosinearabinoside, dacarbazine, dacinostat, dactinomycin, dalotuzumab, danusertib, dasatanib, daunorubicin, decatanib, deguelin, denileukin, deoxycoformycin, depsipeptide, diarylpropionitrile, diethylstilbestrol, diftitox, docetaxel, dovitinib, doxorubicin, droloxifene, edotecarin, yttrium-90 labeled-edotreotide, edotreotide, EKB-569, EMD121974, endostatin, enzalutamide, enzastaurin, epirubicin, epithilone B, ERA-923, Erbitux, erlotinib, estradiol, estramustine, etoposide, everolimus, exemestane, ficlatuzumab, finasteride, flavopiridol, floxuridine, fludarabine, fludrocortisone, fluoxymesterone, flutamide, FOLFOX regimen, Fulvestrant, galeterone, gefitinib, gemcitabine, gimatecan, goserelin, goserelin acetate, gossypol, GSK461364, GSK690693, HMR-3339, hydroxyprogesteronecaproate, hydroxyurea, IC87114, idarubicin, idoxyfene, ifosfamide, IM862, imatinib, IMC-1C11, INCB24360, INO1001, interferon, interleukin-12, ipilimumab, irinotecan, JNJ-16241199, ketoconazole, KRX-0402, thalidomide, lenalidomide, pomalidomide, apremilast,lapatinib, lasofoxifene, letrozole, leucovorin, leuprolide, leuprolide acetate, levamisole, liposome entrapped paclitaxel, lomustine, lonafarnib, lucanthone, LY292223, LY292696, LY293646, LY293684, LY294002, LY317615, marimastat, mechlorethamine, medroxyprogesteroneacetate, megestrolacetate, melphalan, mercaptopurine, mesna, methotrexate, mithramycin, mitomycin, mitotane, mitoxantrone, tozasertib, MLN8054, neovastat, Neratinib, neuradiab, nilotinib, nilutimide, nolatrexed, NVP-BEZ235, oblimersen, octreotide, ofatumumab, oregovomab, orteronel, oxaliplatin, paclitaxel, palbociclib, pamidronate, panitumumab, pazopanib, PD0325901, PD184352, PEG-interferon, pemetrexed, pentostatin, perifosine, phenylalaninemustard, PI-103, pictilisib, PIK-75, pipendoxifene, PKI-166, plicamycin, porfimer, prednisone, procarbazine, progestins, PX-866, R-763, raloxifene, raltitrexed, razoxin, ridaforolimus, rituximab, romidepsin, RTA744, rubitecan, scriptaid, Sdx102, seliciclib, selumetinib, semaxanib, SF1126, sirolimus, SN36093, sorafenib, spironolactone, squalamine, SR13668, streptozocin, SU6668, suberoylanalide hydroxamic acid, sunitinib, synthetic estrogen, talampanel, talimogene laherparepvec, tamoxifen, temozolomide, temsirolimus, teniposide, tesmilifene, testosterone, tetrandrine, TGX-221, thalidomide, thioguanine, thiotepa, tremelimumab, tipifarnib, tivozanib, TKI-258, TLK286, topotecan, toremifene citrate, trabectedin, trastuzumab, tretinoin, trichostatin A, triciribinephosphate monohydrate, triptorelin pamoate, TSE-424, uracil mustard, valproic acid, valrubicin, vandetanib, vatalanib, VEGF trap, vinblastine, vincristine, vindesine, vinorelbine, vitaxin, vitespan, vorinostat, VX-745, wortmannin, Xr311, zanolimumab, ZK186619, ZK-304709, ZM336372, ZSTK474.
- Non-limiting examples of suitable anti-cancer agents to be used in combination with an anti-SIRPα antibody or antigen-binding fragment thereof of the invention include cytostatic agents, immune modulating imide drugs, cytotoxic agents, targeted therapeutic agents (small molecules, biologics, siRNA and microRNA) against cancer and neoplastic diseases,
-
- 1) anti-metabolites (such as methotrexate, 5-fluorouracil, gemcitabine, fludarabine, capecitabine);
- 2) alkylating agents, such as temozolomide, cyclophosphamide,
- 3) DNA interactive and DNA damaging agents, such as cisplatin, oxaliplatin, doxorubicin,
- 4) Ionizing irradiation, such as radiation therapy,
- 5) topoisomerase II inhibitors, such as etoposide, doxorubicin,
- 6) topoisomerase I inhibitors, such as irinotecan, topotecan,
- 7) tubulin interacting agents, such as paclitaxel, docetaxel, Abraxane, epothilones,
- 8) kinesin spindle protein inhibitors,
- 9) spindle checkpoint inhibitors,
- 10) Poly(ADP-ribose) polymerase (PARP) inhibitors, such as olaparib, MK-4827 and veliparib
- 11) Matrix metalloprotease (MMP) inhibitors
- 12) Protease inhibitors, such as cathepsin D and cathepsin K inhibitors
- 13) Proteosome or ubiquitination inhibitors, such as bortezomib,
- 14) Activator of mutant p53 to restore its wild-type p53 activity
- 15) Adenoviral-p53
- 16) Bcl-2 inhibitors, such as ABT-263
- 17) Heat shock protein (HSP) modulators, such as geldanamycin and 17-AAG
- 18) Histone deacetylase (HDAC) inhibitors, such as vorinostat (SAHA),
- 19) sex hormone modulating agents,
- a. anti-estrogens, such as tamoxifen, fulvestrant,
- b. selective estrogen receptor modulators (SERM), such as raloxifene,
- c. anti-androgens, such as bicalutamide, flutamide
- d. LHRH agonists, such as leuprolide,
- e. 5α-reductase inhibitors, such as finasteride,
- f. Cytochrome P450 C17 lyase (CYP450c17, also called 17aC);
- g. aromatase inhibitors, such as letrozole, anastrozole, exemestane,
- 20) EGFR kinase inhibitors, such as geftinib, erlotinib, laptinib
- 21) dual erbB1 and erbB2 inhibitors, such as Lapatinib
- 22) multi-targeted kinases (serine/threonine and/or tyrosine kinase) inhibitors,
- a. ABL kinase inhibitors, imatinib and nilotinib, dasatinib
- b. VEGFR-1, VEGFR-2, PDGFR, KDR, FLT, c-Kit, Tie2, Raf, MEK and ERK inhibitors, such as sunitinib, sorafenib, Vandetanib, pazopanib, PLX-4032, Axitinib, PTK787, GSK-1120212
- c. Polo-like kinase inhibitors
- d. Aurora kinase inhibitors
- e. JAK inhibitor
- f. c-MET kinase inhibitors
- g. Cyclin-dependent kinase inhibitors, such as CDK1 and CDK2 inhibitor Dinaciclib SCH 727965 (see Parry et al, Molecular Cancer Therapeutics 9 (8): 2344-53 (2010)) and CDK4/6 inhibitors, such as Ribociclib, Palbociclib, Abemaciclib, and Trilaciclib.
- h. PI3K and mTOR inhibitors, such as GDC-0941, BEZ-235, BKM-120 and AZD-8055
- i. Rapamycin and its analogs, such as Temsirolimus, everolimus, and deforolimus
- 23) and other anti-cancer (also know as anti-neoplastic) agents include but are not limited to ara-C, adriamycin, cytoxan, Carboplatin, Uracil mustard, Clormethine, Ifosfsmide, Melphalan, Chlorambucil, Pipobroman, Triethylenemelamine, Triethylenethiophosphoramine, Busulfan, Carmustine, Lomustine, Streptozocin, Dacarbazine, Floxuridine, Cytarabine, 6-Mercaptopurine, 6-Thioguanine, Fludarabine phosphate, Pentostatine, Vinblastine, Vincristine, Vindesine, Vinorelbine, Navelbine, Bleomycin, Dactinomycin, Daunorubicin, Doxorubicin, Epirubicin, teniposide, cytarabine, pemetrexed, Idarubicin, Mithramycin, Deoxycoformycin, Mitomycin-C, L-Asparaginase, Teniposide, Ethinylestradiol, Diethylstilbestrol, Testosterone, Prednisone, Fluoxymesterone, Dromostanolone propionate, Testolactone, Megestrolacetate, Methylprednisolone, Methyltestosterone, Prednisolone, Triamcinolone, Chlorotrianisene, Hydroxyprogesterone, Aminoglutethimide, Estramustine, Flutamide Medroxyprogesteroneacetate, Toremifene, goserelin, Carboplatin, Hydroxyurea, Amsacrine, Procarbazine, Mitotane, Mitoxantrone, Levamisole, Drolloxafine, Hexamethylmelamine, Bexxar, Zevalin, Trisenox, Profimer, Thiotepa, Altretamine, Doxil, Ontak, Depocyt, Aranesp, Neupogen, Neulasta, Kepivance.
- 24) Farnesyl protein transferase inhibitors, such as, SARASAR™ (4-[2-[4-[(11R)-3,10-dibromo-8-chloro-6, 11-dihydro-5H-benzo[5,6]cyclohepta[1,2-b]pyridin-11-yl-]-1-piperidinyl]-2-oxoethyl]-piperidinecarboxamide, tipifarnib
- 25) interferons, such as Intron A, Peg-Intron,
- 26) anti-erbB1 antibodies, such as cetuximab, panitumumab,
- 27) anti-erbB2 antibodies, such as trastuzumab,
- 28) anti-CD52 antibodies, such as Alemtuzumab,
- 29) anti-CD20 antibodies, such as Rituximab
- 30) anti-CD33 antibodies, such as Gemtuzumab ozogamicin
- 31) anti-VEGF antibodies, such as Avastin,
- 32) TRIAL ligands, such as Lexatumumab, mapatumumab, and AMG-655
- 33) anti-CTLA-4 antibodies, such as ipilimumab
- 34) antibodies against CTA1, CEA, CD5, CD19, CD22, CD30, CD44, CD44V6, CD55, CD56, EpCAM, FAP, MHCII, HGF, IL-6, MUC1, PSMA, TAL6, TAG-72, TRAILR, VEGFR, IGF-2, FGF,
- 35) anti-IGF-1R antibodies, such as dalotuzumab (MK-0646) and robatumumab (SCH 717454).
- “Estrogen receptor modulators” refers to compounds that interfere with or inhibit the binding of estrogen to the receptor, regardless of mechanism. Examples of estrogen receptor modulators include, but are not limited to, tamoxifen, raloxifene, idoxifene, LY353381, LY117081, toremifene, fulvestrant, 4-[7-(2,2-dimethyl-1-oxopropoxy-4-methyl-2-[4-[2-(1-piperidinyl)ethoxy]phenyl]-2H-1-benzopyran-3-yl]-phenyl-2,2-dimethylpropanoate, 4,4′-dihydroxybenzophenone-2,4-dinitrophenyl-hydrazone, and SH646.
- “Androgen receptor modulators” refers to compounds which interfere or inhibit the binding of androgens to the receptor, regardless of mechanism. Examples of androgen receptor modulators include finasteride and other 5α-reductase inhibitors, nilutamide, flutamide, bicalutamide, liarozole, and abiraterone acetate.
- “Retinoid receptor modulators” refers to compounds which interfere or inhibit the binding of retinoids to the receptor, regardless of mechanism. Examples of such retinoid receptor modulators include bexarotene, tretinoin, 13-cis-retinoic acid, 9-cis-retinoic acid, α-difluoromethylornithine, ILX23-7553, trans-N-(4′-hydroxyphenyl) retinamide, and N-4-carboxyphenyl retinamide.
- “Cytotoxic/cytostatic agents” refer to compounds which cause cell death or inhibit cell proliferation primarily by interfering directly with the cell's functioning or inhibit or interfere with cell myosis, including alkylating agents, tumor necrosis factors, intercalators, hypoxia activatable compounds, microtubule inhibitors/microtubule-stabilizing agents, inhibitors of mitotic kinesins, histone deacetylase inhibitors, inhibitors of kinases involved in mitotic progression, inhibitors of kinases involved in growth factor and cytokine signal transduction pathways, antimetabolites, biological response modifiers, hormonal/anti-hormonal therapeutic agents, haematopoietic growth factors, monoclonal antibody targeted therapeutic agents, topoisomerase inhibitors, proteosome inhibitors, ubiquitin ligase inhibitors, and aurora kinase inhibitors.
- Examples of cytotoxic/cytostatic agents include, but are not limited to, platinum coordinator compounds, sertenef, cachectin, ifosfamide, tasonermin, lonidamine, carboplatin, altretamine, prednimustine, dibromodulcitol, ranimustine, fotemustine, nedaplatin, oxaliplatin, temozolomide, heptaplatin, estramustine, improsulfan tosilate, trofosfamide, nimustine, dibrospidium chloride, pumitepa, lobaplatin, satraplatin, profiromycin, cisplatin, irofulven, dexifosfamide, cis-aminedichloro(2-methyl-pyridine)platinum, benzylguanine, glufosfamide, GPX100, (trans, trans, trans)-bis-mu-(hexane-1,6-diamine)-mu-[diamine-platinum(II)]bis[diamine(chloro)platinum (Th]tetrachloride, diarizidinylspermine, arsenic trioxide, 1-(11-dodecylamino-10-hydroxyundecyl)-3,7-dimethylxanthine, zorubicin, idarubicin, daunorubicin, bisantrene, mitoxantrone, pirarubicin, pinafide, valrubicin, amrubicin, antineoplaston, 3′-deamino-3′-morpholino-13-deoxo-10-hydroxycarminomycin, annamycin, galarubicin, elinafide, MEN10755, 4-demethoxy-3-deamino-3-aziridinyl-4-methylsulphonyl-daunorubicin (see WO 00/50032).
- An example of a hypoxia activatable compound is tirapazamine.
- Examples of proteosome inhibitors include but are not limited to lactacystin and MLN-341 (Velcade).
- Examples of microtubule inhibitors/microtubule-stabilising agents include taxanes in general. Specific compounds include paclitaxel (Taxol®), vindesine sulfate, 3′,4′-didehydro-4′-deoxy-8′-norvincaleukoblastine, docetaxol (Taxotere®), rhizoxin, dolastatin, mivobulin isethionate, auristatin, cemadotin, RPR109881, BMS184476, vinflunine, cryptophycin, 2,3,4,5,6-pentafluoro-N-(3-fluoro-4-methoxyphenyl) benzene sulfonamide, anhydrovinblastine, N,N-dimethyl-L-valyl-L-valyl-N-methyl-L-valyl-L-prolyl-L-proline-t-butylamide, TDX258, the epothilones (see for example U.S. Pat. Nos. 6,284,781 and 6,288,237) and BMS188797.
- Some examples of topoisomerase inhibitors are topotecan, hycaptamine, irinotecan, rubitecan, 6-ethoxypropionyl-3′,4′-O-exo-benzylidene-chartreusin, 9-methoxy-N,N-dimethyl-5-nitropyrazolo[3,4,5-kl]acridine-2-(6H) propanamine, 1-amino-9-ethyl-5-fluoro-2,3-dihydro-9-hydroxy-4-methyl-1H,12H-benzo[de]pyrano[3′,4′:b,7]-indolizino[1,2b]quinoline-10,13(9H,15H)dione, lurtotecan, 7-[2-(N-isopropylamino)ethyl]-(20S)camptothecin, BNP1350, BNPI1100, BN80915, BN80942, etoposide phosphate, teniposide, sobuzoxane, 2′-dimethylamino-2′-deoxy-etoposide, GL331, N-[2-(dimethylamino)ethyl]-9-hydroxy-5,6-dimethyl-6H-pyrido[4,3-b]carbazole-1-carboxamide, asulacrine, (5a, 5aB, 8aa, 9b)-9-[2-[N-[2-(dimethylamino)ethyl]-N-methylamino]ethyl]-5-[4-hydro0xy-3,5-dimethoxyphenyl]-5,5a,6,8,8a,9-hexohydrofuro(3′,4′:6,7)naphtho(2,3-d)-1,3-dioxol-6-one, 2,3-(methylenedioxy)-5-methyl-7-hydroxy-8-methoxybenzo[c]-phenanthridinium, 6,9-bis[(2-aminoethyl)amino]benzo[g]isoguinoline-5,10-dione, 5-(3-aminopropylamino)-7,10-dihydroxy-2-(2-hydroxyethylaminomethyl)-6H-pyrazolo[4,5,1-de]acridin-6-one, N-[1-[2(diethylamino)ethylamino]-7-methoxy-9-oxo-9H-thioxanthen-4-ylmethyl]formamide, N-(2-(dimethylamino)ethyl)acridine-4-carboxamide, 6-[[2-(dimethylamino)ethyl]amino]-3-hydroxy-7H-indeno[2,1-c] quinolin-7-one, and dimesna.
- Examples of inhibitors of mitotic kinesins, and in particular the human mitotic kinesin KSP, are described in Publications WO03/039460, WO03/050064, WO03/050122, WO03/049527, WO03/049679, WO03/049678, WO04/039774, WO03/079973, WO03/099211, WO03/105855, WO03/106417, WO04/037171, WO04/058148, WO04/058700, WO04/126699, WO05/018638, WO05/019206, WO05/019205, WO05/018547, WO05/017190, US2005/0176776. In an embodiment inhibitors of mitotic kinesins include, but are not limited to inhibitors of KSP, inhibitors of MKLP1, inhibitors of CENP-E, inhibitors of MCAK and inhibitors of Rab6-KIFL.
- Examples of “histone deacetylase inhibitors” include, but are not limited to, SAHA, TSA, oxamflatin, PXD101, MG98 and scriptaid. Further reference to other histone deacetylase inhibitors may be found in the following manuscript; Miller, T. A. et al. J. Med. Chem. 46(24):5097-5116 (2003).
- “Inhibitors of kinases involved in mitotic progression” include, but are not limited to, inhibitors of aurora kinase, inhibitors of Polo-like kinases (PLK; in particular inhibitors of PLK-1), inhibitors of bub-1 and inhibitors of bub-R1. An example of an “aurora kinase inhibitor” is VX-680.
- “Antiproliferative agents” includes antisense RNA and DNA oligonucleotides such as G3139, ODN698, RVASKRAS, GEM231, and INX3001, and antimetabolites such as enocitabine, carmofur, tegafur, pentostatin, doxifluridine, trimetrexate, fludarabine, capecitabine, galocitabine, cytarabine ocfosfate, fosteabine sodium hydrate, raltitrexed, paltitrexid, emitefur, tiazofurin, decitabine, nolatrexed, pemetrexed, nelzarabine, 2′-deoxy-2′-methylidenecytidine, 2′-fluoromethylene-2′-deoxycytidine, N-[5-(2,3-dihydro-benzofuryl)sulfonyl]-N′-(3,4-dichlorophenyl)urea, N6-[4-deoxy-4-[N2-[2(E),4(E)-tetradecadienoyl]glycylamino]-L-glycero-B-L-manno-heptopyranosyl]adenine, aplidine, ecteinascidin, troxacitabine, 4-[2-amino-4-oxo-4,6,7,8-tetrahydro-3H-pyrimidino[5,4-b][1,4]thiazin-6-yl-(S)-ethyl]-2,5-thienoyl-L-glutamic acid, aminopterin, 5-flurouracil, alanosine, 11-acetyl-8-(carbamoyloxymethyl)-4-formyl-6-methoxy-14-oxa-1,11-diazatetracyclo(7.4.1.0.0)-tetradeca-2,4,6-trien-9-yl acetic acid ester, swainsonine, lometrexol, dexrazoxane, methioninase, 2′-cyano-2′-deoxy-N4-palmitoyl-1-B-D-arabino furanosyl cytosine, 3-aminopyridine-2-carboxaldehyde thiosemicarbazone and trastuzumab.
- Examples of monoclonal antibody targeted therapeutic agents include those therapeutic agents which have cytotoxic agents or radioisotopes attached to a cancer cell specific or target cell specific monoclonal antibody. Examples include Bexxar.
- “Prenyl-protein transferase inhibitor” refers to a compound which inhibits any one or any combination of the prenyl-protein transferase enzymes, including farnesyl-protein transferase (FPTase), geranylgeranyl-protein transferase type I (GGPTase-I), and geranylgeranyl-protein transferase type-II (GGPTase-II, also called Rab GGPTase).
- Examples of prenyl-protein transferase inhibitors can be found in the following publications and patents: WO 96/30343, WO 97/18813, WO 97/21701, WO 97/23478, WO 97/38665, WO 98/28980, WO 98/29119, WO 95/32987, U.S. Pat. Nos. 5,420,245, 5,523,430, 5,532,359, 5,510,510, 5,589,485, 5,602,098, European Patent Publ. 0 618 221, European Patent Publ. 0 675 112, European Patent Publ. 0 604 181, European Patent Publ. 0 696 593, WO 94/19357, WO 95/08542, WO 95/11917, WO 95/12612, WO 95/12572, WO 95/10514, U.S. Pat. No. 5,661,152, WO 95/10515, WO 95/10516, WO 95/24612, WO 95/34535, WO 95/25086, WO 96/05529, WO 96/06138, WO 96/06193, WO 96/16443, WO 96/21701, WO 96/21456, WO 96/22278, WO 96/24611, WO 96/24612, WO 96/05168, WO 96/05169, WO 96/00736, U.S. Pat. No. 5,571,792, WO 96/17861, WO 96/33159, WO 96/34850, WO 96/34851, WO 96/30017, WO 96/30018, WO 96/30362, WO 96/30363, WO 96/31111, WO 96/31477, WO 96/31478, WO 96/31501, WO 97/00252, WO 97/03047, WO 97/03050, WO 97/04785, WO 97/02920, WO 97/17070, WO 97/23478, WO 97/26246, WO 97/30053, WO 97/44350, WO 98/02436, and U.S. Pat. No. 5,532,359. For an example of the role of a prenyl-protein transferase inhibitor on angiogenesis see European J. of Cancer, Vol. 35, No. 9, pp. 1394-1401 (1999).
- “Angiogenesis inhibitors” refers to compounds that inhibit the formation of new blood vessels, regardless of mechanism. Examples of angiogenesis inhibitors include, but are not limited to, tyrosine kinase inhibitors, such as inhibitors of the tyrosine kinase receptors Flt-1 (VEGFR1) and Flk-1/KDR (VEGFR2), inhibitors of epidermal-derived, fibroblast-derived, or platelet derived growth factors, MMP (matrix metalloprotease) inhibitors, integrin blockers, interferon-a, interleukin-12, pentosan polysulfate, cyclooxygenase inhibitors, including nonsteroidal anti-inflammatories (NSAIDs) like aspirin and ibuprofen as well as selective cyclooxy-genase-2 inhibitors like celecoxib and rofecoxib (PNAS, Vol. 89, p. 7384 (1992); JNCI, Vol. 69, p. 475 (1982); Arch. Opthalmol., Vol. 108, p. 573 (1990); Anat. Rec., Vol. 238, p. 68 (1994); FEBS Letters, Vol. 372, p. 83 (1995); Clin, Orthop. Vol. 313, p. 76 (1995); J. Mol. Endocrinol., Vol. 16, p. 107 (1996); Jpn. J. Pharmacol., Vol. 75, p. 105 (1997); Cancer Res., Vol. 57, p. 1625 (1997); Cell, Vol. 93, p. 705 (1998); Intl. J. Mol. Med., Vol. 2, p. 715 (1998); J. Biol. Chem., Vol. 274, p. 9116 (1999)), steroidal anti-inflammatories (such as corticosteroids, mineralocorticoids, dexamethasone, prednisone, prednisolone, methylpred, betamethasone), carboxyamidotriazole, combretastatin A-4, squalamine, 6-O-chloroacetyl-carbonyl)-fumagillol, thalidomide, angiostatin, troponin-1, angiotensin II antagonists (see Fernandez et al., J. Lab. Clin. Med. 105: 141-145 (1985)), and antibodies to VEGF (see, Nature Biotechnology, Vol. 17, pp. 963-968 (October 1999); Kim et al., Nature, 362, 841-844 (1993); WO 00/44777; and WO 00/61186).
- Other examples of angiogenesis inhibitors include, but are not limited to, endostatin, ukrain, ranpirnase, IM862, 5-methoxy-4-[2-methyl-3-(3-methyl-2-butenyl)oxiranyl]-1-oxaspiro[2,5]oct-6-yl(chloroacetyl)carbamate, acetyldinanaline, 5-amino-1-[ [3,5-dichloro-4-(4-chlorobenzoyl)phenyl]methyl]-1H-1,2,3-triazole-4-carboxamide,CM101, squalamine, combretastatin, RPI4610, NX31838, sulfated mannopentaose phosphate, 7,7-(carbonyl-bis[imino-N-methyl-4,2-pyrrolocarbonylimino[N-methyl-4,2-pyrrole]-carbonylimino]-bis-(1,3-naphthalene disulfonate), and 3-[(2,4-dimethylpyrrol-5-yl)methylene]-2-indolinone (SU5416).
- Other therapeutic agents that modulate or inhibit angiogenesis and may also be used in combination with the compounds of the instant invention include agents that modulate or inhibit the coagulation and fibrinolysis systems (see review in Clin. Chem. La. Med. 38:679-692 (2000)). Examples of such agents that modulate or inhibit the coagulation and fibrinolysis pathways include, but are not limited to, heparin (see Thromb. Haemost. 80:10-23 (1998)), low molecular weight heparins and carboxypeptidase U inhibitors (also known as inhibitors of active thrombin activatable fibrinolysis inhibitor [TAFIa]) (see Thrombosis Res. 101:329-354 (2001)). TAFIa inhibitors have been described in U.S. Ser. Nos. 60/310,927 (filed Aug. 8, 2001) and 60/349,925 (filed Jan. 18, 2002).
- “Agents that interfere with cell cycle checkpoints” refer to compounds that inhibit protein kinases that transduce cell cycle checkpoint signals, thereby sensitizing the cancer cell to DNA damaging agents. Such agents include inhibitors of ATR, ATM, the CHK11 and CHK12 kinases and cdk and cdc kinase inhibitors and are specifically exemplified by 7-hydroxystaurosporin, flavopiridol, CYC202 (Cyclacel) and BMS-387032.
- “Agents that interfere with receptor tyrosine kinases (RTKs)” refer to compounds that inhibit RTKs and therefore mechanisms involved in oncogenesis and tumor progression. Such agents include inhibitors of c-Kit, Eph, PDGF, Flt3 and c-Met. Further agents include inhibitors of RTKs as described by Bume-Jensen and Hunter, Nature, 411:355-365, 2001.
- “Inhibitors of cell proliferation and survival signalling pathway” refer to compounds that inhibit signal transduction cascades downstream of cell surface receptors. Such agents include inhibitors of serine/threonine kinases (including but not limited to inhibitors of Akt such as described in WO 02/083064, WO 02/083139, WO 02/083140, US 2004-0116432, WO 02/083138, US 2004-0102360, WO 03/086404, WO 03/086279, WO 03/086394, WO 03/084473, WO 03/086403, WO 2004/041162, WO 2004/096131, WO 2004/096129, WO 2004/096135, WO 2004/096130, WO 2005/100356, WO 2005/100344, US 2005/029941, US 2005/44294, US 2005/43361, 60/734188, 60/652737, 60/670469), inhibitors of Raf kinase (for example PLX-4032), inhibitors of MEK (for example Arry-162, RO-4987655 and GSK-1120212), inhibitors of mTOR (for example AZD-8055, BEZ-235 and everolimus), and inhibitors of PI3K (for example GDC-0941, BKM-120).
- As used above, “integrin blockers” refers to compounds which selectively antagonize, inhibit or counteract binding of a physiological ligand to the αvβ3integrin, to compounds which selectively antagonize, inhibit or counteract binding of a physiological ligand to the αvβ5 integrin, to compounds which antagonize, inhibit or counteract binding of a physiological ligand to both the αvβ3 integrin and the αvβ5 integrin, and to compounds which antagonize, inhibit or counteract the activity of the particular integrin(s) expressed on capillary endothelial cells. The term also refers to antagonists of the αvβ6, αvβ8, α1β1, α2β1, α5β1, α6β1, and α6β4 integrins. The term also refers to antagonists of any combination of αvβ3, αvβ5, αvβ8, α1β1, α2β1, α5β1, α6β1, and α6β4 integrins.
- Some specific examples of tyrosine kinase inhibitors include N-(trifluoromethylphenyl)-5-methylisoxazol-4-carboxamide, 3-[(2,4-dimethylpyrrol-5-yl)methylidenyl)indolin-2-one, 17-(allylamino)-17-demethoxygeldanamycin, 4-(3-chloro-4-fluorophenylamino)-7-methoxy-6-[3-(4-morpholinyl)propoxyl]quinazoline, N-(3-ethynylphenyl)-6,7-bis(2-methoxyethoxy)-4-quinazolinamine, BIBX1382, 2,3,9,10,11,12-hexahydro-10-(hydroxymethyl)-10-hydroxy-9-methyl-9,12-epoxy-1H-diindolo[1,2,3-fg:3‘′,2’,1′-kl]pyrrolo[3,4-i][1,6]benzodiazocin-1-one, SH268, genistein, STI571, CEP2563, 4-(3-chlorophenylamino)-5,6-dimethyl-7H-pyrrolo[2,3-d]pyrimidinemethane sulfonate, 4-(3-bromo-4-hydroxyphenyl)amino-6,7-dimethoxyquinazoline, 4-(4′-hydroxyphenyl)amino-6,7-dimethoxyquinazoline, SU6668, STI571A, N-4-chlorophenyl-4-(4-pyridylmethyl)-1-phthalazinamine, and EMD121974.
- Combinations of the instantly claimed antibodies or antigen binding fragments with PPAR-γ (i.e., PPAR-gamma) agonists and PPAR-δ (i.e., PPAR-delta) agonists may be useful in the treatment of certain malignancies. PPAR-γ and PPAR-δ are the nuclear peroxisome proliferator-activated receptors γ and δ. The expression of PPAR-γ on endothelial cells and its involvement in angiogenesis has been reported in the literature (see J. Cardiovasc. Pharmacol. 1998; 31: 909-913; J. Biol. Chem. 1999; 274: 9116-9121; Invest. Ophthalmol Vis. Sci. 2000; 41: 2309-2317). More recently, PPAR-γ agonists have been shown to inhibit the angiogenic response to VEGF in vitro; both troglitazone and rosiglitazone maleate inhibit the development of retinal neovascularization in mice. (Arch. Ophthamol. 2001; 119: 709-717). Examples of PPAR-γ agonists and PPAR-γ/α agonists include, but are not limited to, Lynparza®, Rucaparib®, Talazoparib®, niraparib, Veliparib®, thiazolidinediones (such as DRF2725, CS-011, troglitazone, rosiglitazone, and pioglitazone), fenofibrate, gemfibrozil, clofibrate, GW2570, SB219994, AR-H039242, JTT-501, MCC-555, GW2331, GW409544, NN2344, KRP297, NP0110, DRF4158, NN622, GI262570, PNU182716, DRF552926, 2-[(5,7-dipropyl-3-trifluoromethyl-1,2-benzisoxazol-6-yl)oxy]-2-methylpropionic acid, and 2(R)-7-(3-(2-chloro-4-(4-fluorophenoxy) phenoxy)propoxy)-2-ethylchromane-2-carboxylic acid.
- The antibody or antigen binding fragment of the instant invention may also be useful for treating or preventing breast cancer in combination with aromatase inhibitors. Examples of aromatase inhibitors include but are not limited to: anastrozole, letrozole and exemestane.
- The antibody or antigen binding fragment of the instant invention may also be useful for treating cancer in combination with the following chemotherapeutic agents: abarelix (Plenaxis depot®); aldesleukin (Prokine®); Aldesleukin (Proleukin®); Alemtuzumab (Campath®); alitretinoin (Panretin®); allopurinol (Zyloprim®); altretamine (Hexalen®); amifostine (Ethyol®); anastrozole (Arimidex®); arsenic trioxide (Trisenox®); asparaginase (Elspar®); azacitidine (Vidaza®); bendamustine hydrochloride (Treanda®); bevacuzimab (Avastin®); bexarotene capsules (Targretin®); bexarotene gel (Targretin®); bleomycin (Blenoxane®); bortezomib (Velcade®); brefeldin A; busulfan intravenous (Busulfex®); busulfan oral (Myleran®); calusterone (Methosarb®); capecitabine (Xeloda®); carboplatin (Paraplatin®); carmustine (BCNU®, BiCNU®); carmustine (Gliadel®); carmustine with Polifeprosan 20 Implant (Gliadel Wafer®); celecoxib (Celebrex®); cetuximab (Erbitux®); chlorambucil (Leukeran®); cisplatin (Platinol®); cladribine (Leustatin®, 2-CdA®); clofarabine (Clolar®); cyclophosphamide (Cytoxan®, Neosar®); cyclophosphamide (Cytoxan Injection®); cyclophosphamide (Cytoxan Tablet®); cytarabine (Cytosar-U®); cytarabine liposomal (DepoCyt®); dacarbazine (DTIC-Dome®); dactinomycin, actinomycin D (Cosmegen®); dalteparin sodium injection (Fragmin®); daratumumab (DARZALEX®); Darbepoetin alfa (Aranesp®); dasatinib (Sprycel®); daunorubicin liposomal (DanuoXome®); daunorubicin, daunomycin (Daunorubicin®); daunorubicin, daunomycin (Cerubidine®); degarelix (Firmagon®); Denileukin diftitox (Ontak®); dexrazoxane (Zinecard®); dexrazoxane hydrochloride (Totect®); didemnin B; 17-DMAG; docetaxel (Taxotere®); doxorubicin (Adriamycin PFS®); doxorubicin (Adriamycin®, Rubex®); doxorubicin (Adriamycin PFS Injection®); doxorubicin liposomal (Doxil®); dromostanolone propionate (Dromostanolone®); dromostanolone propionate (Masterone Injection®); eculizumab injection (Soliris®); Elliott's B Solution (Elliott's B Solution®); eltrombopag (Promacta®); epirubicin (Ellence®); Epoetin alfa (Epogen®); erlotinib (Tarceva®); estramustine (Emcyt®); ethinyl estradiol; etoposide phosphate (Etopophos®); etoposide, VP-16 (Vepesid®); everolimus tablets (Afinitor®); exemestane (Aromasin®); ferumoxytol (Feraheme Injection®); Filgrastim (Neupogen®); floxuridine (intraarterial) (FUDR®); fludarabine (Fludara®); fluorouracil, 5-FU (Adrucil®); fulvestrant (Faslodex®); gefitinib (Iressa®); geldanamycin; gemcitabine (Gemzar®); gemtuzumab ozogamicin (Mylotarg®); goserelin acetate (Zoladex Implant®); goserelin acetate (Zoladex®); histrelin acetate (Histrelin implant®); hydroxyurea (Hydrea®); Ibritumomab Tiuxetan (Zevalin®); idarubicin (Idamycin®); ifosfamide (IFEX®); imatinib mesylate (Gleevec®); interferon alfa 2a (Roferon A®); Interferon alfa-2b (Intron A®); iobenguane I 123 injection (AdreView®); irinotecan (Camptosar®); ixabepilone (Ixempra®); lapatinib tablets (Tykerb®); lenalidomide (Revlimid®); letrozole (Femara®); leucovorin (Wellcovorin®, Leucovorin®); Leuprolide Acetate (Eligard®); levamisole (Ergamisol®); lomustine, CCNU (CeeBU®); meclorethamine, nitrogen mustard (Mustargen®); megestrol acetate (Megace®); melphalan, L-PAM (Alkeran®); mercaptopurine, 6-MP (Purinethol®); mesna (Mesnex®); mesna (Mesnex tabs®); methotrexate (Methotrexate®); methoxsalen (Uvadex®); 8-methoxypsoralen; mitomycin C (Mutamycin®); mitotane (Lysodren®); mitoxantrone (Novantrone®); mitramycin; nandrolone phenpropionate (Durabolin-50®); nelarabine (Arranon®); nilotinib (Tasigna®); Nofetumomab (Verluma®); ofatumumab (Arzerra®); Oprelvekin (Neumega®); oxaliplatin (Eloxatin®); paclitaxel (Paxene®); paclitaxel (Taxol®); paclitaxel protein-bound particles (Abraxane®); palifermin (Kepivance®); pamidronate (Aredia®); panitumumab (Vectibix®); pazopanib tablets (Votrienttm®); pegademase (Adagen (Pegademase Bovine)®); pegaspargase (Oncaspar®); Pegfilgrastim (Neulasta®); pemetrexed disodium (Alimta®); pentostatin (Nipent®); pipobroman (Vercyte®); plerixafor (Mozobil®); plicamycin, mithramycin (Mithracin®); porfimer sodium (Photofrin®); pralatrexate injection (Folotyn®); procarbazine (Matulane®); quinacrine (Atabrine®); rapamycin; Rasburicase (Elitek®); raloxifene hydrochloride (Evista®); Rituximab (Rituxan®); romidepsin (Istodax®); romiplostim (Nplate®); sargramostim (Leukine®); Sargramostim (Prokine®); sorafenib (Nexavar®); streptozocin (Zanosar®); sunitinib maleate (Sutent®); talc (Sclerosol®); tamoxifen (Nolvadex®); temozolomide (Temodar®); temsirolimus (Torisel®); teniposide, VM-26 (Vumon®); testolactone (Teslac®); thioguanine, 6-TG (Thioguanine®); thiopurine; thiotepa (Thioplex®); topotecan (Hycamtin®); toremifene (Fareston®); Tositumomab (Bexxar®); Tositumomab/I-131 tositumomab (Bexxar®); trans-retinoic acid; Trastuzumab (Herceptin®); tretinoin, ATRA (Vesanoid®); triethylenemelamine; Uracil Mustard (Uracil Mustard Capsules®); valrubicin (Valstar®); vinblastine (Velban®); vincristine (Oncovin®); vinorelbine (Navelbine®); vorinostat (Zolinza®); wortmannin; and zoledronate (Zometa®).
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is in association with one or more antiemetics including, but not limited to: casopitant (GlaxoSmithKline), Netupitant (MGI-Helsinn) and other NK-1 receptor antagonists, palonosetron (sold as Aloxi by MGI Pharma), aprepitant (sold as Emend by Merck and Co.; Rahway, N.J.), diphenhydramine (sold as Benadryl® by Pfizer; New York, N.Y.), hydroxyzine (sold as Atarax® by Pfizer; New York, N.Y.), metoclopramide (sold as Reglan® by AH Robins Co,; Richmond, Va.), lorazepam (sold as Ativan® by Wyeth; Madison, N.J.), alprazolam (sold as Xanax® by Pfizer; New York, N.Y.), haloperidol (sold as Haldol® by Ortho-McNeil; Raritan, N.J.), droperidol (Inapsine®), dronabinol (sold as Marinol® by Solvay Pharmaceuticals, Inc.; Marietta, Ga.), dexamethasone (sold as Decadron® by Merck and Co.; Rahway, N.J.), methylprednisolone (sold as Medrol® by Pfizer; New York, N.Y.), prochlorperazine (sold as Compazine® by Glaxosmithkline; Research Triangle Park, NC), granisetron (sold as Kytril® by Hoffmann-La Roche Inc.; Nutley, N.J.), ondansetron (sold as Zofran® by Glaxosmithkline; Research Triangle Park, NC), dolasetron (sold as Anzemet® by Sanofi-Aventis; New York, N.Y.), tropisetron (sold as Navoban® by Novartis; East Hanover, N.J.).
- Other side effects of cancer treatment include red and white blood cell deficiency. Accordingly, in an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof is in association with an agent which treats or prevents such a deficiency, such as, e.g., filgrastim, PEG-filgrastim, erythropoietin, epoetin alfa or darbepoetin alfa.
- In an embodiment of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention is administered in association with anti-cancer radiation therapy. For example, in an embodiment of the invention, the radiation therapy is external beam therapy (EBT): a method for delivering a beam of high-energy X-rays to the location of the tumor. The beam is generated outside the patient (e.g., by a linear accelerator) and is targeted at the tumor site. These X-rays can destroy the cancer cells and careful treatment planning allows the surrounding normal tissues to be spared. No radioactive sources are placed inside the patient's body. In an embodiment of the invention, the radiation therapy is proton beam therapy: a type of conformal therapy that bombards the diseased tissue with protons instead of X-rays. In an embodiment of the invention, the radiation therapy is conformal external beam radiation therapy: a procedure that uses advanced technology to tailor the radiation therapy to an individual's body structures. In an embodiment of the invention, the radiation therapy is brachytherapy: the temporary placement of radioactive materials within the body, usually employed to give an extra dose—or boost—of radiation to an area.
- In an embodiment of the invention, a surgical procedure is administered in association with an anti-SIRPα antibody or antigen-binding fragment thereof is surgical tumorectomy.
- The anti-SIRPα antibodies and antigen-binding fragments thereof disclosed herein may be used as affinity purification agents. In this process, the anti-SIRPα antibodies and antigen-binding fragments thereof are immobilized on a solid phase such a Sephadex, glass or agarose resin or filter paper, using methods well known in the art. The immobilized antibody or fragment is contacted with a sample containing the SIRPα protein (or a fragment thereof) to be purified, and thereafter the support is washed with a suitable solvent that will remove substantially all the material in the sample except the SIRPα protein, which is bound to the immobilized antibody or fragment. Finally, the support is washed with a solvent which elutes the bound SIRPα (e.g., protein A). Such immobilized antibodies and fragments form part of the present invention.
- Further provided are antigens for generating secondary antibodies which are useful for example for performing Western blots and other immunoassays discussed herein.
- Anti-SIRPα antibodies (e.g., humanized antibodies) and antigen-binding fragments thereof may also be useful in diagnostic assays for SIRPα protein, e.g., detecting its expression in specific cells, tissues, or serum, e.g., myeloid cells such as monocytes, macrophages, neutrophils, basophils, eosinophils, and dendritic cells. Such diagnostic methods may be useful in various disease diagnoses.
- The present invention includes ELISA assays (enzyme-linked immunosorbent assay) incorporating the use of an anti-SIRPα antibody or antigen-binding fragment thereof disclosed herein.
- For example, such a method comprises the following steps:
- (a) coat a substrate (e.g., surface of a microtiter plate well, e.g., a plastic plate) with anti-SIRPα antibody or antigen-binding fragment thereof;
(b) apply a sample to be tested for the presence of SIRPα to the substrate;
(c) wash the plate, so that unbound material in the sample is removed;
(d) apply detectably labeled antibodies (e.g., enzyme-linked antibodies) which are also specific to the SIRPα antigen;
(e) wash the substrate, so that the unbound, labeled antibodies are removed;
(f) if the labeled antibodies are enzyme linked, apply a chemical which is converted by the enzyme into a fluorescent signal; and
(g) detect the presence of the labeled antibody. - Detection of the label associated with the substrate indicates the presence of the SIRPα protein.
- In a further embodiment, the labeled antibody or antigen-binding fragment thereof is labeled with peroxidase which react with ABTS (e.g., 2,2′-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid)) or 3,3′,5,5′-Tetramethylbenzidine to produce a color change which is detectable. Alternatively, the labeled antibody or fragment is labeled with a detectable radioisotope (e.g., 3H) which can be detected by scintillation counter in the presence of a scintillant.
- An anti-SIRPα antibody or antigen-binding fragment thereof of the invention may be used in a Western blot or immune-protein blot procedure. Such a procedure forms part of the present invention and includes e.g.:
-
- (1) optionally transferring proteins from a sample to be tested for the presence of SIRPα (e.g., from a PAGE or SDS-PAGE electrophoretic separation of the proteins in the sample) onto a membrane or other solid substrate using a method known in the art (e.g., semi-dry blotting or tank blotting); contacting the membrane or other solid substrate to be tested for the presence of bound SIRPα or a fragment thereof with an anti-SIRPα antibody or antigen-binding fragment thereof of the invention.
- (2) washing the membrane one or more times to remove unbound anti-SIRPα antibody or fragment and other unbound substances; and
- (3) detecting the bound anti-SIRPα antibody or fragment.
- Such a membrane may take the form of a nitrocellulose or vinyl-based (e.g., polyvinylidene fluoride (PVDF)) membrane to which the proteins to be tested for the presence of SIRPα in a non-denaturing PAGE (polyacrylamide gel electrophoresis) gel or SDS-PAGE (sodium dodecyl sulfate polyacrylamide gel electrophoresis) gel have been transferred (e.g., following electrophoretic separation in the gel). Before contacting the membrane with the anti-SIRPα antibody or fragment, the membrane is optionally blocked, e.g., with non-fat dry milk or the like so as to bind non-specific protein binding sites on the membrane.
- Detection of the bound antibody or fragment indicates that the SIRPα protein is present on the membrane or substrate and in the sample. Detection of the bound antibody or fragment may be by binding the antibody or fragment with a secondary antibody (an anti-immunoglobulin antibody) which is detectably labeled and, then, detecting the presence of the secondary antibody.
- The anti-SIRPα antibodies and antigen-binding fragments thereof disclosed herein may also be used for immunohistochemistry. Such a method forms part of the present invention and comprises, e.g.,
-
- (1) contacting a cell (e.g., a sample containing myeloid cells such as monocytes, macrophages, neutrophils, basophils, eosinophils, and dendritic cells) to be tested for the presence of SIRPα protein with an anti-SIRPα antibody or antigen-binding fragment thereof of the invention; and
- (2) detecting the antibody or fragment on or in the cell.
- If the antibody or fragment itself is detectably labeled, it can be detected directly. Alternatively, the antibody or fragment may be bound by a detectably labeled secondary antibody which is detected.
- Certain anti-SIRPα antibodies and antigen-binding fragments thereof disclosed herein may also be used for in vivo tumor imaging. Such a method may include injection of a radiolabeled anti-SIRPα antibody or antigen-binding fragment thereof into the body of a patient to be tested for the presence of a tumor associated with SIRPα expression (e.g., which expresses SIRPα, for example, on the tumor cell surface) followed by nuclear imaging of the body of the patient to detect the presence of the labeled antibody or fragment e.g., at loci comprising a high concentration of the antibody or fragment which are bound to the tumor. The detection of the loci indicates the presence of the SIRPα+ tumor and tumor cells.
- Imaging techniques include SPECT imaging (single photon emission computed tomography) or PET imaging (positron emission tomography). Labels include e.g., iodine-123 (123I) and technetium-99m (99mTc), e.g., in conjunction with SPECT imaging or 11C, 13N, 15O or 18F, e.g., in conjunction with PET imaging or Indium-111 (See e.g., Gordon et al., (2005) International Rev. Neurobiol. 67:385-440).
