US20180371434A1 - Compositions for Treating Ectopic Calcification Disorders, and Methods Using Same - Google Patents
Compositions for Treating Ectopic Calcification Disorders, and Methods Using Same Download PDFInfo
- Publication number
- US20180371434A1 US20180371434A1 US15/777,446 US201615777446A US2018371434A1 US 20180371434 A1 US20180371434 A1 US 20180371434A1 US 201615777446 A US201615777446 A US 201615777446A US 2018371434 A1 US2018371434 A1 US 2018371434A1
- Authority
- US
- United States
- Prior art keywords
- amino acids
- polypeptide
- seq
- polypeptide consisting
- domain
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 238000000034 method Methods 0.000 title claims abstract description 92
- 230000002308 calcification Effects 0.000 title claims abstract description 48
- 239000000203 mixture Substances 0.000 title abstract description 96
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 192
- 201000010099 disease Diseases 0.000 claims abstract description 108
- 208000035475 disorder Diseases 0.000 claims abstract description 84
- 230000001575 pathological effect Effects 0.000 claims abstract description 10
- 208000034970 Heterotopic Ossification Diseases 0.000 claims abstract description 7
- 150000001413 amino acids Chemical class 0.000 claims description 226
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 226
- 229920001184 polypeptide Polymers 0.000 claims description 219
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 219
- 101000897042 Homo sapiens Nucleotide pyrophosphatase Proteins 0.000 claims description 71
- 102100021969 Nucleotide pyrophosphatase Human genes 0.000 claims description 69
- XPPKVPWEQAFLFU-UHFFFAOYSA-J diphosphate(4-) Chemical compound [O-]P([O-])(=O)OP([O-])([O-])=O XPPKVPWEQAFLFU-UHFFFAOYSA-J 0.000 claims description 56
- 239000012634 fragment Substances 0.000 claims description 55
- 108090000623 proteins and genes Proteins 0.000 claims description 49
- 208000004434 Calcinosis Diseases 0.000 claims description 47
- 108010076504 Protein Sorting Signals Proteins 0.000 claims description 31
- 208000020832 chronic kidney disease Diseases 0.000 claims description 31
- 102000004169 proteins and genes Human genes 0.000 claims description 31
- 102100028187 ATP-binding cassette sub-family C member 6 Human genes 0.000 claims description 28
- 241000282414 Homo sapiens Species 0.000 claims description 28
- 201000004613 Pseudoxanthoma elasticum Diseases 0.000 claims description 28
- 208000023558 pseudoxanthoma elasticum (inherited or acquired) Diseases 0.000 claims description 28
- 108020001507 fusion proteins Proteins 0.000 claims description 24
- 102000037865 fusion proteins Human genes 0.000 claims description 24
- 150000003839 salts Chemical class 0.000 claims description 19
- 230000011164 ossification Effects 0.000 claims description 18
- 201000008482 osteoarthritis Diseases 0.000 claims description 14
- 208000029725 Metabolic bone disease Diseases 0.000 claims description 13
- 201000006035 X-linked dominant hypophosphatemic rickets Diseases 0.000 claims description 13
- 208000031878 X-linked hypophosphatemia Diseases 0.000 claims description 13
- GOJUJUVQIVIZAV-UHFFFAOYSA-N 2-amino-4,6-dichloropyrimidine-5-carbaldehyde Chemical group NC1=NC(Cl)=C(C=O)C(Cl)=N1 GOJUJUVQIVIZAV-UHFFFAOYSA-N 0.000 claims description 12
- 229910019142 PO4 Inorganic materials 0.000 claims description 12
- 210000001367 artery Anatomy 0.000 claims description 12
- 101000812677 Homo sapiens Nucleotide pyrophosphatase Proteins 0.000 claims description 11
- 241000124008 Mammalia Species 0.000 claims description 11
- 206010049088 Osteopenia Diseases 0.000 claims description 11
- 201000000523 end stage renal failure Diseases 0.000 claims description 11
- 208000011111 hypophosphatemic rickets Diseases 0.000 claims description 11
- 239000010452 phosphate Substances 0.000 claims description 11
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 claims description 11
- 102100039306 Nucleotide pyrophosphatase Human genes 0.000 claims description 10
- 235000011180 diphosphates Nutrition 0.000 claims description 10
- 229910052500 inorganic mineral Inorganic materials 0.000 claims description 10
- 239000011707 mineral Substances 0.000 claims description 10
- 210000002966 serum Anatomy 0.000 claims description 10
- 206010051714 Calciphylaxis Diseases 0.000 claims description 9
- 208000028208 end stage renal disease Diseases 0.000 claims description 9
- 108091006905 Human Serum Albumin Proteins 0.000 claims description 8
- 102000008100 Human Serum Albumin Human genes 0.000 claims description 8
- 208000005475 Vascular calcification Diseases 0.000 claims description 8
- 230000032683 aging Effects 0.000 claims description 8
- 208000004900 arterial calcification of infancy Diseases 0.000 claims description 8
- 206010002556 Ankylosing Spondylitis Diseases 0.000 claims description 6
- 208000037260 Atherosclerotic Plaque Diseases 0.000 claims description 6
- 208000020084 Bone disease Diseases 0.000 claims description 6
- 208000013725 Chronic Kidney Disease-Mineral and Bone disease Diseases 0.000 claims description 6
- 208000033173 Generalized arterial calcification of infancy Diseases 0.000 claims description 6
- 230000001413 cellular effect Effects 0.000 claims description 6
- 208000001040 ossification of the posterior longitudinal ligament of the spine Diseases 0.000 claims description 5
- TVZRAEYQIKYCPH-UHFFFAOYSA-N 3-(trimethylsilyl)propane-1-sulfonic acid Chemical compound C[Si](C)(C)CCCS(O)(=O)=O TVZRAEYQIKYCPH-UHFFFAOYSA-N 0.000 claims description 4
- 108010037370 Glu-Glu-Glu-Glu-Glu-Glu-Glu-Pro-Arg-Gly-Asp-Thr Proteins 0.000 claims description 4
- 101710163270 Nuclease Proteins 0.000 claims description 4
- 239000012453 solvate Substances 0.000 claims description 4
- 230000007812 deficiency Effects 0.000 claims description 3
- 201000002044 ossification of the posterior longitudinal ligament of spine Diseases 0.000 claims 3
- 229940024606 amino acid Drugs 0.000 description 172
- 235000001014 amino acid Nutrition 0.000 description 172
- 150000001875 compounds Chemical class 0.000 description 55
- 210000002381 plasma Anatomy 0.000 description 46
- 239000008194 pharmaceutical composition Substances 0.000 description 44
- 238000009472 formulation Methods 0.000 description 34
- 239000000463 material Substances 0.000 description 32
- 239000004480 active ingredient Substances 0.000 description 31
- 150000007523 nucleic acids Chemical class 0.000 description 29
- 102000039446 nucleic acids Human genes 0.000 description 28
- 108020004707 nucleic acids Proteins 0.000 description 28
- 235000018102 proteins Nutrition 0.000 description 28
- -1 pyrophosphate anions Chemical class 0.000 description 27
- 125000005647 linker group Chemical group 0.000 description 24
- 239000002773 nucleotide Substances 0.000 description 22
- 125000003729 nucleotide group Chemical group 0.000 description 22
- 239000000758 substrate Substances 0.000 description 21
- 210000004027 cell Anatomy 0.000 description 20
- 102000009027 Albumins Human genes 0.000 description 17
- 108010088751 Albumins Proteins 0.000 description 17
- 239000003814 drug Substances 0.000 description 17
- 239000000047 product Substances 0.000 description 17
- 230000001225 therapeutic effect Effects 0.000 description 17
- 239000003826 tablet Substances 0.000 description 16
- 210000001519 tissue Anatomy 0.000 description 16
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 15
- 208000005050 Familial Hypophosphatemic Rickets Diseases 0.000 description 15
- 229940079593 drug Drugs 0.000 description 15
- 241001465754 Metazoa Species 0.000 description 14
- 239000003937 drug carrier Substances 0.000 description 14
- 230000000694 effects Effects 0.000 description 14
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 14
- 102000004190 Enzymes Human genes 0.000 description 13
- 108090000790 Enzymes Proteins 0.000 description 13
- 238000013270 controlled release Methods 0.000 description 13
- 239000004615 ingredient Substances 0.000 description 13
- 238000011282 treatment Methods 0.000 description 13
- 239000002585 base Substances 0.000 description 12
- 239000002552 dosage form Substances 0.000 description 12
- 239000003755 preservative agent Substances 0.000 description 12
- 239000002904 solvent Substances 0.000 description 12
- 239000000725 suspension Substances 0.000 description 12
- 108020004414 DNA Proteins 0.000 description 11
- 102000053602 DNA Human genes 0.000 description 11
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 11
- 239000007788 liquid Substances 0.000 description 11
- 239000000546 pharmaceutical excipient Substances 0.000 description 11
- 235000021317 phosphate Nutrition 0.000 description 11
- 239000013612 plasmid Substances 0.000 description 11
- 229920000642 polymer Polymers 0.000 description 11
- 239000000243 solution Substances 0.000 description 11
- 239000002270 dispersing agent Substances 0.000 description 10
- 102000040430 polynucleotide Human genes 0.000 description 10
- 108091033319 polynucleotide Proteins 0.000 description 10
- 239000002157 polynucleotide Substances 0.000 description 10
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 9
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 9
- 239000011230 binding agent Substances 0.000 description 9
- 150000002148 esters Chemical class 0.000 description 9
- 230000036961 partial effect Effects 0.000 description 9
- 239000000375 suspending agent Substances 0.000 description 9
- 208000024891 symptom Diseases 0.000 description 9
- 239000002202 Polyethylene glycol Substances 0.000 description 8
- 239000003795 chemical substances by application Substances 0.000 description 8
- 230000036541 health Effects 0.000 description 8
- 230000000670 limiting effect Effects 0.000 description 8
- 238000007911 parenteral administration Methods 0.000 description 8
- 229920001223 polyethylene glycol Polymers 0.000 description 8
- 239000011347 resin Substances 0.000 description 8
- 229920005989 resin Polymers 0.000 description 8
- 229920002477 rna polymer Polymers 0.000 description 8
- 238000013268 sustained release Methods 0.000 description 8
- 239000012730 sustained-release form Substances 0.000 description 8
- 125000002947 alkylene group Chemical group 0.000 description 7
- 239000000872 buffer Substances 0.000 description 7
- 238000006243 chemical reaction Methods 0.000 description 7
- 230000001351 cycling effect Effects 0.000 description 7
- 239000003995 emulsifying agent Substances 0.000 description 7
- 230000006870 function Effects 0.000 description 7
- 239000000314 lubricant Substances 0.000 description 7