- To prepare pharmaceutical or sterile compositions of the anti-SIRPα antibodies and antigen-binding fragments of the invention, the antibody or antigen-binding fragment thereof is admixed with a pharmaceutically acceptable carrier or excipient. See, e.g., Remington's Pharmaceutical Sciences and U.S. Pharmacopeia: National Formulary, Mack Publishing Company, Easton, Pa. (1984).
- Formulations of therapeutic and diagnostic agents may be prepared by mixing with acceptable carriers, excipients, or stabilizers in the form of, e.g., lyophilized powders, slurries, aqueous solutions or suspensions (see, e.g., Hardman, et al. (2001) Goodman and Gilman's The Pharmacological Basis of Therapeutics, McGraw-Hill, New York, N.Y.; Gennaro (2000) Remington: The Science and Practice of Pharmacy, Lippincott, Williams, and Wilkins, New York, N.Y.; Avis, et al. (eds.) (1993) Pharmaceutical Dosage Forms: Parenteral Medications, Marcel Dekker, N.Y.; Lieberman, et al. (eds.) (1990) Pharmaceutical Dosage Forms: Tablets, Marcel Dekker, N.Y.; Lieberman, et al. (eds.) (1990) Pharmaceutical Dosage Forms: Disperse Systems, Marcel Dekker, N.Y.; Weiner and Kotkoskie (2000) Excipient Toxicity and Safety, Marcel Dekker, Inc., New York, N.Y.).
- Toxicity and therapeutic efficacy of the antibodies of the invention, administered alone or in combination with another therapeutic agent, can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD50 (the dose lethal to 50% of the population) and the ED50 (the dose therapeutically effective in 50% of the population). The dose ratio between toxic and therapeutic effects is the therapeutic index (LD50/ED50). The data obtained from these cell culture assays and animal studies can be used in formulating a range of dosage for use in human. The dosage of such compounds lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity. The dosage may vary within this range depending upon the dosage form employed and the route of administration.
- In a further embodiment, a further therapeutic agent that is administered to a subject in association with an anti-SIRPα antibody or antigen-binding fragment thereof of the invention in accordance with the Physicians' Desk Reference 2003 (Thomson Healthcare; 57th edition (Nov. 1, 2002)).
- The mode of administration can vary. Routes of administration include oral, rectal, transmucosal, intestinal, parenteral; intramuscular, subcutaneous, intradermal, intramedullary, intrathecal, direct intraventricular, intravenous, intraperitoneal, intranasal, intraocular, inhalation, insufflation, topical, cutaneous, transdermal, or intra-arterial.
- In particular embodiments, the anti-SIRPα antibodies or antigen-binding fragments thereof of the invention can be administered by an invasive route such as by injection. In further embodiments of the invention, an anti-SIRPα antibody or antigen-binding fragment thereof, or pharmaceutical composition thereof, is administered intravenously, subcutaneously, intramuscularly, intraarterially, intratumorally, or by inhalation, aerosol delivery. Administration by non-invasive routes (e.g., orally; for example, in a pill, capsule or tablet) is also within the scope of the present invention.
- The present invention provides a vessel (e.g., a plastic or glass vial, e.g., with a cap or a chromatography column, hollow bore needle or a syringe cylinder) comprising any of the antibodies or antigen-binding fragments of the invention or a pharmaceutical composition thereof. The present invention also provides an injection device comprising any of the antibodies or antigen-binding fragments of the invention or a pharmaceutical composition thereof. An injection device is a device that introduces a substance into the body of a patient via a parenteral route, e.g., intramuscular, subcutaneous or intravenous. For example, an injection device may be a syringe (e.g., pre-filled with the pharmaceutical composition, such as an auto-injector) which, for example, includes a cylinder or barrel for holding fluid to be injected (e.g., antibody or fragment or a pharmaceutical composition thereof), a needle for piecing skin and/or blood vessels for injection of the fluid; and a plunger for pushing the fluid out of the cylinder and through the needle bore. In an embodiment of the invention, an injection device that comprises an antibody or antigen-binding fragment thereof of the present invention or a pharmaceutical composition thereof is an intravenous (IV) injection device. Such a device includes the antibody or fragment or a pharmaceutical composition thereof in a cannula or trocar/needle which may be attached to a tube which may be attached to a bag or reservoir for holding fluid (e.g., saline; or lactated ringer solution comprising NaCl, sodium lactate, KCl, CaCl2) and optionally including glucose) introduced into the body of the patient through the cannula or trocar/needle. The antibody or fragment or a pharmaceutical composition thereof may, in an embodiment of the invention, be introduced into the device once the trocar and cannula are inserted into the vein of a subject and the trocar is removed from the inserted cannula. The IV device may, for example, be inserted into a peripheral vein (e.g., in the hand or arm); the superior vena cava or inferior vena cava, or within the right atrium of the heart (e.g., a central IV); or into a subclavian, internal jugular, or a femoral vein and, for example, advanced toward the heart until it reaches the superior vena cava or right atrium (e.g., a central venous line). In an embodiment of the invention, an injection device is an autoinjector; a jet injector or an external infusion pump. A jet injector uses a high-pressure narrow jet of liquid which penetrate the epidermis to introduce the antibody or fragment or a pharmaceutical composition thereof to a patient's body. External infusion pumps are medical devices that deliver the antibody or fragment or a pharmaceutical composition thereof into a patient's body in controlled amounts. External infusion pumps may be powered electrically or mechanically. Different pumps operate in different ways, for example, a syringe pump holds fluid in the reservoir of a syringe, and a moveable piston controls fluid delivery, an elastomeric pump holds fluid in a stretchable balloon reservoir, and pressure from the elastic walls of the balloon drives fluid delivery. In a peristaltic pump, a set of rollers pinches down on a length of flexible tubing, pushing fluid forward. In a multi-channel pump, fluids can be delivered from multiple reservoirs at multiple rates.
- The pharmaceutical compositions disclosed herein may also be administered with a needleless hypodermic injection device; such as the devices disclosed in U.S. Pat. Nos. 6,620,135; 6,096,002; 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824 or 4,596,556. Such needleless devices comprising the pharmaceutical composition are also part of the present invention. The pharmaceutical compositions disclosed herein may also be administered by infusion. Examples of well-known implants and modules for administering the pharmaceutical compositions include those disclosed in: U.S. Pat. No. 4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate; U.S. Pat. No. 4,447,233, which discloses a medication infusion pump for delivering medication at a precise infusion rate; U.S. Pat. No. 4,447,224, which discloses a variable flow implantable infusion apparatus for continuous drug delivery; U.S. Pat. No. 4,439,196, which discloses an osmotic drug delivery system having multi-chamber compartments. Many other such implants, delivery systems, and modules are well known to those skilled in the art and those comprising the pharmaceutical compositions of the present invention are within the scope of the present invention.
- Alternately, one may administer the anti-SIRPα antibody or antigen-binding fragment of the invention in a local rather than systemic manner, for example, via injection of the antibody or fragment directly into a tumor. Furthermore, one may administer the antibody or fragment in a targeted drug delivery system, for example, in a liposome coated with a tissue-specific antibody, targeting, for example, a tumor. The liposomes will be targeted to and taken up selectively by the afflicted tissue. Such methods and liposomes are part of the present invention.
- The administration regimen depends on several factors, including the serum or tissue turnover rate of the therapeutic antibody or antigen-binding fragment, the level of symptoms, the immunogenicity of the therapeutic antibody, and the accessibility of the target cells in the biological matrix. Preferably, the administration regimen delivers sufficient therapeutic antibody or fragment to effect improvement in the target disease state, while simultaneously minimizing undesired side effects. Accordingly, the amount of biologic delivered depends in part on the particular therapeutic antibody and the severity of the condition being treated. Guidance in selecting appropriate doses of therapeutic antibodies or fragments is available (see, e.g., Wawrzynczak (1996) Antibody Therapy, Bios Scientific Pub. Ltd, Oxfordshire, UK; Kresina (ed.) (1991) Monoclonal Antibodies, Cytokines and Arthritis, Marcel Dekker, New York, N.Y.; Bach (ed.) (1993) Monoclonal Antibodies and Peptide Therapy in Autoimmune Diseases, Marcel Dekker, New York, N.Y.; Baert, et al. (2003) New Engl. J. Med. 348:601-608; Milgrom et al. (1999) New Engl. J. Med. 341:1966-1973; Slamon et al. (2001) New Engl. J. Med. 344:783-792; Beniaminovitz et al. (2000) New Engl. J. Med. 342:613-619; Ghosh et al. (2003) New Engl. J. Med. 348:24-32; Lipsky et al. (2000) New Engl. J. Med. 343:1594-1602).
- Determination of the appropriate dose is made by the clinician, e.g., using parameters or factors known or suspected in the art to affect treatment. Generally, the dose begins with an amount somewhat less than the optimum dose and it is increased by small increments thereafter until the desired or optimum effect is achieved relative to any negative side effects. Important diagnostic measures include those of symptoms of, e.g., the inflammation or level of inflammatory cytokines produced. In general, it is desirable that a biologic that will be used is derived from the same species as the animal targeted for treatment, thereby minimizing any immune response to the reagent. In the case of human subjects, for example, humanized and fully human antibodies may be desirable.
- Antibodies or antigen-binding fragments thereof disclosed herein may be provided by continuous infusion, or by doses administered, e.g., daily, 1-7 times per week, weekly, bi-weekly, monthly, bimonthly, quarterly, semiannually, annually etc. Doses may be provided, e.g., intravenously, subcutaneously, topically, orally, nasally, rectally, intramuscular, intracerebrally, intraspinally, or by inhalation. A total weekly dose is generally at least 0.05 μg/kg body weight, more generally at least 0.2 μg/kg, 0.5 μg/kg, 1 μg/kg, 10 μg/kg, 100 μg/kg, 0.25 mg/kg, 1.0 mg/kg, 2.0 mg/kg, 5.0 mg/mL, 10 mg/kg, 25 mg/kg, 50 mg/kg or more (see, e.g., Yang, et al. (2003) New Engl. J. Med. 349:427-434; Herold, et al. (2002) New Engl. J. Med. 346:1692-1698; Liu, et al. (1999) J. Neurol. Neurosurg. Psych. 67: 451-456; Portielji, et al. (20003) Cancer Immunol. Immunother. 52: 151-144). Doses may also be provided to achieve a pre-determined target concentration of anti-SIRPα antibody in the subject's serum, such as 0.1, 0.3, 1, 3, 10, 30, 100, 300 μg/mL or more. In other embodiments, An anti-SIRPα antibody of the present invention is administered, e.g., subcutaneously or intravenously, on a weekly, biweekly, “every 4 weeks,” monthly, bimonthly, or quarterly basis at 10, 20, 50, 80, 100, 200, 500, 1000 or 2500 mg/subject.
- As used herein, the term “effective amount” refer to an amount of an anti-SIRPα or antigen-binding fragment thereof of the invention that, when administered alone or in combination with an additional therapeutic agent to a cell, tissue, or subject, is effective to cause a measurable improvement in one or more symptoms of disease, for example cancer or the progression of cancer. An effective dose further refers to that amount of the antibody or fragment sufficient to result in at least partial amelioration of symptoms, e.g., tumor shrinkage or elimination, lack of tumor growth, increased survival time. When applied to an individual active ingredient administered alone, an effective dose refers to that ingredient alone. When applied to a combination, an effective dose refers to combined amounts of the active ingredients that result in the therapeutic effect, whether administered in combination, serially or simultaneously. An effective amount of a therapeutic will result in an improvement of a diagnostic measure or parameter by at least 10%; usually by at least 20%; preferably at least about 30%; more preferably at least 40%, and most preferably by at least 50%. An effective amount can also result in an improvement in a subjective measure in cases where subjective measures are used to assess disease severity.
- Further provided are kits comprising one or more components that include, but are not limited to, an anti-SIRPα antibody or antigen-binding fragment, as discussed herein in association with one or more additional components including, but not limited to a pharmaceutically acceptable carrier and/or a therapeutic agent, as discussed herein. The antibody or fragment and/or the therapeutic agent can be formulated as a pure composition or in combination with a pharmaceutically acceptable carrier, in a pharmaceutical composition.
- In one embodiment, the kit includes an anti-SIRPα antibody or antigen-binding fragment thereof of the invention or a pharmaceutical composition thereof in one container (e.g., in a sterile glass or plastic vial) and/or a therapeutic agent and a pharmaceutical composition thereof in another container (e.g., in a sterile glass or plastic vial).
- In another embodiment, the kit comprises a combination of the invention, including an anti-SIRPα antibody or antigen-binding fragment thereof of the invention along with a pharmaceutically acceptable carrier, optionally in combination with one or more therapeutic agents formulated together, optionally, in a pharmaceutical composition, in a single, common container.
- If the kit includes a pharmaceutical composition for parenteral administration to a subject, the kit can include a device for performing such administration. For example, the kit can include one or more hypodermic needles or other injection devices as discussed above.
- The kit can include a package insert including information concerning the pharmaceutical compositions and dosage forms in the kit. Generally, such information aids patients and physicians in using the enclosed pharmaceutical compositions and dosage forms effectively and safely. For example, the following information regarding a combination of the invention may be supplied in the insert: pharmacokinetics, pharmacodynamics, clinical studies, efficacy parameters, indications and usage, contraindications, warnings, precautions, adverse reactions, overdosage, proper dosage and administration, how supplied, proper storage conditions, references, manufacturer/distributor information and patent information.
- The kit can also comprise a second therapeutic, for example one or more of: anti-CD47 antibody, anti-APRIL antibody, anti-PD-1 antibody (e.g., nivolumab, pembrolizumab, anti-PDL1 antibody, anti-TIGIT antibody, anti-CTLA4 antibody, anti-CS1 antibody (e.g., elotuzumab), anti-KIR2DL1/2/3 antibody (e.g., lirilumab), anti-CD137 antibody (e.g., urelumab), anti-GITR antibody (e.g., TRX518), anti-PD-L1 antibody (e.g., BMS-936559, MSB0010718C or MPDL3280A), anti-PD-L2 antibody, anti-ILT1 antibody, anti-ILT2 antibody, anti-ILT3 antibody, anti-ILT4 antibody, anti-ILT5 antibody, anti-ILT6 antibody, anti-ILT7 antibody, anti-ILT8 antibody, anti-CD40 antibody, anti-OX40 antibody, anti-ICOS, anti-KIR2DL1 antibody, anti-KIR2DL2/3 antibody, anti-KIR2DL4 antibody, anti-KIR2DL5A antibody, anti-KIR2DL5B antibody, anti-KIR3DL1 antibody, anti-KIR3DL2 antibody, anti-KIR3DL3 antibody, anti-NKG2A antibody, anti-NKG2C antibody, anti-NKG2E antibody, anti-4-1BB antibody (e.g., PF-05082566), anti-TSLP antibody, anti-IL-10 antibody, IL-10 or PEGylated IL-10, or any small organic molecule inhibitor of such targets; an antibody or antigen binding fragment thereof binds to an antigen selected from the group consisting of AMHR2, AXL, BCMA, CA IX, CD4, CD16, CD19, CD20, CD22, CD30, CD37, CD38, CD40, CD52, CD98, CSF1R, GD2, CCR4, CS1, EpCam, EGFR, EGFRvIII, Endoglin, EPHA2, EphA3, FGFR2b, folate receptor alpha, fucosyl-GM1, HER2, HER3, IL1RAP, kappa myeloma antigen, MS4A1, prolactin receptor, TA-MUC1, and PSMA; Rituximab, ublituximab, margetuximab, IMGN-529, SCT400, veltuzumab, Obinutuzumab, ADCT-502, Hul4.18K322A, Hu3F8, Dinituximab, Trastuzumab, Cetuximab, Rituximab-RLI, c.60C3-RLI, Hul4.18-IL2, KM2812, AFM13, and (CD20)2×CD16, erlotinib (Tarceva), daratumumab, alemtuzumab, pertuzumab, brentuximab, elotuzumab, ibritumomab, ifabotuzumab, farletuzumab, otlertuzumab, carotuximab, epratuzumab, inebilizumab, lumretuzumab, 4G7SDIE, AFM21, AFM22, LY-3022855, SNDX-6352, AFM-13, BI-836826, BMS-986012, BVX-20, mogamulizumab, ChiLob-7/4, leukotuximab, isatuximab, DS-8895, FPA144, GM102, GSK-2857916, IGN523, IT1208, ADC-1013, CAN-04, XOMA-213, PankoMab-GEX, chKM-4927, IGN003, IGN004, IGN005, MDX-1097, MOR202, MOR-208, oportuzumab, ensituximab, vedotin (Adcetris), ibritumomab tiuxetan, ABBV-838, HuMax-AXL-ADC, and ado-trastuzumab emtansine (Kadcyla); radiotherapy or chemotherapeutic agents including, but not limited to Anthracyclines (Doxorubicin, Epirubicin, Daunorubicin, Idarubicin, Mitoxantrone), Oxaliplatin, Bortezomib, Cyclophosphamide, Bleomycin, Vorinostat, Paclitaxel, 5-Fluorouracil, Cytarabine, Prednisolone, Docetaxel, Mitomycin C, Topotecan/Camptothecin, Etoposide, Zoledronic acid, Methotrexate, Ibrutinib, Aflibercept, Bevacizumab, Toremifene, Vinblastine, Vincristine, Idelalisib, Mercaptopurine, Thalidomide, Sorafenib; a cyclic dinculeotide or other STING pathway agonist; etc.
- As a matter of convenience, an anti-SIRPα antibody or antigen-binding fragment thereof of the invention can be provided in a kit, i.e., a packaged combination of reagents in predetermined amounts with instructions for performing the diagnostic or detection assay. Where the antibody or fragment is labeled with an enzyme, the kit will include substrates and cofactors required by the enzyme (e.g., a substrate precursor which provides the detectable chromophore or fluorophore). In addition, other additives may be included such as stabilizers, buffers (e.g., a block buffer or lysis buffer) and the like. The relative amounts of the various reagents may be varied widely to provide for concentrations in solution of the reagents which substantially optimize the sensitivity of the assay. Particularly, the reagents may be provided as dry powders, usually lyophilized, including excipients which on dissolution will provide a reagent solution having the appropriate concentration.
- Also provided are diagnostic or detection reagents and kits comprising one or more such reagents for use in a variety of detection assays, including for example, immunoassays such as ELISA (sandwich-type or competitive format). The kit's components may be pre-attached to a solid support, or may be applied to the surface of a solid support when the kit is used. In some embodiments of the invention, the signal generating means may come pre-associated with an antibody or fragment of the invention or may require combination with one or more components, e.g., buffers, antibody-enzyme conjugates, enzyme substrates, or the like, prior to use. Kits may also include additional reagents, e.g., blocking reagents for reducing nonspecific binding to the solid phase surface, washing reagents, enzyme substrates, and the like. The solid phase surface may be in the form of a tube, a bead, a microtiter plate, a microsphere, or other materials suitable for immobilizing proteins, peptides, or polypeptides. In particular aspects, an enzyme that catalyzes the formation of a chemilluminescent or chromogenic product or the reduction of a chemilluminescent or chromogenic substrate is a component of the signal generating means. Such enzymes are well known in the art. Kits may comprise any of the capture agents and detection reagents described herein. Optionally the kit may also comprise instructions for carrying out the methods of the invention.
- Also provided is a kit comprising an anti-SIRPα antibody (e.g., humanized antibody) or antigen-binding fragment thereof packaged in a container, such as a vial or bottle, and further comprising a label attached to or packaged with the container, the label describing the contents of the container and providing indications and/or instructions regarding use of the contents of the container to treat one or more disease states as described herein.
- In one aspect, the kit is for treating cancer and comprises an anti-SIRPα antibody (e.g., humanized antibody) or antigen-binding fragment thereof and a further therapeutic agent or a vaccine. The kit may optionally further include a syringe for parenteral, e.g., intravenous, administration. In another aspect, the kit comprises an anti-SIRPα antibody (e.g., humanized antibody) or antigen-binding fragment thereof and a label attached to or packaged with the container describing use of the antibody or fragment with the vaccine or further therapeutic agent. In yet another aspect, the kit comprises the vaccine or further therapeutic agent and a label attached to or packaged with the container describing use of the vaccine or further therapeutic agent with the anti-SIRPα antibody or fragment. In certain embodiments, an anti-SIRPα antibody and vaccine or further therapeutic agent are in separate vials or are combined together in the same pharmaceutical composition.
- As discussed above in the combination therapy section, concurrent administration of two therapeutic agents does not require that the agents be administered at the same time or by the same route, as long as there is an overlap in the time period during which the agents are exerting their therapeutic effect. Simultaneous or sequential administration is contemplated, as is administration on different days or weeks.
- The therapeutic and detection kits disclosed herein may also be prepared that comprise at least one of the antibody, peptide, antigen-binding fragment, or polynucleotide disclosed herein and instructions for using the composition as a detection reagent or therapeutic agent. Containers for use in such kits may typically comprise at least one vial, test tube, flask, bottle, syringe or other suitable container, into which one or more of the detection and/or therapeutic composition(s) may be placed, and preferably suitably aliquoted. Where a second therapeutic agent is also provided, the kit may also contain a second distinct container into which this second detection and/or therapeutic composition may be placed. Alternatively, a plurality of compounds may be prepared in a single pharmaceutical composition, and may be packaged in a single container means, such as a vial, flask, syringe, bottle, or other suitable single container. The kits disclosed herein will also typically include a means for containing the vial(s) in close confinement for commercial sale, such as, e.g., injection or blow-molded plastic containers into which the desired vial(s) are retained. Where a radiolabel, chromogenic, fluorigenic, or other type of detectable label or detecting means is included within the kit, the labeling agent may be provided either in the same container as the detection or therapeutic composition itself, or may alternatively be placed in a second distinct container means into which this second composition may be placed and suitably aliquoted. Alternatively, the detection reagent and the label may be prepared in a single container means, and in most cases, the kit will also typically include a means for containing the vial(s) in close confinement for commercial sale and/or convenient packaging and delivery.
- A device or apparatus for carrying out the detection or monitoring methods described herein is also provided. Such an apparatus may include a chamber or tube into which sample can be input, a fluid handling system optionally including valves or pumps to direct flow of the sample through the device, optionally filters to separate plasma or serum from blood, mixing chambers for the addition of capture agents or detection reagents, and optionally a detection device for detecting the amount of detectable label bound to the capture agent immunocomplex. The flow of sample may be passive (e.g., by capillary, hydrostatic, or other forces that do not require further manipulation of the device once sample is applied) or active (e.g., by application of force generated via mechanical pumps, electroosmotic pumps, centrifugal force, or increased air pressure), or by a combination of active and passive forces.
- In further embodiments, also provided is a processor, a computer readable memory, and a routine stored on the computer readable memory and adapted to be executed on the processor to perform any of the methods described herein. Examples of suitable computing systems, environments, and/or configurations include personal computers, server computers, hand-held or laptop devices, multiprocessor systems, microprocessor-based systems, set top boxes, programmable consumer electronics, network PCs, minicomputers, mainframe computers, distributed computing environments that include any of the above systems or devices, or any other systems known in the art.
-
Embodiment 1. An antibody or antigen binding fragment thereof that binds to human SIRPα, wherein the antibody or antigen binding fragment comprises one or more, and optionally each, of: -
- a. a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO:69 or an amino acid sequence differing from SEQ ID NO: 1 by 1, 2, or 3 conservative substitutions,
- b. a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO:70 or an amino acid sequence differing from SEQ ID NO: 2 by 1, 2, or 3 conservative substitutions,
- c. a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO:71 or an amino acid sequence differing from SEQ ID NO: 3 by 1, 2, or 3 conservative substitutions,
- d. a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO:72 or an amino acid sequence differing from SEQ ID NO: 4 by 1, 2, or 3 conservative substitutions,
- e. a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO:73 or an amino acid sequence differing from SEQ ID NO: 5 by 1, 2, or 3 conservative substitutions, and
- f. a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO:74 or an amino acid sequence differing from SEQ ID NO: 6 by 1, 2, or 3 conservative substitutions.
or wherein the antibody or antigen binding fragment comprises one or more, and optionally each, of: - g. a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO:1 or an amino acid sequence differing from SEQ ID NO: 1 by 1, 2, or 3 conservative substitutions,
- h. a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO:2 or an amino acid sequence differing from SEQ ID NO: 2 by 1, 2, or 3 conservative substitutions,
- i. a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO:3 or an amino acid sequence differing from SEQ ID NO: 3 by 1, 2, or 3 conservative substitutions,
- j. a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO:4 or an amino acid sequence differing from SEQ ID NO: 4 by 1, 2, or 3 conservative substitutions,
- k. a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO:5 or an amino acid sequence differing from SEQ ID NO: 5 by 1, 2, or 3 conservative substitutions, and
- l. a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO:6 or an amino acid sequence differing from SEQ ID NO: 6 by 1, 2, or 3 conservative substitutions.
-
Embodiment 2. The antibody or antigen binding fragment ofembodiment 1, wherein the antibody or antigen binding fragment comprises -
- each of a heavy chain sequence comprising the amino acid sequence of SEQ ID NO:69 or an amino acid sequence differing from SEQ ID NO: 69 by 1, 2, or 3 conservative substitutions; the amino acid sequence of SEQ ID NO:70 or an amino acid sequence differing from SEQ ID NO: 70 by 1, 2, or 3 conservative substitutions; and the amino acid sequence of SEQ ID NO: 71 or an amino acid sequence differing from SEQ ID NO: 71 by 1, 2, or 3 conservative substitutions;
and/or - each of a light chain sequence comprising the amino acid sequence of SEQ ID NO: 72 or an amino acid sequence differing from SEQ ID NO: 72 by 1, 2, or 3 conservative substitutions; the amino acid sequence of SEQ ID NO: 73 or an amino acid sequence differing from SEQ ID NO: 73 by 1, 2, or 3 conservative substitutions; and the amino acid sequence of SEQ ID NO: 74 or an amino acid sequence differing from SEQ ID NO: 74 by 1, 2, or 3 conservative substitutions;
or wherein the antibody or antigen binding fragment comprises - each of a heavy chain sequence comprising the amino acid sequence of SEQ ID NO:1 or an amino acid sequence differing from SEQ ID NO: 1 by 1, 2, or 3 conservative substitutions; the amino acid sequence of SEQ ID NO:2 or an amino acid sequence differing from SEQ ID NO: 2 by 1, 2, or 3 conservative substitutions; and the amino acid sequence of SEQ ID NO:3 or an amino acid sequence differing from SEQ ID NO: 3 by 1, 2, or 3 conservative substitutions;
and/or - each of a light chain sequence comprising the amino acid sequence of SEQ ID NO:4 or an amino acid sequence differing from SEQ ID NO: 4 by 1, 2, or 3 conservative substitutions; the amino acid sequence of SEQ ID NO:5 or an amino acid sequence differing from SEQ ID NO: 5 by 1, 2, or 3 conservative substitutions; and the amino acid sequence of SEQ ID NO:6 or an amino acid sequence differing from SEQ ID NO: 6 by 1, 2, or 3 conservative substitutions.
- each of a heavy chain sequence comprising the amino acid sequence of SEQ ID NO:69 or an amino acid sequence differing from SEQ ID NO: 69 by 1, 2, or 3 conservative substitutions; the amino acid sequence of SEQ ID NO:70 or an amino acid sequence differing from SEQ ID NO: 70 by 1, 2, or 3 conservative substitutions; and the amino acid sequence of SEQ ID NO: 71 or an amino acid sequence differing from SEQ ID NO: 71 by 1, 2, or 3 conservative substitutions;
-
Embodiment 3. The antibody or antigen binding fragment ofembodiment 2, wherein the antibody or antigen binding fragment comprises one or both of: -
- a heavy chain variable region comprising an amino acid sequence selected from the group consisting of:
- SEQ ID NO: 75 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- SEQ ID NO: 78 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- SEQ ID NO: 80 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- SEQ ID NO: 82 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- SEQ ID NO: 84 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- SEQ ID NO: 86 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- SEQ ID NO: 88 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto, and
- SEQ ID NO: 102 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto;
and
- a light chain variable region comprising an amino acid sequence selected from the group consisting of:
- SEQ ID NO: 76 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- SEQ ID NO: 90 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- SEQ ID NO: 92 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- SEQ ID NO: 94 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- SEQ ID NO: 96 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- SEQ ID NO: 98 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- SEQ ID NO: 100 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto, and
- SEQ ID NO: 104 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto;
or wherein the antibody or antigen binding fragment comprises one or both of:
- a heavy chain variable region comprising an amino acid sequence selected from the group consisting of:
- SEQ ID NO: 7 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- SEQ ID NO: 10 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- SEQ ID NO: 12 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- SEQ ID NO: 14 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- SEQ ID NO: 16 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- SEQ ID NO: 18 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto, and
- SEQ ID NO: 30 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto;
and
- a light chain variable region comprising an amino acid sequence selected from the group consisting of:
- SEQ ID NO: 8 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- SEQ ID NO: 20 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- SEQ ID NO: 22 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- SEQ ID NO: 24 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- SEQ ID NO: 26 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto, and
- SEQ ID NO: 28 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto, and
- SEQ ID NO: 32 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- a heavy chain variable region comprising an amino acid sequence selected from the group consisting of:
-
Embodiment 4. The antibody or antigen binding fragment ofembodiment 3, wherein the antibody or fragment thereof has the following characteristics: -
- binds to a cell expressing human SIRPαV1 protein with an EC50<10 nM, preferably <5 nM, more preferably <1.5 nM, still more preferably <1.0 nM, even more preferably <0.5 nM, and most preferably about 0.3 nM or less;
- binds to a cell expressing human SIRPαV2 protein with an EC50<10 nM, preferably <5 nM, more preferably <1.5 nM, still more preferably <1.0 nM, even more preferably <0.5 nM, and most preferably about 0.3 nM or less;
- does not appreciably bind to SIRPβ1 protein at an antibody concentration of 50 nM, preferably 67 nM, and more preferably 100 nM; or alternatively at a concentration that is 10-fold greater, preferably 50-fold greater, more preferably 100-fold greater, and still more preferably 200-fold greater than the antibody's EC50 for SIRPαV1 or SIRPαV2;
- inhibits binding between human SIRPα and CD47 with an IC50<10.0 nM, more preferably <5.0 nM, still more preferably <2.5 nM, and most preferably about 1.0 nM or less; and
- exhibits a T20 “humanness” score of at least 79, and more preferably 85.
- Embodiment 5. The antibody or antigen binding fragment of
embodiment 1, wherein the antibody or antigen binding fragment thereof comprises one of the following combinations of heavy chain sequence/light chain sequence: - or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID.
- Embodiment 6. The antibody or antigen binding fragment of one of embodiments 1-5, wherein the antibody is an intact IgG.
- Embodiment 7. The antibody or antigen binding fragment of one of embodiments 1-6, wherein the antibody comprises a wild-type or mutated IgG2 Fc region.
-
Embodiment 8. The antibody or antigen binding fragment of one of embodiments 1-6, wherein the antibody comprises a mutated IgG1 Fc region. - Embodiment 9. The antibody or antigen binding fragment of one of embodiments 1-6, wherein the antibody comprises a mutated IgG4 Fc region.
-
Embodiment 10. An antibody or antigen binding fragment thereof that binds to the same epitope of human SIRPα as an antibody as an antibody according to embodiment 5. - Embodiment 11. The antibody or antigen binding fragment of any of embodiments 1-10, wherein the antibody or antigen binding fragment is humanized.
-
Embodiment 12. The antibody or antigen binding fragment of any of embodiments 1-11 that is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 10 and each light chain comprises SEQ ID NO: 20. - Embodiment 13. The antibody or antigen binding fragment of any of embodiments 1-11 that is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 16 and each light chain comprises SEQ ID NO: 28.
- Embodiment 14. The antibody or antigen binding fragment of any of embodiments 1-11 that is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 18 and each light chain comprises SEQ ID NO: 20.
- Embodiment 15. The antibody or antigen binding fragment of any of embodiments 1-11 that is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 80 and each light chain comprises SEQ ID NO: 90.
- Embodiment 16. The antibody or antigen binding fragment of any of embodiments 1-11 that is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 80 and each light chain comprises SEQ ID NO: 92.
- Embodiment 17. The antibody or antigen binding fragment of any of embodiments 1-11 that is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 80 and each light chain comprises SEQ ID NO: 95.
- Embodiment 18. The antibody or antigen binding fragment of any one of embodiments 1-17 that comprises a glycosylation pattern characteristic of expression by a mammalian cell, and optionally is glycosylated by expression from a CHO cell.
- Embodiment 19. An isolated polypeptide comprising the amino acid sequence of any one of SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 76, 90, 92, 94, 96, 98, 100, 102, 104, 7, 10, 12, 14, 16, 18, 30, 8, 20, 22, 24, 26, 28, and 32, or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
-
Embodiment 20. An isolated nucleic acid encoding any one of the antibodies or antigen binding fragments of embodiments 1-18, or any one of the polypeptides of embodiment 19. - Embodiment 21. An isolated nucleic acid of
embodiment 20 comprising: -
- a nucleic acid sequence of SEQ ID NO: 77 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 79 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 81 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 83 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 85 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 87 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 101 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 89 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 91 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 93 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 95 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 97 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 99 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 103 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 9 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 11 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 13 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 15 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 17 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 29 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 19 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 21 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 23 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 25 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,
- a nucleic acid sequence of SEQ ID NO: 27 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto, and/or
- a nucleic acid sequence of SEQ ID NO: 31 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- Embodiment 22. An expression vector comprising the isolated nucleic acid of
embodiment 20 or 21. - Embodiment 23. An expression vector of embodiment 22, encoding both a heavy chain sequence and a light chain sequence of an anti-SIRPα antibody, the expression vectors comprising the following a first nucleic acid sequence/second nucleic acid sequence selected from the group consisting of:
- or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO.
- Embodiment 24. A host cell comprising expression vector of embodiment 22 or 23.
- Embodiment 25. A host cell of embodiment 24 which produces a full length anti-SIRPα antibody.
- Embodiment 26. The host cell of one of embodiments 24 or 25, which is a bacterial cell, a human cell, a mammalian cell, a Pichia cell, a plant cell, an HEK293 cell, or a Chinese hamster ovary cell.
- Embodiment 27. A composition comprising the antibody or antigen binding fragment of any one of embodiments 1-18 and a pharmaceutically acceptable carrier or diluent.
- Embodiment 28. The composition of embodiment 27, further comprising a second antibody or antigen binding fragment thereof that induces ADCC and/or ADCP, wherein said antibody or antigen binding fragment of the invention enhances the antibody-mediated destruction of cells by the second antibody.
- Embodiment 29. The composition according to embodiment 28, wherein the second antibody or antigen binding fragment thereof binds to an antigen selected from the group consisting of AMHR2, AXL, BCMA, CA IX, CD4, CD16, CD19, CD20, CD22, CD30, CD37, CD38, CD40, CD52, CD98, CSF1R, GD2, CCR4, CS1, EpCam, EGFR, EGFRvIII, Endoglin, EPHA2, EphA3, FGFR2b, folate receptor alpha, fucosyl-GM1, HER2, HER3, IL1RAP, kappa myeloma antigen, MS4A1, prolactin receptor, TA-MUC1, and PSMA.
-
Embodiment 30. The composition according to embodiment 29, wherein the second antibody or antigen binding fragment thereof is selected from the group consisting of Rituximab, ublituximab, margetuximab, IMGN-529, SCT400, veltuzumab, Obinutuzumab, ADCT-502, Hul4.18K322A, Hu3F8, Dinituximab, Trastuzumab, Cetuximab, Rituximab-RLI, c.60C3-RLI, Hul4.18-IL2, KM2812, AFM13, (CD20)2xCD16, erlotinib (Tarceva), daratumumab, alemtuzumab, pertuzumab, brentuximab, elotuzumab, ibritumomab, ifabotuzumab, farletuzumab, otlertuzumab, carotuximab, epratuzumab, inebilizumab, lumretuzumab, 4G7SDIE, AFM21, AFM22, LY-3022855, SNDX-6352, AFM-13, BI-836826, BMS-986012, BVX-20, mogamulizumab, ChiLob-7/4, leukotuximab, isatuximab, DS-8895, FPA144, GM102, GSK-2857916, IGN523, IT1208, ADC-1013, CAN-04, XOMA-213, PankoMab-GEX, chKM-4927, IGN003, IGN004, IGN005, MDX-1097, MOR202, MOR-208, oportuzumab, ensituximab, vedotin (Adcetris), ibritumomab tiuxetan, ABBV-838, HuMax-AXL-ADC, and ado-trastuzumab emtansine (Kadcyla). - Embodiment 31. The composition according to embodiment 28, wherein the second antibody or antigen binding fragment thereof induces ADCP.
- Embodiment 32. The composition according to embodiment 31, wherein the second antibody or antigen binding fragment thereof is selected from the group consisting of Rituximab, ublituximab, margetuximab, IMGN-529, SCT400, veltuzumab, Obinutuzumab, Trastuzumab, Cetuximab, alemtuzumab, ibritumomab, farletuzumab, inebilizumab, lumretuzumab, 4G7SDIE, BMS-986012, BVX-20, mogamulizumab, ChiLob-7/4, GM102, GSK-2857916, PankoMab-GEX, chKM-4927, MDX-1097, MOR202, and MOR-208.
- Embodiment 33. The composition of embodiment 27, further comprising one or more agents selected from the group consisting of anti-CD27 antibody, anti-CD47 antibody, anti-APRIL antibody, anti-PD-1 antibody, anti-PD-L1 antibody, anti-TIGIT antibody, anti-CTLA4 antibody, anti-CS1 antibody, anti-KIR2DL1/2/3 antibody, anti-CD137 antibody, anti-GITR antibody, anti-PD-L2 antibody, anti-ILT1 antibody, anti-ILT2 antibody, anti-ILT3 antibody, anti-ILT4 antibody, anti-ILT5 antibody, anti-ILT6 antibody, anti-ILT7 antibody, anti-ILT8 antibody, anti-CD40 antibody, anti-OX40 antibody, anti-ICOS, anti-KIR2DL1 antibody, anti-KIR2DL2/3 antibody, anti-KIR2DL4 antibody, anti-KIR2DL5A antibody, anti-KIR2DL5B antibody, anti-KIR3DL1 antibody, anti-KIR3DL2 antibody, anti-KIR3DL3 antibody, anti-NKG2A antibody, anti-NKG2C antibody, anti-NKG2E antibody, anti-4-1BB antibody, anti-TSLP antibody, anti-IL-10 antibody, IL-10 PEGylated IL-10, an agonist (e.g., an agonistic antibody or antigen-binding fragment thereof, or a soluble fusion) of a TNF receptor protein, an Immunoglobulin-like protein, a cytokine receptor, an integrin, a signaling lymphocytic activation molecules (SLAM proteins), an activating NK cell receptor, a Toll like receptor, OX40, CD2, CD7, CD27, CD28, CD30, CD40, ICAM-1, LFA-1 (CD1 1a/CD18), 4-1BB (CD137), B7-H3, ICOS (CD278), GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD19, CD4, CD8alpha, CD8beta, IL2R beta, IL2R gamma, IL7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD1 1d, ITGAE, CD103, ITGAL, ITGAM, CD1 1b, ITGAX, CD1 1c, ITGB1, CD29, ITGB2, CD18, ITGB7, NKG2D, NKG2C, TNFR2, TRANCE/RANKL, DNAM1 (CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1, CRTAM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), SLAM7, BLAME (SLAMF8), SELPLG (CD162), LTBR, LAT, GADS, PAG/Cbp, CD19a, a ligand that specifically binds with CD83, inhibitor of CD47, an inhibitor of PD-1, an an inhibitor of PD-L1, an inhibitor of PD-L2, an inhibitor of CTLA4, an inhibitor of TIM3, an inhibitor of LAGS, an inhibitor of CEACAM (e.g., CEACAM-1, -3 and/or -5), an inhibitor of VISTA, an inhibitor of BTLA, an inhibitor of TIGIT, an inhibitor of LAIR1, an inhibitor of IDO, an inhibitor of TDO, an inhibitor of CD160 an inhibitor of TGFR beta, and a cyclic dinculeotide or other STING pathway agonist.
- Embodiment 34. A method of producing an antibody or antigen binding fragment comprising:
-
- culturing a host cell comprising a polynucleotide encoding the heavy chain and/or the light chain of any one of the antibodies or antigen binding fragments of embodiments 1-18 under conditions favorable to expression of the polynucleotide; and optionally, recovering the antibody or antigen binding fragment from the host cell and/or culture medium.
- Embodiment 35. A method for detecting the presence of a SIRPα peptide or a fragment thereof in a sample comprising contacting the sample with an antibody or fragment of any of embodiments 1-18 and detecting the presence of a complex between the antibody or fragment and the peptide; wherein detection of the complex indicates the presence of the SIRPα peptide.
- Embodiment 36. An antibody or antigen binding fragment according to any one of embodiments 1-18 or a composition according to any one of embodiments 21-25, for the treatment of cancer or an infectious disease.
- Embodiment 37. An antibody or antigen binding fragment of embodiments 1-18 or a composition according to any one of embodiments 27-33 for decreasing SIRPα/CD47 signalling in a human subject.
- Embodiment 38. A method of treating cancer in a human subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment of any one of embodiments 1-18, or an expression vector according to one of embodiments 22 or 23, or a host cell according to one of embodiments 24-26, or a composition according one of embodiments 27-33, optionally in association with a further therapeutic agent or therapeutic procedure.
- Embodiment 39. A method of treating cancer in a human subject, comprising:
- administering to the subject an effective amount of
(i) an antibody or antigen binding fragment thereof that induces ADCC and/or ADCP; and
(ii) an antibody or antigen binding fragment of any one of embodiments 1-18, or an expression vector according to one of embodiments 22 or 23, or a host cell according to one of embodiments 24-26, or a composition according one of embodiments 27-33, optionally in association with a further therapeutic agent or therapeutic procedure,
wherein the administration of (ii) enhances the antibody-mediated destruction of cells by the antibody or antigen binding fragment thereof that induces ADCC and/or ADCP. -
Embodiment 40. The method according to embodiment 39, wherein the antibody or antigen binding fragment thereof that induces ADCC and/or ADCP binds to an antigen selected from the group consisting of AMHR2, AXL, BCMA, CA IX, CD4, CD16, CD19, CD20, CD22, CD30, CD37, CD38, CD40, CD52, CD98, CSF1R, GD2, CCR4, CS1, EpCam, EGFR, EGFRvIII, Endoglin, EPHA2, EphA3, FGFR2b, folate receptor alpha, fucosyl-GM1, HER2, HER3, IL1RAP, kappa myeloma antigen, MS4A1, prolactin receptor, TA-MUC1, and PSMA. - Embodiment 41. The method according to
embodiment 40, wherein the antibody or antigen binding fragment thereof that induces ADCC and/or ADCP is selected from the group consisting of Rituximab, ublituximab, margetuximab, IMGN-529, SCT400, veltuzumab, Obinutuzumab, ADCT-502, Hul4.18K322A, Hu3F8, Dinituximab, Trastuzumab, Cetuximab, Rituximab-RLI, c.60C3-RLI, Hul4.18-IL2, KM2812, AFM13, (CD20)2xCD16, erlotinib (Tarceva), daratumumab, alemtuzumab, pertuzumab, brentuximab, elotuzumab, ibritumomab, ifabotuzumab, farletuzumab, otlertuzumab, carotuximab, epratuzumab, inebilizumab, lumretuzumab, 4G7SDIE, AFM21, AFM22, LY-3022855, SNDX-6352, AFM-13, BI-836826, BMS-986012, BVX-20, mogamulizumab, ChiLob-7/4, leukotuximab, isatuximab, DS-8895, FPA144, GM102, GSK-2857916, IGN523, IT1208, ADC-1013, CAN-04, XOMA-213, PankoMab-GEX, chKM-4927, IGN003, IGN004, IGN005, MDX-1097, MOR202, MOR-208, oportuzumab, ensituximab, vedotin (Adcetris), ibritumomab tiuxetan, ABBV-838, HuMax-AXL-ADC, and ado-trastuzumab emtansine (Kadcyla). - Embodiment 42. The method according to
embodiment 39 or 40, wherein the second antibody or antigen binding fragment thereof induces ADCP. -
Embodiment 43. The method according to embodiment 42, wherein the second antibody or antigen binding fragment thereof is selected from the group consisting of Rituximab, ublituximab, margetuximab, IMGN-529, SCT400, veltuzumab, Obinutuzumab, Trastuzumab, Cetuximab, alemtuzumab, ibritumomab, farletuzumab, inebilizumab, lumretuzumab, 4G7SDIE, BMS-986012, BVX-20, mogamulizumab, ChiLob-7/4, GM102, GSK-2857916, PankoMab-GEX, chKM-4927, MDX-1097, MOR202, and MOR-208. - Embodiment 44. A method of treating an infection or infectious disease in a human subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment of any one of embodiments 1-18, or an expression vector according to one of embodiments 22 or 23, or a host cell according to one of embodiments 24-26, or a composition according one of embodiments 27-33, optionally in association with a further therapeutic agent or therapeutic procedure.
- Embodiment 45. An antibody having one or more of the following characteristics:
-
- binds human SIRPαV1 protein having the sequence of SEQ ID NO: 34 with an EC50<1 nM; exhibits at least a 100-fold higher EC50 for SIRPαV1(P74A) having the sequence of SEQ ID NO: 62; and exhibits at least a 100-fold higher EC50 for human SIRPβ1 protein having the sequence of SEQ ID NO: 38, preferably when measured by cellular ELISA;
- binds to a cell expressing human SIRPαV1 protein with an EC50<10 nM, preferably <5 nM, more preferably <1.5 nM, still more preferably <1.0 nM, even more preferably <0.5 nM, and most preferably about 0.3 nM or less;
- binds to a cell expressing human SIRPαV2 protein with an EC50<10 nM, preferably <5 nM, more preferably <1.5 nM, still more preferably <1.0 nM, even more preferably <0.5 nM, and most preferably about 0.3 nM or less;
- does not appreciably bind to SIRPβ1 protein at an antibody concentration of 50 nM, preferably 67 nM, and more preferably 100 nM; or alternatively at a concentration that is 10-fold greater, preferably 50-fold greater, more preferably 100-fold greater, and still more preferably 200-fold greater than the antibody's EC50 for SIRPαV1 or SIRPαV2;
- inhibits binding between human SIRPα and CD47 with an IC50<10.0 nM, more preferably <5.0 nM, still more preferably <2.5 nM, and most preferably about 1.0 nM or less; and
- exhibits a T20 “humanness” score of at least 79, and more preferably 85.
- Embodiment 46. The antibody or antigen binding fragment of embodiment 45 that binds human SIRPαV1 protein having the sequence of SEQ ID NO: 34 with an EC50<1 nM; exhibits at least a 100-fold higher EC50 for SIRPαV1(P74A) having the sequence of SEQ ID NO: 62; and exhibits at least a 100-fold higher EC50 for human SIRPβ1 protein having the sequence of SEQ ID NO: 38.
- Embodiment 47. The antibody or antigen binding fragment of embodiment 45 or 46 that comprises one or two light chains comprising SEQ ID NO: 20 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto and one or two heavy chains comprising SEQ ID NO: 10 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- Embodiment 48. The antibody or antigen binding fragment of embodiment 45 or 46 that comprises one or two light chains comprising SEQ ID NO: 28 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto and one or two heavy chains comprising SEQ ID NO: 16 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- Embodiment 49. The antibody or antigen binding fragment of embodiment 45 or 46 that comprises one or two light chains comprising SEQ ID NO: 20 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto and and one or two heavy chains comprising SEQ ID NO: 18 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
-
Embodiment 50. The antibody or antigen binding fragment of embodiment 45 or 46 that comprises one or two light chains comprising SEQ ID NO: 90 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto and one or two heavy chains comprising SEQ ID NO: 80 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto. - Embodiment 51. The antibody or antigen binding fragment of embodiment 45 or 46 that comprises one or two light chains comprising SEQ ID NO: 92 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto and one or two heavy chains comprising SEQ ID NO: 80 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- Embodiment 52. The antibody or antigen binding fragment of embodiment 45 or 46 that comprises one or two light chains comprising SEQ ID NO: 96 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto and and one or two heavy chains comprising SEQ ID NO: 80 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.
- Embodiment 53. The antibody or antigen binding fragment of one of embodiments 45-52, wherein the antibody is an intact IgG.
- Embodiment 54. The antibody or antigen binding fragment of one of embodiments 45-52, wherein the antibody comprises a wild-type or mutated IgG2 Fc region.
- Embodiment 55. The antibody or antigen binding fragment of one of embodiments 45-52, wherein the antibody comprises a mutated IgG1 Fc region.
- Embodiment 56. The antibody or antigen binding fragment of one of embodiments 45-52, wherein the antibody comprises a mutated IgG4 Fc region.
- Embodiment 57. An antibody or antigen binding fragment thereof that binds to the same epitope of human SIRPα as an antibody as an antibody according to one of embodiments 45-52.
- Embodiment 58. The antibody or antigen binding fragment of any of embodiments 45-52, wherein the antibody or antigen binding fragment is humanized.
- Embodiment 59. A composition comprising the antibody or antigen binding fragment of any one of embodiments 45-52 and a pharmaceutically acceptable carrier or diluent.
-
Embodiment 60. An antibody or antigen binding fragment according to any one of embodiments 45-52 or a composition according to embodiment 59, for the treatment of cancer or an infectious disease. - Embodiment 61. An antibody or antigen binding fragment according to any one of embodiments 45-52 or a composition according to embodiment 59 for decreasing SIRPα/CD47 signalling in a human subject.
- Embodiment 62. A method of treating cancer in a human subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment according to any one of embodiments 45-52 or a composition according to embodiment 59, optionally in association with a further therapeutic agent or therapeutic procedure.
- Embodiment 63. A method of treating an infection or infectious disease in a human subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment according to any one of embodiments 45-52 or a composition according to embodiment 59, optionally in association with a further therapeutic agent or therapeutic procedure.
- Standard methods in molecular biology are described Sambrook, Fritsch and Maniatis (1982 & 1989 2nd Edition, 2001 3rd Edition) Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Sambrook and Russell (2001) Molecular Cloning, 3rd ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Wu (1993) Recombinant DNA, Vol. 217, Academic Press, San Diego, Calif.). Standard methods also appear in Ausbel, et al. (2001) Current Protocols in Molecular Biology, Vols. 1-4, John Wiley and Sons, Inc. New York, N.Y., which describes cloning in bacterial cells and DNA mutagenesis (Vol. 1), cloning in mammalian cells and yeast (Vol. 2), glycoconjugates and protein expression (Vol. 3), and bioinformatics (Vol. 4).
- Methods for protein purification including immunoprecipitation, chromatography, electrophoresis, centrifugation, and crystallization are described (Coligan, et al. (2000) Current Protocols in Protein Science, Vol. 1, John Wiley and Sons, Inc., New York). Chemical analysis, chemical modification, post-translational modification, production of fusion proteins, glycosylation of proteins are described (see, e.g., Coligan, et al. (2000) Current Protocols in Protein Science, Vol. 2, John Wiley and Sons, Inc., New York; Ausubel, et al. (2001) Current Protocols in Molecular Biology, Vol. 3, John Wiley and Sons, Inc., NY, NY, pp. 16.0.5-16.22.17; Sigma-Aldrich, Co. (2001) Products for Life Science Research, St. Louis, Mo.; pp. 45-89; Amersham Pharmacia Biotech (2001) BioDirectory, Piscataway, N.J., pp. 384-391). Production, purification, and fragmentation of polyclonal and monoclonal antibodies are described (Coligan, et al. (2001) Current Protcols in Immunology, Vol. 1, John Wiley and Sons, Inc., New York; Harlow and Lane (1999) Using Antibodies, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Harlow and Lane, supra). Standard techniques for characterizing ligand/receptor interactions are available (see, e.g., Coligan, et al. (2001) Current Protocols in Immunology, Vol. 4, John Wiley, Inc., New York).
- Monoclonal, polyclonal, and humanized antibodies can be prepared (see, e.g., Sheperd and Dean (eds.) (2000) Monoclonal Antibodies, Oxford Univ. Press, New York, N.Y.; Kontermann and Dubel (eds.) (2001) Antibody Engineering, Springer-Verlag, New York; Harlow and Lane (1988) Antibodies A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., pp. 139-243; Carpenter, et al. (2000) J. Immunol. 165:6205; He, et al. (1998) J. Immunol. 160:1029; Tang et al. (1999) J. Biol. Chem. 274:27371-27378; Baca et al. (1997) J. Biol. Chem. 272:10678-10684; Chothia et al. (1989) Nature 342:877-883; Foote and Winter (1992) J. Mol. Biol. 224:487-499; U.S. Pat. No. 6,329,511).
- An alternative to humanization is to use human antibody libraries displayed on phage or human antibody libraries in transgenic mice (Vaughan et al. (1996) Nature Biotechnol. 14:309-314; Barbas (1995) Nature Medicine 1:837-839; Mendez et al. (1997) Nature Genetics 15:146-156; Hoogenboom and Chames (2000) Immunol. Today 21:371-377; Barbas et al. (2001) Phage Display: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Kay et al. (1996) Phage Display of Peptides and Proteins: A Laboratory Manual, Academic Press, San Diego, Calif.; de Bruin et al. (1999) Nature Biotechnol. 17:397-399).
- Single chain antibodies and diabodies are described (see, e.g., Malecki et al. (2002) Proc. Natl. Acad. Sci. USA 99:213-218; Conrath et al. (2001) J. Biol. Chem. 276:7346-7350; Desmyter et al. (2001) J. Biol. Chem. 276:26285-26290; Hudson and Kortt (1999) J. Immunol. Methods 231:177-189; and U.S. Pat. No. 4,946,778). Bifunctional antibodies are provided (see, e.g., Mack, et al. (1995) Proc. Natl. Acad. Sci. USA 92:7021-7025; Carter (2001) J. Immunol. Methods 248:7-15; Volkel, et al. (2001) Protein Engineering 14:815-823; Segal, et al. (2001) J. Immunol. Methods 248:1-6; Brennan, et al. (1985) Science 229:81-83; Raso, et al. (1997) J. Biol. Chem. 272:27623; Morrison (1985) Science 229:1202-1207; Traunecker, et al. (1991) EMBO J. 10:3655-3659; and U.S. Pat. Nos. 5,932,448, 5,532,210, and 6,129,914).
- Bispecific antibodies are also provided (see, e.g., Azzoni et al. (1998) J. Immunol. 161:3493; Kita et al. (1999) J. Immunol. 162:6901; Merchant et al. (2000) J. Biol. Chem. 74:9115; Pandey et al. (2000) J. Biol. Chem. 275:38633; Zheng et al. (2001) J. Biol Chem. 276:12999; Propst et al. (2000) J. Immunol. 165:2214; Long (1999) Ann. Rev. Immunol. 17:875). Purification of antigen is not necessary for the generation of antibodies. Animals can be immunized with cells bearing the antigen of interest. Splenocytes can then be isolated from the immunized animals, and the splenocytes can fused with a myeloma cell line to produce a hybridoma (see, e.g., Meyaard et al. (1997) Immunity 7:283-290; Wright et al. (2000) Immunity 13:233-242; Preston et al., supra; Kaithamana et al. (1999) J. Immunol. 163:5157-5164).
- Antibodies can be conjugated, e.g., to small drug molecules, enzymes, liposomes, polyethylene glycol (PEG). Antibodies are useful for therapeutic, diagnostic, kit or other purposes, and include antibodies coupled, e.g., to dyes, radioisotopes, enzymes, or metals, e.g., colloidal gold (see, e.g., Le Doussal et al. (1991) J. Immunol. 146:169-175; Gibellini et al. (1998) J. Immunol. 160:3891-3898; Hsing and Bishop (1999) J. Immunol. 162:2804-2811; Everts et al. (2002) J. Immunol. 168:883-889).
- Methods for flow cytometry, including fluorescence activated cell sorting (FACS), are available (see, e.g., Owens, et al. (1994) Flow Cytometry Principles for Clinical Laboratory Practice, John Wiley and Sons, Hoboken, N.J.; Givan (2001) Flow Cytometry, 2nd ed.; Wiley-Liss, Hoboken, N.J.; Shapiro (2003) Practical Flow Cytometry, John Wiley and Sons, Hoboken, N.J.). Fluorescent reagents suitable for modifying nucleic acids, including nucleic acid primers and probes, polypeptides, and antibodies, for use, e.g., as diagnostic reagents, are available (Molecular Probes (2003) Catalogue, Molecular Probes, Inc., Eugene, Oreg.; Sigma-Aldrich (2003) Catalogue, St. Louis, Mo.).
- Standard methods of histology of the immune system are described (see, e.g., Muller-Harmelink (ed.) (1986) Human Thymus: Histopathology and Pathology, Springer Verlag, New York, N.Y.; Hiatt, et al. (2000) Color Atlas of Histology, Lippincott, Williams, and Wilkins, Phila, Pa.; Louis, et al. (2002) Basic Histology: Text and Atlas, McGraw-Hill, New York, N.Y.).
- Software packages and databases for determining, e.g., antigenic fragments, leader sequences, protein folding, functional domains, glycosylation sites, and sequence alignments, are available (see, e.g., GenBank, Vector NTI® Suite (Informax, Inc, Bethesda, Md.); GCG Wisconsin Package (Accelrys, Inc., San Diego, Calif.); DeCypher® (TimeLogic Corp., Crystal Bay, Nev.); Menne, et al. (2000) Bioinformatics 16: 741-742; Menne, et al. (2000) Bioinformatics Applications Note 16:741-742; Wren, et al. (2002) Comput. Methods Programs Biomed. 68:177-181; von Heijne (1983) Eur. J. Biochem. 133:17-21; von Heijne (1986) Nucleic Acids Res. 14:4683-4690).
- The following examples serve to illustrate the present invention. These examples are in no way intended to limit the scope of the invention.
- The specificity of various commercially available monoclonal anti-hSIRPα antibodies (Table 7) for binding to hSIRPα variant 1 (hSIRPαV1; GenBank accession: NM_001040022.1) (SEQ ID NO: 34), hSIRPα variant 2 (hSIRPαV2; GenBank accession: D86043.1) (SEQ ID NO: 36), hSIRPβ1 (GenBank accession: NM_006065.4) (SEQ ID NO: 38),
hSIRPβ1 transcript variant 3/hSIRPβL (NCBI accession: NM_001135844.3) (SEQ ID NO: 117), and hSIRPγ (NCBI accession: NM_018556.3) (SEQ ID NO: 40) was evaluated by cellular ELISA (CELISA). Reactivity was confirmed using CHO-K1 cells (ATCC CCL-61) that had been transiently transfected, usingLipofectamine 2000, with cDNA encoding the full length open reading frame of hSIRPαV1, hSIRPαV2, hSIRPβ1, hSIRPβL, and hSIRPγ subcloned into the pCI-neo vector (Promega, Madison, Wis.). CHO-K1.hSIRPαV1, CHO-K1.hSIRPαV2, CHO-K1.hSIRPβ1, CHO-K1.hSIRPβL, and CHO-K1.hSIRPγ cells were seeded in culture medium (DMEM-F12 (Gibco) supplemented with 5% New Born Calf Serum (BioWest) and Pen/Strep (Gibco)) in 96-well flat-bottom tissue culture plates and incubated at 37° C., 5% CO2 and 95% humidity for 24 hours. Subsequently, culture medium was removed and cells were incubated for 1 hour at 37° C., 5% CO2 and 95% humidity with purified hSIRPγ antibodies (used at 10 μg/mL and dilutions thereof). Next, cells were washed with PBS-T and incubated for 1 hour at 37° C., 5% CO2 and 95% humidity with goat-anti-mouse IgG-HRP (Southern Biotech). Subsequently, cells were washed three times with PBS-T and immunoreactivity against hSIRPαV1, hSIRPαV2, hSIRPβ1, hSIRPβL, and hSIRPγ was visualized with TMB Stabilized Chromogen (Invitrogen). Reactions were stopped with 0.5 M H2SO4 and absorbances were read at 450 and 610 nm. EC50 values, the concentration at which 50% of the total binding signal is observed, were calculated using GraphPad Prism 6 (GraphPad Software, Inc.). -
TABLE 7 Commercially available hSIRPα antibodies used for comparison with antibodies generated herein. Target Clone Cat. # Company Species Reactivity Isotype hSIRPα SE5A5 323802 Biolegend mouse human IgG1 hSIRPα 7B3 LS-C340387 LifeSpan Biosciences mouse human IgG1 hSIRPα 1B5 LS-C338479 LifeSpan Biosciences mouse human IgG1 hSIRPα 1C6 LS-C338477 LifeSpan Biosciences mouse human IgG1 hSIRPα 27 sc-136067 Santa Cruz mouse human, mouse, rat IgG1 Biotechnology hSIRPα SE7C2 sc-23863 Santa Cruz mouse human IgG1 Biotechnology hSIRPα P3C4 LS-C179629-100 CliniSciences mouse human IgG2a hSIRPα 2A4A5 W172-3 MBL International mouse human IgG2a hSIRPα 15-414 LS-C58098 LifeSpan Biosciences mouse human IgG2a hSIRPα 1H1 LS-C338476 LifeSpan Biosciences mouse human IgG2a hSIRPα C-7 sc-376884 Santa Cruz mouse human IgG2a Biotechnology hSIRPα 03 11612-MM03-100 Sino Biological Inc. mouse human IgG2b hSIRPα 5E10 LS C83566 LifeSpan Biosciences mouse human IgG2b hSIRPα 602411 MAB4546 R&D mouse human IgG2b hSIRPα EPR16264 ab191419 Abcam rabbit human, mouse, rat IgG hSIRPα D6I3M 13379S Cell Signaling rabbit human, mouse, rat, IgG Technology monkey hSIRPα 001 50956- Sino Biological Inc. rabbit mouse, human IgG R001_100ug hSIRPα REA144 130-099-768 Miltenyi Biotec human human IgG1 hSIRPα KWAR23 TAB-453CT Creative Biolabs human human IgG4 - As depicted in
FIG. 1 and the following Table 8, commercially available hSIRPα antibodies cross-react with at least hSIRPβ1, hSIRPβL, or hSIRPγ or demonstrate allele-specific binding to hSIRPαV2. The KWAR23 antibody cross-reacts with all members of the SIRP receptor family tested: it binds to hSIRPαV1, hSIRPαV2, hSIRPβ1, hSIRPβL, and hSIRPγ. -
TABLE 8 hSIRPαV1 hSIRPαV2 hSIRPβ1 hSIRPγ hSIRPβL binding binding binding binding binding EC50 EC50 EC50 EC50 EC50 Antibody (nM) (nM) (nM) (nM) (nM) hSIRPα.50A 1.626 1.627 nd 1.475 0.639 anti-hSIRPα (clone SE5A5) 0.372 0.186 0.185 0.200 0.122 anti-hSIRPα (clone 7B3) 0.187 0.300 0.255 nd 0.206 anti-hSIRPα (clone 1B5) nd 0.122 nd nd nd anti-hSIRPα (clone 1C6) 0.739 0.167 2.965 15.589 2.008 anti-hSIRPα (clone 27) nd nd nd nd nd anti-hSIRPα (clone SE7C2) 1.269* 0.300 nd 1.525 26.818* anti-hSIRPα (clone P3C4) 0.288 2.154 0.383 0.365 0.136 anti-hSIRPα (clone 2A4A5) nd 1.005 8.633 nd 12.156* anti-hSIRPα (clone 15-414) nd nd nd nd nd anti-hSIRPα (clone 1H1) nd 0.204 nd nd nd anti-hSIRPα (clone C-7) nd nd nd nd nd anti-hSIRPα (clone 03) 96.016* 15.059* 16.043* 17.303* 9.109* anti-hSIRPα (clone 5E10) nd nd nd nd nd anti-hSIRPα (clone 602411) 0.068 nd 0.081 3.622 0.060 anti-hSIRPα (clone EPR16264) nd 2.450* nd nd nd anti-hSIRPα (clone D6I3M) 18.690* 8.762* nd nd nd anti-hSIRPα (clone 001) 18.081* nd nd 0.494 6.253* anti-hSIRPα (clone REA144) 5.243* 3.274* 4.534* 3.212* 2.147* KWAR23 0.067 0.062 0.140 0.043 0.097 Values indicated with * were extrapolated; nd, not detected - To generate SIRPα antibodies that bind to all known SIRPα alleles and are not binding SIRPβ1 mice were immunized with a pCI-neo expression construct encoding hSIRPαV1 and hSIRPαV2. Mice were immunized by gene gun immunization using a Helios Gene gun (BioRad, Hercules, Calif.) and DNA coated gold bullets (BioRad) following manufacturer's instructions. Briefly, 1 μm gold particles were coated with pCI-neo-hSIRPαV1 or pCI-neo-hSIRPαV2 cDNA and commercial expression vectors for mouse Flt3L and mouse GM-CSF in a 2:1:1 ratio (both from Aldevron, Fargo, N. Dak.). A total of 1 μg of plasmid DNA was used to
coat 500 μg of gold particles. Specifically, 7-8 weeks old female BALB/C mice (Harlan) were immunized in the ears with a gene gun, receiving 3 administration cycles in both ears. - For positive and negative B-cell selection and CELISA purposes, CHO-K1.hSIRPαV1, CHO-K1.hSIRPαV2, CHO-K1.hSIRPβ1, and CHO-K1.hCD47 stable cell lines were generated by transfecting CHO-K1 cells with pCI-neo vector encoding the full length open reading frame of hSIRPαV1, hSIRPαV2, hSIRPβ1, and hCD47 (NCBI accession: NM_001777.3) (SEQ ID NO: 42), respectively. Stable clones were obtained by limiting dilution.
- Antibody titer was assessed by CELISA, using the CHO-K1.hSIRPαV1 and CHO-K1.hSIRPαV2 stable cell lines. These hSIRPα-expressing CHO-K1 cell lines were maintained in DMEM-F12 (Gibco) supplemented with 10% Fetal Bovine Serum (Hyclone) and 80U Pen/Strep (Gibco). Cells were seeded into 96-well flat-bottom tissue culture plates at 8×104 cells/well and cultured at 37° C., 5% CO2 and 95% humidity until cell layers were confluent. Cells were incubated with each sample of the diluted mouse sera for 1 hour at 37° C., 5% CO2 and 95% humidity. Next, cells were washed with Phosphate buffered Saline (PBS)/0.05% Tween-20 (PBS-T) and incubated with goat-anti-mouse IgG-HRP conjugate (Southern Biotech) for 1 hour at 37° C., 5% CO2 and 95% humidity. Subsequently, cells were washed three times with PBS-T and anti-hSIRPα immunoreactivity was visualized with TMB Stabilized Chromogen (Invitrogen). Reactions were stopped with 0.5 M H2SO4 and absorbances were read at 450 and 610 nm. The anti-hSIRPα titer was higher than 1:2,500 in each individual mouse serum sample as detected after two DNA immunizations. All mice that demonstrated reactivity against hSIRPαV1 and hSIRPαV2 were immunized for a final, third time and sacrificed 14 days later. Erythrocyte-depleted spleen and lymph-node cell populations were prepared as described previously (Steenbakkers et al., 1992, J. Immunol. Meth. 152: 69-77; Steenbakkers et al., 1994, Mol. Biol. Rep. 19: 125-134) and frozen at −180° C.
- To select anti-hSIRPα antibody producing B-cells, a selection strategy was designed and developed that preferentially bound B-cells expressing antibodies that bind to hSIRPαV1 and hSIRPαV2. Splenocytes and lymph nodes were harvested from the hSIRPαV1/V2 immunized mice and isolated cells were incubated with CHO-K1.hSIRPβ1 that were seeded into T25 culture flasks and irradiated at 30 Gray. After 1 hour unbound cells were gently removed by moving the flask back and forth. Medium containing unbound cells was then transferred to a new T25 flask containing irradiated CHO-K1.hSIRPβ1 cells. This procedure was followed for in total three times on ice in order to negatively select hSIRPβ1-reactive B-cells. Next, medium containing unbound B-cells was incubated with CHO-K1.hSIRPαV1 and CHO-K1.hSIRPαV2 cells that were irradiated at 3,000 Gray. After 1.5 hours incubation on ice unbound cells were removed with multiple wash steps using culture medium. Subsequently, T25 flasks containing CHO-K1.hSIRPαV1 and CHO-K1.hSIRPαV2 cells with bound lymphocytes were harvested with Trypsin-EDTA (Sigma). Bound B-cells were cultured, as described by Steenbakkers et al., 1994, Mol. Biol. Rep. 19: 125-134. Briefly, selected B-cells were mixed with 10% (v/v) T-cell supernatant and 50,000 irradiated (25 Gray) EL-4 B5 feeder cells in a final volume of 200 μl medium in 96-well flat-bottom tissue culture plates. On day eight, supernatants were screened for hSIRPαV1 and hSIRPαV2 reactivity by CELISA as described below.
- CHO-K1.hSIRPαV1, CHO-K1.hSIRPαV2, and CHO-K1.hSIRPβ1 were seeded in culture medium (DMEM-F12 (Gibco) supplemented with 10% Fetal Bovine Serum (Hyclone) and 80U Pen/Strep (Gibco)) in 96-well flat-bottom tissue culture plates and cultured at 37° C., 5% CO2 and 95% humidity until they were confluent. Subsequently, culture medium was removed and cells were incubated for 1 hour at 37° C., 5% CO2 and 95% humidity with supernatants from the B-cell cultures. Next, cells were washed with PBS-T and incubated for 1 hour at 37° C., 5% CO2 and 95% humidity with goat-anti-mouse IgG-HRP conjugate (Southern Biotech). Subsequently, cells were washed three times with PBS-T and anti-hSIRPαV1, anti-hSIRPαV2, and anti-hSIRPβ1 immunoreactivity was visualized with TMB Stabilized Chromogen (Invitrogen). Reactions were stopped with 0.5 M H2SO4 and absorbances were read at 450 and 610 nm.
- Immunoreactivity to human SIRPγ was assessed by ELISA using recombinant hSIRPγ/Fc-protein (R&D Systems, Cat.#4486-SB-050; SEQ ID NO: 108) coated 96-well MaxiSorp flat-bottom plates. Protein coated 96-well plates were blocked in PBS/1% bovine serum albumin (BSA) for 1 hour at room temperature (RT). PBS/1% BSA was removed and plates were incubated for 1 hour at RT with supernatants from the B-cell cultures. Next, plates were washed with PBS-T and incubated for 1 hour at RT with goat-anti-mouse IgG-HRP conjugate (Southern Biotech). Subsequently, wells were washed three times with PBS-T and anti-hSIRPγ immunoreactivity was visualized with TMB Stabilized Chromogen (Invitrogen). Reactions were stopped with 0.5 M H2SO4 and absorbances were read at 450 and 610 nm.
- B-cell clones from the hSIRPα reactive supernatants, which were not or which were minimally reactive to hSIRPβ1 were immortalized by mini-electrofusion following published procedures (Steenbakkers et al., 1992, J. Immunol. Meth. 152: 69-77; Steenbakkers et al., 1994, Mol. Biol. Rep. 19:125-34) with some minor deviations (e.g. pronase reaction was omitted). Briefly, B-cells were mixed with 106 Sp2/0-Ag14 murine myeloma cells (ATCC CRL-1581) in Electrofusion Isomolar Buffer (Eppendorf). Electrofusions were performed in a 50 μL fusion chamber by an alternating electric field of 15 s, 1 MHz, 23 Vrms AC followed by a square, high field DC pulse of 10 μs, 180 Volt DC and again by an alternating electric field of 15 s, 1 MHz, 23 Vrms AC. Content of the chamber was transferred to hybridoma selective medium and plated in a 96-well plate under limiting dilution conditions. On
day 10 following the electrofusion, hybridoma supernatants were screened for hSIRPαV1, hSIRPαV2, hSIRPβ1, and hSIRPγ binding activity by CELISA and ELISA, as described above. Hybridomas that secreted antibodies in the supernatant that specifically bound hSIRPαV1 and hSIRPαV2 were both frozen at −180° C. (-1 batch) and subcloned by limited dilution to safeguard their integrity and stability. Stable hybridomas were frozen at −180° C. (-LD1 batch) until cell layers were confluent. - Further selection of the hybridomas was performed by assessing the blocking abilities of the hSIRPαV1/hCD47 interaction in CELISA format. For the assessment of hCD47 blockade CHO-K1.hCD47 cells were seeded in 384-well flat-bottom tissue culture plates and incubated at 37° C., 5% CO2 and 95% humidity in culture medium. Recombinant hSIRPα/Fc-protein (R&D Systems, Cat.#4546-SA-050; SEQ ID NO: 107) was pre-incubated with a dilution series of the hybridoma supernatants containing hSIRPα reactive antibodies and control antibodies (at 10 μg/mL and dilutions thereof) for 30 minutes at 37° C., 5% CO2 and 95% humidity. Confluent CHO-K1.hCD47 cells were washed with PBS-T and incubated for 1 hour with the mixtures containing hSIRPα reactive antibodies and recombinant hSIRPα/Fc-protein at 37° C., 5% CO2 and 95% humidity. Next, cells were washed with PBS-T followed by addition of goat-anti-human IgG-HRP conjugate (Jackson Immuno Research) to the cells, which was incubated for 1 hour at 37° C., 5% CO2 and 95% humidity. Subsequently cells were washed three times with PBS-T and binding of hSIRPα/Fc-protein was visualized with TMB Stabilized Chromogen (Invitrogen). Reactions were stopped with 0.5 M H2SO4 and absorbances were read at 450 and 610 nm.
- Selected stable hybridomas were cultured in serum-free media for 7 days; supernatants were harvested and antibodies were purified using MabSelect Sure Protein A resin according to the manufacturer's instructions (GE Healthcare). Antibody concentrations were quantified using spectrophotometry. Supernatants of the hybridoma cultures were used to isotype the hybridomas. In short, isotyping was done using a mouse monoclonal antibody isotyping kit (Biorad) based on a dipstick with immobilized goat-anti-mouse antibody bands to each of the common mouse isotypes and light chains. Recovered antibodies were all identified as mouse IgG1. Antibody sequences were elucidated by sequencing of variable regions of the mouse IgG1 hybridoma material performed at LakePharma, using the following method: the total RNA of the hybridoma cells was extracted, which allowed cDNA synthesis. Rapid Amplification of cDNA Ends (RACE) was performed that allowed cloning of positive fragments in a TOPO (Thermo Fisher Scientific) vector. TOPO clones were sequenced and sequences were annotated using VBASE2 (Retter et al., VBASE2, an integrative V gene database. Nucleic Acids Res. 2005 Jan. 1; 33(Database issue):D671-4).
- The binding specificity of antibody hSIRPα.50A to hSIRPα was compared antibody KWAR23 (Canadian Patent 2939293 A1), in a CELISA format. CHO-K1 cells were transiently transfected with hSIRPαV1, hSIRPαV2, hSIRPβ1, and hSIRPγ (GenBank accession: NM_018556.3) (SEQ ID NO: 39) cDNAs. Subsequently, hSIRPα binding was assessed by CELISA using CHO-K1.hSIRPαV1, CHO-K1.hSIRPαV2, CHO-K1.hSIRPβ1, and CHO-K1.hSIRPγ cells. Detection of bound antibody was performed with goat-anti-mouse IgG-HRP (Southern Biotech) for mouse antibodies including hSIRPα.50A and control antibodies or, alternatively, with goat-anti-human IgG-HRP conjugate (Jackson Immuno Research) for the KWAR23 antibody. KWAR23 (SEQ ID NO: 130; SEQ ID NO: 131) was expressed as a chimeric human IgG4 kappa antibody in CHO cells. As shown in
FIG. 2 and the following Table 9, KWAR23 antibody cross-reacts with all members of the SIRP receptor family tested: it binds to hSIRPαV1, hSIRPαV2, hSIRPβ1, and hSIRPγ. EC50 values represent the concentration at which 50% of the total binding signal is observed (average and SD were calculated from values of two independent experiments). -
TABLE 9 hSIRPαV1 binding EC50 (nM) hSIRPαV2 binding EC50 (nM) Antibody Average SD Average SD KWAR23 0.081 0.001 0.051 0.004 hSIRPα.50A 1.365 0.164 1.296 0.186 anti-hSIRPα (clone SE5A5) 0.304 0.200 anti-hSIRPγ (clone LSB2.20) nd nd hSIRPβ1 binding EC50 (nM) hSIRPγ binding EC50 (nM) Antibody Average SD Average SD KWAR23 0.161 0.007 0.040 0.002 hSIRPα.50A nd nd 1.249 0.179 anti-hSIRPα (clone SE5A5) 0.192 0.168 anti-hSIRPγ (clone LSB2.20) nd 0.265 Empty squares indicate n = 1 measurements. nd, not detected - In addition, the specificity of hSIRPα.50A for all known of hSIRPα alleles (allelic variants as described by Takenaka et al., 2007, Nat Immunol. 8:1313-1323) was further investigated by CELISA using the same strategy as above. To this end, hSIRPα.50A binding was assessed using CHO-K1 cells that were transiently transfected with cDNAs encoding full length hSIRPαV1, hSIRPαV2, hSIRPαV3 (NA07056_V3) (SEQ ID NO: 43), hSIRPαV4 (NA11832_V4) (SEQ ID NO: 45), hSIRPαV5 (NA18502_V5) (SEQ ID NO: 47), hSIRPαV6 (NA18507_V6) (SEQ ID NO: 49), hSIRPαV8 (NA18570_V8) (SEQ ID NO: 51), and hSIRPαV9 (NA18943_V9) (SEQ ID NO: 53).
FIG. 3 and the following Table 10 demonstrate the reactivity of antibody clone hSIRPα.50A for each of these hSIRPα alleles. EC50 values represent the concentration at which 50% of the total binding signal is observed (average and SD were calculated from values of two independent experiments). -
TABLE 10 Antibody anti-hSIRPα hSIRPα.50A (clone SE5A5) hSIRPαV1 EC50 (nM) 0.936 0.327 SD 0.285 0.107 hSIRPαV2 EC50 (nM) 0.665 0.200 SD 0.106 0.046 hSIRPαV3 EC50 (nM) 0.688 0.226 SD 0.097 0.052 hSIRPαV4 EC50 (nM) 0.824 0.256 SD 0.280 0.085 hSIRPαV5 EC50 (nM) 0.765 0.276 SD 0.210 0.086 hSIRPαV6 EC50 (nM) 0.954 0.098 SD 0.437 0.050 hSIRPαV8 EC50 (nM) 0.644 0.300 SD 0.066 0.061 hSIRPαV9 EC50 (nM) 0.733 0.260 SD 0.205 0.079 - The hSIRPα.50A antibody was analyzed by flow cytometry for its ability to block recombinant hCD47/Fc-protein (R&D Systems, Cat.#4670-CD-050; SEQ ID NO: 109) binding to cell surface expressed hSIRPα. For this purpose, THP-1 (ATCC TIB-202) and U-937 (ATCC CRL-1593.2) monocyte cell lines were used as the source of hSIRPα in the assay. THP-1 and U-937 cells were seeded in 96-well round bottomed tissue culture plates and incubated for 45 minutes with FcR Blocking Reagent (Miltenyi Biotec) and hSIRPα.50A antibody (200 μg/mL and dilutions thereof) in PBS/1% BSA at 4° C. Next, cells were washed three times with PBS/1% BSA and incubated with DyLight 488-labeled recombinant hCD47/Fc-protein for 30 minutes at 4° C. After this labeling procedure, cells were washed two times, resuspended in PBS/1% BSA containing 0.1 μg/mL DAPI (BioLegend), and analysed by flow cytometry on the FACSCanto II (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC).
- As depicted in
FIG. 4 and the following Table 11, binding of recombinant hCD47 fused to an Fc domain of human IgG1 was monitored in the presence of increasing amounts of the hSIRPα.50A antibody. Antibody hSIRPα.50A blocked the hSIRPα/hCD47 interaction, using the flow cytometry-based method described above. IC50 values for the blockade of hCD47 were calculated from this data. IC50 values represent the concentration at which half of the inhibition is observed. -
TABLE 11 THP-1 U-937 Antibody IC50 (nM) IC50 (nM) hSIRPα.50A 4.605 7.164 - Next, the binding of hSIRPα.50A to hSIRPα expressed on primary human CD14+ monocytes was investigated. In addition, the ability of hSIRPα.50A to block the interaction between hSIRPα and recombinant hCD47/Fc-protein was assessed. For this purpose, CD14+ monocytes were isolated from Ficoll-purified human peripheral blood mononuclear cells (PBMCs) using RosetteSep human monocyte enrichment cocktail (Stemcell). The percentage of monocytes present after the enrichment was determined by flow cytometry on the FACSVerse (BD Biosciences) based on CD14 staining using an APC-Cy7-conjugated mouse-anti-human CD14 detection antibody (BD Biosciences). Subsequently, CD14+ enriched PBMCs were seeded in 96-well round bottomed tissue culture plates and incubated for 40 minutes with FcR Blocking Reagent (Miltenyi Biotec) containing hSIRPα.50A antibody (25 μg/mL and dilutions thereof) in PBS/1% BSA at 4° C. Next, cells were washed three times with PBS/1% BSA and incubated with a FITC-labeled goat-anti-mouse Ig (BD Biosciences) detection antibody in PBS/1% BSA for 40 minutes at 4° C. After this labeling procedure, cells were washed two times, resuspended in PBS/1% BSA containing 0.1m/mL DAPI (BioLegend), and analysed by flow cytometry on the FACSVerse (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC).
-
FIGS. 5A and B and the following Table 12 indicates that hSIRPα.50A binds to primary human CD14+ enriched monocytes. EC50 values represent the concentration at which 50% of the total binding signal is observed. To assess the blocking ability of hSIRPα.50A, CD14+ enriched monocytes cells were seeded in 96-well round bottomed tissue culture plates and incubated for 45 minutes with FcR Blocking Reagent (Miltenyi Biotec) and hSIRPα.50A antibody (200m/mL and dilutions thereof) in PBS/1% BSA at 4° C. Thereafter, cells were washed three times with PBS/1% BSA and incubated with 10m/mL DyLight 488-labeled recombinant hCD47/Fc-protein for 45 minutes at 4° C. After this labeling procedure, cells were washed two times, resuspended in PBS/1% BSA containing 0.1m/mL DAPI (BioLegend), and analysed by flow cytometry on the FACSVerse (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC).FIGS. 5 C and D and the following Table 12 demonstrates the ability of antibody hSIRPα.50A to block the hSIRPα/hCD47 interaction. IC50 values for the blockade of hCD47 were calculated from this data. IC50 values represent the concentration at which half of the inhibition is observed. -
TABLE 12 Donor 1Donor 2Antibody EC50 (nM) IC50 (nM) EC50 (nM) IC50 (nM) hSIRPα.50A 7.381 4.618 3.081 1.035 - To confirm the functionality of hSIRPα.50A in primary immune cells, granulocytes (e.g. effector cells) were isolated from healthy human donor EDTA blood. First, the EDTA blood of each donor was pooled and centrifuged at 300 g for 6 minutes at 20° C. Next, plasma was removed by aspiration, and the remaining blood cells were gently resuspended. Cells were recovered in red blood cell (RBC) lysis buffer (155 mM NH4C1; 10 mM KHCO3) and incubated for 10 minutes on ice. Next, cells were centrifuged at 300 g for 7 minutes. Supernatants containing lysed RBCs were removed by aspiration, and the remaining blood cells were gently resuspended in RBC lysis buffer and kept on ice for 1 minute. RBC lysis was neutralized by adding assay medium (IMDM (Gibco) supplemented with 10% Fetal Bovine Serum (Gibco) and Pen/Strep (Gibco)). Blood cells were centrifuged at 300 g for 6 minutes and supernatants were removed by aspiration to remove remaining RBCs as much as possible. Subsequently, erythrocyte-lysed blood cells were resuspended in assay medium containing 10 ng/mL IFNγ and cells were incubated for 1 hour at 37° C., 5% CO2 and 95% humidity. Non-adherent blood cells containing human granulocytes were collected by mild washing of the tissue culture plate with assay medium (monocytes are depleted due to adherence to the plastic surface). The percentage of granulocytes present in the cell suspension was determined by flow cytometry on the FACSCanto II (BD Biosciences) based on high forward scatter (FSC) and side scatter (SSC). Binding of hSIRPα.50A to human granulocytes was assessed by incubating the cells for 30 minutes at 4° C. with hSIRPα.50A antibody (25 μg/mL and dilutions thereof) in PBS/1% BSA containing 10% autologous serum (PBS/1% BSA/10% serum). Next, cells were washed three times with PBS/1% BSA/10% serum and incubated for 30 minutes at 4° C. with a FITC-labeled goat-anti-mouse Ig (BD Biosciences) detection antibody. After this labeling procedure, cells were washed two times, resuspended in PBS/1% BSA/10% serum and analysed by flow cytometry on the FACSCanto II (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC).
FIG. 6A shows that hSIRPα.50A binds to primary human granulocytes. EC50 values represent the concentration at which 50% of the total binding signal is observed. - Next, target cells were fluorescently labeled with either cell proliferation dye eFluor450 (eBioscience) in the case of Raji (ECACC 85011429), Daudi (ECACC 85011437), Ramos (ECACC 85030802), and BJAB (DSMZ ACC-757) lymphoma cells or, alternatively, with Vybrant DiD cell-labeling solution (Thermo Fisher Scientific) for FaDu cells. Labeling was performed according to manufacturer's instructions. Labeled target cells were co-cultured for 2-3 hours at 37° C., 5% CO2 and 95% humidity with isolated primary human granulocytes in a 1:1 ratio (7.5*104 cells of each target and effector per well of a 96-well round bottomed tissue culture plate) in the presence of 0.1 μg/mL rituximab (anti-hCD20). In addition, cells were co-cultured with 0.1 μg/mL rituximab in presence of 10 μg/mL hSIRPα.50A. Phagocytosis was assayed by determining the percentage of granulocytes positive for eFluor450 (or DID) using flow cytometry on the FACSCanto II (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC).
- Compared to the mouse IgG1 isotype control, hSIRPα.50A potently enhances tumor cell phagocytosis induced by rituximab (
FIG. 6B ). The same procedure was followed with other existing therapeutic antibodies such as 0.05 μg/mL daratumumab (anti-hCD38), 0.1 μg/mL alemtuzumab (anti-hCD52), and 0.1 μg/mL cetuximab (anti-hEGFR) (FIG. 6C-E ). These data demonstrate that hSIRPα.50A enhances antibody-mediated tumor cell phagocytosis by human granulocytes. - Blockade of CD47 by hSIRPα.50A enhances the phagocytosis of human lymphoma cells tumor cells by human macrophages. Human macrophages were generated by first enriching CD14+ monocytes from Ficoll-purified human peripheral blood mononuclear cells (PBMCs) using RosetteSep human monocyte enrichment cocktail (Stemcell). Monocytes were seeded into CellCarrier 96-well flat-bottom microplates (Perkin Elmer) and cultured in macrophage medium (IMDM (Gibco) supplemented with 8.5% Fetal Bovine Serum (Gibco) and Pen/Strep (Gibco)) containing 50 ng/mL human monocyte colony stimulating factor (M-CSF) for 7 days at 37° C., 5% CO2 and 95% humidity to promote differentiation into macrophages. These monocyte-derived macrophages (MDMs) become adherent allowing other cells to be washed away. Human Raji, Daudi, Ramos, and BJAB lymphoma cells were counted and labeled with cell proliferation dye eFluor450 (eBioscience) following manufacturer's instructions. After labeling, the lymphoma cells were mixed with assay medium (RPMI (Gibco) supplemented with 10% Fetal Bovine Serum (Gibco) and Pen/Strep (Gibco)) containing 10 μg/mL anti-hSIRPα antibodies, respective isotype controls and either 0.1 μg/mL rituximab (anti-hCD20) or 0.05 μg/mL daratumumab (anti-hCD38). The lymphoma cells were then added to the individual wells containing MDMs at a ratio of 2.5:1 tumor cells per phagocyte, mixed and incubated at 37° C., 5% CO2 and 95% humidity for 2 hours. After the incubation, the wells were washed with PBS to remove most of the non-phagocytosed tumor cells, and cells were fixed with 2% formaldehyde for 10 min at RT. The wells were then washed and maintained in PBS/3% BSA in dark at 4° C. overnight. Lymphoma cells present in the wells were stained with biotin-conjugated anti-human CD19 clone HIB19 (eBioscience) for 1 hour at RT, and subsequently were counterstained with Alexa Fluor 488-conjugated streptavidin (Thermo Fisher Scientific) for 1 hour at RT. Next, nuclei were stained with DRAQ5 (Thermo Fisher Scientific) for 10 minutes at RT, mixture was removed, and PBS was added to each well. Cells were analysed with the Operetta automated fluorescence microscope (Perkin Elmer). Data were processed and analysed with Columbus V2.6 software.
- As shown in
FIG. 7 , hSIRPα.50A enhances rituximab and daratumumab-mediated phagocytosis activity. The phagocytosis of human lymphoma cells was quantified using a phagocytosis index, as follows: (number of tumor cells inside macrophages/number of macrophages)*100; counting at least 200 macrophages per sample. - The mouse hSIRPα.50A antibody was humanized using CDR-grafting technology (see e.g. U.S. Pat. No. 5,225,539 and Williams, D. G. et al., 2010, Antibody Engineering,
volume 1, Chapter 21). - First, human germline sequences were identified using IgBLAST (Ye J. et al., 2013, Nucleic Acids Res. 41:W34-40). For the hSIRPα.50A VH human germline sequence, V-gene IGHV1/OR15-2*02 was identified (75.2% identity) and for the VL human germline sequence IGKV1-27*01 was identified (74.0% identity). These two germline sequences were used to directly graft the mouse CDRs, resulting in the following two cDNA constructs: SEQ ID NO: 17 (VH) and SEQ ID NO: 25 (VL).
- Next, a database was constructed containing all human sequences available in the IMGT database (Lefranc, M.-P. et al., 1999, Nucleic Acid Res. 27:209-212) identifying 85,848 individual sequences. These sequences were queried using TBLASTN (2.2.31+) to identify template sequences that demonstrated the highest identify to the framework of hSIRPα.50A VH and VL sequences. Three VH and three VL sequences were identified that demonstrated a similarity score of 75% or higher and that displayed similar CDR lengths, preferably identical to those in hSIRPα.50A VH CDR1, CDR2, CDR3 and VL CDR1, CDR2 and CDR3, respectively.
- For the heavy chain, the frameworks encoded by GenBank (Benson, D. A. et al., 2013, Nucleic Acids Res. 41(D1): D36-42) accession # AB066948, AB067235, and U84168 were selected as templates for straight grafting of the hSIRPα.50A VH CDRs, resulting in the following cDNA constructs: SEQ ID NO: 9, 11 and 13, respectively. For the light chain, the frameworks encoded by GenBank accession # JF894288, AB363321, and L12101 were selected as templates for straight grafting of the hSIRPα.50A VL CDRs, resulting in the following cDNA constructs: SEQ ID NO: 19, 21 and 23. Framework and CDR definition were those as described by Kabat et al. (“Sequences of Proteins of Immunological Interest”, Kabat, E., et al., US Department of Health and Human Services, (1983)).
- To understand the effect of humanized framework residues on the structure of the Fv, a homology model of the mouse hSIRPα.50A Fv was made using the ‘Antibody Modeling Cascade’ (default parameters) within Discovery Studio 4.5. The homology model was built on basis of PDB ID 1CIC, for the light chain and Fv, and PDB ID 4QOX for the heavy chain. The CDRs were grafted in silico to study residues that are close to any of the CDRs and which might affect the loop conformation, referred as Vernier residues. Residues that might affect the loop conformation, and which are within <5 Å to the CDR surface were identified and substituted with the mouse amino acid at this position. The resulting templates were checked for the presence of post translational modification (PTM) motifs using Discovery Studio 4.5 and where possible (i.e. non-CDR, non-Vernier residues) changed to prevent a PTM. For the heavy chain, removal of the predicted sequence PTM motifs and structural considerations (i.e. rigidity of the backbone) in the hSIRPα.50A VH resulted in the design of one additional construct: SEQ ID NO: 15. For the light chain the PTM removal resulted in the following construct: SEQ ID NO: 27.
- CDRs were grafted on each of the identified templates, expressed as a human IgG4 (SEQ ID NO: 65), kappa (SEQ ID NO: 63) antibody cloned in the pcDNA3.1(+) vector (Thermo Fisher Scientific) and for transient transfection in FreeStyle 293-F human embryonic kidney cells (HEK293T/17, ATCC CRL-11268). In each case, an IgG4 version carrying the stabilizing Adair mutation (Angal S. et al., 1993, Mol Immunol. 30: 105-108), where Serine 228 is converted to Proline, was used.