- 108020004999 messenger RNA Proteins 0.000 description 7
- 239000000843 powder Substances 0.000 description 7
- 238000002360 preparation method Methods 0.000 description 7
- 210000004872 soft tissue Anatomy 0.000 description 7
- 239000007787 solid Substances 0.000 description 7
- 239000000126 substance Substances 0.000 description 7
- 238000006467 substitution reaction Methods 0.000 description 7
- 239000001993 wax Substances 0.000 description 7
- 239000000080 wetting agent Substances 0.000 description 7
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 6
- 108010010803 Gelatin Proteins 0.000 description 6
- 108060003951 Immunoglobulin Proteins 0.000 description 6
- 208000006011 Stroke Diseases 0.000 description 6
- 230000015572 biosynthetic process Effects 0.000 description 6
- 210000000988 bone and bone Anatomy 0.000 description 6
- 239000002738 chelating agent Substances 0.000 description 6
- 238000000576 coating method Methods 0.000 description 6
- 230000000295 complement effect Effects 0.000 description 6
- 239000002299 complementary DNA Substances 0.000 description 6
- 230000002354 daily effect Effects 0.000 description 6
- 239000003085 diluting agent Substances 0.000 description 6
- 238000001647 drug administration Methods 0.000 description 6
- 230000002255 enzymatic effect Effects 0.000 description 6
- 235000019441 ethanol Nutrition 0.000 description 6
- 239000000499 gel Substances 0.000 description 6
- 239000008273 gelatin Substances 0.000 description 6
- 229920000159 gelatin Polymers 0.000 description 6
- 235000019322 gelatine Nutrition 0.000 description 6
- 235000011852 gelatine desserts Nutrition 0.000 description 6
- 230000014509 gene expression Effects 0.000 description 6
- 125000003827 glycol group Chemical group 0.000 description 6
- 125000001183 hydrocarbyl group Chemical group 0.000 description 6
- 102000018358 immunoglobulin Human genes 0.000 description 6
- 230000005764 inhibitory process Effects 0.000 description 6
- 238000010172 mouse model Methods 0.000 description 6
- 230000035772 mutation Effects 0.000 description 6
- 231100000252 nontoxic Toxicity 0.000 description 6
- 230000003000 nontoxic effect Effects 0.000 description 6
- 230000002335 preservative effect Effects 0.000 description 6
- 238000000746 purification Methods 0.000 description 6
- 230000002829 reductive effect Effects 0.000 description 6
- 239000003765 sweetening agent Substances 0.000 description 6
- 235000015112 vegetable and seed oil Nutrition 0.000 description 6
- 239000008158 vegetable oil Substances 0.000 description 6
- 239000003981 vehicle Substances 0.000 description 6
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 5
- 108091006112 ATPases Proteins 0.000 description 5
- 102000057290 Adenosine Triphosphatases Human genes 0.000 description 5
- 102100036093 Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 Human genes 0.000 description 5
- 101000876377 Homo sapiens Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 Proteins 0.000 description 5
- 101150011046 NPP1 gene Proteins 0.000 description 5
- 101100080092 Phytophthora capsici NLP1 gene Proteins 0.000 description 5
- 239000003963 antioxidant agent Substances 0.000 description 5
- 235000006708 antioxidants Nutrition 0.000 description 5
- 230000027455 binding Effects 0.000 description 5
- 210000004369 blood Anatomy 0.000 description 5
- 239000008280 blood Substances 0.000 description 5
- 239000002775 capsule Substances 0.000 description 5
- 230000003247 decreasing effect Effects 0.000 description 5
- 230000003111 delayed effect Effects 0.000 description 5
- 238000000502 dialysis Methods 0.000 description 5
- 235000003599 food sweetener Nutrition 0.000 description 5
- 230000002209 hydrophobic effect Effects 0.000 description 5
- 238000001990 intravenous administration Methods 0.000 description 5
- 235000010445 lecithin Nutrition 0.000 description 5
- 239000000787 lecithin Substances 0.000 description 5
- 229940067606 lecithin Drugs 0.000 description 5
- 230000004048 modification Effects 0.000 description 5
- 238000012986 modification Methods 0.000 description 5
- 150000007524 organic acids Chemical class 0.000 description 5
- 238000004806 packaging method and process Methods 0.000 description 5
- 230000008569 process Effects 0.000 description 5
- 230000028327 secretion Effects 0.000 description 5
- 210000003491 skin Anatomy 0.000 description 5
- 235000010356 sorbitol Nutrition 0.000 description 5
- 239000000600 sorbitol Substances 0.000 description 5
- 239000004094 surface-active agent Substances 0.000 description 5
- 229930024421 Adenine Natural products 0.000 description 4
- GFFGJBXGBJISGV-UHFFFAOYSA-N Adenine Chemical compound NC1=NC=NC2=C1N=CN2 GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 4
- 101100225890 Aplysia californica ENPP gene Proteins 0.000 description 4
- VTYYLEPIZMXCLO-UHFFFAOYSA-L Calcium carbonate Chemical compound [Ca+2].[O-]C([O-])=O VTYYLEPIZMXCLO-UHFFFAOYSA-L 0.000 description 4
- 108091026890 Coding region Proteins 0.000 description 4
- 229920002261 Corn starch Polymers 0.000 description 4
- 108091028043 Nucleic acid sequence Proteins 0.000 description 4
- 230000002159 abnormal effect Effects 0.000 description 4
- 239000000654 additive Substances 0.000 description 4
- 229960000643 adenine Drugs 0.000 description 4
- 230000004071 biological effect Effects 0.000 description 4
- 239000011248 coating agent Substances 0.000 description 4
- 239000003086 colorant Substances 0.000 description 4
- 235000014113 dietary fatty acids Nutrition 0.000 description 4
- 208000037765 diseases and disorders Diseases 0.000 description 4
- 239000013583 drug formulation Substances 0.000 description 4
- 210000004177 elastic tissue Anatomy 0.000 description 4
- 239000000839 emulsion Substances 0.000 description 4
- 238000006911 enzymatic reaction Methods 0.000 description 4
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 4
- 229930195729 fatty acid Natural products 0.000 description 4
- 239000000194 fatty acid Substances 0.000 description 4
- 150000004665 fatty acids Chemical class 0.000 description 4
- 239000000945 filler Substances 0.000 description 4
- 239000000796 flavoring agent Substances 0.000 description 4
- 235000011187 glycerol Nutrition 0.000 description 4
- 239000008187 granular material Substances 0.000 description 4
- 238000005469 granulation Methods 0.000 description 4
- 230000003179 granulation Effects 0.000 description 4
- 229940093915 gynecological organic acid Drugs 0.000 description 4
- 230000007062 hydrolysis Effects 0.000 description 4
- 238000006460 hydrolysis reaction Methods 0.000 description 4
- 208000000740 hypophosphatemic bone disease Diseases 0.000 description 4
- 238000002347 injection Methods 0.000 description 4
- 239000007924 injection Substances 0.000 description 4
- 210000003734 kidney Anatomy 0.000 description 4
- 229940057995 liquid paraffin Drugs 0.000 description 4
- 239000006194 liquid suspension Substances 0.000 description 4
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 4
- 239000002609 medium Substances 0.000 description 4
- BDAGIHXWWSANSR-UHFFFAOYSA-N methanoic acid Natural products OC=O BDAGIHXWWSANSR-UHFFFAOYSA-N 0.000 description 4
- 239000004006 olive oil Substances 0.000 description 4
- 235000008390 olive oil Nutrition 0.000 description 4
- 235000005985 organic acids Nutrition 0.000 description 4
- 208000007442 rickets Diseases 0.000 description 4
- 235000010199 sorbic acid Nutrition 0.000 description 4
- 239000004334 sorbic acid Substances 0.000 description 4
- 229940075582 sorbic acid Drugs 0.000 description 4
- 239000003381 stabilizer Substances 0.000 description 4
- 239000002562 thickening agent Substances 0.000 description 4
- 230000014616 translation Effects 0.000 description 4
- KUBWJGWIWGGEPZ-UHFFFAOYSA-N 1-[amino(ethoxy)phosphoryl]oxy-4-nitrobenzene Chemical compound CCOP(N)(=O)OC1=CC=C([N+]([O-])=O)C=C1 KUBWJGWIWGGEPZ-UHFFFAOYSA-N 0.000 description 3
- 235000019489 Almond oil Nutrition 0.000 description 3
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 3
- 235000003911 Arachis Nutrition 0.000 description 3
- 244000105624 Arachis hypogaea Species 0.000 description 3
- 241000416162 Astragalus gummifer Species 0.000 description 3
- WVDDGKGOMKODPV-UHFFFAOYSA-N Benzyl alcohol Chemical compound OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 description 3
- 229940122361 Bisphosphonate Drugs 0.000 description 3
- 241000283690 Bos taurus Species 0.000 description 3
- 239000004322 Butylated hydroxytoluene Substances 0.000 description 3
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 3
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 3
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 3
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical class OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 3
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- 102000004157 Hydrolases Human genes 0.000 description 3
- 108090000604 Hydrolases Proteins 0.000 description 3
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 3
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 3
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 3
- 240000007472 Leucaena leucocephala Species 0.000 description 3
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 3
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 3
- 101150071357 NPP2 gene Proteins 0.000 description 3
- 240000007817 Olea europaea Species 0.000 description 3
- 108091093037 Peptide nucleic acid Proteins 0.000 description 3
- 101100080097 Phytophthora capsici NLP2 gene Proteins 0.000 description 3
- 229920001615 Tragacanth Polymers 0.000 description 3
- 238000010521 absorption reaction Methods 0.000 description 3
- 239000002253 acid Substances 0.000 description 3
- 150000004781 alginic acids Chemical class 0.000 description 3
- 239000008168 almond oil Substances 0.000 description 3
- 230000004075 alteration Effects 0.000 description 3
- 150000001450 anions Chemical class 0.000 description 3
- 239000003242 anti bacterial agent Substances 0.000 description 3
- 239000003429 antifungal agent Substances 0.000 description 3
- 229940121375 antifungal agent Drugs 0.000 description 3
- 239000008135 aqueous vehicle Substances 0.000 description 3
- 235000010323 ascorbic acid Nutrition 0.000 description 3
- 239000011668 ascorbic acid Substances 0.000 description 3
- 229960005070 ascorbic acid Drugs 0.000 description 3
- 201000003674 autosomal dominant hypophosphatemic rickets Diseases 0.000 description 3
- 150000004663 bisphosphonates Chemical class 0.000 description 3
- 235000010354 butylated hydroxytoluene Nutrition 0.000 description 3