- Plasmids encoding the heavy chain and light chain constructs were mixed in a 1:1 ratio (30m in total) and transiently expressed by transfection into FreeStyle 293-F cells using 293fectin transfection reagent (Invitrogen) following the manufacturer's instructions. Supernatants (30 ml) were harvested after 7 days and antibodies were purified using MabSelect Sure Protein A resin according to the manufacturer's instructions (GE Healthcare). Buffer was exchanged for 10 mM Histidine, 100 mM NaCl pH 5.5 buffer using Zeba desalting columns (Thermo Fisher Scientific). The concentration of purified antibodies was determined based on OD280 (Nanodrop ND-1000). Endotoxin level was determined by LAL-test according to the manufacturer's instructions (Lonza).
- Binding of the humanized antibodies to hSIRPγ was studied in CELISA format.
- Binding of the hSIRPγ antibodies to human SIRPαV1, SIRPαV2, hSIRPβ1, and hSIRPγ was confirmed using CHO-K1 cells that had been transiently transfected with cDNA encoding the full length open reading frame of each of these respective targets subcloned into the pCI-neo vector. CHO-K1.hSIRPαV1, CHO-K1.hSIRPαV2, CHO-K1.hSIRPβ1, and CHO-K1.hSIRPγ cells were seeded in culture medium (DMEM-F12 (Gibco) supplemented with 5% New Born Calf Serum (BioWest) and Pen/Strep (Gibco)) in 96-well flat-bottom tissue culture plates and incubated at 37° C., 5% CO2 and 95% humidity until cell layers were confluent. Subsequently, culture medium was removed and cells were incubated for 1 hour at 37° C., 5% CO2 and 95% humidity with purified hSIRPγ antibodies (10m/mL and dilutions thereof). Next, cells were washed with PBS-T and incubated for 1 hour at 37° C., 5% CO2 and 95% humidity with goat-anti-human IgG-HRP conjugate (Jackson Immuno Research) or goat-anti-mouse IgG-HRP (Southern Biotech). Subsequently, cells were washed three times with PBS-T and anti-hSIRPγ immunoreactivity was visualized with TMB Stabilized Chromogen (Invitrogen). Reactions were stopped with 0.5 M H2SO4 and absorbances were read at 450 and 610 nm. EC50 values, the concentration at which 50% of the total binding signal is observed, were calculated using GraphPad Prism 6 (GraphPad Software, Inc.). In Table 13 the EC50 values of the humanized hSIRPγ antibodies are depicted.
- Table 13: Binding of humanized and parental hSIRPα.50A antibodies to CHO-K1.hSIRPαV1, CHO-K1.hSIRPαV2, CHO-K1.hSIRPβ1, and CHO-K1.hSIRPγ cells. EC50 values represent the concentration at which 50% of the total binding signal is observed (average and SD were calculated from values of two independent experiments).
-
TABLE 13 hSIRPαV1 binding hSIRPαV2 binding hSIRPβ1 binding hSIRPγ binding EC50 (nM) EC50 (nM) EC50 (nM) EC50 (nM) Antibody Average SD Average SD Average SD Average SD hSIRPα.50H 0.883 0.212 0.864 0.109 nd nd 1.485* 0.120 1L1 hSIRPα.50H 0.781 0.104 0.816 0.161 nd nd 1.259* 0.155 1L2 hSIRPα.50H 1.094 0.112 1.107 0.238 nd nd 2.579* 0.672 1L3 hSIRPα.50H 1.488 0.259 1.621 0.320 nd nd 7.435* 0.208 1L4 hSIRPα.50H 0.962 0.235 0.848 0.239 nd nd 1.013* 0.115 1L5 hSIRPα.50H 1.097 0.286 1.056 0.303 nd nd 1.424* 0.080 3L1 hSIRPα.50H 1.055 0.347 0.999 0.450 nd nd 1.502* 0.305 3L2 hSIRPα.50H 1.159 0.417 1.160 0.429 nd nd 2.471* 0.530 3L3 hSIRPα.50H 1.261 0.317 1.520 0.333 nd nd 5.175* 0.210 3L4 hSIRPα.50H 0.878 0.097 0.868 0.190 nd nd 1.199* 0.120 3L5 hSIRPα.50H 0.683 0.027 0.681 0.156 nd nd 0.950* 0.171 4L1 hSIRPα.50H 0.737 0.110 0.651 0.147 nd nd 0.871* 0.062 4L2 hSIRPα.50H 0.933 0.078 0.898 0.133 nd nd 1.596* 0.144 4L3 hSIRPα.50H 1.197 0.175 1.240 0.238 nd nd 1.980* 0.681 4L4 hSIRPα.50H 0.701 0.136 0.661 0.161 nd nd 0.808* 0.038 4L5 hSIRPα.50H 0.731 0.039 0.709 0.063 nd nd 1.028* 0.087 5L1 hSIRPα.50H 0.675 0.086 0.572 0.023 nd nd 0.822* 0.046 5L2 hSIRPα.50H 1.029 0.084 0.796 0.004 nd nd 1.612* 0.247 5L3 hSIRPα.50H 1.169 0.197 1.115 0.060 nd nd 4.028* 0.342 5L4 hSIRPα.50H 0.681 0.066 0.611 0.030 nd nd 0.868* 0.028 5L5 hSIRPα.50A 1.365 0.164 1.296 0.186 nd nd 1.249* 0.179 Note that variants with the H2 heavy chain could not be expressed in FreeStyle 293-F cells; values indicated with * were extrapolated; nd, not detected - Binding of the parental and humanized hSIRPγ antibodies to hSIRPγ was further assessed using NK-92MI cells (ATCC CRL-2408), an interleukin-2 (IL-2) independent natural killer cell line derived from the NK-92 cell line. NK-92MI cells were seeded in 96-well round bottomed tissue culture plates and incubated for 30 minutes with the humanized hSIRPα.50A antibody variants (100m/mL and dilutions thereof) in PBS/1% BSA at 4° C. Next, cells were washed three times with PBS/1% BSA and incubated for 30 minutes at 4° C. with a FITC-labeled mouse-anti-human IgG4 (Abcam) or donkey-anti-mouse IgG (Jackson Immuno Research) detection antibody in PBS/1% BSA. After this labeling procedure, cells were washed two times, resuspended in PBS/1% BSA and analysed by flow cytometry on the FACSCanto II (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC).
- hCD47 blockade was assessed by flow cytometry for the full panel of humanized hSIRPα.50A antibodies. To this end, HEK293 cells (ATCC CRL-1573) were transiently transfected using Lipofectamine 2000 (Invitrogen) with the pCI-neo vector encoding the full length open reading frame of human SIRPαV1. The transfected cells were cultured at 37° C., 5% CO2 and 95% humidity in medium (DMEM-F12 (Gibco) with 10% Fetal Bovine Serum (Gibco) and Pen/Strep (Gibco)) until confluent. Subsequently, cells were dissociated and seeded in 96-well round bottomed tissue culture plates and incubated for 30 minutes with the humanized hSIRPα.50A antibody variants (100m/mL and dilutions thereof) in PBS/1% BSA at 4° C. Next, cells were washed three times with PBS/1% BSA and incubated with recombinant hCD47/Fc-protein (ModiQuest; SEQ ID NO: 42) for 30 minutes at 4° C. Afterwards, cells were washed three times with PBS/1% BSA and incubated for 30 minutes at 4° C. with a mouse-anti-human IgG1 Hinge-FITC (Southern Biotech) detection antibody. After this labeling procedure, cells were washed two times, resuspended in PBS/1% BSA and analysed by flow cytometry on the FACSCanto II (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC) and plotted using GraphPad Prism 6 (GraphPad Software, Inc.) (
FIG. 8 ). - As depicted in
FIG. 8 , binding of recombinant hCD47 fused to an Fc domain of human IgG1 was monitored in the presence of increasing amounts of the humanized hSIRPα.50A antibody variants. All antibody variants blocked the hSIRPα/hCD47 interaction. - To identify the binding region of hSIRPα.50A, several SIRPα exchange-mutants were designed based on the human SIRPαV1 and hSIRPβ1 amino acid sequence. Based on the fold of SIRPα, the extracellular region can be subdivided into three separate domains: the Ig-like (immunoglobulin-like) V-type (IgV), Ig-like C1-type (IgC1), and Ig-like C2-type (IgC2) domain. The IgV domain is also known as the ligand-binding N-terminal domain of SIRPα (which binds to CD47). The human SIRPαV1/31 mutants were designed on the basis of the full length hSIRPαV1 sequence (SEQ ID NO: 33) and each individual Ig-like domain was substituted for the equivalent domain of human SIRPβ1 (SEQ ID NO: 37). The cDNAs encoding the constructs, hSIRPα-VβC1αC2α(SEQ ID NO: 55), hSIRPα-VαC1βC2α(SEQ ID NO: 57), and hSIRPα-VαC1αC2β (SEQ ID NO: 59) were synthesized (GeneArt) and subcloned into the pCI-neo vector. Binding of hSIRPα.50A to the exchange mutants was tested using CELISA. To this end, CHO-K1 cells were transiently transfected, using
Lipofectamine 2000, with the pCI-neo vectors encoding hSIRPαV1, hSIRPαV2, hSIRPβ1, hSIRPα-VβC1αC2α, hSIRPα-VαC1βC2α, and hSIRPα-VaC1αC2β, respectively. The transfected cells were cultured at 37° C., 5% CO2 and 95% humidity in medium (DMEM-F12 (Gibco) with 5% New Born Calf serum (Biowest) and Pen/Strep (Gibco)) until confluent. Subsequently, cells were trypsinized and seeded in 96-well flat-bottom tissue culture plates and cultured at 37° C., 5% CO2 and 95% humidity in culture medium until confluent. Then, culture medium was removed and cells were incubated for 1 hour at 37° C., 5% CO2 and 95% humidity with hSIRPα.50A and anti-hSIRPα clone SE5A5 antibodies. Next, cells were washed with PBS-T and incubated for 1 hour at 37° C., 5% CO2 and 95% humidity with goat-anti-mouse IgG-HRP conjugate (Southern Biotech). After that, cells were washed three times with PBS-T and anti-hSIRPα immunoreactivity was visualized with TMB Stabilized Chromogen (Invitrogen). Reactions were stopped with 0.5 M H2SO4 and absorbances were read at 450 and 610 nm. - The antibody of the present invention demonstrated loss of binding to the hSIRPα-VβC1αC2αmutant, indicating that hSIRPα.50A binds to the IgV domain of hSIRPα (
FIG. 9 ; Table 14). EC50 values represent the concentration at which 50% of the total binding signal is observed (average and SD were calculated from values of two independent experiments). -
TABLE 14 Antibody anti-hSIRPα hSIRPα.50A (clone SE5A5) hSIRPαV1 EC50 (nM) 0.321 0.117 SD 0.018 0.001 hSIRPαV2 EC50 (nM) 0.215 0.084 SD 0.012 0.012 hSIRPβ1 EC50 (nM) nd 0.180 SD nd 0.025 hSIRPα-VβC1αC2α EC50 (nM) nd 0.121 SD nd 0.003 hSIRPα-VαC1βC2α EC50 (nM) 0.345 0.135 SD 0.008 0.013 hSIRPα-VαC1αC2β EC50 (nM) 0.408 0.127 SD 0.039 0.028 - To pinpoint the amino acids for interaction of hSIRPα.50A with the IgV domain, several point mutants of hSIRPαV1 were generated based on single amino acid differences between hSIRPαV1/V2 and hSIRPβ1.
FIG. 10A shows an alignment of the hSIRPα and hSIRPβ1 IgV domain. Amino acids in the hSIRPα IgV domain that are altered in hSIRPβ1 were mutated by using the QuikChange II Site-Directed Mutagenesis Kit (Stratagene) and the full length hSIRPαV1 sequence (SEQ ID NO: 33) as donor cDNA. Binding of hSIRPα.50A to hSIRPαV1 point mutants was tested using CELISA. To this end, CHO-K1 cells were transiently transfected, usingLipofectamine 2000, with cDNA encoding the full length open reading frame of hSIRPαV1 and mutants thereof, and hSIRPβ1 subcloned into the pCI-neo vector. Transfected cells were seeded in culture medium (DMEM-F12 (Gibco) supplemented with 5% New Born Calf Serum (BioWest) and Pen/Strep (Gibco)) in 96-well flat-bottom tissue culture plates and incubated at 37° C., 5% CO2 and 95% humidity for 24 hours. Subsequently, culture medium was removed and cells were incubated for 1 hour at 37° C., 5% CO2 and 95% humidity with purified hSIRPα antibodies (used at 10m/mL and dilutions thereof). Next, cells were washed with PBS-T and incubated for 1 hour at 37° C., 5% CO2 and 95% humidity with goat-anti-mouse IgG-HRP (Southern Biotech). Subsequently, cells were washed three times with PBS-T and immunoreactivity against hSIRPαV1, hSIRPαV1 mutants, and hSIRPβ1 was visualized with TMB Stabilized Chromogen (Invitrogen). Reactions were stopped with 0.5 M H2SO4 and absorbances were read at 450 and 610 nm. EC50 values, the concentration at which 50% of the total binding signal is observed, were calculated using GraphPad Prism 6 (GraphPad Software, Inc.) (average and SD were calculated from values of two independent experiments). As shown inFIG. 10B and the following Table 15, the Proline at position 74 (P74) constitutes a crucial amino acid for the specific binding of hSIRPα.50A to hSIRPαV1. Expression of hSIRPαV1(P74A) (SEQ ID NO: 61), where P74 is converted to Alanine, on CHO-K1 cells results in loss of hSIRPα.50A antibody binding. This proline is absent in the IgV domain sequence of hSIRPβ1. -
TABLE 15 hSIRPαV1 hSIRPβ1 hSIRPαV1(P74A) binding binding binding EC50 (nM) EC50 (nM) EC50 (nM) Antibody Average SD Average SD Average SD hSIRPα.50A 0.535 0.152 nd nd nd nd anti-hSIRPα 0.164 0.008 0.156 0.009 0.150 0.013 (clone SE5A5) - The binding specificity of antibodies hSIRPα.40A and hSIRPα.50A to hSIRPα were compared in a CELISA format. In short, CHO-K1 cells were transiently transfected with hSIRPαV1, hSIRPαV2, hSIRPβ1, hSIRPβL, and hSIRPγ cDNAs. Subsequently, hSIRPα binding was assessed by CELISA using CHO-K1.hSIRPαV1, CHO-K1.hSIRPαV2, CHO-K1.hSIRPβ1, CHO-K1.hSIRPβ3L, and CHO-K1.hSIRPγ cells. Detection of bound antibody was done with goat-anti-mouse IgG-HRP (Southern Biotech). As shown in
FIG. 11 and the following Table 16, hSIRPα.40A and hSIRPα.50A antibodies bind to hSIRPαV1, hSIRPαV2, hSIRPβL, and hSIRPγ, but do not display detectable hSIRPβ1 binding. EC50 values represent the concentration at which 50% of the total binding signal is observed (average and SD were calculated from values of two independent experiments). -
TABLE 16 hSIRPαV1 binding hSIRPαV2 binding hSIRPβ1 binding hSIRPγ binding hSIRPβL binding EC50 (nM) EC50 (nM) EC50 (nM) EC50 (nM) EC50 (nM) Antibody Average SD Average SD Average SD Average SD Average SD hSIRPα.40A 0.109 0.036 0.088 0.002 nd nd 0.099 0.055 0.141 0.078 hSIRPα.50A 1.428 0.371 1.156 0.127 nd nd 1.990 0.827 0.632 0.277 nd, not detected - In addition, the specificity of hSIRPα.40A for all known of hSIRPα alleles (allelic variants as described by Takenaka et al., Nat Immunol. 8:1313-1323 (2007) was further investigated by CELISA using the same strategy as above. To this end, hSIRPα.40A binding was assessed using CHO-K1 cells that were transiently transfected with cDNAs encoding full length hSIRPαV1, hSIRPαV2, hSIRPαV3 (NA07056_V3) (SEQ ID NO: 44), hSIRPαV4 (NA11832_V4) (SEQ ID NO: 46), hSIRPαV5 (NA18502_V5) (SEQ ID NO: 48), hSIRPαV6 (NA18507_V6) (SEQ ID NO: 50), hSIRPαV8 (NA18570_V8) (SEQ ID NO: 52), and hSIRPαV9 (NA18943_V9) (SEQ ID NO: 54).
FIG. 12 and the following Table 17 demonstrates the reactivity of antibody clone hSIRPα.40A for each of these hSIRPα alleles. EC50 values represent the concentration at which 50% of the total binding signal is observed (average and SD were calculated from values of two independent experiments). -
TABLE 17 Antibody hSIRPα.40A hSIRPα.50A hSIRPαV1 EC50 (nM) 0.134 1.690 hSIRPαV2 EC50 (nM) 0.089 1.066 hSIRPαV3 EC50 (nM) 0.107 1.767 hSIRPαV4 EC50 (nM) 0.100 1.297 hSIRPαV5 EC50 (nM) 0.115 1.260 hSIRPαV6 EC50 (nM) 0.136 2.219 hSIRPαV8 EC50 (nM) 0.089 1.508 hSIRPαV9 EC50 (nM) 0.115 1.367 - The hSIRPα.40A antibody was analyzed by flow cytometry for its ability to block recombinant hCD47/Fc-protein (R&D Systems, Cat.#4670-CD-050; SEQ ID NO: 109) binding to cell surface expressed hSIRPα. For this purpose, THP-1 (ATCC TIB-202) and U-937 (ATCC CRL-1593.2) monocyte cell lines were used as the source of hSIRPα in the assay. THP-1 and U-937 cells were seeded in 96-well round bottomed tissue culture plates and incubated for 45 minutes with FcR Blocking Reagent (Miltenyi Biotec) and hSIRPα.40A antibody (100 μg/mL and dilutions thereof) in PBS/1% BSA at 4° C. Next, cells were washed three times with PBS/1% BSA and incubated with DyLight 488-labeled recombinant hCD47/Fc-protein for 30 minutes at 4° C. After this labeling procedure, cells were washed two times, resuspended in PBS/1% BSA containing 0.1 μg/mL DAPI (BioLegend), and analysed by flow cytometry on the FACSCanto II (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC).
- As depicted in
FIG. 13 and the following Table 18, binding of recombinant hCD47 fused to an Fc domain of human IgG1 was monitored in the presence of increasing amounts of the hSIRPα.40A antibody. Antibody hSIRPα.40A blocked the hSIRPα/hCD47 interaction, using the flow cytometry-based method described above. IC50 values for the blockade of hCD47 were calculated from this data. IC50 values represent the concentration at which half of the inhibition is observed. -
TABLE 18 THP-1 U-937 Antibody IC50 (nM) IC50 (nM) hSIRPα.40A 0.646 1.344 hSIRPα.50A 7.833 19.501 - Next, the binding of hSIRPα.40A to hSIRPα expressed on primary human CD14+ monocytes was investigated. In addition, the ability of hSIRPα.40A to block the interaction between hSIRPα and recombinant hCD47/Fc-protein was assessed. For this purpose, CD14+ monocytes were isolated from Ficoll-purified human peripheral blood mononuclear cells (PBMCs) using RosetteSep human monocyte enrichment cocktail (Stemcell). The percentage of monocytes present after the enrichment was determined by flow cytometry on the FACSVerse (BD Biosciences) based on CD14 staining using an APC-Cy7-conjugated mouse-anti-human CD14 detection antibody (BD Biosciences). Subsequently, CD14+ enriched PBMCs were seeded in 96-well round bottomed tissue culture plates and incubated for 40 minutes with FcR Blocking Reagent (Miltenyi Biotec) containing hSIRPα.40A antibody (20m/mL and dilutions thereof) in PBS/1% BSA at 4° C. Next, cells were washed three times with PBS/1% BSA and incubated with an Alexa Fluor 647-labeled goat-anti-mouse IgG (Invitrogen) detection antibody in PBS/1% BSA for 40 minutes at 4° C. After this labeling procedure, cells were washed two times, resuspended in PBS/1% BSA containing 0.1m/mL DAPI (BioLegend), and analysed by flow cytometry on the FACSVerse (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC).
-
FIGS. 14A and B shows that hSIRPα.40A binds to primary human CD14+ enriched monocytes. EC50 values represent the concentration at which 50% of the total binding signal is observed. To assess the blocking ability of hSIRPα.40A, CD14+ enriched monocytes cells were seeded in 96-well round bottomed tissue culture plates and incubated for 45 minutes with FcR Blocking Reagent (Miltenyi Biotec) and hSIRPα.40A antibody (20m/mL and dilutions thereof) in PBS/1% BSA at 4° C. Thereafter, cells were washed three times with PBS/1% BSA and incubated with 10 μg/mL DyLight 488-labeled recombinant hCD47/Fc-protein for 45 minutes at 4° C. After this labeling procedure, cells were washed two times, resuspended in PBS/1% BSA containing 0.1 μg/mL DAPI (BioLegend), and analysed by flow cytometry on the FACSVerse (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC).FIGS. 14 C and D demonstrates the ability of antibody hSIRPα.40A to block the hSIRPα/hCD47 interaction. IC50 values for the blockade of hCD47 were calculated from this data. IC50 values represent the concentration at which half of the inhibition is observed. - To confirm the functionality of hSIRPα.40A in primary immune cells, granulocytes (e.g. effector cells) were isolated from healthy human donor EDTA blood. First, the EDTA blood of each donor was pooled and centrifuged at 300 g for 6 minutes at 20° C. Next, plasma was removed by aspiration, and the remaining blood cells were gently resuspended. Cells were recovered in red blood cell (RBC) lysis buffer (155 mM NH4C1; 10 mM KHCO3) and incubated for 10 minutes on ice. Next, cells were centrifuged at 300 g for 7 minutes. Supernatants containing lysed RBCs were removed by aspiration, and the remaining blood cells were gently resuspended in RBC lysis buffer and kept on ice for 1 minute. RBC lysis was neutralized by adding assay medium (IMDM (Gibco) supplemented with 10% Fetal Bovine Serum (Gibco) and Pen/Strep (Gibco)). Blood cells were centrifuged at 300 g for 6 minutes and supernatants were removed by aspiration to remove remaining RBCs as much as possible. Subsequently, erythrocyte-lysed blood cells were resuspended in assay medium containing 10 ng/mL IFNγ and cells were incubated for 1 hour at 37° C., 5% CO2 and 95% humidity. Non-adherent blood cells containing human granulocytes were collected by mild washing of the tissue culture plate with assay medium (monocytes are depleted due to adherence to the plastic surface). The percentage of granulocytes present in the cell suspension was determined by flow cytometry on the FACSCanto II (BD Biosciences) based on high forward scatter (FSC) and side scatter (SSC). Binding of hSIRPα.40A to human granulocytes was assessed by incubating the cells for 30 minutes at 4° C. with hSIRPα.40A antibody (25 μg/mL and dilutions thereof) in PBS/1% BSA containing 10% autologous serum (PBS/1% BSA/10% serum). Next, cells were washed three times with PBS/1% BSA/10% serum and incubated for 30 minutes at 4° C. with a FITC-labeled goat-anti-mouse Ig (BD Biosciences) detection antibody. After this labeling procedure, cells were washed two times, resuspended in PBS/1% BSA/10% serum and analysed by flow cytometry on the FACSCanto II (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC).
FIG. 15A and the following Table 19 shows that hSIRPα.40A binds to primary human granulocytes. EC50 values represent the concentration at which 50% of the total binding signal is observed. -
TABLE 19 Donor 1Antibody EC50 (nM) hSIRPα.40A 1.227 hSIRPα.50A 4.298 - Next, Ramos (ECACC 85030802) target cells were fluorescently labeled with cell proliferation dye eFluor450 (eBioscience). Labeling was performed according to manufacturer's instructions. Labeled target cells were co-cultured for 2-3 hours at 37° C., 5% CO2 and 95% humidity with isolated primary human granulocytes in a 1:1 ratio (7.5*104 cells of each target and effector per well of a 96-well round bottomed tissue culture plate) in the presence of 0.1 μg/mL rituximab (anti-hCD20). In addition, cells were co-cultured with 0.1 μg/mL rituximab in presence of 10 μg/mL hSIRPα.40A. Phagocytosis was assayed by determining the percentage of granulocytes positive for eFluor450 using flow cytometry on the FACSCanto II (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC).
- Compared to the mouse IgG1 isotype control, hSIRPα.40A potently enhances tumor cell phagocytosis induced by rituximab (
FIG. 15B ). - Blockade of CD47 by hSIRPα.40A enhances the phagocytosis of human lymphoma cells tumor cells by human macrophages. Human macrophages were generated by first enriching CD14+ monocytes from Ficoll-purified human peripheral blood mononuclear cells (PBMCs) using RosetteSep human monocyte enrichment cocktail (Stemcell). Monocytes were seeded into CellCarrier 96-well flat-bottom microplates (Perkin Elmer) and cultured in macrophage medium (IMDM (Gibco) supplemented with 8.5% Fetal Bovine Serum (Gibco) and Pen/Strep (Gibco)) containing 50 ng/mL human monocyte colony stimulating factor (M-CSF) for 7 days at 37° C., 5% CO2 and 95% humidity to promote differentiation into macrophages. These monocyte-derived macrophages (MDMs) become adherent allowing other cells to be washed away. Human Raji lymphoma cells were counted and labeled with cell proliferation dye eFluor450 (eBioscience) following manufacturer's instructions. After labeling, the lymphoma cells were mixed with assay medium (RPMI (Gibco) supplemented with 10% Fetal Bovine Serum (Gibco) and Pen/Strep (Gibco)) containing 100 μg/mL anti-hSIRPα antibodies and dilutions thereof, the respective isotype control antibody, and 1 μg/mL rituximab (anti-hCD20). The lymphoma cells were then added to the individual wells containing MDMs at a ratio of 2.5:1 tumor cells per phagocyte, mixed and incubated at 37° C., 5% CO2 and 95% humidity for 2 hours. After the incubation, the wells were washed with PBS to remove most of the non-phagocytosed tumor cells, and cells were fixed with 2% formaldehyde for 10 min at RT. The wells were then washed and maintained in PBS/3% BSA in dark at 4° C. overnight. Lymphoma cells present in the wells were stained with biotin-conjugated anti-human CD19 clone HIB19 (eBioscience) for 1 hour at RT, and subsequently were counterstained with Alexa Fluor 488-conjugated streptavidin (Thermo Fisher Scientific) for 1 hour at RT. Next, nuclei were stained with DRAQ5 (Thermo Fisher Scientific) for 10 minutes at RT, mixture was removed, and PBS was added to each well. Cells were analysed with the Operetta automated fluorescence microscope (Perkin Elmer). Data were processed and analysed with Columbus V2.6 software.
- As shown in
FIG. 16 , hSIRPα.40A enhances rituximab-mediated phagocytosis activity. The phagocytosis of human lymphoma cells was quantified using a phagocytosis index, as follows: (number of tumor cells inside macrophages/number of macrophages)*100; counting at least 200 macrophages per sample. - The mouse hSIRPα.40A antibody was humanized using CDR-grafting technology (see e.g. U.S. Pat. No. 5,225,539 and Williams, D. G. et al., 2010, Antibody Engineering,
volume 1, Chapter 21). First, human germline sequences were identified using IgBLAST (Ye J. et al., Nucleic Acids Res. 41:W34-40 (2013). For the hSIRPα.40A VH human germline sequence, V-gene IGHV1-46*01 was identified (62.2% identity) and for the VL human germline sequence IGKV1-39*01 was identified (68.4% identity). These two germline sequences were used as template to graft the mouse CDRs, resulting in the following two cDNA constructs: SEQ ID NO: 87 (VH) and SEQ ID NO: 99 (VL). - Next, a database was constructed containing all human sequences available in the IMGT database (Lefranc, M.-P. et al., Nucleic Acid Res. 27:209-212 (1999)) identifying 85,848 individual sequences. These sequences were queried using TBLASTN (2.2.31+) to identify template sequences that demonstrated the highest identify to the framework of hSIRPα.40A VH and VL sequences. Four VH and four VL sequences were identified that demonstrated a similarity score of 80% or higher and that displayed similar CDR lengths, preferably identical to those in hSIRPα.40A VH CDR1, CDR2, CDR3 and VL CDR1, CDR2 and CDR3, respectively.
- For the heavy chain, the frameworks encoded by GenBank (Benson, D. A. et al., Nucleic Acids Res. 41(D1):D36-42 (2013)) accession # L39130, DJ031925, DJ326840, and EF177968 were selected as templates for grafting of the hSIRPα.40A VH CDRs, resulting in the following cDNA constructs: SEQ ID NO: 77, 79, 81 and 83, respectively. For the light chain, the frameworks encoded by GenBank accession # AY731031, DQ840993, AY942002 and DQ535171 were selected as templates for straight grafting of the hSIRPα.40A VL CDRs, resulting in the following cDNA constructs: SEQ ID NO: 89, 91, 93 and 95. Additionally, a database was constructed containing all humanized antibody sequences available in the public domain, identifying 300 sequences. These sequences were queried using BLASTP (2.2.31+) to identify template sequences that demonstrated the highest identify to the framework of hSIRPα.40A VH and VL sequences. For the heavy chain, the framework of Gemtuzumab was selected as template, for grafting of the hSIRPα.40A VH CDRs, resulting in the following cDNA construct: SEQ ID NO: 85. For the light chain, the framework of Alacizumab was selected as template, for grafting of the hSIRPα.40A VL CDRs, resulting in the following cDNA construct: SEQ ID NO: 97
- Framework and CDR definition were those as described by Kabat et al. (“Sequences of Proteins of Immunological Interest”, Kabat, E., et al., US Department of Health and Human Services, (1983)).
- To study the effect of humanized framework residues on the structure of the Fv, a homology model of the mouse hSIRPα.40A Fv was made using the ‘Antibody Modeling Cascade’ (default parameters) within Discovery Studio 4.5. The homology model was built on basis of PDB ID 3UMT, for the light chain, PDB ID 1EHL for the heavy chain, and PDB ID 3BGF for the Fv. The CDRs were grafted in silico to study residues that are close to any of the CDRs and which might affect the loop conformation, referred to as Vernier residues. Residues that might affect the loop conformation, and which are within <5 Å to the CDR surface were identified and substituted with the mouse amino acid at this position. The resulting templates were checked for the presence of post translational modification (PTM) motifs using Discovery Studio 4.5 and where possible (i.e. non-CDR, non-Vernier residues) changed to prevent a PTM. The VH CDR2 contained a glycosylation site that was removed by an aspargine to serine mutation.
- CDRs were grafted on each of the identified templates, expressed as a human IgG2 (SEQ ID NO: 68), kappa (SEQ ID NO: 64) antibody cloned in the pcDNA3.1(+) vector (Thermo Fisher Scientific) and for transient transfection in FreeStyle 293-F human embryonic kidney cells (HEK293T/17, ATCC CRL-11268).
- Plasmids encoding the heavy chain and light chain humanized constructs were mixed in a 1:1 ratio (30m in total) and transiently expressed by transfection into FreeStyle 293-F cells using 293fectin transfection reagent (Invitrogen) following the manufacturer's instructions. Supernatants (30 ml) were harvested after 7 days, filtered over a 0.22 μm filter, and antibodies were purified using MabSelect Sure Protein A resin according to the manufacturer's instructions (GE Healthcare). Buffer was exchanged for 10 mM Histidine, 100 mM NaCl pH 5.5 buffer using Zeba desalting columns (Thermo Fisher Scientific). The concentration of purified antibodies was determined based on OD280 (Nanodrop ND-1000). Endotoxin level was determined by LAL-test according to the manufacturer's instructions (Lonza).
- Binding of the parental and humanized antibodies to hSIRPα was assessed by flow cytometry using the CHO-K1.hSIRPαV1 stable cell line. CHO-K1.hSIRPαV1 cells were seeded in 96-well round bottomed tissue culture plates and incubated for 40 minutes with the humanized hSIRPα.40A antibody variants (20 μg/mL and dilutions thereof) in PBS/1% BSA at 4° C. Next, cells were washed three times with PBS/1% BSA and incubated for 40 minutes at 4° C. with either an Alexa Fluor 647-labeled goat-anti-mouse IgG (Invitrogen), or an Alexa Fluor 647-labeled donkey-anti-human IgG (Jackson Immuno Research) detection antibody in PBS/1% BSA. After this labeling procedure, cells were washed two times, resuspended in PBS/1% BSA, containing 0.1 μg/mL DAPI (BioLegend), and analysed by flow cytometry on the FACSVerse (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC). EC50 values, the concentration at which 50% of the total binding signal is observed, were calculated using GraphPad Prism 6 (GraphPad Software, Inc.) (
FIG. 17 and Table 20). -
TABLE 20 hSIRPαV1 Antibody EC50 (nM) hSIRPα.40A 0.022 hSIRPα.40H1L1 nd hSIRPα.40H1L2 nd hSIRPα.40H1L3 nd hSIRPα.40H1L4 nd hSIRPα.40H1L5 nd hSIRPα.40H1L6 nd hSIRPα.40H2L1 0.264 hSIRPα.40H2L2 0.298 hSIRPα.40H2L3 0.300 hSIRPα.40H2L4 0.315 hSIRPα.40H2L5 0.284 hSIRPα.40H2L6 0.251 hSIRPα.40H3L1 1.644 hSIRPα.40H3L2 1.404 hSIRPα.40H3L3 1.501 hSIRPα.40H3L4 0.693 hSIRPα.40H3L5 2.302 hSIRPα.40H3L6 0.833 hSIRPα.40H4L1 3.308 hSIRPα.40H4L2 3.360 hSIRPα.40H4L3 3.072 hSIRPα.40H4L4 3.471 hSIRPα.40H4L5 4.828 hSIRPα.40H4L6 3.028 hSIRPα.40H5L1 2.011 hSIRPα.40H5L2 1.919 hSIRPα.40H5L3 2.268 hSIRPα.40H5L4 0.869 hSIRPα.40H5L5 2.954 hSIRPα.40H5L6 2.197 hSIRPα.40H6L1 2.349 hSIRPα.40H6L2 3.002 hSIRPα.40H6L3 3.014 hSIRPα.40H6L4 1.279 hSIRPα.40H6L5 3.785 hSIRPα.40H6L6 2.677 nd, not detected - hCD47 blockade was assessed by flow cytometry for the full panel of humanized hSIRPα.40A antibodies. To this end, the U-937 (ATCC CRL-1593.2) monocyte cell line was used as the source of hSIRPα in the assay. U-937 cells were seeded in 96-well round bottomed tissue culture plates and incubated for 45 minutes with FcR Blocking Reagent (Miltenyi Biotec) and the parental or humanized hSIRPα.40A antibody variants (20 μg/mL and dilutions thereof) in PBS/1% BSA at 4° C. Next, cells were washed three times with PBS/1% BSA and incubated with 10 μg/mL DyLight 488-labeled recombinant hCD47/Fc-protein for 30 minutes at 4° C. After this labeling procedure, cells were washed two times, resuspended in PBS/1% BSA containing 0.1 μg/mL DAPI (BioLegend), and analysed by flow cytometry on the FACSVerse (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC) and plotted using GraphPad Prism 6 (GraphPad Software, Inc.).
- As depicted in
FIG. 18 and the following Table 21, binding of recombinant hCD47 fused to an Fc domain of human IgG1 was monitored in the presence of increasing amounts of the humanized hSIRPα.40A antibody variants. Humanized hSIRPα.40A blocked the hSIRPα/hCD47 interaction, using the flow cytometry-based method described above. IC50 values for the blockade of hCD47 were calculated from this data. IC50 values represent the concentration at which half of the inhibition is observed. -
TABLE 21 U-937 Antibody IC50 (nM) hSIRPα.40A 1.122 hSIRPα.40H1L1 nd hSIRPα.40H1L2 nd hSIRPα.40H1L3 nd hSIRPα.40H1L4 nd hSIRPα.40H1L5 nd hSIRPα.40H1L6 nd hSIRPα.40H2L1 0.638 hSIRPα.40H2L2 0.773 hSIRPα.40H2L3 0.685 hSIRPα.40H2L4 0.718 hSIRPα.40H2L5 0.745 hSIRPα.40H2L6 0.901 hSIRPα.40H3L1 0.980* hSIRPα.40H3L2 nd h5IRPα.40H3L3 2.625* hSIRPα.40H3L4 1.784* hSIRPα.40H3L5 2.435* hSIRPα.40H3L6 97.762* hSIRPα.40H4L1 10.002* hSIRPα.40H4L2 7.579* hSIRPα.40H4L3 75.422* hSIRPα.40H4L4 3.153* hSIRPα.40H4L5 5.171* hSIRPα.40H4L6 3.512* hSIRPα.40H5L1 34.977* hSIRPα.40H5L2 nd hSIRPα.40H5L3 nd hSIRPα.40H5L4 10.772* hSIRPα.40H5L5 nd hSIRPα.40H5L6 0.247* hSIRPα.40H6L1 2.391* hSIRPα.40H6L2 20.427* hSIRPα.40H6L3 9.208* hSIRPα.40H6L4 3.797* hSIRPα.40H6L5 20.421* hSIRPα.40H6L6 9.750* Values indicated with * were extrapolated; nd, not detected - To identify the binding region of hSIRPα.40A, several SIRPβ1 exchange-mutants were designed based on the human SIRPβ1 and SIRPγ amino acid sequences. Based on the fold of SIRPα/β1/γ, the extracellular region can be subdivided into three separate domains: the Ig-like (immunoglobulin-like) V-type (IgV), Ig-like C1-type (IgC1), and Ig-like C2-type (IgC2) domain. The IgV domain is also known as the ligand-binding N-terminal domain of SIRPα and SIRPγ (which binds to CD47). The human SIRPβ1/γ mutants were designed based on the full length hSIRPβ1 sequence (SEQ ID NO: 38) and each individual Ig-like domain was substituted for the equivalent domain of human SIRPγ (SEQ ID NO: 40). The cDNAs encoding the constructs, hSIRP-VγC1βC2β (SEQ ID NO: 110), hSIRP-VβC1γC2β (SEQ ID NO: 112), and hSIRP-VβC1βC2γ (SEQ ID NO: 114) were synthesized (GeneArt) and subcloned into the pCI-neo vector. Binding of hSIRPα.40A to the exchange mutants was tested using CELIS A. To this end, CHO-K1 cells were transiently transfected, using
Lipofectamine 2000, with the pCI-neo vectors encoding hSIRPαV1, hSIRPαV2, hSIRPβ1, hSIRP-VγC1βC2β, hSIRP-VβC1γC2β, and hSIRP-VβC1βC2γ, respectively. The transfected cells were cultured at 37° C., 5% CO2 and 95% humidity in medium (DMEM-F12 (Gibco) with 5% New Born Calf serum (Biowest) and Pen/Strep (Gibco)) until confluent. Subsequently, cells were trypsinized and seeded in 96-well flat-bottom tissue culture plates and cultured at 37° C., 5% CO2 and 95% humidity in culture medium until confluent. Then, culture medium was removed and cells were incubated for 1 hour at 37° C., 5% CO2 and 95% humidity with hSIRPα.40A, hSIRPα.50A, and anti-hSIRPγ clone SE5A5 antibodies. Next, cells were washed with PBS-T and incubated for 1 hour at 37° C., 5% CO2 and 95% humidity with goat-anti-mouse IgG-HRP conjugate (Southern Biotech). After that, cells were washed three times with PBS-T and anti-hSIRPγ immunoreactivity was visualized with TMB Stabilized Chromogen (Invitrogen). Reactions were stopped with 0.5 M H2SO4 and absorbances were read at 450 and 610 nm. - The antibody of the present invention demonstrated gain of binding to the hSIRP-VγC1βC2β mutant, indicating that hSIRPα.40A binds to the IgV domain of hSIRPγ and hSIRPγ (
FIG. 19 and Table 22). EC50 values represent the concentration at which 50% of the total binding signal is observed (average and SD were calculated from values of two independent experiments). -
TABLE 22 Antibody anti-hSIRPα hSIRPα.40A hSIRPα.50A (clone SE5A5) hSIRPαV1 EC50 (nM) 0.133 0.968 0.350 SD 0.065 0.432 0.136 hSIRPαV2 EC50 (nM) 0.101 0.821 0.224 SD 0.051 0.183 0.076 hSIRPβ1 EC50 (nM) nd nd 0.249 SD nd nd 0.091 hSIRP- EC50 (nM) 0.123 2.524 0.287 VγC1βC2β SD 0.040 0.609 0.026 hSIRP- EC50 (nM) nd nd 0.309 VβC1γC2β SD nd nd 0.140 hSIRP- EC50 (nM) nd nd 0.231 VβC1βC2γ SD nd nd 0.079 nd, not detected - To pinpoint the amino acids for interaction of hSIRPα.40A with the IgV domain, several point mutants of hSIRPαV1 were generated based on single amino acid differences between hSIRPαV1/V2 and hSIRPβ1. The following sequence alignment shows an alignment of the hSIRPα and hSIRPβ1 IgV domain.
-
- Amino acids in the hSIRPα IgV domain that are altered in hSIRPβ1 were mutated by using the QuikChange II Site-Directed Mutagenesis Kit (Stratagene) and the full length hSIRPαV1 sequence (SEQ ID NO: 33) as donor cDNA. Binding of hSIRPα.40A to hSIRPαV1 point mutants was tested using CELISA. To this end, CHO-K1 cells were transiently transfected, using
Lipofectamine 2000, with cDNA encoding the full length open reading frame of hSIRPαV1 and mutants thereof, and hSIRPβ1 subcloned into the pCI-neo vector. Transfected cells were seeded in culture medium (DMEM-F12 (Gibco) supplemented with 5% New Born Calf Serum (BioWest) and Pen/Strep (Gibco)) in 96-well flat-bottom tissue culture plates and incubated at 37° C., 5% CO2 and 95% humidity for 24 hours. Subsequently, culture medium was removed and cells were incubated for 1 hour at 37° C., 5% CO2 and 95% humidity with purified hSIRPα antibodies (used at 10m/mL and dilutions thereof). Next, cells were washed with PBS-T and incubated for 1 hour at 37° C., 5% CO2 and 95% humidity with goat-anti-mouse IgG-HRP (Southern Biotech). Subsequently, cells were washed three times with PBS-T and immunoreactivity against hSIRPαV1, hSIRPαV1 mutants, and hSIRPβ1 was visualized with TMB Stabilized Chromogen (Invitrogen). Reactions were stopped with 0.5 M H2SO4 and absorbances were read at 450 and 610 nm. EC50 values, the concentration at which 50% of the total binding signal is observed, were calculated using GraphPad Prism 6 (GraphPad Software, Inc.) (average and SD were calculated from values of two independent experiments). - As shown in
FIG. 20 and the following Table 23, the Proline at position 74 (P74) constitutes a crucial amino acid for the specific binding of hSIRPα.40A to hSIRPαV1. Expression of hSIRPαV1(P74A) (SEQ ID NO: 61), where P74 is converted to Alanine, on CHO-K1 cells results in loss of hSIRPα.40A antibody binding. This proline is not present in the IgV domain sequence of hSIRPβ1, and could play a role in the correct conformation of the IgV domain. -
TABLE 23 hSIRPαV1 hSIRPβ1 hSIRPαV1(P74A) binding binding binding EC50 (nM) EC50 (nM) EC50 (nM) Antibody Average SD Average SD Average SD hSIRPα.40A 0.065 0.006 nd nd nd nd hSIRPα.50A 0.534 0.152 nd nd nd nd anti-hSIRPα 0.163 0.008 0.156 0.009 0.149 0.013 (clone SE5A5) nd, not detected - The functionality of hSIRPα.40A variable domains, grafted on different Fc constant domains, was assessed by an in vitro phagocytosis assay using human macrophages. Experimental conditions for the human macrophage phagocytosis assay were similar as explained in Example 15 above. Labelled Raji lymphoma cells were mixed with assay medium containing either 10 μg/mL or 1 μg/mL chimeric hSIRPα.40A antibody variants and 1 μg/mL rituximab and then added to MDMs at a ratio of 2.5:1 tumor cells per phagocyte. Cells were incubated at 37° C., 5% CO2 and 95% humidity for 2 hours.
- Analysis was performed with the Operetta automated fluorescence microscope (Perkin Elmer) and data were processed and analysed with Columbus V2.6 software. The phagocytosis of human lymphoma cells was quantified using a phagocytosis index, as follows: (number of tumor cells inside macrophages/number of macrophages)*100; counting at least 200 macrophages per sample.
- As shown in
FIG. 21 , the wild-type (WT) chimeric hSIRPα.40A.hIgG4 antibody does not enhance rituximab-mediated phagocytosis, whereas inert chimeric hSIRPα.40A.hIgG1 (SEQ ID NO: 119) antibody variants containing N297Q (SEQ ID NO: 126), L234A.L235A (LALA) (SEQ ID NO: 123), or L234A.L235A.P329G (LALAPG) (SEQ ID NO: 125) mutations enhance rituximab-mediated phagocytosis activity in a concentration-dependent manner. Likewise, hSIRPα.40A.hIgG2 and the inert chimeric hSIRPα.40A.hIgG2 antibody variant containing V234A.G237A.P238S.H268A.V309L.A330S.P331S (Sigma) (SEQ ID NO: 122) mutations enhance rituximab-mediated phagocytosis activity in a concentration-dependent manner. - The functionality of a selected set of the humanized hSIRPα.40A antibody variants was assessed by an in vitro phagocytosis assay using human macrophages. Experimental conditions for the human macrophage phagocytosis assay were similar as explained in Example 6.
- As shown in
FIG. 22 , the humanized hSIRPα.40A antibody variants enhance rituximab-mediated phagocytosis activity in a concentration-dependent manner similar to antibody KWAR23 grafted on a hIgG2 Fc. - The functionality of hSIRPα.50A variable domains, grafted on different Fc constant domains, was assessed by in vitro phagocytosis assays using human macrophages. As shown in
FIG. 23A , the chimeric hSIRPα.50A.hIgG4 antibody marginally enhances rituximab-mediated phagocytosis, whereas the chimeric hSIRPα.50A.hIgG2 antibody enhances rituximab-mediated phagocytosis activity similar to the murine hSIRPα.50A.mIgG1 (SEQ ID NO: 120) antibody.FIG. 23B demonstrates that the chimeric hSIRPα.50A.hIgG2 antibody potently enhances tumor cell phagocytosis induced by rituximab in a concentration-dependent manner as compared to the human IgG2 isotype control. Similarly, hSIRPα.50A.hIgG2 enhanced daratumumab-mediated phagocytosis (anti-hCD38, used at 0.05 μg/mL) (FIG. 23C ). - In addition, hSIRPα.50A.hIgG2 also enhanced rituximab-mediated phagocytosis in human granulocytes. As shown in
FIG. 23D , the chimeric hSIRPα.50A.hIgG2 antibody enhances phagocytosis activity induced by rituximab to a similar extend as the murine hSIRPα.50A.mIgG1 antibody. Likewise, as shown inFIG. 24A , the chimeric hSIRPα.50A.hIgG1.N297Q, hSIRPα.50A.hIgG4.N297Q (SEQ ID NO: 127) or hSIRPα.50A.hIgG2 antibodies enhance rituximab-mediated phagocytosis activity by human MDMs to a similar extent as the murine hSIRPα.50A.mIgG1 antibody (rituximab used at 1 μg/mL). Similar observations were made inFIG. 24B when phagocytosis was induced by daratumumab (0.05 μg/mL). As shown inFIG. 25 , the chimeric hSIRPα.50A.hIgG1.N297Q and hSIRPα.50A hIgG1.L234A.L235A.P329G antibodies also enhance rituximab-mediated phagocytosis activity by human MDMs to a similar extent as the or hSIRPα.50A.hIgG2 antibody (rituximab used at 1 μg/mL). Chimeric variants of hSIRPα.50A mAb containing a wild-type hIgG1 or hIgG4 Fc region did not enhance tumor cell phagocytosis. - A direct comparison of the specificity of monoclonal anti-hSIRPα antibodies KWAR23, clone 18D5 (SEQ ID NO: 128; SEQ ID NO: 129) from WO2017/178653, hSIRPα.50A, and hSIRPα.40A for binding to hSIRPαV1, hSIRPαV1(P74A), hSIRPαV2, and hSIRPβ1 was evaluated by CELISA. Reactivity was confirmed using CHO-K1 cells (ATCC CCL-61) expressing a cDNA encoding the full length open reading frame of hSIRPαV1, hSIRPαV1(P74A), hSIRPαV2, and hSIRPβ1 subcloned into the pCI-neo vector (Promega, Madison, Wis.). CHO-K1.hSIRPαV1, CHO-K1.hSIRPαV1(P74A), CHO-K1.hSIRPαV2, and CHO-K1.hSIRPβ1 cells were seeded in culture medium (DMEM-F12 (Gibco) supplemented with 5% New Born Calf Serum (BioWest) and Pen/Strep (Gibco)) in 96-well flat-bottom tissue culture plates and incubated at 37° C., 5% CO2 and 95% humidity for 24 hours. Subsequently, culture medium was removed and cells were incubated for 1 hour at 37° C., 5% CO2 and 95% humidity with purified hSIRPα antibodies (used at 10m/mL and dilutions thereof). Next, cells were washed with PBS-T and incubated for 1 hour at 37° C., 5% CO2 and 95% humidity with goat-anti-mouse IgG-HRP (Southern Biotech). Subsequently, cells were washed three times with PBS-T and immunoreactivity against hSIRPαV1, hSIRPαV1(P74A), hSIRPαV2, and hSIRPβ1 was visualized with TMB Stabilized Chromogen (Invitrogen). Reactions were stopped with 0.5 M H2SO4 and absorbances were read at 450 and 610 nm. EC50 values, the concentration at which 50% of the total binding signal is observed, were calculated using GraphPad Prism 6 (GraphPad Software, Inc.).
- Binding to hSIRPγ was assessed by flow cytometry using the Jurkat E6.1 T cell leukemia cell line (ECACC 88042803). Jurkat cells were seeded in 96-well round bottomed tissue culture plates and incubated for 40 minutes with the anti-hSIRPα antibodies (20m/mL and dilutions thereof) in PBS/1% BSA at 4° C. Next, cells were washed three times with PBS/1% BSA and incubated for 40 minutes at 4° C. with an Alexa Fluor 647-labeled goat-anti-mouse IgG (Invitrogen) detection antibody in PBS/1% BSA. After this labeling procedure, cells were washed two times, resuspended in PBS/1% BSA, containing 0.1m/mL DAPI (BioLegend), and analysed by flow cytometry on the FACSVerse (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC). EC50 values, the concentration at which 50% of the total binding signal is observed, were calculated using GraphPad Prism 6 (GraphPad Software, Inc.).
- As depicted in Table 24, KWAR23 and clone 18D5 antibodies cross-react with at least hSIRPβ1 and the P74A variant of hSIRPαV1. The hSIRPα.50A, and hSIRPα.40A antibodies of the present invention do not bind to either hSIRPβ1 or the P74A variant of hSIRPαV1 under the tested conditions. In this regard, the hSIRPα.50A, and hSIRPα.40A antibodies of the present invention similarly distinguish from antibody clone SIRP29 from WO2013/056352.
FIGS. 7A and B of WO2017/178653 compares clone SIRP29 and KWAR23 binding to SIRPβ1 (referred to as “sirp-b”, Product No. ABIN3077231 from antibodies-online.com), demonstrating that each of clone SIRP29 and KWAR23 has nanomolar affinity for SIRPβ1. -
TABLE 24 hSIRPαV1 hSIRPαV1 hSIRPαV2 hSIRPβ1 hSIRPγ binding (P74A) binding binding binding EC50 binding EC50 EC50 EC50 Antibody (nM) EC50 (nM) (nM) (nM) (nM) hSIRPα.40A 0.114 nd 0.093 nd 0.369 hSIRPα.50A 0.773 nd 0.645 nd — KWAR23 0.070 0.049 0.049 0.033 0.003 18D5 0.134 0.055 nd 0.055 nd nd, not detected; — not tested - hCD47 blockade for the KWAR23, clone 18D5, and hSIRPα.40A antibodies was assessed by flow cytometry. For this purpose, THP-1 (ATCC TIB-202) and U-937 (ATCC CRL-1593.2) monocyte cell lines were used as the source of hSIRPα in the assay. THP-1 and U-937 cells were seeded in 96-well round bottomed tissue culture plates and incubated for 45 minutes with FcR Blocking Reagent (Miltenyi Biotec) and indicated anti-hSIRPα antibodies (20 μg/mL and dilutions thereof) in PBS/1% BSA at 4° C. Next, cells were washed three times with PBS/1% BSA and incubated with 10 μg/mL DyLight 488-labeled recombinant hCD47/Fc-protein for 30 minutes at 4° C. After this labeling procedure, cells were washed two times, resuspended in PBS/1% BSA containing 0.1 μg/mL DAPI (BioLegend), and analysed by flow cytometry on the FACSVerse (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC) and plotted using GraphPad Prism 6 (GraphPad Software, Inc.). Binding of recombinant hCD47 fused to an Fc domain of human IgG1 was monitored in the presence of increasing amounts of the anti-hSIRPα antibodies. IC50 values for the blockade of hCD47 were calculated from this data. IC50 values represent the concentration at which half of the inhibition is observed.
- As depicted in Table 18 and Table 25, hSIRPα.40A, hSIRPα.50A, and KWAR23 antibodies block rhCD47/Fc binding to both the THP-1 and U-937 monocyte cell lines which express the hSIRPαV2 and hSIRPαV1 allele, respectively. Antibody clone 18D5 blocks rhCD47/Fc binding to the U-937 monocyte cell line but does not block rhCD47/Fc binding to the THP-1 monocyte cell line, in line with the observation that 18D5 does not bind to hSIRPαV2 (Table 24). In this regard, the hSIRPα.50A, and hSIRPα.40A antibodies of the present invention similarly distinguish from antibody clone 18D5.
-
TABLE 25 THP-1 U-937 Antibody IC50 (nM) IC50 (nM) hSIRPα.40A 0.548 1.417 KWAR23 0.132 0.284 18D5 nd 1.522 nd, not detected - The amino acids on hSIRPα that are bound by hSIRPα.40A or hSIRPα.50A were elucidated by a procedure that involves deuterated chemical cross-linking followed by enzymatic digestion and detection using mass spectrometry. First, antibody hSIRPα.40A and antigen rhSIRPα-HIS (SinoBiological 11612-H08H-100, SEQ ID NO: 132), or antibody hSIRPα.50A and antigen rhSIRPα-HIS were incubated to promote binding and integrity and aggregation level were verified by Ultraflex III MALDI TOF mass spectrometer (Bruker) equipped with a HM4 interaction module (CovalX). For these control experiments a dilution series of 10 μL samples of antibody or antigen (1- to 128-fold dilution, starting at 1 mg/mL) were prepared. Of each sample 9 μL was submitted to cross-linking using K200 MALDI MS analysis kit, according to the manufacturer's instructions (CovalX) and incubated for 180 minutes, while 1 μL was directly used for mass spectrometry analysis (High-Mass MALDI). The mass spectrometry analysis showed the antibody and antigen had the expected molecular weight: hSIRPα.40A=151.68 kDa (152.78 kDa with cross-linker), hSIRPα.50A=151.80 kD (153.17 kDa with cross-linker), and rhSIRPα-HIS=46.05 kDa (48.67 kDa with cross-linker). For characterization of the antigen-antibody complex, a mixture was made with an excess of antigen (antigen:antibody ratio for rhSIRPα-HIS:hSIRPα.40A 10.8 μM:8.5 μM, and antigen:antibody ratio for rhSIRPα-HIS:hSIRPα.50A 5.4 μM:2.13 μM). A 9 μL sample of the antigen-antibody mixture was submitted to cross-linking using K200 MALDI MS analysis kit, according to the manufacturer's instructions, while 1 μL was directly used for mass spectrometry analysis. The detected mass of the antibody and antigen (hSIRPα.40A: 151.18 kDa, rhSIRPα-HIS 45.93 kDa, hSIRPα.50A: 151.69 kDa, rhSIRPα-HIS 46.18 kDa) corresponds to the molecular weight as detected previously. The antigen-antibody complexes, after cross-linking, were detected as two non-covalent complexes with a 1:1 (195.24 kDa) and 2:1 (240.48 kDa) stoichiometry for rhSIRPα-HIS:hSIRPα.40A, and as one non-covalent complex with a 1:1 (198.24 kDa) stoichiometry for rhSIRPα-HIS:hSIRPα.50A. Antibody and antigen bound non-covalent; non-covalent aggregates or non-specific multimers were not detected.
- Next, peptide mass fingerprinting of rhSIRPα-HIS was performed. Samples were submitted to ASP-N, trypsin, chymotrypsin, elastase and thermolysin (Roche Diagnostic) proteolysis, following manufacturer's instructions followed by analysis by nLC-LTQ Orbitrap MS/MS using an Ultimate 3000 (Dionex) system in line with a LTQ Orbitrap XL mass spectrometer (Thermo Scientific). This proteolysis array resulted in 98% of the sequence being covered by the identified peptides.
- To determine the interacting amino acids of antibody hSIRPα.40A and hSIRPα.50A on rhSIRPα-HIS antigen with high resolution, the antigen-antibody complex (rhSIRPα-HIS:hSIRPα.40A ratio 10.8 μM:8.5 μM, rhSIRPα-HIS:hSIRPα.50A ratio 5.4 μM:2.13 μM) was incubated with deuterated cross-linkers d0/d12 (K200 MALDI Kit) for 180 minutes and subjected to multi-enzymatic cleavage with the enzymes ASP-N, trypsin, chymotrypsin, elastase and thermolysin. After enrichment of the cross-linked peptides, the samples were analyzed by high-resolution mass spectrometry (nLC-Orbitrap MS) and the data generated were analyzed using XQuest (Jin Lee, Mol. Biosyst. 4:816-823 (2008)) and Stavrox (Gotze et al., J. Am. Soc. Mass Spectrom. 23:76-87 (2012)). The interacting amino acids of hSIRPα.40A and hSIRPα.50A to rhSIRPα-HIS were mapped onto human SIRPαV1 (SEQ ID NO: 34). Cross-linked residues of hSIRPα.40A are depicted as bold, boxed, and hSIRPα.50A as bold, underlined:
-
MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVAAGETATLRCTATSLIPVG DFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEVAHVTLQGDPLRGTANLSETIRVPPTL EVTQQPVRAENQVNVTCQVRKFYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNV SAHRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSNERNIYIVVGVVCTLLV ALLMAALYLVRIRQKKAQGSTSSTRLHEPEKNAREITQDTNDITYADLNLPKGKKPAPQAAEPN NHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK - The C-alpha distance between residue P74 and the identified cross-linked residues was measured in Discovery Studio using the crystal structure of SIRPα (PDB ID 4CMM). The cross-linked residues identified for hSIRPα.50A are within 14.0 to 21.4 angstrom C-alpha atom distance from residue P74; the cross-linked residues identified for hSIRPα.40A are within 16.2 to 33.5 angstrom C-alpha atom distance from residue P74. The C-alpha distances fit within the expected range for an epitope-paratope surface area of 700 Å2 (Rowley et al., Biotech. Ann. Rev. 10:151-188 (2004)). The identified residues and surface area are distinctly different from the binding epitope of anti-hSIRPα antibody KWAR23 (Ring et al., Proc. Natl Acad. Sci. USA 114:E10578-E10585 (2017)).
- The specificity of monoclonal anti-hSIRPα antibodies (e.g., including the hSIRPα antibodies known in the art, KWAR23 (U.S. Patent CA2939293 A1), 18D5 (Patent WO2017/178653 A2), and various commercially available hSIRPα antibodies) for binding to hSIRPαV1, hSIRPαV1(P74A), and hSIRPβ1 was evaluated by CELISA. Reactivity was confirmed using CHO-K1 cells (ATCC CCL-61) expressing a cDNA encoding the full length open reading frame of hSIRPαV1, hSIRPαV1(P74A), and hSIRPβ1 subcloned into the pCI-neo vector (Promega, Madison, Wis.). CHO-K1.hSIRPαV1, CHO-K1.hSIRPαV1(P74A), and CHO-K1.hSIRPβ1 cells were seeded in culture medium (DMEM-F12 (Gibco) supplemented with 5% New Born Calf Serum (BioWest) and Pen/Strep (Gibco)) in 96-well flat-bottom tissue culture plates and incubated at 37° C., 5% CO2 and 95% humidity for 24 hours. Subsequently, culture medium was removed and cells were incubated for 1 hour at 37° C., 5% CO2 and 95% humidity with purified hSIRPα antibodies (used at 10 μg/ml and dilutions thereof). Next, cells were washed with PBS-T and incubated for 1 hour at 37° C., 5% CO2 and 95% humidity with either goat-anti-mouse IgG-HRP (Southern Biotech), goat-anti-human IgG-HRP (Jackson Immuno Research), or goat-anti-rabbit IgG-HRP (Southern Biotech). Subsequently, cells were washed three times with PBS-T and immunoreactivity against hSIRPαV1, hSIRPαV1(P74A), and hSIRPβ1 was visualized with TMB Stabilized Chromogen (Invitrogen). Reactions were stopped with 0.5 M H2SO4 and absorbances were read at 450 and 610 nm. EC50 values, the concentration at which 50% of the total binding signal is observed, were calculated using GraphPad Prism 6 (GraphPad Software, Inc.)
- As depicted in Table 26, KWAR23, clone 18D5, and all commercially available monoclonal anti-hSIRPα antibodies are able to bind to the P74A variant of hSIRPαV1 whereas the hSIRPα.40A and hSIRPα.50A antibodies of the present invention do not bind to the P74A variant of hSIRPαV1 under the tested conditions.
-
TABLE 26 hSIRPαV1 hSIRPαV1 hSIRPβ1 binding (P74A) binding EC50 binding EC50 Antibody (nM) EC50 (nM) (nM) hSIRPα.40A 0.053 nd nd hSIRPα.50A 0.307 nd nd KWAR23 0.135 0.077 0.065 18D5 0.128 0.073 0.064 anti-hSIRPα (clone SE5A5) 0.156 0.207 0.105 anti-hSIRPα (clone 7B3) 0.122 0.141 0.115 anti-hSIRPα (clone 1C6) 0.329 0.440 >2.817 anti-hSIRPα (clone 27) nd nd nd anti-hSIRPα (clone SE7C2) >7.010 >6.139 nd anti-hSIRPα (clone P3C4) 0.179 0.197 0.160 anti-hSIRPα (clone 2A4A5) nd nd >6.456 anti-hSIRPα (clone 15-414) nd nd nd anti-hSIRPα (clone 1H1) nd nd nd anti-hSIRPα (clone C-7) nd nd nd anti-hSIRPα (clone 03) >8.247 >8.992 >6.092 anti-hSIRPα (clone 5E10) nd nd nd anti-hSIRPα (clone 602411) 0.047 0.076 0.051 anti-hSIRPα (clone EPR16264) >1.166 >1.999 nd anti-hSIRPα (clone D6I3M) >6.413 >121.509 nd anti-hSIRPα (clone 001) >0.868 >1.192 nd anti-hSIRPα (clone REA144) >3.661 >4.793 >3.075 nd, not detected -
-
SEQ ID Description NO: SEQUENCE 50A heavy chain 1 NYYIH CDR1 (amino acid sequence) 50A heavy chain 2 WIYPGNVNTKYNEKFKA CDR2 (amino acid sequence) 50A heavy chain 3 PTIIATDFDV CDR3 (amino acid sequence) 50A light chain CDR1 4 KASQGVGTAVG (amino acid sequence) 50A light chain CDR2 5 WASTRHT (amino acid sequence) 50A light chain CDR3 6 QQYSTYPFT (amino acid sequence) humanized 50 heavy 7 EVQLX1X2SGX3EX4VKPGASVX5X6SCKASGFTFTNYYIHWVRQX7P chain variable region X8QGLEWX9GWIYPGNVNTKYNEKFKAX10X11X12X13TADKSTSTX14 (consensus sequence) YMX15LSSLX16SX17DX18AVYYCARPTIIATDFDVWGQGTX19VTVS S wherein: X1 = Q, V X2 = Q, E X3 = A, S X4 = V, L X5 = K, M X6 = V, I X7 = A, R X8 = G, E X9 = I, M X10 = R, K X11 = V, A X12 = T, I X13 = I, M X14 = A, V X15 = D, E, Q X16 = R, T X17 = E, D X18 = T, M X19 = T, L humanized 50 light 8 X1X2X3X4TQSPSX5LSASVGDRVTITCKASQGVGTAVGWYQX6KPGK chain variable region X7PKLLIYWASTRHTGVPDRFSGSGSGTX8FTLX9IX10X11LQPEDX (consensus sequence) 12AX13YYCQQYSTYPFTFGGGTKX14EIK wherein: X1 = D, E X2 = I, L X3 = V, Q X4 = L, M X5 = F, S X6 = Q, K X7 = A, S, V X8 = E, D X9 = T, A X10 = S, N X11 = S, N, G X12 = F, I, V X13 = A, D, T X14 = L, V hSIRPα.50AVH1 9 GAAGTGCAGCTGCAGCAGTCTGGCGCCGAGGTCGTGAAACCTGGCG (nucleotide sequence) CCTCTGTGAAGGTGTCCTGCAAGGCCTCCGGCTTCACCTTCACCAA CTACTACATCCACTGGGTGCGACAGGCCCCAGGCCAGGGACTGGAA TGGATCGGCTGGATCTACCCCGGCAACGTGAACACCAAGTACAACG AGAAGTTCAAGGCCCGCGTGACCATCACCGCCGACAAGTCTACCTC CACCGCCTACATGGACCTGTCCTCCCTGAGATCCGAGGACACCGCC GTGTACTACTGCGCCAGACCCACCATCATTGCCACCGACTTCGACG TGTGGGGCCAGGGCACAACCGTGACCGTGTCCTCT hSIRPα.50AVH1 10 EVQLQQSGAEVVKPGASVKVSCKASGFTFTNYYIHWVRQAPGQGLE (amino acid sequence) WIGWIYPGNVNTKYNEKFKARVTITADKSTSTAYMDLSSLRSEDTA VYYCARPTIIATDFDVWGQGTTVTVSS hSIRPα.50AVH2 11 GAAGTGCAGCTGGTGGAATCCGGCTCCGAGCTCGTGAAGCCTGGCG (nucleotide sequence) CCTCCGTGAAGGTGTCCTGCAAGGCCTCTGGCTTCACCTTCACCAA CTACTACATCCACTGGGTGCGACAGGCCCCAGGCCAGGGACTGGAA TGGATGGGCTGGATCTACCCCGGCAACGTGAACACCAAGTACAACG AGAAGTTCAAGGCCAAGGCCACCATCACCGCCGACAAGTCCACCTC CACCGCCTACATGGAACTGTCCTCCCTGCGGAGCGAGGACACCGCC GTGTACTACTGTGCCCGGCCTACCATCATTGCCACCGACTTCGATG TGTGGGGCCAGGGCACACTCGTGACCGTGTCCTCT hSIRPα.50AVH2 12 EVQLVESGSELVKPGASVKVSCKASGFTFTNYYIHWVRQAPGQGLE (amino acid sequence) WMGWIYPGNVNTKYNEKFKAKATITADKSTSTAYMELSSLRSEDTA VYYCARPTIIATDFDVWGQGTLVTVSS hSIRPα.50AVH3 13 GAAGTGCAGCTGGTGCAGTCTGGCGCCGAGGTCGTGAAACCTGGCG (nucleotide sequence) CCTCCGTGATGATCTCCTGCAAGGCCTCCGGCTTCACCTTCACCAA CTACTACATCCACTGGGTGCGACAGCGGCCAGGCCAGGGACTGGAA TGGATCGGCTGGATCTACCCCGGCAACGTGAACACCAAGTACAACG AGAAGTTCAAGGCCCGCGTGATCATGACCGCCGACAAGTCCACCTC CACCGTGTACATGCAGCTGTCCTCCCTGACCTCCGAGGACACCGCC GTGTACTACTGCGCCAGACCCACCATCATTGCCACCGACTTCGACG TGTGGGGCCAGGGCACACTCGTGACCGTGTCCTCT hSIRPα.50AVH3 14 EVQLVQSGAEVVKPGASVMISCKASGFTFTNYYIHWVRQRPGQGLE (amino acid sequence) WIGWIYPGNVNTKYNEKFKARVIMTADKSTSTVYMQLSSLTSEDTA VYYCARPTIIATDFDVWGQGTLVTVSS hSIRPα.50AVH4 15 GAAGTGCAGCTGCAGCAGTCTGGCGCCGAGCTCGTGAAACCTGGCG (nucleotide sequence) CCTCTGTGAAGGTGTCCTGCAAGGCCTCCGGCTTCACCTTCACCAA CTACTACATCCACTGGGTGCGACAGCGGCCAGGCCAGGGACTGGAA TGGATGGGCTGGATCTACCCCGGCAACGTGAACACCAAGTACAACG AGAAGTTCAAGGCCAAGGCCACCATCACCGCCGACAAGTCCACCTC CACCGCCTACATGGAACTGTCCTCCCTGACCTCCGAGGACACCGCC GTGTACTACTGCGCCAGACCCACCATCATTGCCACCGACTTCGACG TGTGGGGCCAGGGCACAACCGTGACCGTGTCCTCT hSIRPα.50AVH4 16 EVQLQQSGAELVKPGASVKVSCKASGFTFTNYYIHWVRQRPGQGLE (amino acid sequence) WMGWIYPGNVNTKYNEKFKAKATITADKSTSTAYMELSSLTSEDTA VYYCARPTIIATDFDVWGQGTTVTVSS hSIRPα.50AVH5 17 GAAGTGCAGCTGGTGCAGTCTGGCGCCGAGGTCGTGAAACCTGGCG (nucleotide sequence) CCTCTGTGAAGGTGTCCTGCAAGGCCTCCGGCTTCACCTTCACCAA CTACTACATCCACTGGGTGCGACAGGCCCCCGAGCAGGGACTGGAA TGGATCGGCTGGATCTACCCCGGCAACGTGAACACCAAGTACAACG AGAAGTTCAAGGCCCGCGTGACCATGACCGCCGACAAGTCTACCTC CACCGCCTACATGGAACTGTCCTCCCTGCGGAGCGACGACATGGCC GTGTACTACTGCGCCAGACCCACCATCATTGCCACCGACTTCGACG TGTGGGGCCAGGGCACAACCGTGACCGTGTCCTCT hSIRPα.50AVH5 18 EVQLVQSGAEVVKPGASVKVSCKASGFTFTNYYIHWVRQAPEQGLE (amino acid sequence) WIGWIYPGNVNTKYNEKFKARVTMTADKSTSTAYMELSSLRSDDMA VYYCARPTIIATDFDVWGQGTTVTVSS hSIRPα.50AVL1 19 GACATCGTGCTGACCCAGTCCCCCAGCTTCCTGTCTGCCTCTGTGG (nucleotide sequence) GCGACAGAGTGACCATCACATGCAAGGCCTCTCAGGGCGTGGGCAC CGCTGTGGGATGGTATCAGCAGAAGCCTGGCAAGGCCCCCAAGCTG CTGATCTACTGGGCCTCTACCAGACACACCGGCGTGCCCGACAGAT TCTCCGGCTCTGGCTCTGGCACCGAGTTTACCCTGACCATCTCCAG CCTGCAGCCCGAGGATTTCGCCGCCTACTACTGCCAGCAGTACTCC ACCTACCCCTTCACCTTCGGCGGAGGCACCAAGCTGGAAATCAAG hSIRPα.50AVL1 20 DIVLTQSPSFLSASVGDRVTITCKASQGVGTAVGWYQQKPGKAPKL (amino acid sequence) LIYWASTRHTGVPDRFSGSGSGTEFTLTISSLQPEDFAAYYCQQYS TYPFTFGGGTKLEIK hSIRPα.50AVL2 21 GACATCGTGATGACCCAGTCCCCCTCCAGCCTGTCTGCCTCTGTGG (nucleotide sequence) GCGACAGAGTGACCATCACATGCAAGGCCTCTCAGGGCGTGGGCAC CGCTGTGGGATGGTATCAGCAGAAGCCTGGCAAGGCCCCCAAGCTG CTGATCTACTGGGCCTCTACCAGACACACCGGCGTGCCCGACAGAT TCTCCGGCTCTGGCTCTGGCACCGACTTCACCCTGACCATCTCCAA CCTGCAGCCCGAGGACTTCGCCGACTACTACTGCCAGCAGTACTCC ACCTACCCCTTCACCTTCGGCGGAGGCACCAAGGTGGAAATCAAG hSIRPα.50AVL2 22 DIVMTQSPSSLSASVGDRVTITCKASQGVGTAVGWYQQKPGKAPKL (amino acid sequence) LIYWASTRHTGVPDRFSGSGSGTDFTLTISNLQPEDFADYYCQQYS TYPFTFGGGTKVEIK hSIRPα.50AVL3 23 GAGCTCGTGATGACCCAGTCCCCTTCCAGCCTGTCTGCCTCCGTGG (nucleotide sequence) GCGACAGAGTGACCATCACATGCAAGGCCTCTCAGGGCGTGGGCAC CGCTGTGGGATGGTATCAGCAGAAGCCTGGCAAGGCCCCCAAGCTG CTGATCTACTGGGCCTCTACCAGACACACCGGCGTGCCCGACAGAT TCTCCGGCTCTGGCTCTGGCACCGACTTTACCCTGGCCATCTCCAG CCTGCAGCCCGAGGATATCGCCGACTACTACTGCCAGCAGTACTCC ACCTACCCCTTCACCTTCGGCGGAGGCACCAAGGTGGAAATCAAG hSIRPα.50AVL3 24 ELVMTQSPSSLSASVGDRVTITCKASQGVGTAVGWYQQKPGKAPKL (amino acid sequence) LIYWASTRHTGVPDRFSGSGSGTDFTLAISSLQPEDIADYYCQQYS TYPFTFGGGTKVEIK hSIRPα.50AVL4 25 GACATCCAGATGACCCAGTCCCCCTCCAGCCTGTCTGCCTCTGTGG (nucleotide sequence) GCGACAGAGTGACCATCACATGCAAGGCCTCTCAGGGCGTGGGCAC CGCTGTGGGCTGGTATCAGAAAAAGCCCGGCAAGGTGCCCAAGCTG CTGATCTACTGGGCCTCCACCAGACACACCGGCGTGCCCGATAGAT TCTCCGGCTCTGGCTCTGGCACCGACTTCACCCTGACCATCAACGG CCTGCAGCCTGAGGACGTGGCCACCTACTACTGCCAGCAGTACTCC ACCTACCCCTTCACCTTCGGCGGAGGCACCAAGCTGGAAATCAAG hSIRPα.50AVL4 26 DIQMTQSPSSLSASVGDRVTITCKASQGVGTAVGWYQKKPGKVPKL (amino acid sequence) LIYWASTRHTGVPDRFSGSGSGTDFTLTINGLQPEDVATYYCQQYS TYPFTFGGGTKLEIK hSIRPα.50AVL5 27 GACATCGTGCTGACCCAGTCCCCCAGCTTCCTGTCTGCCTCTGTGG (nucleotide sequence) GCGACAGAGTGACCATCACATGCAAGGCCTCTCAGGGCGTGGGCAC CGCTGTGGGATGGTATCAGCAGAAGCCCGGCAAGTCCCCCAAGCTG CTGATCTACTGGGCCTCCACCAGACACACCGGCGTGCCCGATAGAT TCTCCGGCTCTGGCTCTGGCACCGAGTTCACCCTGACCATCTCCAA CCTGCAGCCCGAGGACTTCGCCGCCTACTACTGCCAGCAGTACTCC ACCTACCCCTTCACCTTCGGCGGAGGCACCAAGCTGGAAATCAAG hSIRPα.50AVL5 28 DIVLTQSPSFLSASVGDRVTITCKASQGVGTAVGWYQQKPGKSPKL (amino acid sequence) LIYWASTRHTGVPDRFSGSGSGTEFTLTISNLQPEDFAAYYCQQYS TYPFTFGGGTKLEIK hSIRPα.50A mouse 29 CAGGTCCAGCTGCAGCAGTCTGGACCTGAACTGGTGAAGCCTGGGG VH (nucleotide CTTCAGTTAGGATATCCTGCAAGGCTTCTGGCTTCACCTTCACAAA sequence) CTACTATATACACTGGGTGAAGCAGAGGCCTGGACAGGGACTTGAG TGGATTGGATGGATTTATCCTGGAAATGTTAATACTAAGTACAATG AGAAGTTCAAGGCCAAGGCCACACTGACTGCAGACAAATCCTCCAC CACAGCCTACATGCAGCTCAGCAGCCTGGCCTCTGAGGACTCTGCG GTCTATTTCTGTGCAAGACCTACGATAATAGCTACGGACTTCGATG TCTGGGGCGCAGGGACCACGGTCACCGTCTCCTCA hSIRPα.50A mouse 30 QVQLQQSGPELVKPGASVRISCKASGFTFTNYYIHWVKQRPGQGLE VH (amino acid WIGWIYPGNVNTKYNEKFKAKATLTADKSSTTAYMQLSSLASEDSA sequence) VYFCARPTIIATDFDVWGAGTTVTVSS hSIRPα.50A mouse 31 GACATTGTCATGACCCAGTCTCACAAATTCATGTCCACATCAGTAG VL (nucleotide GAGACAGGGTCAACATCACCTGCAAGGCCAGTCAGGGTGTGGGTAC sequence) TGCTGTAGGCTGGTATCAACAGAAACCAGGGCAATCTCCTAGACTA CTGATTTACTGGGCATCCACCCGGCACACTGGAGTCCCTGATCGCT TCACAGGCAGTGGATCTGGGACAGATTTCAGTCTCGCCATTAGCAA TGTGCAGTCTGAAGACCTGGCAGATTATTTCTGTCAGCAATATAGC ACCTATCCGTTCACGTTCGGAGGGGGGACCAATCTAGAAATAAAA hSIRPα.50A mouse 32 DIVMTQSHKFMSTSVGDRVNITCKASQGVGTAVGWYQQKPGQSPRL VL (amino acid LIYWASTRHTGVPDRFTGSGSGTDFSLAISNVQSEDLADYFCQQYS sequence) TYPFTFGGGTNLEIK human SIRPαV1 33 ATGGAGCCCGCCGGCCCGGCCCCCGGCCGCCTCGGGCCGCTGCTCT (nucleotide sequence) GCCTGCTGCTCGCCGCGTCCTGCGCCTGGTCAGGAGTGGCGGGTGA GGAGGAGCTGCAGGTGATTCAGCCTGACAAGTCCGTGTTGGTTGCA GCTGGAGAGACAGCCACTCTGCGCTGCACTGCGACCTCTCTGATCC CTGTGGGGCCCATCCAGTGGTTCAGAGGAGCTGGACCAGGCCGGGA ATTAATCTACAATCAAAAAGAAGGCCACTTCCCCCGGGTAACAACT GTTTCAGACCTCACAAAGAGAAACAACATGGACTTTTCCATCCGCA TCGGTAACATCACCCCAGCAGATGCCGGCACCTACTACTGTGTGAA GTTCCGGAAAGGGAGCCCCGATGACGTGGAGTTTAAGTCTGGAGCA GGCACTGAGCTGTCTGTGCGCGCCAAACCCTCTGCCCCCGTGGTAT CGGGCCCTGCGGCGAGGGCCACACCTCAGCACACAGTGAGCTTCAC CTGCGAGTCCCACGGCTTCTCACCCAGAGACATCACCCTGAAATGG TTCAAAAATGGGAATGAGCTCTCAGACTTCCAGACCAACGTGGACC CCGTAGGAGAGAGCGTGTCCTACAGCATCCACAGCACAGCCAAGGT GGTGCTGACCCGCGAGGACGTTCACTCTCAAGTCATCTGCGAGGTG GCCCACGTCACCTTGCAGGGGGACCCTCTTCGTGGGACTGCCAACT TGTCTGAGACCATCCGAGTTCCACCCACCTTGGAGGTTACTCAACA GCCCGTGAGGGCAGAGAACCAGGTGAATGTCACCTGCCAGGTGAGG AAGTTCTACCCCCAGAGACTACAGCTGACCTGGTTGGAGAATGGAA ACGTGTCCCGGACAGAAACGGCCTCAACCGTTACAGAGAACAAGGA TGGTACCTACAACTGGATGAGCTGGCTCCTGGTGAATGTATCTGCC CACAGGGATGATGTGAAGCTCACCTGCCAGGTGGAGCATGACGGGC AGCCAGCGGTCAGCAAAAGCCATGACCTGAAGGTCTCAGCCCACCC GAAGGAGCAGGGCTCAAATACCGCCGCTGAGAACACTGGATCTAAT GAACGGAACATCTATATTGTGGTGGGTGTGGTGTGCACCTTGCTGG TGGCCCTACTGATGGCGGCCCTCTACCTCGTCCGAATCAGACAGAA GAAAGCCCAGGGCTCCACTTCTTCTACAAGGTTGCATGAGCCCGAG AAGAATGCCAGAGAAATAACACAGGACACAAATGATATCACATATG CAGACCTGAACCTGCCCAAGGGGAAGAAGCCTGCTCCCCAGGCTGC GGAGCCCAACAACCACACGGAGTATGCCAGCATTCAGACCAGCCCG CAGCCCGCGTCGGAGGACACCCTCACCTATGCTGACCTGGACATGG TCCACCTCAACCGGACCCCCAAGCAGCCGGCCCCCAAGCCTGAGCC GTCCTTCTCAGAGTACGCCAGCGTCCAGGTCCCGAGGAAG human SIRPαV1 34 MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVA (amino acid sequence) AGETATLRCTATSLIPVGPIQWFRGAGPGRELIYNQKEGHFPRVTT VSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGA GTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKW FKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEV AHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVR KFYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSA HRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSN ERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPE KNAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSP QPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK human SIRPαV2 35 ATGGAACCTGCCGGACCTGCCCCTGGCAGACTGGGACCTCTGCTGT (nucleotide sequence) GTCTGCTGCTGGCCGCCTCTTGTGCTTGGAGCGGAGTGGCTGGCGA AGAGGAACTGCAAGTGATCCAGCCCGACAAGAGCGTGTCCGTGGCT GCTGGCGAGTCTGCCATCCTGCACTGTACCGTGACCAGCCTGATCC CCGTGGGCCCCATCCAGTGGTTTAGAGGCGCTGGCCCTGCCAGAGA GCTGATCTACAACCAGAAAGAGGGCCACTTCCCCAGAGTGACCACC GTGTCCGAGAGCACCAAGCGCGAGAACATGGACTTCAGCATCAGCA TCTCCAACATCACCCCTGCCGACGCCGGCACCTACTACTGCGTGAA GTTCAGAAAGGGCAGCCCCGACACCGAGTTCAAGAGCGGCGCTGGA ACCGAGCTGTCTGTGCGGGCTAAGCCTTCTGCCCCTGTGGTGTCTG GACCTGCCGCCAGAGCTACACCTCAGCACACCGTGTCTTTCACATG CGAGAGCCACGGCTTCAGCCCCAGAGACATCACCCTGAAGTGGTTC AAGAACGGCAACGAGCTGAGCGACTTCCAGACCAACGTGGACCCTG TGGGCGAGTCCGTGTCCTACAGCATCCACAGCACCGCCAAGGTGGT GCTGACCCGCGAGGATGTGCACAGCCAAGTGATCTGCGAGGTGGCC CACGTGACACTGCAGGGCGATCCTCTGAGAGGCACCGCTAACCTGA GCGAGACAATCAGAGTGCCCCCCACCCTGGAAGTGACCCAGCAGCC CGTGCGGGCTGAGAACCAAGTGAACGTGACCTGCCAAGTGCGGAAG TTCTACCCTCAGAGACTGCAGCTGACCTGGCTGGAAAACGGAAACG TGTCCAGAACCGAGACAGCCAGCACCGTGACAGAGAACAAGGACGG CACATACAACTGGATGAGCTGGCTGCTCGTGAACGTGTCCGCCCAC AGAGATGACGTGAAGCTGACATGCCAGGTGGAACACGACGGCCAGC CTGCCGTGTCTAAGAGCCACGACCTGAAGGTGTCCGCTCACCCCAA AGAGCAGGGCAGCAACACCGCCGCTGAGAACACAGGCAGCAACGAG AGAAACATCTACATCGTCGTGGGCGTCGTGTGCACCCTGCTGGTGG CTCTGCTGATGGCTGCCCTGTACCTCGTGCGGATCAGACAGAAGAA GGCCCAGGGCTCCACCTCCAGCACCAGACTGCACGAGCCTGAGAAG AACGCCCGCGAGATCACCCAGGACACCAACGACATCACCTACGCCG ACCTGAACCTGCCCAAGGGCAAGAAGCCTGCCCCTCAGGCTGCCGA GCCTAACAACCACACAGAGTACGCCAGCATCCAGACCAGCCCTCAG CCTGCCAGCGAGGACACACTGACATACGCCGATCTGGACATGGTGC ACCTGAACAGAACCCCCAAGCAGCCCGCTCCCAAGCCCGAGCCTAG CTTCTCTGAGTACGCCTCCGTGCAGGTGCCCAGAAAA human SIRPαV2 36 MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVSVA (amino acid sequence) AGESAILHCTVTSLIPVGPIQWFRGAGPARELIYNQKEGHFPRVTT VSESTKRENMDFSISISNITPADAGTYYCVKFRKGSPDTEFKSGAG TELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKWF KNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEVA HVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRK FYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSAH RDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSNE RNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPEK NAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSPQ PASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK human SIRPβ1 37 ATGCCCGTGCCAGCCTCCTGGCCCCACCTTCCTAGTCCTTTCCTGC (nucleotide sequence) TGATGACGCTACTGCTGGGGAGACTCACAGGAGTGGCAGGTGAGGA CGAGCTACAGGTGATTCAGCCTGAAAAGTCCGTATCAGTTGCAGCT GGAGAGTCGGCCACTCTGCGCTGTGCTATGACGTCCCTGATCCCTG TGGGGCCCATCATGTGGTTTAGAGGAGCTGGAGCAGGCCGGGAATT AATCTACAATCAGAAAGAAGGCCACTTCCCACGGGTAACAACTGTT TCAGAACTCACAAAGAGAAACAACCTGGACTTTTCCATCAGCATCA GTAACATCACCCCAGCAGACGCCGGCACCTACTACTGTGTGAAGTT CCGGAAAGGGAGCCCTGACGACGTGGAGTTTAAGTCTGGAGCAGGC ACTGAGCTGTCTGTGCGCGCCAAACCCTCTGCCCCCGTGGTATCGG GCCCTGCGGTGAGGGCCACACCTGAGCACACAGTGAGCTTCACCTG CGAGTCCCATGGCTTCTCTCCCAGAGACATCACCCTGAAATGGTTC AAAAATGGGAATGAGCTCTCAGACTTCCAGACCAACGTGGACCCCG CAGGAGACAGTGTGTCCTACAGCATCCACAGCACAGCCAGGGTGGT GCTGACCCGTGGGGACGTTCACTCTCAAGTCATCTGCGAGATAGCC CACATCACCTTGCAGGGGGACCCTCTTCGTGGGACTGCCAACTTGT CTGAGGCCATCCGAGTTCCACCCACCTTGGAGGTTACTCAACAGCC CATGAGGGCAGAGAACCAGGCAAACGTCACCTGCCAGGTGAGCAAT TTCTACCCCCGGGGACTACAGCTGACCTGGTTGGAGAATGGAAATG TGTCCCGGACAGAAACAGCTTCGACCCTCATAGAGAACAAGGATGG CACCTACAACTGGATGAGCTGGCTCCTGGTGAACACCTGTGCCCAC AGGGACGATGTGGTGCTCACCTGTCAGGTGGAGCATGATGGGCAGC AAGCAGTCAGCAAAAGCTATGCCCTGGAGATCTCAGCGCACCAGAA GGAGCACGGCTCAGATATCACCCATGAAGCAGCGCTGGCTCCTACT GCTCCACTCCTCGTAGCTCTCCTCCTGGGCCCCAAGCTGCTACTGG TGGTTGGTGTCTCTGCCATCTACATCTGCTGGAAACAGAAGGCC human SIRPβ1 (amino 38 MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAA acid sequence) GESATLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTTV SELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAG TELSVRAKPSAPVVSGPAVRATPEHTVSFTCESHGFSPRDITLKWF KNGNELSDFQTNVDPAGDSVSYSIHSTARVVLTRGDVHSQVICEIA HITLQGDPLRGTANLSEAIRVPPTLEVTQQPMRAENQANVTCQVSN FYPRGLQLTWLENGNVSRTETASTLIENKDGTYNWMSWLLVNTCAH RDDVVLTCQVEHDGQQAVSKSYALEISAHQKEHGSDITHEAALAPT APLLVALLLGPKLLLVVGVSAIYICWKQKA human SIRPγ 39 ATGCCTGTCCCAGCCTCCTGGCCCCATCCTCCTGGTCCTTTCCTGC (nucleotide sequence) TTCTGACTCTACTGCTGGGACTTACAGAAGTGGCAGGTGAGGAGGA GCTACAGATGATTCAGCCTGAGAAGCTCCTGTTGGTCACAGTTGGA AAGACAGCCACTCTGCACTGCACTGTGACCTCCCTGCTTCCCGTGG GACCCGTCCTGTGGTTCAGAGGAGTTGGACCAGGCCGGGAATTAAT CTACAATCAAAAAGAAGGCCACTTCCCCAGGGTAACAACAGTTTCA GACCTCACAAAGAGAAACAACATGGACTTTTCCATCCGCATCAGTA GCATCACCCCAGCAGATGTCGGCACATACTACTGTGTGAAGTTTCG AAAAGGGAGCCCTGAGAACGTGGAGTTTAAGTCTGGACCAGGCACT GAGATGGCTTTGGGTGCCAAACCCTCTGCCCCCGTGGTATTGGGCC CTGCGGCGAGGACCACACCTGAGCATACAGTGAGTTTCACCTGTGA