- 239000011575 calcium Substances 0.000 description 3
- 229910052791 calcium Inorganic materials 0.000 description 3
- 239000007894 caplet Substances 0.000 description 3
- 235000010980 cellulose Nutrition 0.000 description 3
- 229920002678 cellulose Polymers 0.000 description 3
- 239000001913 cellulose Substances 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 239000008120 corn starch Substances 0.000 description 3
- 229940099112 cornstarch Drugs 0.000 description 3
- 238000012217 deletion Methods 0.000 description 3
- 230000037430 deletion Effects 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000018109 developmental process Effects 0.000 description 3
- 235000013355 food flavoring agent Nutrition 0.000 description 3
- 230000004927 fusion Effects 0.000 description 3
- 239000007897 gelcap Substances 0.000 description 3
- 238000004128 high performance liquid chromatography Methods 0.000 description 3
- 239000003701 inert diluent Substances 0.000 description 3
- 239000007972 injectable composition Substances 0.000 description 3
- 238000003780 insertion Methods 0.000 description 3
- 230000037431 insertion Effects 0.000 description 3
- 238000007913 intrathecal administration Methods 0.000 description 3
- 239000008101 lactose Substances 0.000 description 3
- 210000004446 longitudinal ligament Anatomy 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 238000005259 measurement Methods 0.000 description 3
- 239000000155 melt Substances 0.000 description 3
- 238000007909 melt granulation Methods 0.000 description 3
- 239000002480 mineral oil Substances 0.000 description 3
- 150000007522 mineralic acids Chemical class 0.000 description 3
- 239000003921 oil Substances 0.000 description 3
- 235000019198 oils Nutrition 0.000 description 3
- 210000000056 organ Anatomy 0.000 description 3
- 239000006072 paste Substances 0.000 description 3
- 239000008177 pharmaceutical agent Substances 0.000 description 3
- 239000000825 pharmaceutical preparation Substances 0.000 description 3
- 230000002265 prevention Effects 0.000 description 3
- 230000035484 reaction time Effects 0.000 description 3
- 239000008159 sesame oil Substances 0.000 description 3
- 235000011803 sesame oil Nutrition 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 125000006850 spacer group Chemical group 0.000 description 3
- 238000007920 subcutaneous administration Methods 0.000 description 3
- 239000000829 suppository Substances 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- 238000013518 transcription Methods 0.000 description 3
- 230000035897 transcription Effects 0.000 description 3
- 239000013598 vector Substances 0.000 description 3
- PUPZLCDOIYMWBV-UHFFFAOYSA-N (+/-)-1,3-Butanediol Chemical compound CC(O)CCO PUPZLCDOIYMWBV-UHFFFAOYSA-N 0.000 description 2
- VBICKXHEKHSIBG-UHFFFAOYSA-N 1-monostearoylglycerol Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCC(O)CO VBICKXHEKHSIBG-UHFFFAOYSA-N 0.000 description 2
- IZHVBANLECCAGF-UHFFFAOYSA-N 2-hydroxy-3-(octadecanoyloxy)propyl octadecanoate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCC(O)COC(=O)CCCCCCCCCCCCCCCCC IZHVBANLECCAGF-UHFFFAOYSA-N 0.000 description 2
- OSWFIVFLDKOXQC-UHFFFAOYSA-N 4-(3-methoxyphenyl)aniline Chemical compound COC1=CC=CC(C=2C=CC(N)=CC=2)=C1 OSWFIVFLDKOXQC-UHFFFAOYSA-N 0.000 description 2
- KDCGOANMDULRCW-UHFFFAOYSA-N 7H-purine Chemical compound N1=CNC2=NC=NC2=C1 KDCGOANMDULRCW-UHFFFAOYSA-N 0.000 description 2
- 238000006064 ATPase reaction Methods 0.000 description 2
- 244000215068 Acacia senegal Species 0.000 description 2
- 235000006491 Acacia senegal Nutrition 0.000 description 2
- 102000006306 Antigen Receptors Human genes 0.000 description 2
- 108010083359 Antigen Receptors Proteins 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 2
- 108091008875 B cell receptors Proteins 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- 102000004506 Blood Proteins Human genes 0.000 description 2
- 108010017384 Blood Proteins Proteins 0.000 description 2
- 241000282472 Canis lupus familiaris Species 0.000 description 2
- 108091033380 Coding strand Proteins 0.000 description 2
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 2
- 241000283073 Equus caballus Species 0.000 description 2
- 241000282326 Felis catus Species 0.000 description 2
- 102000004042 Fibroblast Growth Factor-23 Human genes 0.000 description 2
- 108090000569 Fibroblast Growth Factor-23 Proteins 0.000 description 2
- 229920000084 Gum arabic Polymers 0.000 description 2
- 208000025500 Hutchinson-Gilford progeria syndrome Diseases 0.000 description 2
- 206010020772 Hypertension Diseases 0.000 description 2
- 208000029663 Hypophosphatemia Diseases 0.000 description 2
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 2
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- 229930195725 Mannitol Natural products 0.000 description 2
- MBBZMMPHUWSWHV-BDVNFPICSA-N N-methylglucamine Chemical compound CNC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO MBBZMMPHUWSWHV-BDVNFPICSA-N 0.000 description 2
- PXHVJJICTQNCMI-UHFFFAOYSA-N Nickel Chemical compound [Ni] PXHVJJICTQNCMI-UHFFFAOYSA-N 0.000 description 2
- 101100030372 Nicotiana tabacum NPP5 gene Proteins 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- 208000009469 Ossification of Posterior Longitudinal Ligament Diseases 0.000 description 2
- 235000019483 Peanut oil Nutrition 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 108090001050 Phosphoric Diester Hydrolases Proteins 0.000 description 2
- 102000004861 Phosphoric Diester Hydrolases Human genes 0.000 description 2
- 208000007932 Progeria Diseases 0.000 description 2
- 108010009413 Pyrophosphatases Proteins 0.000 description 2
- 102000009609 Pyrophosphatases Human genes 0.000 description 2
- WHBMMWSBFZVSSR-UHFFFAOYSA-N R3HBA Natural products CC(O)CC(O)=O WHBMMWSBFZVSSR-UHFFFAOYSA-N 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 208000001647 Renal Insufficiency Diseases 0.000 description 2
- 229920002684 Sepharose Polymers 0.000 description 2
- 244000000231 Sesamum indicum Species 0.000 description 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 2
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 2
- 206010058660 Spinal ligament ossification Diseases 0.000 description 2
- 229920002472 Starch Polymers 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 2
- 208000002847 Surgical Wound Diseases 0.000 description 2
- HSCJRCZFDFQWRP-RDKQLNKOSA-N UDP-D-glucose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)OC1OP(O)(=O)OP(O)(=O)OC[C@@H]1[C@@H](O)[C@@H](O)[C@H](N2C(NC(=O)C=C2)=O)O1 HSCJRCZFDFQWRP-RDKQLNKOSA-N 0.000 description 2
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 2
- 241000700605 Viruses Species 0.000 description 2
- 208000035724 X-linked hypophosphatemic rickets Diseases 0.000 description 2
- 235000010489 acacia gum Nutrition 0.000 description 2
- 238000009825 accumulation Methods 0.000 description 2
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 239000013543 active substance Substances 0.000 description 2
- 235000010443 alginic acid Nutrition 0.000 description 2
- 239000000783 alginic acid Substances 0.000 description 2
- 229920000615 alginic acid Polymers 0.000 description 2
- 229960001126 alginic acid Drugs 0.000 description 2
- 125000000539 amino acid group Chemical group 0.000 description 2
- 238000010171 animal model Methods 0.000 description 2
- 230000000844 anti-bacterial effect Effects 0.000 description 2
- 230000000692 anti-sense effect Effects 0.000 description 2
- 230000003078 antioxidant effect Effects 0.000 description 2
- 239000003125 aqueous solvent Substances 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 206010003246 arthritis Diseases 0.000 description 2
- 125000003118 aryl group Chemical group 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- 229960001230 asparagine Drugs 0.000 description 2
- 235000003704 aspartic acid Nutrition 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 2
- 239000012620 biological material Substances 0.000 description 2
- 239000012472 biological sample Substances 0.000 description 2
- 239000000090 biomarker Substances 0.000 description 2
- 230000033558 biomineral tissue development Effects 0.000 description 2
- 230000036765 blood level Effects 0.000 description 2
- 229910000019 calcium carbonate Inorganic materials 0.000 description 2
- 239000001506 calcium phosphate Substances 0.000 description 2
- 229910000389 calcium phosphate Inorganic materials 0.000 description 2
- 235000011010 calcium phosphates Nutrition 0.000 description 2
- 239000001768 carboxy methyl cellulose Substances 0.000 description 2
- 210000000845 cartilage Anatomy 0.000 description 2
- 239000007795 chemical reaction product Substances 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- 238000011210 chromatographic step Methods 0.000 description 2
- 238000004587 chromatography analysis Methods 0.000 description 2
- 239000003240 coconut oil Substances 0.000 description 2
- 235000019864 coconut oil Nutrition 0.000 description 2
- 239000007859 condensation product Substances 0.000 description 2
- 238000001816 cooling Methods 0.000 description 2
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 2
- 239000005547 deoxyribonucleotide Substances 0.000 description 2
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 238000000151 deposition Methods 0.000 description 2
- 238000003745 diagnosis Methods 0.000 description 2
- 235000005911 diet Nutrition 0.000 description 2
- 230000037213 diet Effects 0.000 description 2
- 239000006185 dispersion Substances 0.000 description 2
- 238000004090 dissolution Methods 0.000 description 2
- 108010067341 ectonucleotide pyrophosphatase phosphodiesterase 1 Proteins 0.000 description 2
- 230000002526 effect on cardiovascular system Effects 0.000 description 2
- 239000003974 emollient agent Substances 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- MMXKVMNBHPAILY-UHFFFAOYSA-N ethyl laurate Chemical compound CCCCCCCCCCCC(=O)OCC MMXKVMNBHPAILY-UHFFFAOYSA-N 0.000 description 2
- 230000003203 everyday effect Effects 0.000 description 2
- 230000029142 excretion Effects 0.000 description 2
- 239000003925 fat Substances 0.000 description 2
- 235000019197 fats Nutrition 0.000 description 2
- 235000019253 formic acid Nutrition 0.000 description 2
- 230000037433 frameshift Effects 0.000 description 2
- 230000002496 gastric effect Effects 0.000 description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 2
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical compound O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 2