GTCCCATGGCTTCTCTCCCAGAGACATCACCCTGAAATGGTTCAAA AATGGGAATGAGCTCTCAGACTTCCAGACCAACGTGGACCCCACAG GACAGAGTGTGGCCTACAGCATCCGCAGCACAGCCAGGGTGGTACT GGACCCCTGGGACGTTCGCTCTCAGGTCATCTGCGAGGTGGCCCAT GTCACCTTGCAGGGGGACCCTCTTCGTGGGACTGCCAACTTGTCTG AGGCCATCCGAGTTCCACCCACCTTGGAGGTTACTCAACAGCCCAT GAGGGIGGGGAACCAGGTAAACGTCACCTGCCAGGTGAGGAAGTIC TACCCCCAGAGCCTACAGCTGACCTGGTCGGAGAATGGAAACGTGT GCCAGAGAGAAACAGCCICGACCCTTACAGAGAACAAGGATGGTAC CTACAACTGGACAAGCTGGTTCCTGGTGAACATATCTGACCAAAGG GATGATGTGGTCCTCACCTGCCAGGTGAAGCATGATGGGCAGCTGG CGGTCAGCAAACGCCTTGCCCTAGAGGTCACAGTCCACCAGAAGGA CCAGAGCTCAGATGCTACCCCTGGCCCGGCATCATCCCTTACTGCG CTGCTCCTCATAGCTGTCCTCCTGGGCCCCATCTACGTCCCCTGGA AGCAGAAGACC human SIRPγ (amino 40 MPVPASWPHPPGPFLLLTLLLGLTEVAGEEELQMIQPEKLLLVTVG acid sequence) KTATLHCTVTSLLPVGPVLWFRGVGPGRELIYNQKEGHFPRVTTVS DLTKRNNMDFSIRISSITPADVGTYYCVKFRKGSPENVEFKSGPGT EMALGAKPSAPVVLGPAARTTPEHTVSFTCESHGFSPRDITLKWFK NGNELSDFQTNVDPTGQSVAYSIRSTARVVLDPWDVRSQVICEVAH VTLQGDPLRGTANLSEAIRVPPTLEVTQQPMRVGNQVNVTCQVRKF YPQSLQLTWSENGNVCQRETASTLTENKDGTYNWTSWFLVNISDQR DDVVLTCQVKHDGQLAVSKRLALEVTVHQKDQSSDATPGPASSLTA LLLIAVLLGPIYVPWKQKT human CD47 41 ATGTGGCCTCTGGTGGCCGCTCTGCTGCTGGGCTCTGCTTGTTGTG (nucleotide sequence) GATCCGCCCAGCTGCTGTTCAACAAGACCAAGTCCGTGGAGTTCAC CTTCTGCAACGATACCGTCGTGATCCCCTGCTTCGTGACCAACATG GAAGCCCAGAACACCACCGAGGTGTACGTGAAGTGGAAGTTCAAGG GCCGGGACATCTACACCTTCGACGGCGCCCTGAACAAGTCCACCGT GCCCACCGATTTCTCCAGCGCCAAGATCGAGGTGTCACAGCTGCTG AAGGGCGACGCCTCCCTGAAGATGGACAAGTCCGACGCCGTGTCCC ACACCGGCAACTACACCTGTGAAGTGACCGAGCTGACCAGAGAGGG CGAGACAATCATCGAGCTGAAGTACCGGGTGGTGTCCTGGTTCAGC CCCAACGAGAACATCCTGATCGTGATCTTCCCCATCTTCGCCATCC TGCTGTTCTGGGGCCAGTTCGGCATCAAGACCCTGAAGTACAGATC CGGCGGCATGGACGAAAAGACAATCGCCCTGCTGGTGGCTGGCCTC GTGATCACCGTGATTGTGATCGTGGGCGCTATCCTGTTCGTGCCCG GCGAGTACAGCCTGAAGAATGCTACCGGCCTGGGCCTGATTGTGAC CTCCACCGGAATCCTGATCCTGCTGCACTACTACGTGTTCTCCACC GCTATCGGCCTGACCTCCTTCGTGATCGCCATTCTCGTGATCCAAG TGATCGCCTACATCCTGGCCGTCGTGGGCCTGTCCCTGTGTATCGC CGCCTGCATCCCTATGCACGGCCCCCTGCTGATCTCCGGCCTGTCT ATTCTGGCCCTGGCTCAGCTGCTGGGACTGGTGTACATGAAGTTCG TGGCCTCCAACCAGAAAACCATCCAGCCCCCTCGGAAGGCCGTGGA AGAACCCCTGAACGCCTTCAAAGAATCCAAGGGCATGATGAACGAC GAA human CD47 (amino 42 MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNM acid sequence) EAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLL KGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFS PNENILIVIFPIFAILLFWGQFGIKTLKYRSGGMDEKTIALLVAGL VITVIVIVGAILFVPGEYSLKNATGLGLIVTSTGILILLHYYVFST AIGLTSFVIAILVIQVIAYILAVVGLSLCIAACIPMHGPLLISGLS ILALAQLLGLVYMKFVASNQKTIQPPRKAVEEPLNAFKESKGMMND E human SIRPαV3 43 ATGGAACCTGCCGGCCCTGCTCCTGGTAGACTGGGACCTCTGCTGT (nucleotide sequence) GTCTGCTGCTGGCCGCCTCTTGTGCTTGGAGCGGAGTGGCTGGCGA AGAGGAACTGCAAGTGATCCAGCCCGACAAGTCCGTGTCTGTGGCC GCTGGCGAGTCTGCCATCCTGCTGTGTACCGTGACCTCCCTGATCC CCGTGGGCCCCATCCAGTGGTTTAGAGGCGCTGGCCCTGCCAGAGA GCTGATCTACAACCAGAAAGAGGGCCACTTCCCCAGAGTGACCACC GTGTCCGAGTCCACCAAGCGCGAGAACATGGACTTCTCCATCTCCA TCAGCAACATCACCCCTGCCGACGCCGGCACCTACTACTGCGTGAA GTTCCGGAAGGGCTCCCCCGACACCGAGTTCAAGTCTGGCGCTGGC ACCGAGCTGTCTGTGCGGGCTAAACCTICTGCCCCTGTGGTGTCTG GACCTGCCGCTAGAGCTACCCCTCAGCACACCGTGTCTTTTACCTG CGAGTCCCACGGCTTCAGCCCTCGGGACATCACCCTGAAGTGGTTC AAGAACGGCAACGAGCTGAGCGACTTCCAGACCAACGTGGACCCTG TGGGCGAGAGCGTGTCCTACTCCATCCACTCCACCGCCAAGGTGGT GCTGACACGCGAGGACGTGCACTCCCAAGTGATCTGCGAGGTGGCC CACGTGACACTGCAGGGCGATCCTCTGAGAGGCACCGCCAACCTGT CCGAGACAATCAGAGTGCCCCCCACCCTGGAAGTGACCCAGCAGCC AGTGCGGGCCGAGAACCAAGTGAACGTGACCTGCCAAGTGCGGAAG TTCTACCCCCAGCGGCTGCAGCTGACCTGGCTGGAAAACGGCAATG TGTCCCGGACCGAGACAGCCAGCACCGTGACCGAGAACAAGGATGG CACCTACAATTGGATGTCTTGGCTGCTCGTGAACGTGTCCGCCCAC CGGGACGATGTGAAGCTGACATGCCAGGTGGAACACGACGGCCAGC CTGCCGTGTCCAAGAGCCACGATCTGAAGGTGTCCGCTCATCCCAA AGAGCAGGGCTCCAACACCGCCGCTGAGAACACCGGCTCTAACGAG CGGAACATCTACATCGTCGTGGGCGTCGTGTGCACCCTGCTGGTGG CTCTGCTGATGGCTGCCCTGTACCTCGTGCGGATCCGGCAGAAGAA GGCCCAGGGCTCTACCTCCTCCACCAGACTGCACGAGCCCGAGAAG AACGCCAGAGAGATCACCCAGGACACCAACGACATCACCTACGCCG ACCTGAACCTGCCCAAGGGCAAGAAGCCTGCCCCTCAGGCTGCCGA GCCTAACAACCACACCGAGTACGCCTCCATCCAGACCAGCCCTCAG CCTGCCTCTGAGGACACCCTGACCTACGCTGATCTGGACATGGTGC ACCTGAACCGGACCCCCAAGCAGCCAGCTCCTAAGCCCGAGCCTAG CTTCTCTGAGTACGCCAGCGTGCAGGTGCCCCGGAAA human SIRPαV3 44 MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVSVA (amino acid sequence) AGESAILLCTVTSLIPVGPIQWFRGAGPARELIYNQKEGHFPRVTT VSESTKRENMDFSISISNITPADAGTYYCVKFRKGSPDTEFKSGAG TELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKWF KNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEVA HVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRK FYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSAH RDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSNE RNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPEK NAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSPQ PASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK human SIRPαV4 45 ATGGAACCTGCCGGCCCTGCTCCTGGTAGACTGGGACCTCTGCTGT (nucleotide sequence) GTCTGCTGCTGGCCGCCTCTTGTGCTTGGAGCGGAGTGGCTGGCGA AGAGGGCCTGCAAGTGATCCAGCCCGACAAGTCCGTGTCTGTGGCC GCTGGCGAGTCTGCCATCCTGCACTGTACCGCCACCTCCCTGATCC CCGTGGGACCCATCCAGTGGTTTAGAGGCGCTGGCCCTGGCAGAGA GCTGATCTACAACCAGAAAGAGGGCCACTTCCCCAGAGTGACCACC GTGTCCGACCTGACCAAGCGGAACAACATGGACTTCTCCATCCGGA TCGGCAACATCACCCCTGCCGATGCCGGCACCTACTACTGCGTGAA GTTCCGGAAGGGCTCCCCCGACGACGTGGAGTTCAAATCCGGCGCT GGCACCGAGCTGTCTGTGCGGGCTAAACCTTCTGCCCCTGTGGTGT CTGGCCCTGCCGCTAGAGCTACCCCTCAGCACACCGTGTCTTTTAC CTGCGAGTCCCACGGCTTCAGCCCTCGGGACATCACCCTGAAGTGG TTCAAGAACGGCAACGAGCTGAGCGACTTCCAGACCAACGTGGACC CTGTGGGCGAGAGCGTGTCCTACTCCATCCACTCCACCGCCAAGGT GGTGCTGACACGCGAGGACGTGCACTCCCAAGTGATCTGCGAGGTG GCCCACGTGACACTGCAGGGCGATCCTCTGAGAGGCACCGCCAACC TGTCCGAGACAATCAGAGTGCCCCCCACCCTGGAAGTGACCCAGCA GCCAGTGCGGGCCGAGAACCAAGTGAACGTGACCTGCCAAGTGCGG AAGTTCTACCCCCAGCGGCTGCAGCTGACCTGGCTGGAAAACGGCA ATGTGTCCCGGACCGAGACAGCCTCCACCGTGACCGAGAACAAGGA TGGCACCTACAATTGGATGTCTTGGCTGCTCGTGAACGTGTCCGCC CACCGGGACGATGTGAAGCTGACATGCCAGGTGGAACACGACGGCC AGCCTGCCGTGTCCAAGTCCCACGATCTGAAGGTGTCCGCTCATCC CAAAGAGCAGGGCTCCAACACCGCCGCTGAGAACACCGGCTCTAAC GAGCGGAACATCTACATCGTCGTGGGCGTCGTGTGCACCCTGCTGG TGGCTCTGCTGATGGCTGCCCTGTACCTCGTGCGGATCCGGCAGAA GAAGGCCCAGGGCTCTACCTCCTCCACCAGACTGCACGAGCCCGAG AAGAACGCCAGAGAGATCACCCAGGACACCAACGACATCACCTACG CCGACCTGAACCTGCCCAAGGGCAAGAAGCCTGCCCCTCAGGCTGC CGAGCCTAACAACCACACCGAGTACGCCTCCATCCAGACCAGCCCT CAGCCTGCCTCTGAGGACACCCTGACCTACGCTGATCTGGACATGG TGCACCTGAACCGGACCCCCAAGCAGCCAGCTCCTAAGCCCGAGCC TAGCTTCTCTGAGTACGCCAGCGTGCAGGTGCCCCGGAAA human SIRPαV4 46 MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEGLQVIQPDKSVSVA (amino acid sequence) AGESAILHCTATSLIPVGPIQWFRGAGPGRELIYNQKEGHFPRVTT VSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGA GTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKW FKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEV AHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVR KFYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSA HRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSN ERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPE KNAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSP QPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK human SIRPαV5 47 ATGGAACCTGCCGGCCCTGCTCCTGGTAGACTGGGACCTCTGCTGT (nucleotide sequence) GTCTGCTGCTGGCCGCCTCTTGTGCTTGGAGCGGAGTGGCTGGCGA AGAGGAACTGCAAGTGATCCAGCCCGACAAGTTCGTGCTGGTGGCC GCTGGCGAGACAGCCACCCTGAGATGTACCGCCACCTCCCTGATCC CCGTGGGCCCTATCCAGTGGTTTAGAGGCGCTGGCCCTGGCAGAGA GCTGATCTACAACCAGAAAGAGGGCCACTTCCCCAGAGTGACCACC GTGTCCGACCTGACCAAGCGGAACAACATGGACTTCTCCATCCGGA TCGGCAACATCACCCCTGCCGATGCCGGCACCTACTACTGCGTGAA GTTCCGGAAGGGCTCCCCCGACGACGTGGAGTTCAAATCCGGCGCT GGCACCGAGCTGTCTGTGCGGGCTAAACCTTCTGCCCCTGTGGTGT CTGGCCCTGCCGCTAGAGCTACCCCTCAGCACACCGTGTCTTTTAC CTGCGAGTCCCACGGCTTCAGCCCTCGGGACATCACCCTGAAGTGG TTCAAGAACGGCAACGAGCTGAGCGACTICCAGACCAACGTGGACC CTGTGGGCGAGTCCGTGTCCTACTCCATCCACTCCACCGCCAAGGT GGTGCTGACACGCGAGGACGTGCACTCCCAAGTGATCTGCGAGGTG GCCCACGTGACACTGCAGGGCGATCCTCTGAGAGGCACCGCCAACC TGTCCGAGACAATCAGAGTGCCCCCCACCCTGGAAGTGACCCAGCA GCCAGTGCGGGCCGAGAACCAAGTGAACGTGACCTGCCAAGTGCGG AAGTTCTACCCCCAGCGGCTGCAGCTGACCTGGCTGGAAAACGGCA ATGTGTCCCGGACCGAGACTGCCTCCACCGTGACCGAGAACAAGGA TGGCACCTACAATTGGATGTCTTGGCTGCTCGTGAACGTGTCCGCC CACCGGGACGATGTGAAGCTGACATGCCAGGTGGAACACGACGGCC AGCCTGCCGTGTCCAAGTCCCACGATCTGAAGGTGTCCGCTCATCC CAAAGAGCAGGGCTCCAACACCGCCGCTGAGAACACCGGCTCTAAC GAGCGGAACATCTACATCGTCGTGGGCGTCGTGTGCACCCTGCTGG TGGCTCTGCTGATGGCTGCCCTGTACCTCGTGCGGATCCGGCAGAA GAAGGCCCAGGGCTCTACCTCCTCCACCAGACTGCACGAGCCCGAG AAGAACGCCAGAGAGATCACCCAGGACACCAACGACATCACCTACG CCGACCTGAACCTGCCCAAGGGCAAGAAGCCTGCCCCTCAGGCTGC CGAGCCTAACAACCACACCGAGTACGCCTCCATCCAGACCAGCCCT CAGCCTGCCTCTGAGGACACCCTGACCTACGCTGATCTGGACATGG TGCACCTGAACCGGACCCCCAAGCAGCCAGCTCCTAAGCCCGAGCC TAGCTTCTCTGAGTACGCCAGCGTGCAGGTGCCCCGGAAA human SIRPαV5 48 MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKFVLVA (amino acid sequence) AGETATLRCTATSLIPVGPIQWFRGAGPGRELIYNQKEGHFPRVTT VSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGA GTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKW FKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEV AHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVR KFYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSA HRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSN ERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPE KNAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSP QPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK human SIRPαV6 49 ATGGAACCTGCCGGCCCTGCTCCTGGTAGACTGGGACCTCTGCTGT (nucleotide sequence) GTCTGCTGCTGGCCGCCTCTTGTGCTTGGAGCGGAGTGGCTGGCGA AGAGGAACTGCAAGTGATCCAGCCCGACAAGTCCGTGCTGGTGGCT GCTGGCGAGACTGCCACCCTGAGATGTACCGCCACCTCCCTGATCC CCGTGGGCCCTATCCAGTGGTTTAGAGGCGCTGGCCCTGGCAGAGA GCTGATCTACAACCAGAAAGAGGGCCACTTCCCCAGAGTGACCACC GTGTCCGACCTGACCAAGCGGAACAACATGGACTTCCCCATCCGGA TCGGCAACATCACCCCTGCCGATGCCGGCACCTACTACTGCGTGAA GTTCCGGAAGGGCTCCCCCGACGACGTGGAGTTCAAATCCGGCGCT GGCACCGAGCTGTCTGTGCGGGCTAAACCTTCTGCCCCTGTGGTGT CTGGCCCTGCCGCTAGAGCTACCCCTCAGCACACCGTGTCTTTTAC CTGCGAGTCCCACGGCTTCAGCCCTCGGGACATCACCCTGAAGTGG TTCAAGAACGGCAACGAGCTGAGCGACTTCCAGACCAACGTGGACC CTGTGGGCGAGTCCGTGTCCTACTCCATCCACTCCACCGCCAAGGT GGTGCTGACACGCGAGGACGTGCACTCCCAAGTGATCTGCGAGGTG GCCCACGTGACACTGCAGGGCGATCCTCTGAGAGGCACCGCCAACC TGTCCGAGACAATCAGAGTGCCCCCCACCCTGGAAGTGACCCAGCA GCCCGTGCGGGCTGAGAACCAAGTGAACGTGACCTGCCAAGTGCGG AAGTTCTACCCCCAGCGGCTGCAGCTGACCTGGCTGGAAAACGGCA ATGTGTCCCGGACCGAGACAGCCTCCACCGTGACCGAGAACAAGGA TGGCACCTACAATTGGATGTCCTGGCTGCTCGTGAACGTGTCCGCC CACCGGGACGATGTGAAGCTGACATGCCAGGTGGAACACGACGGCC AGCCTGCCGTGTCCAAGTCCCACGATCTGAAGGTGTCCGCTCATCC CAAAGAGCAGGGCTCCAACACCGCCGCTGAGAACACCGGCTCTAAC GAGCGGAACATCTACATCGTCGTGGGCGTCGTGTGCACCCTGCTGG TGGCACTGCTGATGGCCGCTCTGTACCTCGTGCGGATCCGGCAGAA GAAGGCCCAGGGCTCTACCTCCTCCACCAGACTGCACGAGCCCGAG AAGAACGCCAGAGAGATCACCCAGGACACCAACGACATCACCTACG CCGACCTGAACCTGCCCAAGGGCAAGAAGCCTGCCCCTCAGGCTGC CGAGCCTAACAACCACACCGAGTACGCCTCCATCCAGACCAGCCCT CAGCCTGCCTCTGAGGACACCCTGACCTACGCTGATCTGGACATGG TGCACCTGAACCGGACCCCCAAGCAGCCAGCTCCTAAGCCCGAGCC TAGCTTCTCTGAGTACGCCAGCGTGCAGGTGCCCCGGAAA human SIRPαV6 50 MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVA (amino acid sequence) AGETATLRCTATSLIPVGPIQWFRGAGPGRELIYNQKEGHFPRVTT VSDLTKRNNMDFPIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGA GTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKW FKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEV AHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVR KEYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSA HRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSN ERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPE KNAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSP QPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK human SIRPαV8 51 ATGGAACCTGCCGGCCCTGCTCCTGGTAGACTGGGACCTCTGCTGT (nucleotide sequence) GTCTGCTGCTGGCCGCCTCTTGTGCTTGGAGCGGAGTGGCTGGCGA AGAGGAACTGCAAGTGATCCAGCCCGACAAGTCCGTGCTGGTGGCT GCTGGCGAGACTGCCACCCTGAGATGTACCGCCACCTCCCTGATCC CCGTGGGCCCTATCCAGTGGTTTAGAGGCGCTGGCCCTGCCAGAGA GCTGATCTACAACCAGAAAGAGGGCCACTTCCCCAGAGTGACCACC GTGTCCGAGTCCACCAAGCGCGAGAACATGGACTTCTCCATCTCCA TCAGCAACATCACCCCTGCCGACGCCGGCACCTACTACTGCGTGAA GTTCCGGAAGGGCTCCCCCGACACCGAGTTCAAGTCTGGCGCTGGC ACCGAGCTGTCTGTGCGGGCTAAACCTTCTGCCCCTGTGGTGTCTG GACCTGCCGCTAGAGCTACCCCTCAGCACACCGTGTCTTTTACCTG CGAGTCCCACGGCTTCAGCCCTCGGGACATCACCCTGAAGTGGTTC AAGAACGGCAACGAGCTGAGCGACTTCCAGACCAACGTGGACCCTG TGGGCGAGTCCGTGTCCTACTCCATCCACTCCACCGCCAAGGTGGT GCTGACACGCGAGGACGTGCACTCCCAAGTGATCTGCGAGGTGGCC CACGTGACACTGCAGGGCGATCCTCTGAGAGGCACCGCCAACCTGT CCGAGACAATCAGAGTGCCCCCCACCCTGGAAGTGACCCAGCAGCC CGTGCGGGCTGAGAACCAAGTGAACGTGACCTGCCAAGTGCGGAAG TTCTACCCCCAGCGGCTGCAGCTGACCTGGCTGGAAAACGGCAATG TGTCCCGGACCGAGACAGCCAGCACCGTGACCGAGAACAAGGATGG CACCTACAATTGGATGTCCTGGCTGCTCGTGAACGTGTCCGCCCAC CGGGACGATGTGAAGCTGACATGCCAGGTGGAACACGACGGCCAGC CTGCCGTGTCCAAGAGCCACGATCTGAAGGTGTCCGCTCATCCCAA AGAGCAGGGCTCCAACACCGCCGCTGAGAACACCGGCTCTAACGAG CGGAACATCTACATCGTCGTGGGCGTCGTGTGCACCCTGCTGGTGG CACTGCTGATGGCCGCTCTGTACCTCGTGCGGATCCGGCAGAAGAA GGCCCAGGGCTCTACCTCCTCCACCAGACTGCACGAGCCCGAGAAG AACGCCAGAGAGATCACCCAGGACACCAACGACATCACCTACGCCG ACCTGAACCTGCCCAAGGGCAAGAAGCCTGCCCCTCAGGCTGCCGA GCCTAACAACCACACCGAGTACGCCTCCATCCAGACCAGCCCTCAG CCTGCCTCTGAGGACACCCTGACCTACGCTGATCTGGACATGGTGC ACCTGAACCGGACCCCCAAGCAGCCAGCTCCTAAGCCCGAGCCTAG CTTCTCTGAGTACGCCAGCGTGCAGGTGCCCCGGAAA human SIRPαV8 52 MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVA (amino acid sequence) AGETATLRCTATSLIPVGPIQWFRGAGPARELIYNQKEGHFPRVTT VSESTKRENMDFSISISNITPADAGTYYCVKFRKGSPDTEFKSGAG TELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKWF KNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEVA HVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRK FYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSAH RDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSNE RNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPEK NAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSPQ PASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK human SIRPαV9 53 ATGGAACCTGCCGGCCCTGCTCCTGGTAGACTGGGACCTCTGCTGT (nucleotide sequence) GTCTGCTGCTGGCCGCCTCTTGTGCTTGGAGCGGAGTGGCTGGCGA AGAGGAACTGCAAGTGATCCAGCCCGACAAGTCCGTGCTGGTGGCT GCTGGCGAGACTGCCACCCTGAGATGTACCGCCACCTCCCTGATCC CCGTGGGCCCTATCCAGTGGTTTAGAGGCGCTGGCCCTGGCAGAGA GCTGATCTACAACCAGAAAGAGGGCCACTTCCCCAGAGTGACCACC GTGTCCGACCTGACCAAGCGGAACAACATGGACTTCTCCATCCGGA TCTCCAACATCACCCCTGCCGACGCCGGCACCTACTACTGCGTGAA GTTCCGGAAGGGCTCCCCCGACGACGTGGAGTTCAAATCCGGCGCT GGCACCGAGCTGTCTGTGCGGGCTAAACCTTCTGCCCCTGTGGTGT CTGGCCCTGCCGCTAGAGCTACCCCTCAGCACACCGTGTCTTTTAC CTGCGAGTCCCACGGCTTCAGCCCTCGGGACATCACCCTGAAGTGG TTCAAGAACGGCAACGAGCTGAGCGACTTCCAGACCAACGTGGACC CTGTGGGCGAGTCCGTGTCCTACTCCATCCACTCCACCGCCAAGGT GGTGCTGACACGCGAGGACGTGCACTCCCAAGTGATCTGCGAGGTG GCCCACGTGACACTGCAGGGCGATCCTCTGAGAGGCACCGCCAACC TGTCCGAGACAATCAGAGTGCCCCCCACCCTGGAAGTGACCCAGCA GCCCGTGCGGGCTGAGAACCAAGTGAACGTGACCTGCCAAGTGCGG AAGTTCTACCCCCAGCGGCTGCAGCTGACCTGGCTGGAAAACGGCA ATGTGTCCCGGACCGAGACAGCCTCCACCGTGACCGAGAACAAGGA TGGCACCTACAATTGGATGTCCTGGCTGCTCGTGAACGTGTCCGCC CACCGGGACGATGTGAAGCTGACATGCCAGGTGGAACACGACGGCC AGCCTGCCGTGTCCAAGTCCCACGATCTGAAGGTGTCCGCTCATCC CAAAGAGCAGGGCTCCAACACCGCCGCTGAGAACACCGGCTCTAAC GAGCGGAACATCTACATCGTCGTGGGCGTCGTGTGCACCCTGCTGG TGGCACTGCTGATGGCCGCTCTGTACCTCGTGCGGATCCGGCAGAA GAAGGCCCAGGGCTCTACCTCCTCCACCAGACTGCACGAGCCCGAG AAGAACGCCAGAGAGATCACCCAGGACACCAACGACATCACCTACG CCGACCTGAACCTGCCCAAGGGCAAGAAGCCTGCCCCTCAGGCTGC CGAGCCTAACAACCACACCGAGTACGCCTCCATCCAGACCAGCCCT CAGCCTGCCTCTGAGGACACCCTGACCTACGCTGATCTGGACATGG TGCACCTGAACCGGACCCCCAAGCAGCCAGCTCCTAAGCCCGAGCC TAGCTTCTCTGAGTACGCCAGCGTGCAGGTGCCCCGGAAA human SIRPαV9 54 MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVA (amino acid sequence) AGETATLRCTATSLIPVGPIQWFRGAGPORELIYNQKEGHFPRVTT VSDLTKRNNMDFSIRISNITPADAGTYYCVKFRKGSPDDVEFKSGA GTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKW FKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEV AHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVR KFYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSA HRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSN ERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPE KNAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSP QPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK hSIRPα-VβC1αC2α 55 ATGGAACCTGCCGGCCCTGCTCCTGGTAGACTGGGACCTCTGCTGT (nucleotide sequence) GTCTGCTGCTGGCCGCCTCTTGTGCTTGGAGCGGAGTGGCTGGCGA GGACGAGCTGCAAGTGATCCAGCCCGAGAAGTCCGTGTCTGTGGCC GCTGGCGAGTCTGCCACCCTGAGATGCGCTATGACCTCCCTGATCC CCGTGGGCCCCATCATGTGGTTTAGAGGCGCTGGCGCTGGCAGAGA GCTGATCTACAACCAGAAAGAGGGCCACTTCCCCAGAGTGACCACC GTGTCCGAGCTGACCAAGCGGAACAACCTGGACTTCTCCATCTCCA TCAGCAACATCACCCCTGCCGACGCCGGCACCTACTACTGCGTGAA GTTCCGGAAGGGCTCCCCCGACGACGTGGAGTTCAAATCCGGCGCT GGAACCGAGCTGTCCGTGCGGGCTAAACCTTCTGCCCCTGTGGTGT CTGGCCCTGCCGCTAGAGCTACCCCTCAGCACACCGTGTCTTTTAC CTGCGAGTCCCACGGCTTCAGCCCTCGGGACATCACCCTGAAGTGG TTCAAGAACGGCAACGAGCTGAGCGACTTCCAGACCAACGTGGACC CTGTGGGCGAGAGCGTGTCCTACTCCATCCACTCCACCGCCAAGGT GGTGCTGACACGCGAGGACGTGCACTCCCAAGTGATCTGCGAGGTG GCCCACGTGACACTGCAGGGCGATCCTCTGAGAGGCACCGCCAACC TGTCCGAGACAATCAGAGTGCCCCCCACCCTGGAAGTGACCCAGCA GCCTGTGCGGGCCGAGAACCAAGTGAACGTGACCTGCCAAGTGCGG AAGTTCTACCCCCAGCGGCTGCAGCTGACCTGGCTGGAAAACGGCA ATGTGTCCCGGACCGAGACAGCCAGCACCGTGACCGAGAACAAGGA TGGCACCTACAATTGGATGTCCTGGCTGCTCGTGAACGTGTCCGCC CACCGGGACGATGTGAAGCTGACATGCCAGGTGGAACACGACGGCC AGCCTGCCGTGTCCAAGTCCCACGATCTGAAGGTGTCCGCTCATCC CAAAGAGCAGGGCTCCAACACCGCCGCTGAGAACACCGGCTCTAAC GAGCGGAACATCTACATCGTCGTGGGCGTCGTGTGCACCCTGCTGG TGGCTCTGCTGATGGCTGCCCTGTACCTCGTGCGGATCCGGCAGAA GAAGGCCCAGGGCTCTACCTCCTCCACCAGACTGCACGAGCCTGAG AAGAACGCCAGAGAGATCACCCAGGACACCAACGACATCACCTACG CCGACCTGAACCTGCCCAAGGGCAAGAAGCCTGCCCCTCAGGCCGC CGAGCCTAACAACCACACCGAGTACGCCTCCATCCAGACCAGCCCT CAGCCTGCCTCTGAGGACACCCTGACCTACGCTGATCTGGACATGG TGCACCTGAACCGGACCCCCAAGCAGCCAGCTCCTAAGCCCGAGCC TAGCTTCTCTGAGTACGCCAGCGTGCAGGTGCCCCGGAAA hSIRPα-VβC1αC2α 56 MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEDELQVIQPEKSVSVA (amino acid sequence) AGESATLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTT VSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGA GTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKW FKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEV AHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVR KFYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSA HRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSN ERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPE KNAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSP QPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK hSIRPα-VαC1βC2α 57 ATGGAACCTGCCGGCCCTGCTCCTGGTAGACTGGGACCTCTGCTGT (nucleotide sequence) GTCTGCTGCTGGCCGCCTCTTGTGCTTGGAGCGGAGTGGCTGGCGA AGAGGAACTGCAAGTGATCCAGCCCGACAAGTCCGTGCTGGTGGCT GCTGGCGAGACTGCCACCCTGAGATGTACCGCCACCTCCCTGATCC CCGTGGGCCCTATCCAGTGGTTTAGAGGCGCTGGCCCTGGCAGAGA GCTGATCTACAACCAGAAAGAGGGCCACTTCCCCAGAGTGACCACC GTGTCCGACCTGACCAAGCGGAACAACATGGACTTCTCCATCCGGA TCGGCAACATCACCCCTGCCGATGCCGGCACCTACTACTGCGTGAA GTTCCGGAAGGGCTCCCCCGACGACGTGGAGTTCAAATCCGGCGCT GGCACCGAGCTGTCTGTGCGGGCTAAACCTTCTGCCCCCGTGGTGT CTGGACCTGCCGTGCGAGCTACCCCTGAGCACACCGTGTCTTTTAC CTGCGAGTCCCACGGCTTCAGCCCTCGGGACATCACCCTGAAGTGG TTCAAGAACGGCAACGAGCTGAGCGACTTCCAGACCAACGTGGACC CAGCCGGCGACTCCGTGTCCTACTCCATCCACTCTACCGCCAGAGT GGTGCTGACCAGAGGCGACGTGCACTCCCAAGTGATCTGCGAGATC GCCCATATCACACTGCAGGGCGACCCCCTGAGAGGCACCGCTAACC TGTCTGAGACAATCCGGGTGCCCCCCACCCTGGAAGTGACTCAGCA GCCAGTGCGGGCCGAGAACCAAGTGAACGTGACCTGCCAAGTGCGG AAGTTCTACCCCCAGCGGCTGCAGCTGACCTGGCTGGAAAACGGCA ATGTGTCCCGGACCGAGACAGCCTCCACCGTGACCGAGAACAAGGA TGGCACCTACAATTGGATGTCTTGGCTGCTCGTGAACGTGTCCGCC CACCGGGACGATGTGAAGCTGACATGCCAGGTGGAACACGACGGCC AGCCTGCCGTGTCCAAGTCCCACGATCTGAAGGTGTCCGCTCATCC CAAAGAGCAGGGCTCCAACACCGCCGCTGAGAACACCGGCTCTAAC GAGCGGAACATCTACATCGTCGTGGGCGTCGTGTGCACCCTGCTGG TGGCACTGCTGATGGCCGCTCTGTACCTCGTGCGGATCCGGCAGAA GAAGGCCCAGGGCTCTACCTCCTCCACCAGACTGCACGAGCCCGAG AAGAACGCCAGAGAGATCACCCAGGACACCAACGACATCACCTACG CCGACCTGAACCTGCCCAAGGGCAAGAAGCCTGCCCCTCAGGCCGC CGAGCCTAACAACCACACCGAGTACGCCTCCATCCAGACCAGCCCT CAGCCTGCCTCTGAGGACACCCTGACCTACGCTGATCTGGACATGG TGCACCTGAACCGGACCCCCAAGCAGCCAGCTCCTAAGCCCGAGCC TAGCTTCTCTGAGTACGCCAGCGTGCAGGTGCCCCGGAAA hSIRPα-VαC1βC2α 58 MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVA (amino acid sequence) AGETATLRCTATSLIPVGPIQWFRGAGPGRELIYNQKEGHFPRVTT VSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGA GTELSVRAKPSAPVVSGPAVRATPEHTVSFTCESHGFSPRDITLKW FKNGNELSDFQTNVDPAGDSVSYSIHSTARVVLTRGDVHSQVICEI AHITLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVR KFYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSA HRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSN ERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPE KNAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSP QPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK hSIRPα-VαC1αC2β 59 ATGGAACCTGCCGGCCCTGCTCCTGGTAGACTGGGACCTCTGCTGT (nucleotide sequence) GTCTGCTGCTGGCCGCCTCTTGTGCTTGGAGCGGAGTGGCTGGCGA AGAGGAACTGCAAGTGATCCAGCCCGACAAGTCCGTGCTGGTGGCT GCTGGCGAGACTGCCACCCTGAGATGTACCGCCACCTCCCTGATCC CCGTGGGCCCTATCCAGTGGTTTAGAGGCGCTGGCCCTGGCAGAGA GCTGATCTACAACCAGAAAGAGGGCCACTTCCCCAGAGTGACCACC GTGTCCGACCTGACCAAGCGGAACAACATGGACTTCTCCATCCGGA TCGGCAACATCACCCCTGCCGATGCCGGCACCTACTACTGCGTGAA GTTCCGGAAGGGCTCCCCCGACGACGTGGAGTTCAAATCCGGCGCT GGCACCGAGCTGTCTGTGCGGGCTAAACCTTCTGCCCCTGTGGTGT CTGGCCCTGCCGCTAGAGCTACCCCTCAGCACACCGTGTCTTTTAC CTGCGAGTCCCACGGCTTCAGCCCTCGGGACATCACCCTGAAGTGG TTCAAGAACGGCAACGAGCTGAGCGACTTCCAGACCAACGTGGACC CTGTGGGCGAGTCCGTGTCCTACTCCATCCACTCCACCGCCAAGGT GGTGCTGACACGCGAGGACGTGCACTCCCAAGTGATCTGCGAGGTG GCCCACGTGACACTGCAGGGCGATCCTCTGAGAGGCACCGCCAACC TGTCCGAGACAATCAGAGTGCCCCCCACCCTGGAAGTGACCCAGCA GCCTATGAGAGCCGAGAACCAGGCCAACGTGACCTGCCAGGTGTCC AACTTCTACCCTCGGGGCCTGCAGCTGACCTGGCTGGAAAACGGCA ATGTGTCCCGGACCGAGACAGCCTCCACCCTGATCGAGAACAAGGA TGGCACCTACAATTGGATGTCCTGGCTGCTCGTGAACACCTGTGCC CACCGGGACGATGTGGTGCTGACCTGTCAGGTGGAACACGATGGCC AGCAGGCCGTGTCCAAGTCCTACGCTCTGGAAGTGTCCGCCCACCC CAAAGAGCAGGGCTCTAATACCGCCGCTGAGAACACCGGCTCCAAC GAGCGGAACATCTACATCGTCGTGGGCGTCGTGTGCACCCTGCTGG TGGCACTGCTGATGGCCGCTCTGTACCTCGTGCGGATCCGGCAGAA GAAGGCTCAGGGCTCCACCTCCTCCACCAGACTGCACGAGCCTGAG AAGAACGCCAGAGAGATCACCCAGGACACCAACGACATCACCTACG CCGACCTGAACCTGCCCAAGGGCAAGAAGCCTGCCCCTCAGGCTGC CGAGCCTAACAACCACACCGAGTACGCCTCCATCCAGACCAGCCCT CAGCCTGCCTCTGAGGACACCCTGACCTACGCTGATCTGGACATGG TGCACCTGAACCGGACCCCCAAGCAGCCAGCTCCTAAGCCCGAGCC TAGCTTCTCTGAGTACGCCAGCGTGCAGGTGCCCCGGAAA hSIRPα-VαC1αC2β 60 MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVA (amino acid sequence) AGETATLRCTATSLIPVGPIQWFRGAGPGRELIYNQKEGHFPRVTT VSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGA GTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKW FKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEV AHVTLQGDPLRGTANLSETIRVPPTLEVTQQPMRAENQANVTCQVS NFYPRGLQLTWLENGNVSRTETASTLIENKDGTYNWMSWLLVNTCA HRDDVVLTCQVEHDGQQAVSKSYALEVSAHPKEQGSNTAAENTGSN ERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPE KNAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSP QPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK human 61 ATGGAGCCCGCCGGCCCGGCCCCCGGCCGCCTCGGGCCGCTGCTCT SIRPαV1(P74A) GCCTGCTGCTCGCCGCGTCCTGCGCCTGGTCAGGAGTGGCGGGTGA (nucleotide sequence) GGAGGAGCTGCAGGTGATTCAGCCTGACAAGTCCGTGTTGGTTGCA GCTGGAGAGACAGCCACTCTGCGCTGCACTGCGACCTCTCTGATCC CTGTGGGGCCCATCCAGTGGTTCAGAGGAGCTGGAGCAGGCCGGGA ATTAATCTACAATCAAAAAGAAGGCCACTTCCCCCGGGTAACAACT GTTTCAGACCTCACAAAGAGAAACAACATGGACTTTTCCATCCGCA TCGGTAACATCACCCCAGCAGATGCCGGCACCTACTACTGTGTGAA GTTCCGGAAAGGGAGCCCCGATGACGTGGAGTTTAAGTCTGGAGCA GGCACTGAGCTGTCTGTGCGCGCCAAACCCTCTGCCCCCGTGGTAT CGGGCCCTGCGGCGAGGGCCACACCTCAGCACACAGTGAGCTTCAC CTGCGAGTCCCACGGCTTCTCACCCAGAGACATCACCCTGAAATGG TTCAAAAATGGGAATGAGCTCTCAGACTTCCAGACCAACGTGGACC CCGTAGGAGAGAGCGTGTCCTACAGCATCCACAGCACAGCCAAGGT GGTGCTGACCCGCGAGGACGTTCACTCTCAAGTCATCTGCGAGGTG GCCCACGTCACCTTGCAGGGGGACCCTCTTCGTGGGACTGCCAACT TGTCTGAGACCATCCGAGTTCCACCCACCTTGGAGGTTACTCAACA GCCCGTGAGGGCAGAGAACCAGGTGAATGTCACCTGCCAGGTGAGG AAGTTCTACCCCCAGAGACTACAGCTGACCTGGTTGGAGAATGGAA ACGTGTCCCGGACAGAAACGGCCTCAACCGTTACAGAGAACAAGGA TGGTACCTACAACTGGATGAGCTGGCTCCTGGTGAATGTATCTGCC CACAGGGATGATGTGAAGCTCACCTGCCAGGTGGAGCATGACGGGC AGCCAGCGGTCAGCAAAAGCCATGACCTGAAGGTCTCAGCCCACCC GAAGGAGCAGGGCTCAAATACCGCCGCTGAGAACACTGGATCTAAT GAACGGAACATCTATATTGTGGTGGGTGTGGTGTGCACCTTGCTGG TGGCCCTACTGATGGCGGCCCTCTACCTCGTCCGAATCAGACAGAA GAAAGCCCAGGGCTCCACTTCTTCTACAAGGTTGCATGAGCCCGAG AAGAATGCCAGAGAAATAACACAGGACACAAATGATATCACATATG CAGACCTGAACCTGCCCAAGGGGAAGAAGCCTGCTCCCCAGGCTGC GGAGCCCAACAACCACACGGAGTATGCCAGCATTCAGACCAGCCCG CAGCCCGCGTCGGAGGACACCCTCACCTATGCTGACCTGGACATGG TCCACCTCAACCGGACCCCCAAGCAGCCGGCCCCCAAGCCTGAGCC GTCCTTCTCAGAGTACGCCAGCGTCCAGGTCCCGAGGAAG human 62 MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVA SIRPαV1(P74A) AGETATLRCTATSLIPVGPIQWFRGAGAGRELIYNQKEGHFPRVTT (amino acid sequence) VSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGA GTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKW FKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEV AHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVR KFYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSA HRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSN ERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPE KNAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSP QPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK human kappa constant 63 CGGACCGTGGCCGCTCCCTCCGTGTTCATCTTCCCACCTTCCGACG domain (nucleotide AGCAGCTGAAGTCCGGCACCGCTTCTGTCGTGTGCCTGCTGAACAA sequence) CTTCTACCCCCGCGAGGCCAAGGTGCAGTGGAAGGTGGACAACGCC CTGCAGTCCGGCAACTCCCAGGAATCCGTGACCGAGCAGGACTCCA AGGACAGCACCTACTCCCTGTCCTCCACCCTGACCCTGTCCAAGGC CGACTACGAGAAGCACAAGGTGTACGCCTGCGAAGTGACCCACCAG GGCCTGTCTAGCCCTGTGACCAAGTCCTTCAACCGGGGCGAGTGC human kappa constant 64 RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNA domain (protein LQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQ sequence) GLSSPVTKSFNRGEC human IgG4 constant 65 GCTTCCACCAAGGGCCCCTCCGTGTTTCCTCTGGCCCCTTGCTCCA domains (including GATCCACCTCCGAGTCTACCGCCGCTCTGGGCTGCCTCGTGAAGGA S228P) CTACTTCCCCGAGCCTGTGACAGTGTCCTGGAACTCTGGCGCCCTG (nucleotide sequence) ACCTCTGGCGTGCACACCTTTCCAGCTGTGCTGCAGTCCTCCGGCC TGTACTCCCTGTCCAGCGTCGTGACAGTGCCCTCCAGCTCTCTGGG CACCAAGACCTACACCTGTAACGTGGACCACAAGCCCTCCAACACC AAGGTGGACAAGCGGGTGGAATCTAAGTACGGCCCTCCCTGCCCTC CTTGCCCAGCCCCTGAATTTCTGGGCGGACCTTCTGTGTTTCTGTT CCCCCCAAAGCCCAAGGACACCCTGATGATCTCCCGGACCCCCGAA GTGACCTGCGTGGTGGTGGATGTGTCCCAGGAAGATCCCGAGGTGC AGTTCAATTGGTACGTGGACGGCGTGGAAGTGCACAACGCCAAGAC CAAGCCTAGAGAGGAACAGTTCAACTCCACCTACCGGGTGGTGTCC GTGCTGACCGTGCTGCACCAGGATTGGCTGAACGGCAAAGAGTACA AGTGCAAGGTGTCCAACAAGGGCCTGCCCAGCTCCATCGAAAAGAC CATCTCCAAGGCCAAGGGCCAGCCCCGGGAACCCCAGGTGTACACA CTGCCTCCAAGCCAGGAAGAGATGACCAAGAACCAGGTGTCCCTGA CCTGTCTCGTGAAAGGCTTCTACCCCTCCGATATCGCCGTGGAATG GGAGTCCAACGGCCAGCCTGAGAACAACTACAAGACCACCCCCCCT GTGCTGGACTCCGACGGCTCCTTCTTTCTGTACTCTCGCCTGACCG TGGACAAGTCCCGGTGGCAGGAAGGCAACGTGTTCTCCTGCAGCGT GATGCACGAGGCCCTGCACAACCACTACACCCAGAAGTCCCTGTCC CTGTCTCTGGGAAAA human IgG4 constant 66 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGAL domains (including TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNT S228P) KVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPE (protein sequence) VTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVS VLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYT LPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLS LSLGK human IgG2 constant 67 GCTTCTACAAAGGGCCCCAGCGTGTTCCCTCTGGCTCCTTGTAGCA domains (nucleotide GAAGCACCAGCGAGTCTACAGCCGCTCTGGGCTGTCTGGTCAAGGA sequence) CTACTTTCCCGAGCCTGTGACCGTGTCCTGGAATAGCGGAGCACTG ACAAGCGGCGTGCACACCTTTCCAGCTGTGCTGCAAAGCTCCGGCC TGTACTCTCTGTCCAGCGTGGTCACAGTGCCCAGCAGCAATTTTGG CACCCAGACCTACACCTGTAATGTGGACCACAAGCCTAGCAACACC AAGGTGGACAAGACCGTGGAACGGAAGTGCTGCGTGGAATGCCCTC CTTGTCCTGCTCCTCCAGTGGCTGGCCCTTCCGTGTTTCTGTTCCC TCCAAAGCCTAAGGACACCCTGATGATCAGCAGAACCCCTGAAGTG ACCTGCGTGGTGGTGGATGTGTCCCACGAGGATCCTGAGGTGCAGT TCAATTGGTACGTGGACGGCGTGGAAGTGCACAACGCCAAGACCAA GCCTAGAGAGGAACAGTTCAACAGCACCTTCAGAGTGGTGTCCGTG CTGACCGTGGTGCATCAGGATTGGCTGAACGGCAAAGAGTACAAGT GCAAGGTGTCCAACAAGGGCCTGCCTGCTCCTATCGAGAAAACCAT CAGCAAGACCAAAGGCCAGCCTCGCGAGCCCCAGGTTTACACACTT CCTCCAAGCCGGGAAGAGATGACCAAGAACCAGGTGTCCCTGACCT GCCTCGTGAAGGGCTTCTACCCCAGCGACATCX1CCGTGGAATGGG AGAGCAATGGCCAGCCTGAGAACAACTACAAGACCACACCTCCTAT GCTGGACTCCGACGGCTCATTCTTCCTGTACAGCAAGCTGACAGTG GACAAGTCCAGATGGCAGCAGGGCAACGTGTTCTCCTGCAGCGTGA TGCACGAGGCCCTGCACAACCACTACACCCAGAAGTCCCTGTCTCT GAGCCCCGGCAAA wherein: X1 = G, T human IgG2 constant 68 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGAL domains (protein TSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNT sequence) KVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEV TCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSV LTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTL PPSREEMTKNQVSLTCLVKGFYPSDIX1VEWESNGQPENNYKTTPP MLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK wherein: X1 = A, S 40A heavy chain 69 SYWMH CDR1 (amino acid sequence) 40A heavy chain 70 AIYPVNNDTTYNQKFKG CDR2 (amino acid sequence) 40A heavy chain 71 SFYYSLDAAWFVY CDR3 (amino acid sequence) 40A light chain CDR1 72 RASQDIGSRLN (amino acid sequence) 40A light chain CDR2 73 ATSSLDS (amino acid sequence) 40A light chain CDR3 74 LQYASSPFT (amino acid sequence) humanized 40 heavy 75 EVQX1X2QSGAX3X4X5KPGASVKX6SCKASGSTFTSYWMHWVX7QX8 chain variable region PGQGLEWX9GAIYPVNSDTTYNQKFKGX10X11TX12TVX13X14SX15S (consensus sequence) TX16YMX17LSSLX18X19EDX20AVYYCX21RSFYYSLDAAWFVYWGQG TX22X23TVSS wherein: X1 = F, L X2 = Q, R, V X3 = E, V X4 = L, V X5 = A, K, V X6 = L, M, V X7 = K, R X8 = A, R, T X9 = I, M X10 = K, R X11 = A, V X12 = L, M X13 = D, V X14 = K, T X15 = A, S, T X16 = A, V X17 = E, Q X18 = R, T X19 = F, S X20 = S, T X21 = A, T X22 = L, T X23 = L, V humanized 40 light 76 DIQMTQSPSSLSASX1GX2RVX3ITCRASQDIGSRLNWLQQX4PGKA chain variable region X5KRLIYATSSLDSGVPX6RFSGSX7SGX8X9X10X11LTISX12LQPE (consensus sequence) DFATYYCLQYASSPFTFGX13GTKX14EIX15 wherein: X1 = L, V X2 = D, E X3 = S, T X4 = K, T X5 = I, P X6 = K, S X7 = G, R X8 = S, T X9 = D, E X10 = F, Y X11 = S, T X12 = G, S X13 = G, Q X14 = L, V X15 = H, K hSIRPα.40AVH1 77 GAGGTGCAGTTCTTGCAGTCTGGTGCCGTGCTGGCTAGACCTGGAA (nucleotide sequence) CCTCCGTGAAGATCTCCTGCAAGGCCTCCGGCTCCACCTTCACCTC TTACTGGATGCACTGGGTCAAGCAGAGGCCTGGACAGGGACTCGAA TGGATCGGCGCTCTGTACCCTGTGAACTCCGACACCACCTACAACC AGAAGTTCAAGGGCAGAGCCAAGCTGACCGTGGCCACCTCTGCTTC TATCGCCTACCTGGAATTTTCCAGCCTGACCAACGAGGACTCCGCC GTGTACTACTGCGCCCGGTCCTTCTACTACTCTCTGGACGCCGCTT GGTTTGTGTACTGGGGCCAGGGAACTCTGGTGACCGTGTCCTCT hSIRPα.40AVH1 78 EVQFLQSGAVLARPGTSVKISCKASGSTFTSYWMHWVKQRPGQGLE (amino acid sequence) WIGALYPVNSDTTYNQKFKGRAKLTVATSASIAYLEFSSLTNEDSA VYYCARSFYYSLDAAWFVYWGQGTLVTVSS hSIRPα.40AVH2 79 GAGGTGCAGCTGGTTCAGTCTGGCGCTGAGGTTGTGAAGCCTGGCG (nucleotide sequence) CTTCCGTGAAGCTGTCCTGCAAGGCTTCTGGCTCCACCTTCACCAG CTACTGGATGCACTGGGTCAAGCAGGCCCCTGGACAAGGCCTGGAA TGGATCGGCGCTATCTACCCCGTGAACTCCGACACCACCTACAACC AGAAGTTCAAGGGCAAAGCTACCCTGACCGTGGACAAGTCTGCCTC CACCGCCTACATGGAACTGTCCAGCCTGAGATCTGAGGACACCGCC GTGTACTACTGCACCCGGTCCTTCTACTACTCCCTGGACGCCGCTT GGTTTGTGTATTGGGGCCAGGGAACACTGGTGACCGTGTCCTCT hSIRPα.40AVH2 80 EVQLVQSGAEVVKPGASVKLSCKASGSTFTSYWMHWVKQAPGQGLE (amino acid sequence) WIGAIYPVNSDTTYNQKFKGKATLTVDKSASTAYMELSSLRSEDTA VYYCTRSFYYSLDAAWFVYWGQGTLVTVSS hSIRPα.40AVH3 81 GAGGTGCAGCTGAGACAGTCTGGCGCTGTGCTTGTGAAGCCTGGCG (nucleotide sequence) CCTCCGTGAAGATGTCCTGCAAGGCTTCTGGCTCCACCTTCACCAG CTACTGGATGCACTGGGTCAAGCAGACCCCTGGACAGGGACTCGAG TGGATCGGCGCTATCTACCCTGTGAACTCCGACACCACCTACAACC AGAAGTTCAAGGGCAAAGCTACCCTGACCGTGGACAAGTCCTCCTC CACCGCTTACATGCAGCTGTCCAGCCTGACCTCTGAGGACTCCGCC GTGTACTACTGCGCCCGGTCCTTCTACTACTCTCTGGACGCCGCTT GGTTTGTGTACTGGGGCCAGGGCACAACCCTGACAGTGTCCTCT hSIRPα.40AVH3 82 EVQLRQSGAVLVKPGASVKMSCKASGSTFTSYWMHWVKQTPGQGLE (amino acid sequence) WIGAIYPVNSDTTYNQKFKGKATLTVDKSSSTAYMQLSSLTSEDSA VYYCARSFYYSLDAAWFVYWGQGTTLTVSS hSIRPα.40AVH4 83 GAGGTGCAGTTCGTTCAGTCTGGCGCCGAAGTGAAGAAACCTGGCG (nucleotide sequence) CCTCTGTGAAGGTGTCCTGCAAGGCTTCTGGCTCCACCTTCACCAG CTACTGGATGCACTGGGTCCGACAGGCTCCAGGACAAGGCTTGGAA TGGATGGGCGCTATCTACCCCGTGAACTCCGACACCACCTACAACC AGAAATTCAAGGGCAGAGTGACCATGACCGTCGTGACCTCCACCTC CACCGTGTACATGGAACTGTCCAGCCTGAGATCCGAGGACACCGCC GTGTACTACTGCGCCCGGTCCTTCTACTACTCTCTGGACGCCGCTT GGTTTGTGTACTGGGGCCAGGGAACTCTGGTGACCGTGTCCTCT hSIRPα.40AVH4 84 EVQFVQSGAEVKKPGASVKVSCKASGSTFTSYWMHWVRQAPGQGLE (amino acid sequence) WMGAIYPVNSDTTYNQKFKGRVTMTVVTSTSTVYMELSSLRSEDTA VYYCARSFYYSLDAAWFVYWGQGTLVTVSS hSIRPα.40AVH5 85 GAGGTCCAGCTGCAACAGTCTGGTGCCGTGTTGGCTAAGCCTGGCG (nucleotide sequence) CCTCCGTGAAGATGTCCTGCAAGGCTTCTGGCTCCACCTTCACCAG CTACTGGATGCACTGGGTCAAGCAGAGGCCTGGACAGGGACTCGAG TGGATCGGCGCTATCTACCCTGTGAACTCCGACACCACCTACAACC AGAAGTTCAAGGGCAAAGCTACCCTGACCGTGGACAAGTCCTCCTC CACCGCTTACATGCAGCTGTCCAGCCTGACCTTCGAGGACTCCGCC GTGTACTACTGCGCCCGGTCCTTCTACTACTCTCTGGACGCCGCTT GGTTTGTGTACTGGGGCCAGGGCACAACCCTGACAGTGTCCTCT hSIRPα.40AVH5 86 EVQLQQSGAVLAKPGASVKMSCKASGSTFTSYWMHWVKQRPGQGLE (amino acid sequence) WIGAIYPVNSDTTYNQKFKGKATLTVDKSSSTAYMQLSSLTFEDSA VYYCARSFYYSLDAAWFVYWGQGTTLTVSS hSIRPα.40AVH6 87 GAGGTGCAGCTGGTTCAGTCTGGCGCCGAAGTGAAGAAACCTGGCG (nucleotide sequence) CCTCTGTGAAGGTGTCCTGCAAGGCTTCTGGCTCCACCTTCACCAG CTACTGGATGCACTGGGTCCGACAGGCTCCAGGACAAGGCTTGGAA TGGATGGGCGCTATCTACCCCGTGAACTCCGACACCACCTACAACC AGAAATTCAAGGGCAGAGTGACCATGACCGTGGACACCTCCACCAG CACCGTGTACATGGAACTGTCCAGCCTGAGATCCGAGGACACCGCC GTGTACTACTGCGCCCGGTCCTTCTACTACTCTCTGGACGCCGCTT GGTTTGTGTACTGGGGCCAGGGAACTCTGGTGACCGTGTCCTCT hSIRPα.40AVH6 88 EVQLVQSGAEVKKPGASVKVSCKASGSTFTSYWMHWVRQAPGQGLE (amino acid sequence) WMGAIYPVNSDTTYNQKFKGRVTMTVDTSTSTVYMELSSLRSEDTA VYYCARSFYYSLDAAWFVYWGQGTLVTVSS hSIRPα.40AVL1 89 GACATCCAGATGACCCAGTCTCCATCCTCTCTGTCCGCCTCTGTGG (nucleotide sequence) GCGACAGAGTGACCATCACCTGTAGAGCCTCTCAGGACATCGGCTC CAGACTGAACTGGCTGCAGCAGACCCCTGGCAAGGCCATCAAGAGA CTGATCTACGCCACCTCCAGCCTGGATTCTGGCGTGCCCTCTAGAT TCTCCGGCTCTAGATCTGGCACCGACTTCTCCCTGACCATCTCTGG ACTGCAGCCTGAGGACTTCGCCACCTACTACTGTCTGCAGTACGCC AGCTCTCCATTCACCTTTGGCGGAGGCACCAAGGTGGAAATCCAC hSIRPα.40AVL1 90 DIQMTQSPSSLSASVGDRVTITCRASQDIGSRLNWLQQTPGKAIKR (amino acid sequence) LIYATSSLDSGVPSRFSGSRSGTDFSLTISGLQPEDFATYYCLQYA SSPFTFGGGTKVEIH hSIRPα.40AVL2 91 GACATCCAGATGACCCAGTCTCCATCCTCTCTGTCCGCCTCTGTGG (nucleotide sequence) GCGACAGAGTGACCATCACCTGTAGAGCCTCTCAGGACATCGGCTC CAGACTGAACTGGCTGCAGCAGAAGCCTGGCAAGGCCATCAAGAGA CTGATCTACGCCACCTCCAGCCTGGATTCTGGCGTGCCCTCTAGAT TCTCCGGCTCTAGATCTGGCACCGACTTTACCCTGACAATCAGCTC CCTGCAGCCTGAGGACTTCGCCACCTACTACTGTCTGCAGTACGCC TCCTCTCCATTCACCTTTGGCCAGGGCACCAAGGTGGAAATCAAG hSIRPα.40AVL2 92 DIQMTQSPSSLSASVGDRVTITCRASQDIGSRLNWLQQKPGKAIKR (amino acid sequence) LIYATSSLDSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCLQYA SSPFTFGQGTKVEIK hSIRPα.40AVL3 93 GACATCCAGATGACCCAGTCTCCATCCTCTCTGTCCGCCTCTGTGG (nucleotide sequence) GCGACAGAGTGACCATCACCTGTAGAGCCTCTCAGGACATCGGCTC CAGACTGAACTGGCTGCAGCAGAAGCCTGGCAAGGCCATCAAGAGA CTGATCTACGCCACCTCCAGCCTGGATTCTGGCGTGCCCTCTAGAT TCTCCGGCTCTAGATCTGGCACCGACTTTACCCTGACAATCAGCTC CCTGCAGCCTGAGGACTTCGCCACCTACTACTGTCTGCAGTACGCC AGCTCTCCATTCACCTTTGGCGGAGGCACCAAGCTGGAAATCAAG hSIRPα.40AVL3 94 DIQMTQSPSSLSASVGDRVTITCRASQDIGSRLNWLQQKPGKAIKR (amino acid sequence) LIYATSSLDSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCLQYA SSPFTFGGGTKLEIK hSIRPα.40AVL4 95 GACATCCAGATGACCCAGTCTCCATCCTCTCTGTCCGCCTCTGTGG (nucleotide sequence) GCGACAGAGTGACCATCACCTGTAGAGCCTCTCAGGACATCGGCTC CAGACTGAACTGGCTGCAGCAGAAGCCTGGCAAGGCCCCTAAGAGA CTGATCTACGCCACCTCCAGCCTGGATTCTGGCGTGCCCTCTAGAT TCTCCGGCTCTGGCTCTGGCACCGAGTTTACCCTGACAATCAGCTC CCTGCAGCCTGAGGACTTCGCCACCTACTACTGTCTGCAGTACGCC AGCTCTCCATTCACCTTTGGCGGAGGCACCAAGGTGGAAATCAAG hSIRPα.40AVL4 96 DIQMTQSPSSLSASVGDRVTITCRASQDIGSRLNWLQQKPGKAPKR (amino acid sequence) LIYATSSLDSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQYA SSPFTFGGGTKVEIK hSIRPα.40AVL5 97 GACATCCAGATGACCCAGTCTCCATCCTCTCTGTCCGCCTCTGTGG (nucleotide sequence) GCGACAGAGTGACCATCACCTGTAGAGCCTCTCAGGACATCGGCTC CAGACTGAACTGGCTGCAGCAGAAGCCTGGCAAGGCCATCAAGAGA CTGATCTACGCCACCTCCAGCCTGGATTCTGGCGTGCCCAAGAGAT TCTCCGGCTCTAGATCCGGCTCCGACTATACCCTGACAATCAGCTC CCTGCAGCCTGAGGACTTCGCCACCTACTACTGTCTGCAGTACGCC TCCTCTCCATTCACCTTTGGCCAGGGCACCAAGGTGGAAATCAAG hSIRPα.40AVL5 98 DIQMTQSPSSLSASVGDRVTITCRASQDIGSRLNWLQQKPGKAIKR (amino acid sequence) LIYATSSLDSGVPKRFSGSRSGSDYTLTISSLQPEDFATYYCLQYA SSPFTFGQGTKVEIK hSIRPα.40AVL6 99 GACATCCAGATGACCCAGTCTCCATCCTCTCTGTCTGCTTCCCTGG (nucleotide sequence) GCGAGAGAGTGTCCATCACCTGTAGAGCCTCTCAGGACATCGGCTC CAGACTGAACTGGCTGCAGCAGAAGCCTGGCAAGGCCATCAAGAGA CTGATCTACGCCACCTCCAGCCTGGATTCTGGCGTGCCCTCTAGAT TCTCCGGCTCTAGATCTGGCACCGACTTTACCCTGACAATCAGCTC CCTGCAGCCTGAGGACTTCGCCACCTACTACTGTCTGCAGTACGCC AGCTCTCCATTCACCTTTGGCGGAGGCACCAAGGTGGAAATCAAG hSIRPα.40AVL6 100 DIQMTQSPSSLSASLGERVSITCRASQDIGSRLNWLQQKPGKAIKR (amino acid sequence) LIYATSSLDSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCLQYA SSPFTFGGGTKVEIK hSIRPα.40A mouse 101 GAGGTTCAGTTCCAGCAGTCTGGGACTGTGCTGGCAAGGCCAGGGA VH (nucleotide CTTCAGTGAAGATGTCCTGCAAGGCTTCTGGCTCCACCTTTACCAG sequence) CTACTGGATGCACTGGGTAAAACAGGGGCCTGGACAGGGTCTGCAA TGGATTGGCGCTATTTATCCTGTAAATAATGATACTACCTATAATC AGAAGTTCAAGGGCAAGGCCGAACTCACTGTAGTCACTTCCACCAG CACTGCCTACATGGAGGTCAGTAGTCTGACAAATGAGGACTCTGCG GTCTATTACTGTACAAGATCGTTCTACTATAGTCTCGACGCGGCCT GGTTTGTTTACTGGGGCCAAGGGACTCTGGTCACTGTCTCTGCA hSIRPα.40A mouse 102 EVQFQQSGTVLARPGTSVKMSCKASGSTFTSYWMHWVKQGPGQGLQ VH (amino acid WIGAIYPVNNDTTYNQKFKGKAELTVVTSTSTAYMEVSSLTNEDSA sequence) VYYCTRSFYYSLDAAWFVYWGQGTLVTVSA hSIRPα.40A mouse 103 GACATCCAGATGACCCAGTCTCCATCCTCCTTATCTGCCTCTCTGG VL (nucleotide GAGAAAGAGTCAGTCTCACTTGTCGGGCAAGTCAGGACATTGGTAG sequence) TAGGTTAAACTGGCTTCAGCAGGAACCAGATGGAACTATTAAACGC CTGATCTACGCCACATCCAGTTTAGATTCTGGTGTCCCCAAAAGGT TCAGTGGCAGTAGGTCTGGGTCAGATTATTCTCTCACCATCAGCGG CCTTGAGTCTGAAGACTTTGTAGACTATTACTGTCTACAATATGCT AGTTCTCCGTTCACGTTCGGAGGGGGGACCAAGCTGGAAATAAAC hSIRPα.40A mouse 104 DIQMTQSPSSLSASLGERVSLTCRASQDIGSRLNWLQQEPDGTIKR VL (amino acid LIYATSSLDSGVPKRFSGSRSGSDYSLTISGLESEDFVDYYCLQYA sequence) SSPFTFGGGTKLEIN hSIRPα.40A mouse 105 EVQFQQSGTVLARPGTSVKMSCKASGSTFTSYWMHWVKQGPGQGLQ heavy chain (amino WIGAIYPVNNDTTYNQKFKGKAELTVVTSTSTAYMEVSSLTNEDSA acid sequence; VYYCTRSFYYSLDAAWFVYWGQGTLVTVSAAKTTPPSVYPLAPGSA constant domain AQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLY underlined, signal TLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCI peptide not shown) CTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSW FVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRV NSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMI TDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKS NWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK hSIRPα.40A mouse 106 DIQMTQSPSSLSASLGERVSLTCRASQDIGSRLNWLQQEPDGTIKR light chain (amino acid LIYATSSLDSGVPKRFSGSRSGSDYSLTISGLESEDFVDYYCLQYA sequence; constant SSPFTFGGGTKLEINRADAAPTVSIFPPSSEQLTSGGASVVCFLNN domain underlined, FYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKD signal peptide not EYERHNSYTCEATHKTSTSPIVKSFNRNEC shown) rhSIRPα/Fc (amino 107 (GVAG)EEELQVIQPDKSVLVAAGETATLRCTATSLIPVGPIQWFR acid sequence) GAGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRIGNITPADA GTYYCVKFRKGSPDDVEFKSGAGTELSVRAKPSAPVVSGPAARATP QHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPVGESVSYS IHSTAKVVLTREDVHSQVICEVAHVTLQGDPLRGTANLSETIRVPP TLEVTQQPVRAENQVNVTCQVRKFYPQRLQLTWLENGNVSRTETAS TVTENKDGTYNWMSWLLVNVSAHRDDVKLTCQVEHDGQPAVSKSHD LKVSAHPKEQGSNTAAENTGSNERIEGRMDPKSCDKTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK rhSIRPγ/Fc (amino 108 VLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSI acid sequence) TPADVGTYYCVKFRKGSPENVEFKSGPGTEMALGAKPSAPVVLGPA ARTTPEHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPTGQ SVAYSIRSTARVVLDPWDVRSQVICEVAHVTLQGDPLRGTANLSEA IRVPPTLEVTQQPMRAGNQVNVTCQVRKFYPQSLQLTWLENGNVCQ RETASTLTENKDGTYNWTSWFLVNISDQRDDVVLTCQVKHDGQLAV SKRLALEVTVHQKDQSSDATPGPASIEGRMDPKSCDKTHTCPPCPA PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKV SNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK rhCD47/Fc (amino 109 QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRD acid sequence) IYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTG NYTCEVTELTREGETIIELKYRVVSWFSPIEGRMDPKSCDKTHTCP PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK hSIRP-VγC1βC2β 110 ATGCCCGTGCCTGCCTCTTGGCCTCATCTGCCCAGCCCCTTTCTGC (nucleotide sequence) TGATGACCCTGCTGCTGGGCAGGCTGACAGGCGTGGCAGGCGAAGA GGAACTGCAGATGATCCAGCCCGAGAAGCTGCTGCTCGTGACCGTG GGCAAGACCGCCACCCTGCACTGCACCGTGACATCCCTGCTGCCTG TGGGACCCGTGCTGTGGTTTAGAGGCGTGGGCCCTGGCAGAGAGCT GATCTACAACCAGAAAGAGGGCCACTTCCCCAGAGTGACCACCGTG TCCGACCTGACCAAGCGGAACAACATGGACTTCTCCATCCGGATCT CCAGCATCACCCCTGCCGACGTGGGCACCTACTACTGCGTGAAGTT CCGGAAGGGCTCCCCCGAGAACGTGGAGTTCAAGTCTGGCCCAGGC ACCGAGATGGCCCTGGGCGCTAAACCTTCTGCCCCTGTGGTGTCTG GACCTGCCGTGCGGGCTACCCCTGAGCACACCGTGTCTTTTACCTG CGAGTCCCACGGCTTCAGCCCTCGGGACATCACCCTGAAGTGGTTC AAGAACGGCAACGAGCTGTCCGACTTCCAGACCAACGTGGACCCTG CCGGCGACTCCGTGTCCTACTCCATCCACTCTACCGCCAGAGTGGT GCTGACCAGAGGCGACGTGCACTCCCAAGTGATCTGCGAGATCGCC CATATCACACTGCAGGGCGACCCCCTGAGAGGCACCGCCAATCTGT CTGAGGCCATCAGAGTGCCCCCCACCCTGGAAGTGACCCAGCAGCC TATGAGAGCCGAGAACCAGGCCAACGTGACCTGTCAGGTGTCCAAC TTCTACCCTCGGGGCCTGCAGCTGACCTGGCTGGAAAACGGCAATG TGTCCCGGACCGAGACAGCCTCCACCCTGATCGAGAACAAGGACGG CACCTACAATTGGATGTCCTGGCTGCTCGTGAACACCTGTGCCCAC AGGGACGACGTGGTGCTGACATGCCAGGTGGAACACGATGGCCAGC AGGCCGTGTCCAAGTCCTACGCCCTGGAAATCTCCGCCCATCAGAA AGAGCACGGCTCCGATATCACCCACGAGGCCGCTCTGGCTCCTACC GCTCCTCTGCTGGTGGCTCTGCTGCTGGGACCTAAGCTGCTGCTGG TCGTGGGCGTGTCCGCCATCTACATCTGCTGGAAGCAGAAGGCCTG A hSIRP-VγC1βC2β 111 MPVPASWPHLPSPFLLMTLLLGRLTGVAGEEELQMIQPEKLLLVTV (amino acid sequence) GKTATLHCTVTSLLPVGPVLWFRGVGPGRELIYNQKEGHFPRVTTV SDLTKRNNMDFSIRISSITPADVGTYYCVKFRKGSPENVEFKSGPG TEMALGAKPSAPVVSGPAVRATPEHTVSFTCESHGFSPRDITLKWF KNGNELSDFQTNVDPAGDSVSYSIHSTARVVLTRGDVHSQVICEIA HITLQGDPLRGTANLSEAIRVPPTLEVTQQPMRAENQANVTCQVSN FYPRGLQLTWLENGNVSRTETASTLIENKDGTYNWMSWLLVNTCAH RDDVVLTCQVEHDGQQAVSKSYALEISAHQKEHGSDITHEAALAPT APLLVALLLGPKLLLVVGVSAIYICWKQKA hSIRP-VβC1γC2β 112 ATGCCCGTGCCTGCCTCTTGGCCTCATCTGCCCAGCCCCTTTCTGC (nucleotide sequence) TGATGACCCTGCTGCTGGGCAGGCTGACAGGCGTGGCAGGCGAAGA TGAGCTGCAAGTGATCCAGCCCGAGAAGTCCGTGTCTGTGGCCGCT GGCGAGTCTGCCACCCTGAGATGCGCTATGACCTCCCTGATCCCCG TGGGCCCCATCATGTGGTTTAGAGGCGCTGGCGCTGGCAGAGAGCT GATCTACAACCAGAAAGAGGGCCACTTCCCCAGAGTGACCACCGTG TCCGAGCTGACCAAGCGGAACAACCTGGACTTCTCCATCTCCATCA GCAACATCACCCCTGCCGACGCCGGCACCTACTACTGCGTGAAGTT CCGGAAGGGCTCCCCCGACGACGTGGAGTTCAAATCCGGCGCTGGA ACCGAGCTGTCCGTGCGGGCTAAACCTTCTGCCCCTGTGGTGCTGG GACCTGCCGCTAGAACCACCCCTGAGCACACCGTGTCTTTTACCTG CGAGTCCCACGGCTTCAGCCCTCGGGACATCACCCTGAAGTGGTTC AAGAACGGCAACGAGCTGAGCGACTTCCAGACCAACGTGGACCCTA CCGGCCAGTCCGTGGCCTACTCCATCAGATCCACCGCCAGAGTGGT GCTGGACCCTTGGGATGTGCGGTCCCAAGTGATCTGCGAGGTGGCC CATGTGACACTGCAGGGCGATCCTCTGAGAGGCACCGCCAATCTGT CTGAGGCCATCAGAGTGCCCCCCACCCTGGAAGTGACCCAGCAGCC TATGAGAGCCGAGAACCAGGCCAACGTGACCTGCCAGGTGTCCAAC TTCTACCCTCGGGGCCTGCAGCTGACCTGGCTGGAAAACGGCAATG TGTCCCGGACCGAGACAGCCTCCACCCTGATCGAGAACAAGGATGG CACCTACAATTGGATGTCCTGGCTGCTCGTGAACACCTGTGCCCAC CGGGATGACGTGGTGCTGACTTGTCAGGTGGAACACGACGGCCAGC AGGCCGTGTCCAAGTCCTACGCCCTGGAAATCTCCGCCCATCAGAA AGAGCACGGCTCCGATATCACCCACGAGGCCGCTCTGGCTCCTACC GCTCCTCTGCTGGTGGCTCTGCTGCTGGGACCTAAGCTGCTGCTGG TCGTGGGCGTGTCCGCCATCTACATCTGCTGGAAGCAGAAGGCCTG A hSIRP-VβC1γC2β 113 MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAA (amino acid sequence) GESATLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTTV SELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAG TELSVRAKPSAPVVLGPAARTTPEHTVSFTCESHGFSPRDITLKWF KNGNELSDFQTNVDPTGQSVAYSIRSTARVVLDPWDVRSQVICEVA HVTLQGDPLRGTANLSEAIRVPPTLEVTQQPMRAENQANVTCQVSN FYPRGLQLTWLENGNVSRTETASTLIENKDGTYNWMSWLLVNTCAH RDDVVLTCQVEHDGQQAVSKSYALEISAHQKEHGSDITHEAALAPT APLLVALLLGPKLLLVVGVSAIYICWKQKA hSIRP-VβC1βC2γ 114 ATGCCCGTGCCTGCCTCTTGGCCTCATCTGCCCAGCCCCTTTCTGC (nucleotide sequence) TGATGACCCTGCTGCTGGGCAGGCTGACAGGCGTGGCAGGCGAAGA TGAGCTGCAAGTGATCCAGCCCGAGAAGTCCGTGTCTGTGGCCGCT GGCGAGTCTGCCACCCTGAGATGCGCTATGACCTCCCTGATCCCCG TGGGCCCCATCATGTGGTTTAGAGGCGCTGGCGCTGGCAGAGAGCT GATCTACAACCAGAAAGAGGGCCACTTCCCCAGAGTGACCACCGTG TCCGAGCTGACCAAGCGGAACAACCTGGACTTCTCCATCTCCATCA GCAACATCACCCCTGCCGACGCCGGCACCTACTACTGCGTGAAGTT CCGGAAGGGCTCCCCCGACGACGTGGAGTTCAAATCCGGCGCTGGA ACCGAGCTGTCCGTGCGGGCTAAACCTTCTGCCCCTGTGGTGTCTG GACCTGCTGTGCGCGCTACCCCTGAGCACACCGTGTCTTTTACCTG CGAGTCCCACGGCTTCAGCCCTCGGGACATCACCCTGAAGTGGTTC AAGAACGGCAACGAGCTGAGCGACTTCCAGACCAACGTGGACCCTG CCGGCGACTCCGTGTCCTACTCCATCCACTCTACCGCCAGAGTGGT GCTGACCAGAGGCGACGTGCACTCCCAAGTGATCTGCGAGATCGCC CATATCACACTGCAGGGCGACCCCCTGAGAGGCACCGCCAATCTGT CTGAGGCCATCAGAGTGCCCCCCACCCTGGAAGTGACCCAGCAGCC TATGAGAGTGGGCAACCAAGTGAACGTGACCTGCCAAGTGCGGAAG TTCTACCCCCAGTCCCTGCAGCTGACTTGGAGCGAGAATGGCAACG TGTGCCAGAGAGAGACAGCCTCCACCCTGACCGAGAACAAGGACGG AACCTACAACTGGACCTCCTGGTTCCTCGTGAACATCTCCGACCAG CGGGACGACGTGGTGCTGACATGCCAAGTGAAGCACGATGGACAGC TGGCCGTGTCCAAGCGGCTGGCTCTGGAAGTGACAGTGCACCAGAA AGAGCACGGCTCCGACATCACCCACGAGGCCGCTCTGGCTCCTACA GCTCCTCTGCTGGTGGCTCTGCTGCTGGGACCTAAGCTGCTGCTGG TCGTGGGCGTGTCCGCCATCTACATCTGCTGGAAGCAGAAGGCCTG A hSIRP-VβC1βC2γ 115 MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAA (amino acid sequence) GESATLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTTV SELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAG TELSVRAKPSAPVVSGPAVRATPEHTVSFTCESHGFSPRDITLKWF KNGNELSDFQTNVDPAGDSVSYSIHSTARVVLTRGDVHSQVICEIA HITLQGDPLRGTANLSEAIRVPPTLEVTQQPMRVGNQVNVTCQVRK FYPQSLQLTWSENGNVCQRETASTLTENKDGTYNWTSWFLVNISDQ RDDVVLTCQVKHDGQLAVSKRLALEVTVHQKEHGSDITHEAALAPT APLLVALLLGPKLLLVVGVSAIYICWKQKA human SIRPβL 116 ATGCCTGTGCCTGCCTCTTGGCCTCATCTGCCCTCTCCATTTCTGC (nucleotide sequence) TGATGACCCTGCTGCTGGGCAGACTGACAGGTGTTGCTGGCGAAGA GGAACTGCAAGTGATCCAGCCTGACAAGAGCATCTCTGTGGCCGCT GGCGAATCTGCCACACTGCACTGTACCGTGACATCTCTGATCCCTG TGGGCCCCATCCAGTGGTTTAGAGGTGCTGGACCTGGCAGAGAGCT GATCTACAACCAGAAAGAGGGACACTTCCCCAGAGTGACCACCGTG TCCGACCTGACCAAGCGGAACAACATGGACTTCAGCATCCGGATCA GCAACATCACCCCTGCCGATGCCGGCACCTACTACTGCGTGAAGTT CAGAAAGGGCAGCCCCGACCACGTCGAGTTTAAAAGCGGAGCCGGC ACAGAGCTGAGCGTGCGGGCTAAACCTTCTGCTCCTGTGGTGTCTG GACCAGCCGCTAGAGCTACACCTCAGCACACCGTGTCTTTTACCTG CGAGAGCCACGGCTTCAGCCCCAGAGATATCACCCTGAAGTGGTTC AAGAACGGCAACGAGCTGTCCGACTTCCAGACCAATGTGGACCCAG CCGGCGATAGCGTGTCCTACAGCATTCACAGCACCGCCAAGGTGGT GCTGACCCGGGAAGATGTGCACAGCCAAGTGATTTGCGAGGTGGCC CACGTTACCCTGCAAGGCGATCCTCTGAGAGGAACCGCCAACCTGA GCGAGACAATCCGGGTGCCACCTACACTGGAAGTGACCCAGCAGCC TGTGCGGGCCGAGAATCAAGTGAACGTGACCTGCCAAGTGCGGAAG TTCTACCCTCAGAGACTGCAGCTGACCTGGCTGGAAAACGGCAATG TGTCCCGGACCGAGACAGCCAGCACACTGACCGAGAACAAGGATGG CACCTACAATTGGATGAGCTGGCTGCTGGTCAATGTGTCTGCCCAC CGGGACGATGTGAAGCTGACATGCCAGGTGGAACACGATGGCCAGC CTGCCGTGTCTAAGAGCCACGACCTGAAGGTGTCCGCTCATCCCAA AGAGCAGGGCAGCAATACTGCCCCTGGACCTGCTCTTGCTTCTGCC GCTCCTCTGCTGATCGCCTTTCTGCTGGGACCTAAGGTGCTGCTGG TTGTGGGAGTGTCCGTGATCTACGTGTACTGGAAGCAGAAGGCC human SIRPβL (amino 117 MPVPASWPHLPSPFLLMTLLLGRLTGVAGEEELQVIQPDKSISVAA acid sequence) GESATLHCTVTSLIPVGPIQWFRGAGPGRELIYNQKEGHFPRVTTV SDLTKRNNMDFSIRISNITPADAGTYYCVKFRKGSPDHVEFKSGAG TELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKWF KNGNELSDFQTNVDPAGDSVSYSIHSTAKVVLTREDVHSQVICEVA HVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRK FYPQRLQLTWLENGNVSRTETASTLTENKDGTYNWMSWLLVNVSAH RDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAPGPALASA APLLIAFLLGPKVLLVVGVSVIYVYWKQKA human IgG1 constant 118 GCCAGCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCCA domains (nucleotide AGAGCACCTCTGGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAGGA sequence) CTACTTCCCCGAACCGGTGACGGTGTCGTGGAACTCAGGCGCCCTG ACCAGCGGCGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGAC TCTACTCCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAGCTTGGG CACCCAGACCTACATCTGCAACGTGAATCACAAGCCCAGCAACACC AAGGTGGACAAGAAAGTTGAGCCCAAATCTTGTGACAAAACTCACA CATGCCCACCGTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGT CTTCCTCTTCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGG ACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACC CTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATAA TGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTACCGG GTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCA AGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCAT CGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAG GTGTACACCCTGCCCCCATCCCGGGATGAGCTGACCAAGAACCAGG TCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGC CGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACC ACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCA AGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTC ATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAG AGCCTCTCCCTGTCTCCGGGTAAA human IgG1 constant 119 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGAL domains (amino acid TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNT sequence) KVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQ VYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQK SLSLSPGK mouse IgG1 constant 120 AKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSL domains (amino acid SSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTT sequence) VDKKLEPSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKD VLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHRED YNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKG LVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHT EENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLK NYYLKKTISRSPGK mouse kappa constant 121 RADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGS domain (amino acid ERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHK sequence) TSTSPIVKSFNRNEC human IgG2 constant 122 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGAL domains, V234A- TSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNT G237A-P238S- KVDKTVERKCCVECPPCPAPPAAASSVFLFPPKPKDTLMISRTPEV H268A-V309L- TCVVVDVSAEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSV A330S-P331S (Sigma) LTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKTKGQPREPQVYTL mutant (amino acid PPSREEMTKNQVSLTCLVKGFYPSDIX1VEWESNGQPENNYKTTPP sequence) MLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK wherein: X1 = A, S human IgG1 constant 123 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGAL domains, L234A- TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNT L235A mutant (amino KVDKKVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISR acid sequence) TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQ VYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQK SLSLSPGK human IgG1 constant 124 GCTAGCACAAAGGGCCCTAGTGTGTTTCCTCTGGCTCCCTCTTCCA domains, L234A- AATCCACTTCTGGTGGCACTGCTGCTCTGGGATGCCTGGTGAAGGA L235A-P329G mutant TTACTTTCCTGAACCTGTGACTGTCTCATGGAACTCTGGTGCTCTG (nucleotide sequence) ACTTCTGGTGTCCACACTTTCCCTGCTGTGCTGCAGTCTAGTGGAC TGTACTCTCTGTCATCTGTGGTCACTGTGCCCTCTTCATCTCTGGG AACCCAGACCTACATTTGTAATGTGAACCACAAACCATCCAACACT AAAGTGGACAAAAAAGTGGAACCCAAATCCTGTGACAAAACCCACA CCTGCCCACCTTGTCCGGCGCCTGAAGCGGCGGGAGGACCTTCTGT GTTTCTGTTCCCCCCCAAACCAAAGGATACCCTGATGATCTCGCGA ACCCCTGAGGTGACATGTGTGGTGGTGGATGTGTCTCATGAGGACC CCGAAGTCAAATTTAATTGGTATGTCGACGGCGTCGAGGTGCATAA TGCCAAAACCAAGCCTAGAGAGGAACAGTACAATTCAACCTACAGA GTCGTCAGTGTGCTGACTGTGCTGCATCAGGATTGGCTGAATGGCA AGGAATACAAGTGTAAAGTCTCAAACAAGGCCCTGGGAGCTCCAAT TGAGAAAACAATCTCAAAGGCCAAAGGACAGCCTAGGGAACCCCAG GTCTACACCCTGCCACCTTCGAGAGACGAACTGACCAAAAACCAGG TGTCCCTGACATGCCTGGTCAAAGGCTTCTACCCTTCTGACATTGC TGTGGAGTGGGAGTCAAATGGACAGCCTGAGAACAACTACAAAACA ACCCCCCCTGTGCTGGATTCTGATGGCTCTTTCTTTCTGTACTCCA AACTGACTGTGGACAAGTCTAGATGGCAGCAGGGGAATGTCTTTTC TTGCTCTGTCATGCATGAGGCTCTGCATAACCACTACACTCAGAAA TCCCTGTCTCTGTCTCCCGGGAAA human IgG1 constant 125 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGAL domains, L234A- TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNT L235A-P329G mutant KVDKKVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISR (amino acid sequence) TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR VVSVLTVLHQDWLNGKEYKCKVSNKALGAPIEKTISKAKGQPREPQ VYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQK SLSLSPGK human IgG1 constant 126 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGAL domains, N297Q TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNT mutant (amino acid KVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR sequence) TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYQSTYR VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQ VYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQK SLSLSPGK human IgG4 constant 127 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGAL domains, S228P- TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNT N297Q mutant (amino KVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPE acid sequence) VTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFQSTYRVVS VLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYT LPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLS LSLGK 18D5 VH (amino acid 128 QVQLQQPGAELVRPGSSVKLSCKASGYTFTSYWVHWVKQRPIQGLE sequence) WIGNIDPSDSDTHYNQKFKDKASLTVDKSSSTAYMQLSSLTFEDSA VYYCVRGGTGTMAWFAYWGQGTLVTVSA 18D5 VL (amino acid 129 DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSYGNTYLYWYLQKPG sequence) QSPKLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYF CFQGTHVPYTFGSGTKLEIK KWAR23 VH (amino 130 EVQLQQSGAELVKPGASVKLSCTASGFNIKDYYIHWVQQRTEQGLE acid sequence) WIGRIDPEDGETKYAPKFQDKATITADTSSNTAYLHLSSLTSEDTA VYYCARWGAYWGQGTLVTVSS KWAR23 VL (amino 131 QIVLTQSPAIMSASPGEKVTLTCSASSSVSSSYLYWYQQKPGSSPK acid sequence) LWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAASYFCHQW SSYPRTFGAGTKLELK rhSIRPα-HIS (amino 132 MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVA acid sequence) AGETATLRCTATSLIPVGPIQWFRGAGPGRELIYNQKEGHFPRVTT VSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGA GTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKW FKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEV AHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVR KFYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSA HRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSN ERHHHHHH - All references cited herein are incorporated by reference to the same extent as if each individual publication, database entry (e.g. Genbank sequences or GeneID entries), patent application, or patent, was specifically and individually indicated to be incorporated by reference. This statement of incorporation by reference is intended by Applicants, pursuant to 37 C.F.R. § 1.57(b)(1), to relate to each and every individual publication, database entry (e.g. Genbank sequences or GeneID entries), patent application, or patent, each of which is clearly identified in compliance with 37 C.F.R. § 1.57(b)(2), even if such citation is not immediately adjacent to a dedicated statement of incorporation by reference. The inclusion of dedicated statements of incorporation by reference, if any, within the specification does not in any way weaken this general statement of incorporation by reference. Citation of the references herein is not intended as an admission that the reference is pertinent prior art, nor does it constitute any admission as to the contents or date of these publications or documents. To the extent that the references provide a definition for a claimed term that conflicts with the definitions provided in the instant specification, the definitions provided in the instant specification shall be used to interpret the claimed invention.
- The present invention is not to be limited in scope by the specific embodiments described herein. Indeed, various modifications of the invention in addition to those described herein will become apparent to those skilled in the art from the foregoing description and the accompanying figures. Such modifications are intended to fall within the scope of the appended claims.
- The foregoing written specification is considered to be sufficient to enable one skilled in the art to practice the invention. Various modifications of the invention in addition to those shown and described herein will become apparent to those skilled in the art from the foregoing description and fall within the scope of the appended claims.
Claims (22)
1. An isolated therapeutic antibody, comprising:
a variable region that binds to human SIRPαV1 protein having the sequence of SEQ ID NO: 34 with an EC50 of 10 nM or less,
wherein the variable region discriminates between human SIRP isoforms comprising a proline in the SIRP IgV domain at a position corresponding to Pro74 of SEQ ID NO: 34 and human SIRP isoforms in which the proline corresponding to residue 74 of SEQ ID NO: 34 is replaced by alanine.
2. An isolated therapeutic antibody according to claim 1 , wherein the antibody inhibits binding of human SIRPα having the sequence of SEQ ID NO: 34 to human CD47 with an IC50 of of 10 nM or less.
3. An isolated therapeutic antibody according to claim 1 , wherein the antibody binds to a cell expressing human SIRPαV2 protein with an EC50 of 10 nM or less.
4. An isolated therapeutic antibody according to claim 3 , wherein the antibody binds to a cell expressing human SIRPαV1 protein having the sequence of SEQ ID NO: 34 with an EC50 of 1 nM or less, and binds to a cell expressing human SIRPαV2 protein with an EC50 of 1 nM or less.
5. An isolated therapeutic antibody of claim 1 , wherein the antibody is an IgG.
6. An isolated therapeutic antibody of claim 5 , wherein each of the two variable regions of the IgG binds to human SIRPαV1 protein having the sequence of SEQ ID NO: 34 with an EC50 of 10 nM or less and discriminates between human SIRP isoforms comprising a proline in the SIRP IgV domain at a position corresponding to Pro74 of SEQ ID NO: 34 and human SIRP isoforms in which the proline corresponding to residue 74 of SEQ ID NO: 34 is replaced by alanine.
7. An isolated therapeutic antibody of claim 5 , wherein the antibody exhibits a T20 “humanness” score of at least 79.
8. An isolated therapeutic antibody of claim 6 , wherein the antibody exhibits a T20 “humanness” score of at least 79.
9. An isolated therapeutic antibody of claim 4 , wherein the antibody is an IgG.
10. An isolated therapeutic antibody of claim 9 , wherein each of the two variable regions of the IgG binds to human SIRPαV1 protein having the sequence of SEQ ID NO: 34 with an EC50 of 10 nM or less and discriminates between human SIRP isoforms comprising a proline in the SIRP IgV domain at a position corresponding to Pro74 of SEQ ID NO: 34 and human SIRP isoforms in which the proline corresponding to residue 74 of SEQ ID NO: 34 is replaced by alanine.
11. An isolated therapeutic antibody of claim 9 , wherein the antibody exhibits a T20 “humanness” score of at least 79.
12. An isolated therapeutic antibody of claim 10 , wherein the antibody exhibits a T20 “humanness” score of at least 79.
13. A composition comprising:
the therapeutic antibody of claim 1 and a pharmaceutically acceptable carrier or diluent.
14. A composition comprising:
the therapeutic antibody of claim 4 and a pharmaceutically acceptable carrier or diluent.
15. A composition comprising:
the therapeutic antibody of claim 5 and a pharmaceutically acceptable carrier or diluent.
16. A composition comprising:
the therapeutic antibody of claim 6 and a pharmaceutically acceptable carrier or diluent.
17. A composition comprising:
the therapeutic antibody of claim 7 and a pharmaceutically acceptable carrier or diluent.
18. A composition comprising:
the therapeutic antibody of claim 8 and a pharmaceutically acceptable carrier or diluent.
19. A composition comprising:
the therapeutic antibody of claim 9 and a pharmaceutically acceptable carrier or diluent.
20. A composition comprising:
the therapeutic antibody of claim 10 and a pharmaceutically acceptable carrier or diluent.
21. A composition comprising:
the therapeutic antibody of claim 11 and a pharmaceutically acceptable carrier or diluent.