- 239000007902 hard capsule Substances 0.000 description 2
- 208000014092 hereditary hypophosphatemic rickets Diseases 0.000 description 2
- BXWNKGSJHAJOGX-UHFFFAOYSA-N hexadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCO BXWNKGSJHAJOGX-UHFFFAOYSA-N 0.000 description 2
- 230000013632 homeostatic process Effects 0.000 description 2
- 102000048180 human ENPP3 Human genes 0.000 description 2
- 235000010979 hydroxypropyl methyl cellulose Nutrition 0.000 description 2
- 239000001866 hydroxypropyl methyl cellulose Substances 0.000 description 2
- 229920003088 hydroxypropyl methyl cellulose Polymers 0.000 description 2
- UFVKGYZPFZQRLF-UHFFFAOYSA-N hydroxypropyl methyl cellulose Chemical compound OC1C(O)C(OC)OC(CO)C1OC1C(O)C(O)C(OC2C(C(O)C(OC3C(C(O)C(O)C(CO)O3)O)C(CO)O2)O)C(CO)O1 UFVKGYZPFZQRLF-UHFFFAOYSA-N 0.000 description 2
- 239000012729 immediate-release (IR) formulation Substances 0.000 description 2
- 238000002513 implantation Methods 0.000 description 2
- 150000007529 inorganic bases Chemical class 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- 208000017169 kidney disease Diseases 0.000 description 2
- 201000006370 kidney failure Diseases 0.000 description 2
- 239000002502 liposome Substances 0.000 description 2
- 239000006193 liquid solution Substances 0.000 description 2
- 235000019359 magnesium stearate Nutrition 0.000 description 2
- 238000012423 maintenance Methods 0.000 description 2
- 235000010355 mannitol Nutrition 0.000 description 2
- 239000000594 mannitol Substances 0.000 description 2
- 238000002844 melting Methods 0.000 description 2
- 230000008018 melting Effects 0.000 description 2
- 210000004379 membrane Anatomy 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 230000004060 metabolic process Effects 0.000 description 2
- 229930182817 methionine Natural products 0.000 description 2
- 229920000609 methyl cellulose Polymers 0.000 description 2
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 2
- 235000010981 methylcellulose Nutrition 0.000 description 2
- 239000001923 methylcellulose Substances 0.000 description 2
- 239000011859 microparticle Substances 0.000 description 2
- 239000004005 microsphere Substances 0.000 description 2
- 239000001788 mono and diglycerides of fatty acids Substances 0.000 description 2
- 238000000465 moulding Methods 0.000 description 2
- 229940051866 mouthwash Drugs 0.000 description 2
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 2
- 230000003204 osmotic effect Effects 0.000 description 2
- 239000000312 peanut oil Substances 0.000 description 2
- 239000006187 pill Substances 0.000 description 2
- 230000036470 plasma concentration Effects 0.000 description 2
- 229920005862 polyol Polymers 0.000 description 2
- 150000003077 polyols Chemical class 0.000 description 2
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 2
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 2
- 229920000053 polysorbate 80 Polymers 0.000 description 2
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 2
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 2
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 2
- 229920001592 potato starch Polymers 0.000 description 2
- 230000003389 potentiating effect Effects 0.000 description 2
- 230000002028 premature Effects 0.000 description 2
- 230000002035 prolonged effect Effects 0.000 description 2
- 230000002685 pulmonary effect Effects 0.000 description 2
- 230000000541 pulsatile effect Effects 0.000 description 2
- 238000011002 quantification Methods 0.000 description 2
- 238000011552 rat model Methods 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 108091008146 restriction endonucleases Proteins 0.000 description 2
- 239000002336 ribonucleotide Substances 0.000 description 2
- 125000002652 ribonucleotide group Chemical group 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 235000019812 sodium carboxymethyl cellulose Nutrition 0.000 description 2
- 229920001027 sodium carboxymethylcellulose Polymers 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 235000019698 starch Nutrition 0.000 description 2
- 239000007858 starting material Substances 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 150000008163 sugars Chemical class 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 239000006188 syrup Substances 0.000 description 2
- 235000020357 syrup Nutrition 0.000 description 2
- 239000000454 talc Substances 0.000 description 2
- 229910052623 talc Inorganic materials 0.000 description 2
- 229940124597 therapeutic agent Drugs 0.000 description 2
- 230000004797 therapeutic response Effects 0.000 description 2
- RWQNBRDOKXIBIV-UHFFFAOYSA-N thymine Chemical compound CC1=CNC(=O)NC1=O RWQNBRDOKXIBIV-UHFFFAOYSA-N 0.000 description 2
- 238000011200 topical administration Methods 0.000 description 2
- 238000013519 translation Methods 0.000 description 2
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 2
- 230000002792 vascular Effects 0.000 description 2
- LNAZSHAWQACDHT-XIYTZBAFSA-N (2r,3r,4s,5r,6s)-4,5-dimethoxy-2-(methoxymethyl)-3-[(2s,3r,4s,5r,6r)-3,4,5-trimethoxy-6-(methoxymethyl)oxan-2-yl]oxy-6-[(2r,3r,4s,5r,6r)-4,5,6-trimethoxy-2-(methoxymethyl)oxan-3-yl]oxyoxane Chemical compound CO[C@@H]1[C@@H](OC)[C@H](OC)[C@@H](COC)O[C@H]1O[C@H]1[C@H](OC)[C@@H](OC)[C@H](O[C@H]2[C@@H]([C@@H](OC)[C@H](OC)O[C@@H]2COC)OC)O[C@@H]1COC LNAZSHAWQACDHT-XIYTZBAFSA-N 0.000 description 1
- DNIAPMSPPWPWGF-GSVOUGTGSA-N (R)-(-)-Propylene glycol Chemical compound C[C@@H](O)CO DNIAPMSPPWPWGF-GSVOUGTGSA-N 0.000 description 1
- GVJHHUAWPYXKBD-IEOSBIPESA-N (R)-alpha-Tocopherol Natural products OC1=C(C)C(C)=C2O[C@@](CCC[C@H](C)CCC[C@H](C)CCCC(C)C)(C)CCC2=C1C GVJHHUAWPYXKBD-IEOSBIPESA-N 0.000 description 1
- ZORQXIQZAOLNGE-UHFFFAOYSA-N 1,1-difluorocyclohexane Chemical compound FC1(F)CCCCC1 ZORQXIQZAOLNGE-UHFFFAOYSA-N 0.000 description 1
- NWUYHJFMYQTDRP-UHFFFAOYSA-N 1,2-bis(ethenyl)benzene;1-ethenyl-2-ethylbenzene;styrene Chemical compound C=CC1=CC=CC=C1.CCC1=CC=CC=C1C=C.C=CC1=CC=CC=C1C=C NWUYHJFMYQTDRP-UHFFFAOYSA-N 0.000 description 1
- QXQAPNSHUJORMC-UHFFFAOYSA-N 1-chloro-4-propylbenzene Chemical compound CCCC1=CC=C(Cl)C=C1 QXQAPNSHUJORMC-UHFFFAOYSA-N 0.000 description 1
- IXPNQXFRVYWDDI-UHFFFAOYSA-N 1-methyl-2,4-dioxo-1,3-diazinane-5-carboximidamide Chemical compound CN1CC(C(N)=N)C(=O)NC1=O IXPNQXFRVYWDDI-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 125000005274 4-hydroxybenzoic acid group Chemical group 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- 239000005995 Aluminium silicate Substances 0.000 description 1
- 206010002383 Angina Pectoris Diseases 0.000 description 1
- 108020005544 Antisense RNA Proteins 0.000 description 1
- 206010062542 Arterial insufficiency Diseases 0.000 description 1
- 201000001320 Atherosclerosis Diseases 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- 239000004255 Butylated hydroxyanisole Substances 0.000 description 1
- 241000282465 Canis Species 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- 208000006029 Cardiomegaly Diseases 0.000 description 1
- 208000024172 Cardiovascular disease Diseases 0.000 description 1
- 108090000994 Catalytic RNA Proteins 0.000 description 1
- 102000053642 Catalytic RNA Human genes 0.000 description 1
- 208000000094 Chronic Pain Diseases 0.000 description 1
- 206010009192 Circulatory collapse Diseases 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- RYGMFSIKBFXOCR-UHFFFAOYSA-N Copper Chemical compound [Cu] RYGMFSIKBFXOCR-UHFFFAOYSA-N 0.000 description 1
- 206010011703 Cyanosis Diseases 0.000 description 1
- 230000004568 DNA-binding Effects 0.000 description 1
- 206010012289 Dementia Diseases 0.000 description 1
- 102100021977 Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 Human genes 0.000 description 1
- 102100021962 Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 Human genes 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 108010042407 Endonucleases Proteins 0.000 description 1
- 102000004533 Endonucleases Human genes 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 239000001856 Ethyl cellulose Substances 0.000 description 1
- ZZSNKZQZMQGXPY-UHFFFAOYSA-N Ethyl cellulose Chemical compound CCOCC1OC(OC)C(OCC)C(OCC)C1OC1C(O)C(O)C(OC)C(CO)O1 ZZSNKZQZMQGXPY-UHFFFAOYSA-N 0.000 description 1
- IAYPIBMASNFSPL-UHFFFAOYSA-N Ethylene oxide Chemical compound C1CO1 IAYPIBMASNFSPL-UHFFFAOYSA-N 0.000 description 1
- PIICEJLVQHRZGT-UHFFFAOYSA-N Ethylenediamine Chemical compound NCCN PIICEJLVQHRZGT-UHFFFAOYSA-N 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 206010051841 Exposure to allergen Diseases 0.000 description 1
- 241000282324 Felis Species 0.000 description 1
- DSLZVSRJTYRBFB-UHFFFAOYSA-N Galactaric acid Natural products OC(=O)C(O)C(O)C(O)C(O)C(O)=O DSLZVSRJTYRBFB-UHFFFAOYSA-N 0.000 description 1
- IAJILQKETJEXLJ-UHFFFAOYSA-N Galacturonsaeure Natural products O=CC(O)C(O)C(O)C(O)C(O)=O IAJILQKETJEXLJ-UHFFFAOYSA-N 0.000 description 1
- 206010017711 Gangrene Diseases 0.000 description 1
- 208000012671 Gastrointestinal haemorrhages Diseases 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 244000068988 Glycine max Species 0.000 description 1
- 235000010469 Glycine max Nutrition 0.000 description 1
- 206010018910 Haemolysis Diseases 0.000 description 1
- 206010019280 Heart failures Diseases 0.000 description 1
- 108091027305 Heteroduplex Proteins 0.000 description 1
- 101000897035 Homo sapiens Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 Proteins 0.000 description 1
- 101000897063 Homo sapiens Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 Proteins 0.000 description 1
- 206010049933 Hypophosphatasia Diseases 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 208000001718 Immediate Hypersensitivity Diseases 0.000 description 1
- 208000026350 Inborn Genetic disease Diseases 0.000 description 1
- 206010061216 Infarction Diseases 0.000 description 1
- 206010022562 Intermittent claudication Diseases 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- 235000019759 Maize starch Nutrition 0.000 description 1
- 108091027974 Mature messenger RNA Proteins 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- GXCLVBGFBYZDAG-UHFFFAOYSA-N N-[2-(1H-indol-3-yl)ethyl]-N-methylprop-2-en-1-amine Chemical compound CN(CCC1=CNC2=C1C=CC=C2)CC=C GXCLVBGFBYZDAG-UHFFFAOYSA-N 0.000 description 1
- 208000020241 Neonatal disease Diseases 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 208000037129 Newborn Diseases Infant Diseases 0.000 description 1
- 108020004485 Nonsense Codon Proteins 0.000 description 1
- 108091005461 Nucleic proteins Proteins 0.000 description 1
- QCICUPZZLIQAPA-XPWFQUROSA-N P(1),P(3)-bis(5'-adenosyl) triphosphate Chemical compound C1=NC2=C(N)N=CN=C2N1[C@@H]([C@H](O)[C@@H]1O)O[C@@H]1COP(O)(=O)OP(O)(=O)OP(O)(=O)OC[C@H]([C@@H](O)[C@H]1O)O[C@H]1N1C(N=CN=C2N)=C2N=C1 QCICUPZZLIQAPA-XPWFQUROSA-N 0.000 description 1
- 208000002193 Pain Diseases 0.000 description 1
- 206010033733 Papule Diseases 0.000 description 1
- 102000003982 Parathyroid hormone Human genes 0.000 description 1
- 108090000445 Parathyroid hormone Proteins 0.000 description 1
- 208000037273 Pathologic Processes Diseases 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-L Phosphate ion(2-) Chemical compound OP([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-L 0.000 description 1
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- CZPWVGJYEJSRLH-UHFFFAOYSA-N Pyrimidine Chemical compound C1=CN=CN=C1 CZPWVGJYEJSRLH-UHFFFAOYSA-N 0.000 description 1
- 239000012614 Q-Sepharose Substances 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 201000003099 Renovascular Hypertension Diseases 0.000 description 1
- 206010038687 Respiratory distress Diseases 0.000 description 1
- 206010038748 Restrictive cardiomyopathy Diseases 0.000 description 1
- 208000037111 Retinal Hemorrhage Diseases 0.000 description 1
- 241000219061 Rheum Species 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- 235000019485 Safflower oil Nutrition 0.000 description 1
- YGSDEFSMJLZEOE-UHFFFAOYSA-N Salicylic acid Natural products OC(=O)C1=CC=CC=C1O YGSDEFSMJLZEOE-UHFFFAOYSA-N 0.000 description 1
- 229920005654 Sephadex Polymers 0.000 description 1
- 239000012507 Sephadex™ Substances 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 208000031709 Skin Manifestations Diseases 0.000 description 1
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 1
- 239000004141 Sodium laurylsulphate Substances 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- 239000012505 Superdex™ Substances 0.000 description 1
- 108700005078 Synthetic Genes Proteins 0.000 description 1
- 241000906446 Theraps Species 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 208000007536 Thrombosis Diseases 0.000 description 1
- 206010068872 Toe walking Diseases 0.000 description 1
- 101710120037 Toxin CcdB Proteins 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 206010045240 Type I hypersensitivity Diseases 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 206010047115 Vasculitis Diseases 0.000 description 1
- WERKSKAQRVDLDW-ANOHMWSOSA-N [(2s,3r,4r,5r)-2,3,4,5,6-pentahydroxyhexyl] (z)-octadec-9-enoate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO WERKSKAQRVDLDW-ANOHMWSOSA-N 0.000 description 1
- 230000005856 abnormality Effects 0.000 description 1
- 239000002250 absorbent Substances 0.000 description 1
- 230000002745 absorbent Effects 0.000 description 1
- 239000003070 absorption delaying agent Substances 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000008186 active pharmaceutical agent Substances 0.000 description 1
- 230000001464 adherent effect Effects 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 230000004520 agglutination Effects 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- IAJILQKETJEXLJ-RSJOWCBRSA-N aldehydo-D-galacturonic acid Chemical compound O=C[C@H](O)[C@@H](O)[C@@H](O)[C@H](O)C(O)=O IAJILQKETJEXLJ-RSJOWCBRSA-N 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- 229910052783 alkali metal Inorganic materials 0.000 description 1
- 150000001340 alkali metals Chemical class 0.000 description 1
- 229910052784 alkaline earth metal Inorganic materials 0.000 description 1
- 150000001342 alkaline earth metals Chemical class 0.000 description 1
- 229940087168 alpha tocopherol Drugs 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- 235000012211 aluminium silicate Nutrition 0.000 description 1
- 230000001668 ameliorated effect Effects 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 239000003708 ampul Substances 0.000 description 1
- 238000002266 amputation Methods 0.000 description 1
- 238000005349 anion exchange Methods 0.000 description 1
- 238000005571 anion exchange chromatography Methods 0.000 description 1
- 239000000730 antalgic agent Substances 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 125000000637 arginyl group Chemical class N[C@@H](CCCNC(N)=N)C(=O)* 0.000 description 1
- 230000003143 atherosclerotic effect Effects 0.000 description 1
- 208000010216 atopic IgE responsiveness Diseases 0.000 description 1
- 208000016448 atrial septal aneurysm Diseases 0.000 description 1
- 208000037691 autosomal recessive 1 hypophosphatemic rickets Diseases 0.000 description 1
- 201000003672 autosomal recessive hypophosphatemic rickets Diseases 0.000 description 1
- 239000012752 auxiliary agent Substances 0.000 description 1
- 210000001099 axilla Anatomy 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 239000007982 barbital buffer Substances 0.000 description 1
- 210000003651 basophil Anatomy 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- 235000013871 bee wax Nutrition 0.000 description 1
- 239000012166 beeswax Substances 0.000 description 1
- JUHORIMYRDESRB-UHFFFAOYSA-N benzathine Chemical compound C=1C=CC=CC=1CNCCNCC1=CC=CC=C1 JUHORIMYRDESRB-UHFFFAOYSA-N 0.000 description 1
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid group Chemical group C(C1=CC=CC=C1)(=O)O WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 1
- 235000019445 benzyl alcohol Nutrition 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 229920002988 biodegradable polymer Polymers 0.000 description 1
- 239000004621 biodegradable polymer Substances 0.000 description 1
- 239000006177 biological buffer Substances 0.000 description 1
- 230000031018 biological processes and functions Effects 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 230000010072 bone remodeling Effects 0.000 description 1
- 229940098773 bovine serum albumin Drugs 0.000 description 1
- 210000001775 bruch membrane Anatomy 0.000 description 1
- 239000006172 buffering agent Substances 0.000 description 1
- 235000019282 butylated hydroxyanisole Nutrition 0.000 description 1
- 239000007978 cacodylate buffer Substances 0.000 description 1
- 235000010216 calcium carbonate Nutrition 0.000 description 1
- FUFJGUQYACFECW-UHFFFAOYSA-L calcium hydrogenphosphate Chemical compound [Ca+2].OP([O-])([O-])=O FUFJGUQYACFECW-UHFFFAOYSA-L 0.000 description 1
- 159000000007 calcium salts Chemical class 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 239000003054 catalyst Substances 0.000 description 1
- 238000005341 cation exchange Methods 0.000 description 1
- 238000005277 cation exchange chromatography Methods 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 229920002301 cellulose acetate Polymers 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 229960000541 cetyl alcohol Drugs 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 239000003638 chemical reducing agent Substances 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- VDANGULDQQJODZ-UHFFFAOYSA-N chloroprocaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1Cl VDANGULDQQJODZ-UHFFFAOYSA-N 0.000 description 1
- 229960002023 chloroprocaine Drugs 0.000 description 1
- 229960001231 choline Drugs 0.000 description 1
- OEYIOHPDSNJKLS-UHFFFAOYSA-N choline Chemical compound C[N+](C)(C)CCO OEYIOHPDSNJKLS-UHFFFAOYSA-N 0.000 description 1
- 238000011097 chromatography purification Methods 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 229940110456 cocoa butter Drugs 0.000 description 1
- 235000019868 cocoa butter Nutrition 0.000 description 1
- 238000004040 coloring Methods 0.000 description 1
- 239000003184 complementary RNA Substances 0.000 description 1
- 238000013329 compounding Methods 0.000 description 1
- 239000007891 compressed tablet Substances 0.000 description 1
- 210000002808 connective tissue Anatomy 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 229910052802 copper Inorganic materials 0.000 description 1
- 239000010949 copper Substances 0.000 description 1
- 235000005687 corn oil Nutrition 0.000 description 1
- 239000002285 corn oil Substances 0.000 description 1
- 235000012343 cottonseed oil Nutrition 0.000 description 1
- 239000002385 cottonseed oil Substances 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 239000013058 crude material Substances 0.000 description 1
- WZHCOOQXZCIUNC-UHFFFAOYSA-N cyclandelate Chemical compound C1C(C)(C)CC(C)CC1OC(=O)C(O)C1=CC=CC=C1 WZHCOOQXZCIUNC-UHFFFAOYSA-N 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 229940104302 cytosine Drugs 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 230000007123 defense Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- 239000003405 delayed action preparation Substances 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 230000008021 deposition Effects 0.000 description 1
- 210000004207 dermis Anatomy 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 230000001627 detrimental effect Effects 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 239000000032 diagnostic agent Substances 0.000 description 1
- 229940039227 diagnostic agent Drugs 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 235000019700 dicalcium phosphate Nutrition 0.000 description 1
- ZBCBWPMODOFKDW-UHFFFAOYSA-N diethanolamine Chemical compound OCCNCCO ZBCBWPMODOFKDW-UHFFFAOYSA-N 0.000 description 1
- 229940043237 diethanolamine Drugs 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-M dihydrogenphosphate Chemical compound OP(O)([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-M 0.000 description 1
- 239000002612 dispersion medium Substances 0.000 description 1
- 239000008298 dragée Substances 0.000 description 1
- 239000006196 drop Substances 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 229940088679 drug related substance Drugs 0.000 description 1
- 238000002651 drug therapy Methods 0.000 description 1
- 238000001035 drying Methods 0.000 description 1
- 230000002500 effect on skin Effects 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 210000001174 endocardium Anatomy 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 238000007824 enzymatic assay Methods 0.000 description 1
- 238000001976 enzyme digestion Methods 0.000 description 1
- 210000003743 erythrocyte Anatomy 0.000 description 1
- 235000019325 ethyl cellulose Nutrition 0.000 description 1
- 229920001249 ethyl cellulose Polymers 0.000 description 1
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- 229940012017 ethylenediamine Drugs 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 210000003414 extremity Anatomy 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 210000003754 fetus Anatomy 0.000 description 1
- 239000007888 film coating Substances 0.000 description 1
- 238000009501 film coating Methods 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 235000012041 food component Nutrition 0.000 description 1
- DSLZVSRJTYRBFB-DUHBMQHGSA-N galactaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)[C@@H](O)[C@H](O)C(O)=O DSLZVSRJTYRBFB-DUHBMQHGSA-N 0.000 description 1
- 208000030304 gastrointestinal bleeding Diseases 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- 239000007903 gelatin capsule Substances 0.000 description 1
- 208000016361 genetic disease Diseases 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- 229940074045 glyceryl distearate Drugs 0.000 description 1
- 229940075507 glyceryl monostearate Drugs 0.000 description 1
- 239000007973 glycine-HCl buffer Substances 0.000 description 1
- 150000002334 glycols Chemical class 0.000 description 1
- 210000004013 groin Anatomy 0.000 description 1
- 238000001631 haemodialysis Methods 0.000 description 1
- 210000003709 heart valve Anatomy 0.000 description 1
- 230000000322 hemodialysis Effects 0.000 description 1
- 230000008588 hemolysis Effects 0.000 description 1
- 125000000623 heterocyclic group Chemical group 0.000 description 1
- FBPFZTCFMRRESA-UHFFFAOYSA-N hexane-1,2,3,4,5,6-hexol Chemical compound OCC(O)C(O)C(O)C(O)CO FBPFZTCFMRRESA-UHFFFAOYSA-N 0.000 description 1
- 238000000703 high-speed centrifugation Methods 0.000 description 1
- 210000003630 histaminocyte Anatomy 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 235000020256 human milk Nutrition 0.000 description 1
- 210000004251 human milk Anatomy 0.000 description 1
- 238000009396 hybridization Methods 0.000 description 1
- 150000004677 hydrates Chemical class 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-M hydrogensulfate Chemical compound OS([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-M 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- 229910052588 hydroxylapatite Inorganic materials 0.000 description 1
- 201000005991 hyperphosphatemia Diseases 0.000 description 1
- ZCTXEAQXZGPWFG-UHFFFAOYSA-N imidurea Chemical compound O=C1NC(=O)N(CO)C1NC(=O)NCNC(=O)NC1C(=O)NC(=O)N1CO ZCTXEAQXZGPWFG-UHFFFAOYSA-N 0.000 description 1
- 229940113174 imidurea Drugs 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 239000000411 inducer Substances 0.000 description 1
- 230000007574 infarction Effects 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 230000000266 injurious effect Effects 0.000 description 1
- 208000021156 intermittent vascular claudication Diseases 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 230000032631 intramembranous ossification Effects 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000005342 ion exchange Methods 0.000 description 1
- 239000003456 ion exchange resin Substances 0.000 description 1
- 229920003303 ion-exchange polymer Polymers 0.000 description 1
- 208000028867 ischemia Diseases 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- NLYAJNPCOHFWQQ-UHFFFAOYSA-N kaolin Chemical compound O.O.O=[Al]O[Si](=O)O[Si](=O)O[Al]=O NLYAJNPCOHFWQQ-UHFFFAOYSA-N 0.000 description 1
- 238000011813 knockout mouse model Methods 0.000 description 1
- 238000009533 lab test Methods 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 210000003041 ligament Anatomy 0.000 description 1
- 239000012669 liquid formulation Substances 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 244000144972 livestock Species 0.000 description 1
- 239000006210 lotion Substances 0.000 description 1
- 239000007937 lozenge Substances 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 208000002780 macular degeneration Diseases 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- VTHJTEIRLNZDEV-UHFFFAOYSA-L magnesium dihydroxide Chemical compound [OH-].[OH-].[Mg+2] VTHJTEIRLNZDEV-UHFFFAOYSA-L 0.000 description 1
- 239000000347 magnesium hydroxide Substances 0.000 description 1
- 229910001862 magnesium hydroxide Inorganic materials 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 229960003194 meglumine Drugs 0.000 description 1
- 208000030159 metabolic disease Diseases 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 229910021645 metal ion Inorganic materials 0.000 description 1
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 1
- 238000010603 microCT Methods 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 239000007932 molded tablet Substances 0.000 description 1
- 230000009456 molecular mechanism Effects 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 239000002324 mouth wash Substances 0.000 description 1
- 210000003097 mucus Anatomy 0.000 description 1
- 208000010125 myocardial infarction Diseases 0.000 description 1
- 125000004123 n-propyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 238000013059 nephrectomy Methods 0.000 description 1
- 229910052759 nickel Inorganic materials 0.000 description 1
- 239000012299 nitrogen atmosphere Substances 0.000 description 1
- 239000002687 nonaqueous vehicle Substances 0.000 description 1
- 230000037434 nonsense mutation Effects 0.000 description 1
- 239000000346 nonvolatile oil Substances 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 239000007764 o/w emulsion Substances 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- OIPZNTLJVJGRCI-UHFFFAOYSA-M octadecanoyloxyaluminum;dihydrate Chemical compound O.O.CCCCCCCCCCCCCCCCCC(=O)O[Al] OIPZNTLJVJGRCI-UHFFFAOYSA-M 0.000 description 1
- 239000006186 oral dosage form Substances 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 210000000963 osteoblast Anatomy 0.000 description 1
- 208000005368 osteomalacia Diseases 0.000 description 1
- 239000007800 oxidant agent Substances 0.000 description 1
- RWOAVOYBVRQNIZ-BFHYXJOUSA-N p-nitrophenyl thymidine 5'-monophosphate Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](COP(O)(=O)OC=2C=CC(=CC=2)[N+]([O-])=O)[C@@H](O)C1 RWOAVOYBVRQNIZ-BFHYXJOUSA-N 0.000 description 1
- FJKROLUGYXJWQN-UHFFFAOYSA-N papa-hydroxy-benzoic acid Natural products OC(=O)C1=CC=C(O)C=C1 FJKROLUGYXJWQN-UHFFFAOYSA-N 0.000 description 1
- 239000012188 paraffin wax Substances 0.000 description 1
- 239000000199 parathyroid hormone Substances 0.000 description 1
- 229960001319 parathyroid hormone Drugs 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 239000011236 particulate material Substances 0.000 description 1
- 230000009054 pathological process Effects 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- XYJRXVWERLGGKC-UHFFFAOYSA-D pentacalcium;hydroxide;triphosphate Chemical compound [OH-].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O XYJRXVWERLGGKC-UHFFFAOYSA-D 0.000 description 1
- 229940127557 pharmaceutical product Drugs 0.000 description 1
- 230000002974 pharmacogenomic effect Effects 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 229960003742 phenol Drugs 0.000 description 1
- WVDDGKGOMKODPV-ZQBYOMGUSA-N phenyl(114C)methanol Chemical compound O[14CH2]C1=CC=CC=C1 WVDDGKGOMKODPV-ZQBYOMGUSA-N 0.000 description 1
- WLJVXDMOQOGPHL-UHFFFAOYSA-N phenylacetic acid Chemical compound OC(=O)CC1=CC=CC=C1 WLJVXDMOQOGPHL-UHFFFAOYSA-N 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 235000011007 phosphoric acid Nutrition 0.000 description 1
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 1
- 150000003016 phosphoric acids Chemical class 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 210000001698 popliteal fossa Anatomy 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 239000012254 powdered material Substances 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- MFDFERRIHVXMIY-UHFFFAOYSA-N procaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1 MFDFERRIHVXMIY-UHFFFAOYSA-N 0.000 description 1
- 229960004919 procaine Drugs 0.000 description 1
- 238000004393 prognosis Methods 0.000 description 1
- KNVAYBMMCPLDOZ-UHFFFAOYSA-N propan-2-yl 12-hydroxyoctadecanoate Chemical compound CCCCCCC(O)CCCCCCCCCCC(=O)OC(C)C KNVAYBMMCPLDOZ-UHFFFAOYSA-N 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 235000010232 propyl p-hydroxybenzoate Nutrition 0.000 description 1
- 235000013772 propylene glycol Nutrition 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 210000001525 retina Anatomy 0.000 description 1
- 108091092562 ribozyme Proteins 0.000 description 1
- 238000011808 rodent model Methods 0.000 description 1
- CVHZOJJKTDOEJC-UHFFFAOYSA-N saccharin Chemical compound C1=CC=C2C(=O)NS(=O)(=O)C2=C1 CVHZOJJKTDOEJC-UHFFFAOYSA-N 0.000 description 1
- 229940081974 saccharin Drugs 0.000 description 1
- 235000019204 saccharin Nutrition 0.000 description 1
- 239000000901 saccharin and its Na,K and Ca salt Substances 0.000 description 1
- 235000005713 safflower oil Nutrition 0.000 description 1
- 239000003813 safflower oil Substances 0.000 description 1
- 210000003296 saliva Anatomy 0.000 description 1
- 239000012266 salt solution Substances 0.000 description 1
- 239000000523 sample Substances 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 238000007493 shaping process Methods 0.000 description 1
- 208000007056 sickle cell anemia Diseases 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- 238000001542 size-exclusion chromatography Methods 0.000 description 1
- 238000007390 skin biopsy Methods 0.000 description 1
- 206010040882 skin lesion Diseases 0.000 description 1
- 231100000444 skin lesion Toxicity 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 235000010413 sodium alginate Nutrition 0.000 description 1
- 239000000661 sodium alginate Substances 0.000 description 1
- 229940005550 sodium alginate Drugs 0.000 description 1
- 229910000029 sodium carbonate Inorganic materials 0.000 description 1
- 235000019333 sodium laurylsulphate Nutrition 0.000 description 1
- 239000001488 sodium phosphate Substances 0.000 description 1
- 229910000162 sodium phosphate Inorganic materials 0.000 description 1
- 235000011008 sodium phosphates Nutrition 0.000 description 1
- 229940080313 sodium starch Drugs 0.000 description 1
- RGHFKWPGWBFQLN-UHFFFAOYSA-M sodium;5,5-diethylpyrimidin-3-ide-2,4,6-trione Chemical compound [Na+].CCC1(CC)C([O-])=NC(=O)NC1=O RGHFKWPGWBFQLN-UHFFFAOYSA-M 0.000 description 1
- 239000007901 soft capsule Substances 0.000 description 1
- 239000007962 solid dispersion Substances 0.000 description 1
- 239000006104 solid solution Substances 0.000 description 1
- 235000011069 sorbitan monooleate Nutrition 0.000 description 1
- 239000001593 sorbitan monooleate Substances 0.000 description 1
- 229940035049 sorbitan monooleate Drugs 0.000 description 1
- 239000003549 soybean oil Substances 0.000 description 1
- 235000012424 soybean oil Nutrition 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 230000037436 splice-site mutation Effects 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 238000003153 stable transfection Methods 0.000 description 1
- 229940032147 starch Drugs 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 239000008117 stearic acid Substances 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 150000005846 sugar alcohols Polymers 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 210000001138 tear Anatomy 0.000 description 1
- 238000005496 tempering Methods 0.000 description 1
- 230000002123 temporal effect Effects 0.000 description 1
- 210000002435 tendon Anatomy 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 230000008719 thickening Effects 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- 229940113082 thymine Drugs 0.000 description 1
- 230000009772 tissue formation Effects 0.000 description 1
- 229960000984 tocofersolan Drugs 0.000 description 1
- AOBORMOPSGHCAX-DGHZZKTQSA-N tocofersolan Chemical compound OCCOC(=O)CCC(=O)OC1=C(C)C(C)=C2O[C@](CCC[C@H](C)CCC[C@H](C)CCCC(C)C)(C)CCC2=C1C AOBORMOPSGHCAX-DGHZZKTQSA-N 0.000 description 1
- 239000000606 toothpaste Substances 0.000 description 1
- 229940034610 toothpaste Drugs 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 235000010487 tragacanth Nutrition 0.000 description 1
- 239000000196 tragacanth Substances 0.000 description 1
- 229940116362 tragacanth Drugs 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- 229910052723 transition metal Inorganic materials 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 1
- 230000007306 turnover Effects 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 238000000108 ultra-filtration Methods 0.000 description 1
- 238000005199 ultracentrifugation Methods 0.000 description 1
- 229940035893 uracil Drugs 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 108700026220 vif Genes Proteins 0.000 description 1
- 239000007762 w/o emulsion Substances 0.000 description 1
- 235000012431 wafers Nutrition 0.000 description 1
- 150000003751 zinc Chemical class 0.000 description 1
- 239000002076 α-tocopherol Substances 0.000 description 1
- 235000004835 α-tocopherol Nutrition 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/38—Albumins
- A61K38/385—Serum albumin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/46—Hydrolases (3)
- A61K38/465—Hydrolases (3) acting on ester bonds (3.1), e.g. lipases, ribonucleases
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/76—Albumins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y301/00—Hydrolases acting on ester bonds (3.1)
- C12Y301/03—Phosphoric monoester hydrolases (3.1.3)
- C12Y301/03036—Phosphoinositide 5-phosphatase (3.1.3.36)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y301/00—Hydrolases acting on ester bonds (3.1)
- C12Y301/04—Phosphoric diester hydrolases (3.1.4)
- C12Y301/04001—Phosphodiesterase I (3.1.4.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y301/00—Hydrolases acting on ester bonds (3.1)
- C12Y301/04—Phosphoric diester hydrolases (3.1.4)
- C12Y301/04012—Sphingomyelin phosphodiesterase (3.1.4.12)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y306/00—Hydrolases acting on acid anhydrides (3.6)
- C12Y306/01—Hydrolases acting on acid anhydrides (3.6) in phosphorus-containing anhydrides (3.6.1)
- C12Y306/01009—Nucleotide diphosphatase (3.6.1.9), i.e. nucleotide-pyrophosphatase
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/31—Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin
Definitions
- Calcification is the accumulation of calcium salts in a body tissue. It normally occurs during formation of bone, but calcium can also be deposited abnormally in soft tissues such as arteries, cartilage and heart valves. Vascular calcification frequently develops in patients with atherosclerosis, stroke, valvular disease and varicosis. Advanced age and metabolic disorders, including diabetes mellitus are contributing factors.
- Ossification refers to the process of bone tissue formation or bone remodeling orchestrated by the osteoblasts. Ossification allows bones to form while a fetus is still in the womb, and also converts various types of connective tissue into bone.
- the two main processes of ossification are intra-membranous ossification and intra-cartilaginous ossification, which differ based on the area of the body in which the cartilage is located.
- GCI general arterial calcification of infancy
- IIAC idiopathic infantile arterial calcification
- PXE pseudoxanthoma elasticum
- OPLL ossification of posterior longitudinal ligament
- MWVC medial wall vascular calcification
- ARHR2 autosomal recessive hypophosphatemia rickets type-2
- ESRD end state renal disease
- CKD-MBD chronic kidney disease-bone/mineral disorder
- X-linked hypophosphatemia XLH
- age related osteopenia calcific uremic arteriolopathy (CUA) and hypophosphatemic rickets.
- CUA hypophosphatemic rickets.
- GACI is an ultra-rare neonatal disease characterized by infantile onset of widespread arterial calcifications in large and medium sized vessels, resulting in cardiovascular collapse and death in the neonatal period.
- the disease presents clinically with heart failure, respiratory distress, hypertension, cyanosis, and cardiomegaly.
- the prognosis is grave, with older reports of a mortality rate of 85% at six months, while recently intensive treatment with bisphosphonates (such as etridonate) has lowered mortality to 55% at six months. Tempering this apparent progress is the severe skeletal toxicity associated with prolonged use of etridonate in patients with GACI, and the ineffectiveness of bisphosphonates to prevent mortality in some patients even when instituted early. Further, the limited available data makes it difficult to determine if bisphosphonate treatment is truly protective or reflects the natural history of the disease in less effected patients. Interestingly, serum PPi levels appear to be significantly depleted in GACI patients.
- Kidneys are integral to maintenance of normal bone and mineral metabolism, including excretion of phosphate.
- CKD chronic kidney disease
- NEFK/DOQI National Kidney Foundation Kidney Disease Outcomes Quality Initiative
- ESRD ESRD
- end stage kidney disease developed in over 90,000 people in the U.S.
- the population of patients on dialysis therapy or needing transplantation was 380,000 in 2003, and became 651,000 patients in 2010.
- Care for patients with ESRD already consumes more than $18 billion per year in the U.S., a substantial burden for the health care system.
- kidney failure are unable to appropriately regulate serum mineral balance and tend to retain phosphate that is absorbed from the various dietary components.
- a high serum level of phosphate is associated with excessive secretion of parathyroid hormone and a tendency to calcification of the soft tissues, including blood vessels.
- CUA is a fatal disease seen in patients with CKD on dialysis. Calcification of small arteries leads to tissue/skin ischemia, infarction and thrombosis, with patient mortality close to 80%.
- CUA has hallmarks resembling GACI and other disorders of calcification, exhibiting low levels of PPi and high levels of fibroblast growth factor 23 (FGF23). In ESRD patients requiring dialysis, this calcification process is further accelerated, with an average life-expectancy of 5-6 years.
- PXE is a heritable disorder characterized by mineralization of elastic fibers in skin, arteries and the retina, which results in dermal lesions with associated laxity and loss of elasticity, arterial insufficiency, cardiovascular disease and retinal hemorrhages leading to macular degeneration. Mutations associated with PXE are also located in the abcc6 gene. Characteristic skin lesions (yellowish papules and plaques and laxity with loss of elasticity, typically seen on the face, neck, axilla, antecubital fossa, popliteal fossa, groin and periumbilical areas) are generally an early sign of PXE and result from an accumulation of abnormal mineralized elastic fibers in the mid-dermis.
- a PXE diagnosis can be confirmed by a skin biopsy that shows calcification of fragmented elastic fibers in the mid- and lower dermis.
- the skin manifestations are among the most common characteristics of PXE, but the ocular and cardiovascular symptoms are responsible for the morbidity of the disease.
- hypophosphatemia which often results from renal phosphate wasting, is caused by a number of genetic disorders including X-linked hypophosphatemic rickets (XLH), hereditary hypophosphatemic rickets with hypercakiuria (HHRH), hypophosphatemic bone disease (HBD), and autosomal dominant hypophosphatemic rickets (ADHR).
- XLH X-linked hypophosphatemic rickets
- HHRH hereditary hypophosphatemic rickets with hypercakiuria
- HHD hypophosphatemic bone disease
- ADHR autosomal dominant hypophosphatemic rickets
- compositions and methods for treating diseases and disorders associated with pathological calcification and/or pathological ossification should not undesirably disturb other physiologic processes.
- Such compositions and methods should reduce the level of calcification and increasing PPi plasma levels in individuals who exhibit lower than normal plasma PPi levels.
- the present invention fulfills this need.
- FIGS. 1A-1C comprise graphs illustrating studies of human ENPP3 steady state ATP hydrolysis activity.
- FIG. 1A illustrates time courses of AMP product formation after addition of 50 nM hNPP3 with (from bottom to top) 0.98, 1.95, 3.9, 7.8, 15.6, 31.3, 62.5, 125, 250 and 500 ⁇ M ATP.
- the enzyme reaction was quenched by equal volume of 3 M formic acid at different times, and the reaction product AMP was quantified by HPLC analysis with an AMP standard curve. The smooth line though data points are best fits to a non-linear enzyme kinetic model with product inhibition and substrate depletion.
- FIG. 1B illustrates steady state ATPase cycling rate comparison.
- ENPP3 substrate concentration dependence of initial steady state enzyme cycling rate was compared with the previously measured values for human ENPP1.
- ATPase cycling reaction of both 50 nM hNPP3 and hNPP1 totally depleted ATP substrate in 1 minute for 0.98, 1.95 and 3.9 ⁇ M ATP, and thus these three rates were omitted from the plot because their rates could not be accurately determined.
- the hNPP3 steady state ATPase reaction reached the maximum (k cat ) of 2.59( ⁇ 0.04) s ⁇ 1 enzyme ⁇ 1 , from the weighted average of the measured rates with 7.8, 15.6, 31.3, 62.5, 125 ⁇ M substrate concentration, seeming slower than that for hNPP1 3.46( ⁇ 0.44) s ⁇ 1 enzyme ⁇ 1 .
- the K M can be estimated ⁇ 8 ⁇ M.
- substrate [ATP]>125 ⁇ M hNPP3 ATPase cycling rate gradually decreased.
- FIG. 1C illustrates substrate concentration dependent ⁇ .
- FIG. 2 illustrates a non-limiting purification profile of NPP3 fusion protein through a Coomasie stained sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) gel, wherein the purified. NPP3 protein is shown in relation to certain size markers.
- FIG. 3 illustrates a non-limiting plasmid construct map of human NPP121-NPP3-Fc in the plasmid, cloned using the indicated restriction endonuclease sites.
- FIG. 4 illustrates a non-limiting plasmid construct map of human NPP121-NPP3-Fc in the plasmid pcDNA3, cloned using IN-FUSION® technology.
- FIG. 5 illustrates a non-limiting plasmid construct map of human NPP121-NPP3-Albumin in the plasmid pcDNA3.
- the invention provides an isolated polypeptide, or a pharmaceutical salt or solvate thereof.
- the invention further provides a method of treating or preventing a disease or disorder associated with pathological calcification or pathological ossification in a subject in need thereof.
- the invention further provides a method of reducing or preventing vascular calcification in a subject with low plasma pyrophosphate (PPi) or high serum phosphate (Pi).
- PPi low plasma pyrophosphate
- Pi high serum phosphate
- the invention further provides a method of treating of a subject having NPP I deficiency or NPP1-associated disease.
- the invention further provides a kit comprising at least one isolated polypeptide of the invention and instructions reciting the use of the at least one polypeptide for treating a disease or disorder associated with pathological calcification or pathological ossification in a subject in need thereof, optionally further comprising an applicator.
- the polypeptide of the invention has formula (I): EXPORT-PROTEIN-Z-DOMAIN-X-Y (I), wherein in (I): EXPORT is absent, or a signal export sequence or a biologically active fragment thereof; PROTEIN is the extracellular domain of ENPP3 (SEQ ID NO:1) or a biologically active fragment thereof; DOMAIN is selected from the group consisting of a human IgG Fc domain and human albumin domain; X and Z are independently absent or a polypeptide comprising 1-20 amino acids; and, Y is absent or a sequence selected from the group consisting of: (DSS) n (SEQ ID NO:6), (ESS) n (SEQ ID NO:7), (RQQ) n (SEQ ID NO:8), (KR) n (SEQ ID NO:9), R n (SEQ ID NO:10), (KR) n (SEQ ID NO:11), DSSSEEKFLRRIGRFG (SEQ ID NO:12),
- the nuclease domain of the PROTEIN or mutant thereof is absent.
- EXPORT is absent or selected from the group consisting of SEQ ID NOs:2-5.
- X is selected from the group consisting of: absent, a polypeptide consisting of 20 amino acids, a polypeptide consisting of 19 amino acids, a polypeptide consisting of 18 amino acids, a polypeptide consisting of 17 amino acids, a polypeptide consisting of 16 amino acids, a polypeptide consisting of 15 amino acids, a polypeptide consisting of 14 amino acids, a polypeptide consisting of 13 amino acids, a polypeptide consisting of 12 amino acids, a polypeptide consisting of 11 amino acids, a polypeptide consisting of 10 amino acids, a polypeptide consisting of 9 amino acids, a polypeptide consisting of 8 amino acids, a polypeptide consisting of 7 amino acids, a polypeptide consisting of 6 amino acids, a polypeptide consist
- Z is selected from the group consisting of: absent, a polypeptide consisting of 20 amino acids, a polypeptide consisting of 19 amino acids, a polypeptide consisting of 18 amino acids, a polypeptide consisting of 17 amino acids, a polypeptide consisting of 16 amino acids, a polypeptide consisting of 15 amino acids, a polypeptide consisting of 14 amino acids, a polypeptide consisting of 13 amino acids, a polypeptide consisting of 12 amino acids, a polypeptide consisting of 11 amino acids, a polypeptide consisting of 10 amino acids, a polypeptide consisting of 9 amino acids, a polypeptide consisting of 8 amino acids, a polypeptide consisting of 7 amino acids, a polypeptide consisting of 6 amino acids, a polypeptide consisting of 5 amino acids, a polypeptide consisting of 4 amino acids, a polypeptide consisting of 3 amino acids, a polypeptide consisting of 2 amino acids, and a polypeptide consisting of
- DOMAIN is a human IgG Fe domain selected from the group consisting of IgG1, IgG2, IgG3 and IgG4.
- the polypeptide is selected from the group consisting of SEQ NOs:19, 21 and 22.
- DOMAIN is a human albumin domain.
- the polypeptide is selected from the group consisting of SEQ ID NOs:24, 25 and 26.
- the polypeptide comprises a soluble region of NPP3 and lacks a transmembrane domain and a signal peptide, or a fusion protein thereof, wherein the polypeptide reduces cellular calcification when administered to a subject suffering from diseases of calcification and ossification.
- the polypeptide comprises a soluble region of NPP3 and lacks a transmembrane domain and a signal peptide, wherein the polypeptide reduces cellular calcification when administered to a subject suffering from diseases of calcification and ossification.
- the polypeptide comprises the extracellular domain of ENPP3 (SEQ ID NO:1) or a biologically active fragment thereof. In other embodiments, the polypeptide consists essentially of SEQ ID NO:1 or a biologically active fragment thereof. In yet other embodiments, the polypeptide consists of SEQ ID NO: 1 or a biologically active fragment thereof.
- the soluble ENPP3 fragment or fusion protein thereof comprises the extracellular domain of ENPP3 (SEQ IL) NO:1) or a biologically active fragment thereof.
- the soluble ENPP3 fragment consists essentially of SEQ ID NO:1 or a biologically active fragment thereof
- the soluble ENPP3 fragment consists of SEQ ID NO:1 or a biologically active fragment thereof.
- the soluble ENPP3 fragment or fusion protein thereof lacks a transmembrane domain and a signal peptide.
- the method comprises administering to the subject a therapeutically effective amount of at least one polypeptide the invention, or a pharmaceutical salt or solvate thereof. In other embodiments, the method comprises administering to the subject a therapeutically effective amount of an isolated recombinant human soluble ENPP3 fragment or fusion protein thereof.
- the disease or disorder comprises at least one selected from the group consisting of GACI, IIAC, PXE, OPLL, hypophosphatemic rickets, osteoarthritis, calcification of atherosclerotic plaques, hereditary and non-hereditary forms of osteoarthritis, ankylosing spondylitis, hardening of the arteries occurring with aging, and calciphylaxis resulting from end stage renal disease (or mineral bone disorder of chronic kidney disease).
- the disease or disorder comprises at least one selected from a group consisting of GACI, IIAC, PXE, OPLL, MWVC, ARHR2, ESRD, CKD-MBD, XLH, age related osteopenia, CUA and hypophosphatemic rickets.
- the disease or disorder is GACI. In other embodiments, the disease or disorder is IIAC. In yet other embodiments, the disease or disorder is PXE. In vet other embodiments, the disease or disorder is OPLL. In yet other embodiments, the disease or disorder is hypophosphatemic rickets. In yet other embodiments, the disease or disorder is osteoarthritis. In vet other embodiments, the disease or disorder is calcification of atherosclerotic plaques. In yet other embodiments, the disease or disorder is hereditary and non-hereditary forms of osteoarthritis. In yet other embodiments, the disease or disorder is ankylosing spondylitis. In vet other embodiments, the disease or disorder is hardening of the arteries occurring with aging.
- the disease or disorder is calciphylaxis resulting from end stage renal disease (or mineral bone disorder of chronic kidney disease). In yet other embodiments, the disease or disorder is age related osteopenia. In yet other embodiments, the disease or disorder is CUA. In yet other embodiments, the disease or disorder is MWVC. In yet other embodiments, the disease or disorder is ARHR2. In yet other embodiments, the disease or disorder is ESRD.
- the administered amount raises the level of plasma PPi in the subject to at least about 800 nM. In other embodiments, the administered amount raises the level of plasma PPi in the subject to at least about 1 ⁇ M. In yet other embodiments, the administered amount raises the level of plasma PPi in the subject to at least about 1.5 ⁇ M.
- the at least one polypeptide is administered acutely or chronically to the subject. In other embodiments, the at least one polypeptide is administered locally, regionally or systemically to the subject. In yet other embodiments, the subject is a mammal. In yet other embodiments, the mammal is human.
- ENPP3 also known as NPP3
- ENPP3 which is a member of the ectonucleotide pyrophosphatase/phosphodiesterase (ENPP or NPP) family of enzymes
- ENPP3 hydrolyzes ATP to AMP and PPi, as demonstrated herein.
- the present invention provides compositions, such as but not limited to fusion proteins, that elevate plasma PPi in physiologic states where plasma PPi is low (as determined, for example, by a medical professional or by consulting of a medical document or manual), placing the individual at risk of morbidity associated with low PPi states.
- these physiologic states are recognized disease conditions such as GACI, PXE, Hutchinson Gilford Progeria Syndrome, chronic kidney disease (CKD), X-linked hypophosphatemia, sickle cell anemia, and end stage renal disease.
- these physiologic states occur in non-disease states, such as in elderly adults who are afflicted with chronic ailments known to occur in all aging adults such as “hardening of the arteries” and osteopenia.
- low plasma PPi is defined as plasma PPi concentration lower than about 1.5 ⁇ M.
- These disease states may or may not be accompanied by pathologic calcification of the arteries and/or soft tissues, medial vascular wall calcifications, strokes or cerebrovascular accidents, decreased pulse wave velocity, calcifications of the soft tissues such as the skin, calcifications of the Bruchs membrane in the eye, calcifications of soft tissues surrounding tendons also known as entheses, calcifications of ligaments in the spine such as the posterior longitudinal ligament, and disease of ossification such as Rickets.
- the invention contemplates treatment of low PPi physiologic states via administration of the fusion proteins described herein.
- compositions and methods of the invention can be used to treat disease states known to occur in conditions where the expression or the activity of the enzyme ENPP1 is reduced.
- These recognized disease states include, in non-limited manner, osteoarthritis, GACI, and ARHR2.
- These states may also occur in other physiologic states in which ENPP1 protein levels are reduced, such as in individuals who have a common polymporphism in the ENPP1 coding region in which a Q residue is substituted for a K reside at position 121 of the secreted protein (or position 173 of the full length protein) (Eller, et al., 2008, Nephrol. Dial. Transplant. 23(1):321-7; Flanagan, et al., 2013, Blood