22. A composition comprising:
the therapeutic antibody of claim 12 and a pharmaceutically acceptable carrier or diluent.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US17/576,109 US20220135677A1 (en) | 2017-04-13 | 2022-01-14 | Anti-sirp alpha antibodies |
Applications Claiming Priority (7)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
NL2018708A NL2018708B1 (en) | 2017-04-13 | 2017-04-13 | ANTI-SIRPα ANTIBODIES |
NL2018708 | 2017-04-13 | ||
NL2019166 | 2017-07-03 | ||
NL2019166 | 2017-07-03 | ||
US15/953,201 US10851164B2 (en) | 2017-04-13 | 2018-04-13 | Anti-SIRPα antibodies |
US17/107,334 US20220135671A1 (en) | 2017-04-13 | 2020-11-30 | Anti-sirp alpha antibodies |
US17/576,109 US20220135677A1 (en) | 2017-04-13 | 2022-01-14 | Anti-sirp alpha antibodies |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US17/107,334 Division US20220135671A1 (en) | 2017-04-13 | 2020-11-30 | Anti-sirp alpha antibodies |
Publications (1)
Publication Number | Publication Date |
---|---|
US20220135677A1 true US20220135677A1 (en) | 2022-05-05 |
Family
ID=63793537
Family Applications (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/953,201 Active 2038-05-31 US10851164B2 (en) | 2017-04-13 | 2018-04-13 | Anti-SIRPα antibodies |
US17/107,334 Abandoned US20220135671A1 (en) | 2017-04-13 | 2020-11-30 | Anti-sirp alpha antibodies |
US17/576,109 Pending US20220135677A1 (en) | 2017-04-13 | 2022-01-14 | Anti-sirp alpha antibodies |
Family Applications Before (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/953,201 Active 2038-05-31 US10851164B2 (en) | 2017-04-13 | 2018-04-13 | Anti-SIRPα antibodies |
US17/107,334 Abandoned US20220135671A1 (en) | 2017-04-13 | 2020-11-30 | Anti-sirp alpha antibodies |
Country Status (11)
Country | Link |
---|---|
US (3) | US10851164B2 (en) |
EP (1) | EP3609922A2 (en) |
JP (2) | JP7160833B2 (en) |
KR (1) | KR20190140454A (en) |
AU (1) | AU2018252546A1 (en) |
CA (1) | CA3058134A1 (en) |
IL (1) | IL269405A (en) |
MX (1) | MX2019012233A (en) |
SG (1) | SG11201908813QA (en) |
TW (1) | TW201841943A (en) |
WO (1) | WO2018190719A2 (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20220135671A1 (en) * | 2017-04-13 | 2022-05-05 | Aduro Biotech Holdings, Europe B.V. | Anti-sirp alpha antibodies |
Families Citing this family (57)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JOP20190009A1 (en) | 2016-09-21 | 2019-01-27 | Alx Oncology Inc | Antibodies against signal-regulatory protein alpha and methods of use |
EP3551661A1 (en) | 2016-12-09 | 2019-10-16 | Alector LLC | Anti-sirp-alpha antibodies and methods of use thereof |
CN112040979A (en) | 2018-03-21 | 2020-12-04 | Alx肿瘤生物技术公司 | Antibodies to signal-modulating protein alpha and methods of use |
US11319373B2 (en) | 2018-05-25 | 2022-05-03 | Alector Llc | Anti-SIRPA antibodies and methods of use thereof |
US20210155707A1 (en) | 2018-07-10 | 2021-05-27 | National University Corporation Kobe University | ANTI-SIRPalpha ANTIBODY |
US11591390B2 (en) | 2018-09-27 | 2023-02-28 | Celgene Corporation | SIRP-α binding proteins and methods of use thereof |
BR112021009325A2 (en) | 2018-11-14 | 2021-09-14 | Arch Oncology, Inc. | MONOCLONAL ANTIBODY, OR ANTIGEN-BINDING FRAGMENT THEREOF; B-SPECIFIC ANTIBODY; METHOD TO PREVENT OR TREAT A SUSCEPTIBLE CANCER IN A HUMAN BEING; SIRP¿ EXPRESSION ASSAY METHOD IN TUMOR AND/OR IMMUNE CELLS; AND; PHARMACEUTICAL COMPOSITION |
CN113412279A (en) | 2018-11-15 | 2021-09-17 | 拜奥迪斯私人有限公司 | Humanized anti-SIRP alpha antibodies |
EP3883966B1 (en) | 2018-12-21 | 2023-07-12 | OSE Immunotherapeutics | Humanized anti-human-pd-1 antibody |
WO2020127373A1 (en) | 2018-12-21 | 2020-06-25 | Ose Immunotherapeutics | Bifunctional anti-pd-1/sirpa molecule |
JP2022515223A (en) | 2018-12-21 | 2022-02-17 | オーエスイー・イミュノセラピューティクス | Bifunctional molecule for human PD-1 |
US20230071889A1 (en) | 2018-12-21 | 2023-03-09 | Ose Immunotherapeutics | Bifunctional anti-pd-1/il-7 molecule |
WO2020165374A1 (en) | 2019-02-14 | 2020-08-20 | Ose Immunotherapeutics | Bifunctional molecule comprising il-15ra |
EP3980747A1 (en) | 2019-06-07 | 2022-04-13 | ALX Oncology Inc. | Methods and reagents for reducing the interference of drugs that bind cd47 in serological assays |
PE20220231A1 (en) | 2019-06-25 | 2022-02-07 | Gilead Sciences Inc | FLT3L-FC FUSION PROTEINS AND METHODS OF USE |
WO2021011912A1 (en) * | 2019-07-17 | 2021-01-21 | The Board Of Trustees Of The Leland Stanford Junior University | Combination of integrin-targeting knottin-fc fusion and anti-cd47 antibody for the treatment of cancer |
WO2021020845A1 (en) * | 2019-07-26 | 2021-02-04 | Abl Bio Inc. | Anti-egfr/anti-4-1bb bispecific antibody and use thereof |
KR20220085796A (en) | 2019-10-18 | 2022-06-22 | 포티 세븐, 인코포레이티드 | Combination Therapy to Treat Myelodysplastic Syndrome and Acute Myelogenous Leukemia |
CA3153636A1 (en) | 2019-10-31 | 2021-05-06 | Forty Seven, Inc. | Anti-cd47 and anti-cd20 based treatment of blood cancer |
CN114845710A (en) | 2019-11-27 | 2022-08-02 | Alx肿瘤生物技术公司 | Combination therapy for the treatment of cancer |
PE20230376A1 (en) | 2019-12-24 | 2023-03-06 | Carna Biosciences Inc | DIACYL GLYCEROL KINASE MODULATING COMPOUNDS |
CN116621981A (en) * | 2019-12-24 | 2023-08-22 | 礼新医药科技(上海)有限公司 | anti-SIRP alpha monoclonal antibody and application thereof |
IL295023A (en) | 2020-02-14 | 2022-09-01 | Jounce Therapeutics Inc | Antibodies and fusion proteins that bind to ccr8 and uses thereof |
US20230340112A1 (en) * | 2020-02-28 | 2023-10-26 | Apexigen, Inc. | Anti-sirpa antibodies and methods of use |
TW202208431A (en) * | 2020-05-08 | 2022-03-01 | 美商電子療法股份有限公司 | Sirp alpha and sirp beta 1 antibodies and uses thereof |
EP4157315A1 (en) | 2020-06-01 | 2023-04-05 | ALX Oncology Inc. | Combination therapies comprising a hypomethylation agent for treating cancer |
US20240016787A1 (en) | 2020-11-03 | 2024-01-18 | Rdiscovery, LLC | Methods for treatment of cancer and phagocytosis-deficiency related diseases |
EP4245321A1 (en) | 2020-11-11 | 2023-09-20 | Daiichi Sankyo Company, Limited | Combination of antibody-drug conjugate with anti-sirpalpha antibody |
CN115368455A (en) * | 2020-11-30 | 2022-11-22 | 启愈生物技术(上海)有限公司 | Specific antibody of targeted human SIRP alpha protein and application thereof |
JP2023552375A (en) | 2020-12-06 | 2023-12-15 | エーエルエックス オンコロジー インコーポレイテッド | Multimers for reducing interference of drugs that bind to CD47 in serological assays |
TW202302145A (en) | 2021-04-14 | 2023-01-16 | 美商基利科學股份有限公司 | Co-inhibition of cd47/sirpα binding and nedd8-activating enzyme e1 regulatory subunit for the treatment of cancer |
KR20240007913A (en) | 2021-05-13 | 2024-01-17 | 알렉소 온콜로지 인크. | Combination therapy for cancer treatment |
WO2022245671A1 (en) | 2021-05-18 | 2022-11-24 | Gilead Sciences, Inc. | Methods of using flt3l-fc fusion proteins |
CN117355539A (en) * | 2021-05-28 | 2024-01-05 | 百奥泰生物制药股份有限公司 | anti-SIRP alpha antibody and application thereof |
US11572412B2 (en) | 2021-06-04 | 2023-02-07 | Boehringer Ingelheim International Gmbh | Anti-SIRP-alpha antibodies |
CA3222595A1 (en) | 2021-06-23 | 2022-12-29 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
US11932634B2 (en) | 2021-06-23 | 2024-03-19 | Gilead Sciences, Inc. | Diacylglycerol kinase modulating compounds |
US20230046340A1 (en) | 2021-06-23 | 2023-02-16 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
AU2022299051A1 (en) | 2021-06-23 | 2023-12-07 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
CA3221281A1 (en) | 2021-06-29 | 2023-01-05 | Seagen Inc. | Methods of treating cancer with a combination of a nonfucosylated anti-cd70 antibody and a cd47 antagonist |
CA3227617A1 (en) | 2021-08-05 | 2023-02-09 | Osiris MARROQUIN BELAUNZARAN | Combination medicaments comprising hla fusion proteins |
WO2023020459A1 (en) * | 2021-08-17 | 2023-02-23 | 杭州九源基因工程有限公司 | MONOCLONAL ANTIBODY TARGETING SIRPα AND USE THEREOF |
CN113956363B (en) * | 2021-10-13 | 2023-03-31 | 宜明昂科生物医药技术(上海)股份有限公司 | Recombinant fusion protein targeting CD47 and CD24 and preparation and application thereof |
US20230183216A1 (en) | 2021-10-28 | 2023-06-15 | Gilead Sciences, Inc. | Pyridizin-3(2h)-one derivatives |
WO2023077030A1 (en) | 2021-10-29 | 2023-05-04 | Gilead Sciences, Inc. | Cd73 compounds |
US20230242508A1 (en) | 2021-12-22 | 2023-08-03 | Gilead Sciences, Inc. | Ikaros zinc finger family degraders and uses thereof |
WO2023122581A2 (en) | 2021-12-22 | 2023-06-29 | Gilead Sciences, Inc. | Ikaros zinc finger family degraders and uses thereof |
TW202340168A (en) | 2022-01-28 | 2023-10-16 | 美商基利科學股份有限公司 | Parp7 inhibitors |
WO2023154578A1 (en) | 2022-02-14 | 2023-08-17 | Sana Biotechnology, Inc. | Methods of treating patients exhibiting a prior failed therapy with hypoimmunogenic cells |
US20230373950A1 (en) | 2022-03-17 | 2023-11-23 | Gilead Sciences, Inc. | Ikaros zinc finger family degraders and uses thereof |
WO2023183313A1 (en) | 2022-03-22 | 2023-09-28 | Sana Biotechnology, Inc. | Engineering cells with a transgene in b2m or ciita locus and associated compositions and methods |
US20230355796A1 (en) | 2022-03-24 | 2023-11-09 | Gilead Sciences, Inc. | Combination therapy for treating trop-2 expressing cancers |
TW202345901A (en) | 2022-04-05 | 2023-12-01 | 美商基利科學股份有限公司 | Combination therapy for treating colorectal cancer |
WO2023205719A1 (en) | 2022-04-21 | 2023-10-26 | Gilead Sciences, Inc. | Kras g12d modulating compounds |
US20240010701A1 (en) | 2022-06-01 | 2024-01-11 | ALX Oncology Inc. | Combination therapies for treating urothelial carcinoma |
WO2024006929A1 (en) | 2022-07-01 | 2024-01-04 | Gilead Sciences, Inc. | Cd73 compounds |
WO2024064668A1 (en) | 2022-09-21 | 2024-03-28 | Gilead Sciences, Inc. | FOCAL IONIZING RADIATION AND CD47/SIRPα DISRUPTION ANTICANCER COMBINATION THERAPY |
Family Cites Families (209)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4399216A (en) | 1980-02-25 | 1983-08-16 | The Trustees Of Columbia University | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
US4447233A (en) | 1981-04-10 | 1984-05-08 | Parker-Hannifin Corporation | Medication infusion pump |
US4439196A (en) | 1982-03-18 | 1984-03-27 | Merck & Co., Inc. | Osmotic drug delivery system |
US4447224A (en) | 1982-09-20 | 1984-05-08 | Infusaid Corporation | Variable flow implantable infusion apparatus |
US4487603A (en) | 1982-11-26 | 1984-12-11 | Cordis Corporation | Implantable microinfusion pump system |
US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
US4740461A (en) | 1983-12-27 | 1988-04-26 | Genetics Institute, Inc. | Vectors and methods for transformation of eucaryotic cells |
DE3572982D1 (en) | 1984-03-06 | 1989-10-19 | Takeda Chemical Industries Ltd | Chemically modified lymphokine and production thereof |
US4596556A (en) | 1985-03-25 | 1986-06-24 | Bioject, Inc. | Hypodermic injection apparatus |
JP2532858B2 (en) | 1985-04-01 | 1996-09-11 | セルテツク リミテツド | Transformed myeloma cell line |
GB8601597D0 (en) | 1986-01-23 | 1986-02-26 | Wilson R H | Nucleotide sequences |
US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
US4959455A (en) | 1986-07-14 | 1990-09-25 | Genetics Institute, Inc. | Primate hematopoietic growth factors IL-3 and pharmaceutical compositions |
US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
US5260203A (en) | 1986-09-02 | 1993-11-09 | Enzon, Inc. | Single polypeptide chain binding molecules |
ATE87659T1 (en) | 1986-09-02 | 1993-04-15 | Enzon Lab Inc | BINDING MOLECULES WITH SINGLE POLYPEPTIDE CHAIN. |
US4912040A (en) | 1986-11-14 | 1990-03-27 | Genetics Institute, Inc. | Eucaryotic expression system |
EP0307434B2 (en) | 1987-03-18 | 1998-07-29 | Scotgen Biopharmaceuticals, Inc. | Altered antibodies |
US4941880A (en) | 1987-06-19 | 1990-07-17 | Bioject, Inc. | Pre-filled ampule and non-invasive hypodermic injection device assembly |
US4790824A (en) | 1987-06-19 | 1988-12-13 | Bioject, Inc. | Non-invasive hypodermic injection device |
GB8717430D0 (en) | 1987-07-23 | 1987-08-26 | Celltech Ltd | Recombinant dna product |
US5677425A (en) | 1987-09-04 | 1997-10-14 | Celltech Therapeutics Limited | Recombinant antibody |
GB8809129D0 (en) | 1988-04-18 | 1988-05-18 | Celltech Ltd | Recombinant dna methods vectors and host cells |
CA2006596C (en) | 1988-12-22 | 2000-09-05 | Rika Ishikawa | Chemically-modified g-csf |
US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
DE3920358A1 (en) | 1989-06-22 | 1991-01-17 | Behringwerke Ag | BISPECIFIC AND OLIGO-SPECIFIC, MONO- AND OLIGOVALENT ANTI-BODY CONSTRUCTS, THEIR PRODUCTION AND USE |
US5064413A (en) | 1989-11-09 | 1991-11-12 | Bioject, Inc. | Needleless hypodermic injection device |
US5312335A (en) | 1989-11-09 | 1994-05-17 | Bioject Inc. | Needleless hypodermic injection device |
US5420245A (en) | 1990-04-18 | 1995-05-30 | Board Of Regents, The University Of Texas | Tetrapeptide-based inhibitors of farnesyl transferase |
DE69233528T2 (en) | 1991-11-25 | 2006-03-16 | Enzon, Inc. | Process for the preparation of multivalent antigen-binding proteins |
US5932448A (en) | 1991-11-29 | 1999-08-03 | Protein Design Labs., Inc. | Bispecific antibody heterodimers |
US5714350A (en) | 1992-03-09 | 1998-02-03 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region |
US6129914A (en) | 1992-03-27 | 2000-10-10 | Protein Design Labs, Inc. | Bispecific antibody effective to treat B-cell lymphoma and cell line |
EP0640094A1 (en) | 1992-04-24 | 1995-03-01 | The Board Of Regents, The University Of Texas System | Recombinant production of immunoglobulin-like domains in prokaryotic cells |
US5383851A (en) | 1992-07-24 | 1995-01-24 | Bioject Inc. | Needleless hypodermic injection device |
CA2111902A1 (en) | 1992-12-21 | 1994-06-22 | Jack Beuford Campbell | Antitumor compositions and methods of treatment |
WO1994019357A1 (en) | 1993-02-23 | 1994-09-01 | Merrell Dow Pharmaceuticals Inc. | Farnesyl:protein transferase inhibitors as anticancer agents |
CA2118985A1 (en) | 1993-04-02 | 1994-10-03 | Dinesh V. Patel | Heterocyclic inhibitors of farnesyl protein transferase |
JPH09500615A (en) | 1993-05-14 | 1997-01-21 | ジェネンテク,インコーポレイテッド | Ras-farnesyl transferase inhibitor |
US5602098A (en) | 1993-05-18 | 1997-02-11 | University Of Pittsburgh | Inhibition of farnesyltransferase |
EP0714409A1 (en) | 1993-06-16 | 1996-06-05 | Celltech Therapeutics Limited | Antibodies |
EP0670314A4 (en) | 1993-09-22 | 1996-04-10 | Kyowa Hakko Kogyo Kk | Farnesyltransferase inhibitor. |
US5719148A (en) | 1993-10-15 | 1998-02-17 | Schering Corporation | Tricyclic amide and urea compounds useful for inhibition of g-protein function and for treatment of proliferative diseases |
AU698960B2 (en) | 1993-10-15 | 1998-11-12 | Schering Corporation | Tricyclic sulfonamide compounds useful for inhibition of g-protein function and for treatment of proliferative diseases |
US5661152A (en) | 1993-10-15 | 1997-08-26 | Schering Corporation | Tricyclic sulfonamide compounds useful for inhibition of G-protein function and for treatment of proliferative diseases |
US5721236A (en) | 1993-10-15 | 1998-02-24 | Schering Corporation | Tricyclic carbamate compounds useful for inhibition of G-protein function and for treatment of proliferative diseases |
NZ274749A (en) | 1993-10-15 | 1998-05-27 | Schering Corp | Tricyclic carbamate derivatives useful for inhibition of g-protein function and for treating proliferative diseases, medicaments |
IL111235A (en) | 1993-10-15 | 2001-03-19 | Schering Plough Corp | Pharmaceutical compositions for inhibition of g-protein function and for treatment of proliferative diseases containing tricyclic compounds some such compounds and process for preparing part of them |
WO1995011917A1 (en) | 1993-10-25 | 1995-05-04 | Parke, Davis & Company | Substituted tetra- and pentapeptide inhibitors of protein:farnesyl transferase |
ATE177420T1 (en) | 1993-11-04 | 1999-03-15 | Abbott Lab | CYCLOBUTANE DERIVATIVES AS INHIBITORS OF SQUALENE SYNTHETASE AND PROTEIN FARNESYL TRANSFERASE |
US5783593A (en) | 1993-11-04 | 1998-07-21 | Abbott Laboratories | Inhibitors of squalene synthetase and protein farnesyltransferase |
WO1995012612A1 (en) | 1993-11-05 | 1995-05-11 | Warner-Lambert Company | Substituted di- and tripeptide inhibitors of protein:farnesyl transferase |
US5484799A (en) | 1993-12-09 | 1996-01-16 | Abbott Laboratories | Antifungal dorrigocin derivatives |
WO1995024612A1 (en) | 1994-03-07 | 1995-09-14 | International Business Machines Corporation | Fast process and device for interpolating intermediate values from periodic phase-shifted signals and for detecting rotary body defects |
EP0750609A4 (en) | 1994-03-15 | 1997-09-24 | Eisai Co Ltd | Isoprenyl transferase inhibitors |
IL113196A0 (en) | 1994-03-31 | 1995-06-29 | Bristol Myers Squibb Co | Imidazole derivatives and pharmaceutical compositions containing the same |
US5523430A (en) | 1994-04-14 | 1996-06-04 | Bristol-Myers Squibb Company | Protein farnesyl transferase inhibitors |
US5510510A (en) | 1994-05-10 | 1996-04-23 | Bristol-Meyers Squibb Company | Inhibitors of farnesyl protein transferase |
US5563255A (en) | 1994-05-31 | 1996-10-08 | Isis Pharmaceuticals, Inc. | Antisense oligonucleotide modulation of raf gene expression |
US5532210A (en) | 1994-06-08 | 1996-07-02 | E. I. Du Pont De Nemours And Company | High temperature superconductor dielectric slow wave structures for accelerators and traveling wave tubes |
CA2192389A1 (en) | 1994-06-10 | 1995-12-21 | Bernard Baudoin | Novel farnesyl transferase inhibitors, their preparation and pharmaceutical compositions containing same |
US5571792A (en) | 1994-06-30 | 1996-11-05 | Warner-Lambert Company | Histidine and homohistidine derivatives as inhibitors of protein farnesyltransferase |
WO1996005529A1 (en) | 1994-08-09 | 1996-02-22 | Micron Optics, Inc. | Temperature compensated fiber fabry-perot filters |
CA2155448A1 (en) | 1994-08-11 | 1996-02-12 | Katerina Leftheris | Inhibitors of farnesyl protein transferase |
EP0776884B1 (en) | 1994-08-11 | 2000-01-05 | Banyu Pharmaceutical Co., Ltd. | Substituted amide derivative |
EP0805154A1 (en) | 1994-08-12 | 1997-11-05 | Banyu Pharmaceutical Co., Ltd. | N,n-disubstituted amic acid derivative |
DE4429506B4 (en) | 1994-08-19 | 2007-09-13 | Degussa Gmbh | Process for the extraction of natural carotenoid dyes |
DE4429653C2 (en) | 1994-08-20 | 1997-04-03 | Anton Dr More | Converter and method for refining molten metals, in particular from pig iron to steel |
DE69507284T2 (en) | 1994-11-22 | 1999-07-01 | Philips Electronics Nv | SEMICONDUCTORS WITH A CARRIER ON WHICH A SUBSTRATE WITH A SEMICONDUCTOR ELEMENT IS FASTENED BY MEANS OF AN ADHESIVE LAYER AND A PATTERN PATTERN |
JPH10510261A (en) | 1994-12-09 | 1998-10-06 | ワーナー−ランバート・カンパニー | Protein: substituted tetra- and pentapeptide inhibitors of farnesyltransferase |
BR9606896A (en) | 1995-01-09 | 1997-10-21 | Magla Int Ltd | Water resistant image printing on latex surfaces |
JP3929069B2 (en) | 1995-01-12 | 2007-06-13 | ユニバーシティ オブ ピッツバーグ | Inhibitors of prenyltransferase |
FR2729390A1 (en) | 1995-01-18 | 1996-07-19 | Rhone Poulenc Rorer Sa | NOVEL FARNESYL TRANSFERASE INHIBITORS, THEIR PREPARATION AND THE PHARMACEUTICAL COMPOSITIONS CONTAINING THEM |
FR2730491B1 (en) | 1995-02-09 | 1997-03-14 | Rhone Poulenc Rorer Sa | NOVEL FARNESYL TRANSFERASE INHIBITORS, THEIR PREPARATION AND THE PHARMACEUTICAL COMPOSITIONS CONTAINING THEM |
FR2730492B1 (en) | 1995-02-09 | 1997-03-14 | Rhone Poulenc Rorer Sa | NOVEL FARNESYL TRANSFERASE INHIBITORS, THEIR PREPARATION AND THE PHARMACEUTICAL COMPOSITIONS CONTAINING THEM |
US5684013A (en) | 1995-03-24 | 1997-11-04 | Schering Corporation | Tricyclic compounds useful for inhibition of g-protein function and for treatment of proliferative diseases |
US5700806A (en) | 1995-03-24 | 1997-12-23 | Schering Corporation | Tricyclic amide and urea compounds useful for inhibition of G-protein function and for treatment of proliferative diseases |
IL117580A0 (en) | 1995-03-29 | 1996-07-23 | Merck & Co Inc | Inhibitors of farnesyl-protein transferase and pharmaceutical compositions containing them |
IL117798A (en) | 1995-04-07 | 2001-11-25 | Schering Plough Corp | Tricyclic compounds useful for inhibition of g-protein function and for treatment of proliferative diseases and pharmaceutical compositions comprising them |
US5712280A (en) | 1995-04-07 | 1998-01-27 | Schering Corporation | Tricyclic compounds useful for inhibition of G-protein function and for treatment of proliferative diseases |
US5891872A (en) | 1995-04-07 | 1999-04-06 | Schering Corporation | Tricyclic compounds |
EP0820452B1 (en) | 1995-04-07 | 2003-06-04 | Schering Corporation | Carbonyl-piperazinyl and piperidinil compounds which inhibit farnesyl protein transferase |
US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
US6121022A (en) | 1995-04-14 | 2000-09-19 | Genentech, Inc. | Altered polypeptides with increased half-life |
US5831115A (en) | 1995-04-21 | 1998-11-03 | Abbott Laboratories | Inhibitors of squalene synthase and protein farnesyltransferase |
IL118101A0 (en) | 1995-05-03 | 1996-09-12 | Abbott Lab | Inhibitors of farnesyltransferase |
WO1997000252A1 (en) | 1995-06-16 | 1997-01-03 | Warner-Lambert Company | Tricyclic inhibitors of protein farnesyltransferase |
FR2736641B1 (en) | 1995-07-10 | 1997-08-22 | Rhone Poulenc Rorer Sa | NOVEL FARNESYL TRANSFERASE INHIBITORS, THEIR PREPARATION AND THE PHARMACEUTICAL COMPOSITIONS CONTAINING THEM |
AT402617B (en) | 1995-07-11 | 1997-07-25 | Datacon Schweitzer & Zeindl Gm | SYSTEM FOR AUTOMATED, HERMETIC SYSTEM FOR AUTOMATED, HERMETIC LOCKING OF HOUSINGS LOCKING OF HOUSINGS |
FR2736638B1 (en) | 1995-07-12 | 1997-08-22 | Rhone Poulenc Rorer Sa | NOVEL FARNESYL TRANSFERASE INHIBITORS, THEIR PREPARATION AND THE PHARMACEUTICAL COMPOSITIONS CONTAINING THEM |
CH690163A5 (en) | 1995-07-28 | 2000-05-31 | Symphar Sa | Derivatives substituted gem-diphosphonates useful as anti-cancer. |
EP0873123B1 (en) | 1995-11-06 | 2003-04-09 | University Of Pittsburgh | Inhibitors of protein isoprenyl transferases |
JP4183099B2 (en) | 1995-11-17 | 2008-11-19 | ゲゼルシャフト・フュア・ビオテヒノロジッシェ・フォルシュング・ミット・ベシュレンクテル・ハフツング(ゲー・ベー・エフ) | Epothilones C and D, production methods and compositions |
EP0862435A4 (en) | 1995-11-22 | 1999-02-03 | Merck & Co Inc | Inhibitors of farnesyl-protein transferase |
PT1162201E (en) | 1995-12-08 | 2006-08-31 | Janssen Pharmaceutica Nv | (IMIDAZOL-5-IL) METHYL-2-KINOLINONE DERIVATIVES AS FARNESIL PROTEIN INHIBITORS TRANSFERASE |
SK86198A3 (en) | 1995-12-22 | 1999-02-11 | Schering Corp | Tricyclic amides useful for inhibition of g-protein function and for treatment of proliferative diseases |
WO1997026246A1 (en) | 1996-01-16 | 1997-07-24 | Warner-Lambert Company | Substituted histidine inhibitors of protein farnesyltransferase |
US6673927B2 (en) | 1996-02-16 | 2004-01-06 | Societe De Conseils De Recherches Et D'applications Scientifiques, S.A.S. | Farnesyl transferase inhibitors |
JP2001519766A (en) | 1996-04-03 | 2001-10-23 | メルク エンド カンパニー インコーポレーテッド | Inhibitors of farnesyl protein transferase |
JP2000511527A (en) | 1996-05-22 | 2000-09-05 | ワーナー―ランバート・コンパニー | Inhibition of protein farnesyltransferase |
CA2260216A1 (en) | 1996-07-15 | 1998-01-22 | Bristol-Myers Squibb Company | Thiadioxobenzodiazepine inhibitors of farnesyl protein transferase |
AU756699B2 (en) | 1996-12-03 | 2003-01-23 | Sloan-Kettering Institute For Cancer Research | Synthesis of epothilones, intermediates thereto, analogues and uses thereof |
AU6013998A (en) | 1996-12-30 | 1998-07-31 | Merck & Co., Inc. | Inhibitors of farnesyl-protein transferase |
AU5719598A (en) | 1996-12-30 | 1998-07-31 | Merck & Co., Inc. | Inhibitors of farnesyl-protein transferase |
US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
EP1724282B1 (en) | 1997-05-21 | 2013-05-15 | Merck Patent GmbH | Method for the production of non-immunogenic proteins |
US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
GB9818110D0 (en) | 1998-08-19 | 1998-10-14 | Weston Medical Ltd | Needleless injectors and other devices |
US6096002A (en) | 1998-11-18 | 2000-08-01 | Bioject, Inc. | NGAS powered self-resetting needle-less hypodermic jet injection apparatus and method |
CA2352572C (en) | 1998-12-01 | 2010-04-20 | Protein Design Labs, Inc. | Humanized antibodies to gamma-interferon |
JP2002536968A (en) | 1999-01-29 | 2002-11-05 | イムクローン システムズ インコーポレイティド | Antibodies specific for KDR and uses thereof |
GB9904387D0 (en) | 1999-02-25 | 1999-04-21 | Pharmacia & Upjohn Spa | Antitumour synergistic composition |
AU4972900A (en) | 1999-04-08 | 2000-11-14 | Arch Development Corporation | Use of anti-vegf antibody to enhance radiation in cancer therapy |
EP2264166B1 (en) | 1999-04-09 | 2016-03-23 | Kyowa Hakko Kirin Co., Ltd. | Method for controlling the activity of immunologically functional molecule |
EP1048299A1 (en) * | 1999-04-28 | 2000-11-02 | Faculteit der Geneeskunde van de Vrije Universiteit | Method for inhibiting cell functioning for use in anti-inflammatory and anti-tumour therapies |
WO2001040307A1 (en) | 1999-11-30 | 2001-06-07 | Eberhard-Karls-Universität Tübingen Universitätsklinikum | Antibodies against signal regulator proteins |
EP2339013B1 (en) | 2000-06-28 | 2014-07-02 | GlycoFi, Inc. | Methods for producing modified glycoproteins |
US7449308B2 (en) | 2000-06-28 | 2008-11-11 | Glycofi, Inc. | Combinatorial DNA library for producing modified N-glycans in lower eukaryotes |
US6946292B2 (en) | 2000-10-06 | 2005-09-20 | Kyowa Hakko Kogyo Co., Ltd. | Cells producing antibody compositions with increased antibody dependent cytotoxic activity |
WO2002083138A1 (en) | 2001-04-10 | 2002-10-24 | Merck & Co., Inc. | Inhibitors of akt activity |
WO2002083675A2 (en) | 2001-04-10 | 2002-10-24 | Merck Sharp & Dohme Limited | Inhibitors of akt activity |
WO2002083140A1 (en) | 2001-04-10 | 2002-10-24 | Merck & Co., Inc. | Inhibitors of akt activity |
JP2004527531A (en) | 2001-04-10 | 2004-09-09 | メルク エンド カムパニー インコーポレーテッド | How to treat cancer |
WO2002083139A1 (en) | 2001-04-10 | 2002-10-24 | Merck & Co., Inc. | Inhibitors of akt activity |
AU2002363429B2 (en) | 2001-11-07 | 2008-05-08 | Merck & Co., Inc. | Mitotic kinesin inhibitors |
AU2002357043B2 (en) | 2001-12-06 | 2008-04-24 | Merck Sharp & Dohme Corp. | Mitotic kinesin inhibitors |
ES2291543T3 (en) | 2001-12-06 | 2008-03-01 | MERCK & CO., INC. | INHIBITION OF MYTHICAL KINESINA. |
EP1465896A4 (en) | 2001-12-06 | 2006-01-11 | Merck & Co Inc | Mitotic kinesin inhibitors |
EP1458726B1 (en) | 2001-12-06 | 2009-07-15 | Merck & Co., Inc. | Mitotic kinesin inhibitors |
JP4467979B2 (en) | 2001-12-06 | 2010-05-26 | メルク・シャープ・エンド・ドーム・コーポレイション | Mitotic kinesin inhibitor |
AU2003249597B2 (en) | 2002-03-08 | 2007-06-28 | Merck Sharp & Dohme Corp. | Mitotic kinesin inhibitors |
US20060142178A1 (en) | 2002-04-08 | 2006-06-29 | Barnett Stanley F | Method of treating cancer |
JP4451136B2 (en) | 2002-04-08 | 2010-04-14 | メルク エンド カムパニー インコーポレーテッド | Akt activity inhibitor |
WO2003086279A2 (en) | 2002-04-08 | 2003-10-23 | Merck & Co., Inc. | Inhibitors of akt activity |
US7223738B2 (en) | 2002-04-08 | 2007-05-29 | Merck & Co., Inc. | Inhibitors of Akt activity |
EP1494676B1 (en) | 2002-04-08 | 2013-05-08 | Merck Sharp & Dohme Corp. | Fused quinoxaline derivatives as inhibitors of akt activity |
WO2003086310A2 (en) | 2002-04-12 | 2003-10-23 | Ramot At Tel Aviv University Ltd. | Prevention of brain inflammation as a result of induced autoimmune response |
AU2003299517A1 (en) | 2002-05-23 | 2004-05-25 | Merck & Co., Inc. | Mitotic kinesin inhibitors |
WO2003099211A2 (en) | 2002-05-23 | 2003-12-04 | Merck & Co., Inc. | Mitotic kinesin inhibitors |
CA2486215A1 (en) | 2002-06-14 | 2003-12-24 | Merck & Co., Inc. | Mitotic kinesin inhibitors |
US7348440B2 (en) | 2002-06-14 | 2008-03-25 | Merck & Co., Inc. | Mitotic kinesin inhibitors |
AU2003287057B2 (en) | 2002-10-18 | 2008-08-21 | Merck Sharp & Dohme Corp. | Mitotic kinesin inhibitors |
DE60336576D1 (en) | 2002-10-30 | 2011-05-12 | Merck Sharp & Dohme | HEMMER OF ACT ACTIVITY |
US20040102360A1 (en) | 2002-10-30 | 2004-05-27 | Barnett Stanley F. | Combination therapy |
EP1585391A4 (en) | 2002-12-06 | 2006-03-15 | Pharmacia Corp | Mitoneet polypeptide from mitochondrial membranes, modulators thereof, and methods of using the same |
CA2508956A1 (en) | 2002-12-20 | 2004-07-15 | Merck & Co., Inc. | Mitotic kinesin inhibitors |
US7622468B2 (en) | 2002-12-20 | 2009-11-24 | Merck & Co. Inc. | Mitotic kinesin inhibitors |
EP1622616B1 (en) | 2003-04-24 | 2011-06-15 | Merck Sharp & Dohme Corp. | Inhibitors of akt activity |
CA2522430A1 (en) | 2003-04-24 | 2004-11-11 | Merck & Co., Inc. | Inhibitors of akt activity |
EP1631548B1 (en) | 2003-04-24 | 2009-10-28 | Merck & Co., Inc. | Inhibitors of akt activity |
DE602004026047D1 (en) | 2003-04-24 | 2010-04-29 | Merck Sharp & Dohme | HEMMER OF ACT ACTIVITY |
US7410483B2 (en) | 2003-05-23 | 2008-08-12 | Novare Surgical Systems, Inc. | Hand-actuated device for remote manipulation of a grasping tool |
ATE426605T1 (en) | 2003-06-12 | 2009-04-15 | Merck & Co Inc | INHIBITORS OF MITOTIC KINESIN |
CA2475189C (en) | 2003-07-17 | 2009-10-06 | At&T Corp. | Method and apparatus for window matching in delta compressors |
US20050054048A1 (en) | 2003-07-29 | 2005-03-10 | Luigi Grasso | Antibodies and methods for generating genetically altered antibodies with enhanced effector function |
KR100536215B1 (en) | 2003-08-05 | 2005-12-12 | 삼성에스디아이 주식회사 | Plasma display panel |
US7307085B2 (en) | 2003-08-13 | 2007-12-11 | Merck & Co., Inc. | Mitotic kinesin inhibitors |
PE20050730A1 (en) | 2003-08-15 | 2005-09-20 | Merck & Co Inc | DERIVATIVES OF 2,5-DIHYDROPYRROL 2,2-DISUSTITUTED AS INHIBITORS OF MYTHOTIC KINESINS |
CA2533889A1 (en) | 2003-08-15 | 2005-03-03 | Merck & Co., Inc. | Mitotic kinesin inhibitors |
ES2319429T3 (en) | 2003-08-15 | 2009-05-07 | MERCK & CO., INC. | INHIBITORS OF MITOTIC CINESINE. |
AU2004264533B2 (en) | 2003-08-15 | 2009-01-22 | Merck Sharp & Dohme Corp. | Mitotic kinesin inhibitors |
US7294640B2 (en) | 2004-02-06 | 2007-11-13 | Merck & Co., Inc. | Mitotic kinesin inhibitors |
EP1729781B1 (en) | 2004-03-15 | 2012-10-24 | Karaolis, David K. R. | A method for inhibiting cancer cell proliferation or increasing cancer cell apoptosis |
EP1737843B1 (en) | 2004-04-09 | 2011-02-23 | Merck Sharp & Dohme Corp. | Inhibitors of akt activity |
AU2005233569B2 (en) | 2004-04-09 | 2010-08-19 | Merck Sharp & Dohme Corp. | Inhibitors of Akt activity |
ATE476993T1 (en) | 2004-06-07 | 2010-08-15 | Univ Ramot | METHOD FOR PASSIVE IMMUNIZATION AGAINST A DISEASE CHARACTERIZED BY AMYLOID AGGREGATION OR DISEASE WITH A REDUCED RISK OF NEUR INFLAMMATION |
CA2575663C (en) | 2004-07-30 | 2013-04-23 | Rinat Neuroscience Corp. | Antibodies directed against amyloid-beta peptide and methods using same |
EP1782826A1 (en) | 2005-11-08 | 2007-05-09 | GBF Gesellschaft für Biotechnologische Forschung mbH | PQS and c-diGMP and its conjugates as adjuvants and their uses in pharmaceutical compositions |
ES2582340T3 (en) | 2008-01-15 | 2016-09-12 | The Board Of Trustees Of The Leland Stanford Junior University | Methods for manipulating phagocytosis mediated by CD47 |
EP2111869A1 (en) | 2008-04-23 | 2009-10-28 | Stichting Sanquin Bloedvoorziening | Compositions and methods to enhance the immune system |
US8450293B2 (en) | 2010-08-10 | 2013-05-28 | Rutgers, The State University Of New Jersey | Synthesis and characterization of C8 analogs of c-di-GMP |
WO2012067176A1 (en) * | 2010-11-17 | 2012-05-24 | 中外製薬株式会社 | Multi-specific antigen-binding molecule having alternative function to function of blood coagulation factor viii |
US8790651B2 (en) * | 2011-07-21 | 2014-07-29 | Zoetis Llc | Interleukin-31 monoclonal antibody |
WO2013056352A1 (en) | 2011-10-19 | 2013-04-25 | University Health Network | Antibodies and antibody fragments targeting sirp-alpha and their use in treating hematologic cancers |
EP2931738B1 (en) | 2012-12-13 | 2019-02-06 | Aduro Biotech, Inc. | Compositions comprising cyclic purine dinucleotides having defined stereochemistries and methods for their preparation and use |
WO2014173886A1 (en) | 2013-04-22 | 2014-10-30 | Glycotope Gmbh | Anti-cancer treatments with anti-egfr antibodies having a low fucosylation |
SG11201508165VA (en) | 2013-04-29 | 2015-11-27 | Sloan Kettering Inst Cancer | Compositions and methods for altering second messenger signaling |
EP2992000B1 (en) | 2013-05-03 | 2020-07-08 | The Regents of The University of California | Cyclic di-nucleotide induction of type i interferon |
MY175308A (en) | 2013-05-18 | 2020-06-18 | Aduro Biotech Inc | Compositions and methods for activating "stimulator of interferon gene"-dependent signalling |
EP3116544A4 (en) | 2014-03-11 | 2017-08-23 | The Board of Trustees of the Leland Stanford Junior University | Anti sirp-alpha antibodies and bi-specific macrophage enhancing antibodies |
ES2843546T3 (en) | 2014-04-18 | 2021-07-19 | The Research Foundation Of The State Univ Of New York | Humanized anti-TF-antigen antibodies |
ES2692226T3 (en) | 2014-06-04 | 2018-11-30 | Glaxosmithkline Intellectual Property Development Limited | Cyclic dinucleotides as STING modulators |
US10011630B2 (en) | 2014-12-16 | 2018-07-03 | Invivogen | Cyclic dinucleotides for cytokine induction |
GB201501462D0 (en) | 2015-01-29 | 2015-03-18 | Glaxosmithkline Ip Dev Ltd | Novel compounds |
TN2017000375A1 (en) | 2015-03-10 | 2019-01-16 | Aduro Biotech Inc | Compositions and methods for activating "stimulator of interferon gene" -dependent signalling |
WO2017011444A1 (en) | 2015-07-13 | 2017-01-19 | The Wistar Institute Of Anatomy And Biology | Methods and compositions for treating b cell cancers |
WO2017027646A1 (en) | 2015-08-13 | 2017-02-16 | Merck Sharp & Dohme Corp. | Cyclic di-nucleotide compounds as sting agonists |
MY194058A (en) | 2016-01-11 | 2022-11-10 | Innate Tumor Immunity Inc | Cyclic dinucleotides for treating conditions associated with sting activity such as cancer |
US10723756B2 (en) | 2016-01-11 | 2020-07-28 | Innate Tumor Immunity Inc. | Cyclic dinucleotides for treating conditions associated with STING activity such as cancer |
US10981901B1 (en) | 2016-04-07 | 2021-04-20 | Glaxosmithkline Intellectual Property Development Limited | Heterocyclic amides useful as protein modulators |
AU2017247806B2 (en) | 2016-04-07 | 2019-11-14 | Glaxosmithkline Intellectual Property Development Limited | Heterocyclic amides useful as protein modulators |
US20190153095A1 (en) | 2016-07-05 | 2019-05-23 | National University Corporation Kobe University | Antitumor Agent |
CN109843302B (en) | 2016-07-06 | 2022-11-29 | F-星治疗公司 | Compounds, compositions and methods for treating diseases |
CN106200187B (en) | 2016-07-07 | 2019-04-09 | 京东方科技集团股份有限公司 | Tunable optical glass, controllable shading device, method and vehicle |
WO2018013887A1 (en) | 2016-07-15 | 2018-01-18 | Sperovie Biosciences, Inc. | Compounds, compositions, and methods for the treatment of disease |
CA3030830A1 (en) | 2016-07-15 | 2018-01-18 | Sperovie Biosciences, Inc. | Compounds, compositions, and methods for the treatment of disease |
EP3493845A4 (en) | 2016-08-03 | 2020-04-15 | The Board of Trustees of the Leland Stanford Junior University | Disrupting fc receptor engagement on macrophages enhances efficacy of anti-sirpalpha antibody therapy |
US20190345191A1 (en) | 2016-08-31 | 2019-11-14 | Innate Tumor Immunity, Inc. | Cyclic dinucleotide analogs for treating conditions associated with sting (stimulator of interferon genes) activity |
JOP20190009A1 (en) * | 2016-09-21 | 2019-01-27 | Alx Oncology Inc | Antibodies against signal-regulatory protein alpha and methods of use |
US10537590B2 (en) | 2016-09-30 | 2020-01-21 | Boehringer Ingelheim International Gmbh | Cyclic dinucleotide compounds |
CN110036001B (en) | 2016-10-04 | 2022-03-22 | 默沙东公司 | Benzo [ b ] thiophene compounds as STING agonists |
EP3551661A1 (en) | 2016-12-09 | 2019-10-16 | Alector LLC | Anti-sirp-alpha antibodies and methods of use thereof |
EA201891882A1 (en) | 2017-02-17 | 2019-07-31 | Осе Иммьюнотерапьютикс | NEW ANTIBODIES TO SIRPa AND OPTIONS OF THEIR THERAPEUTIC APPLICATION |
MX2019012233A (en) * | 2017-04-13 | 2020-01-14 | Aduro Biotech Holdings Europe Bv | Anti-sirp alpha antibodies. |
CA3063622A1 (en) | 2017-05-16 | 2018-11-22 | Synthon Biopharmaceuticals B.V. | Anti-sirp.alpha. antibodies |
AU2018308364C1 (en) | 2017-07-26 | 2023-02-16 | Forty Seven, Inc. | Anti-SIRP-alpha antibodies and related methods |
CN113412279A (en) * | 2018-11-15 | 2021-09-17 | 拜奥迪斯私人有限公司 | Humanized anti-SIRP alpha antibodies |
CN111635458A (en) * | 2020-03-20 | 2020-09-08 | 上海健信生物医药科技有限公司 | Sirp alpha-targeting antibody or antigen binding fragment thereof, and preparation and application thereof |
US11572412B2 (en) * | 2021-06-04 | 2023-02-07 | Boehringer Ingelheim International Gmbh | Anti-SIRP-alpha antibodies |
-
2018
- 2018-04-13 MX MX2019012233A patent/MX2019012233A/en unknown
- 2018-04-13 JP JP2019556200A patent/JP7160833B2/en active Active
- 2018-04-13 KR KR1020197033365A patent/KR20190140454A/en not_active Application Discontinuation
- 2018-04-13 US US15/953,201 patent/US10851164B2/en active Active
- 2018-04-13 EP EP18784073.1A patent/EP3609922A2/en active Pending
- 2018-04-13 TW TW107112801A patent/TW201841943A/en unknown
- 2018-04-13 WO PCT/NL2018/050234 patent/WO2018190719A2/en unknown
- 2018-04-13 AU AU2018252546A patent/AU2018252546A1/en active Pending
- 2018-04-13 SG SG11201908813Q patent/SG11201908813QA/en unknown
- 2018-04-13 CA CA3058134A patent/CA3058134A1/en active Pending
-
2019
- 2019-09-16 IL IL26940519A patent/IL269405A/en unknown
-
2020
- 2020-11-30 US US17/107,334 patent/US20220135671A1/en not_active Abandoned
-
2022
- 2022-01-14 US US17/576,109 patent/US20220135677A1/en active Pending
- 2022-10-13 JP JP2022164426A patent/JP2022191386A/en active Pending
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20220135671A1 (en) * | 2017-04-13 | 2022-05-05 | Aduro Biotech Holdings, Europe B.V. | Anti-sirp alpha antibodies |
Also Published As
Publication number | Publication date |
---|---|
CA3058134A1 (en) | 2018-10-18 |
JP7160833B2 (en) | 2022-10-25 |
IL269405A (en) | 2019-11-28 |
SG11201908813QA (en) | 2019-10-30 |
WO2018190719A2 (en) | 2018-10-18 |
JP2022191386A (en) | 2022-12-27 |
WO2018190719A3 (en) | 2019-10-31 |
EP3609922A2 (en) | 2020-02-19 |
CN110650976A (en) | 2020-01-03 |
US10851164B2 (en) | 2020-12-01 |
US20180312587A1 (en) | 2018-11-01 |
MX2019012233A (en) | 2020-01-14 |
JP2020516300A (en) | 2020-06-11 |
AU2018252546A1 (en) | 2019-10-10 |
US20220135671A1 (en) | 2022-05-05 |
KR20190140454A (en) | 2019-12-19 |
TW201841943A (en) | 2018-12-01 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20220135677A1 (en) | Anti-sirp alpha antibodies | |
US20210363256A1 (en) | Anti-pd-1/lag3 bispecific antibodies | |
JP7002588B2 (en) | Anti-CD27 antibody | |
US20210032342A1 (en) | Anti-pd-1 antibodies | |
US20220251194A1 (en) | Anti-pd-1/lag3/tigit trispecific antibodies and anti-pd-1/lag3 bicpecific antibodies | |
NL2018708B1 (en) | ANTI-SIRPα ANTIBODIES | |
CN110650976B (en) | Anti-SIRP alpha antibodies | |
US20230192876A1 (en) | Dosing regimen of anti-cd27 antibodies for treatment of cancer | |
EA043743B1 (en) | AN ANTIBODY OR ANTIGENE-BINDING FRAGMENT THAT BINDS TO HUMAN SIRPα | |
RU2788095C2 (en) | Anti-pd-1 antibodies |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |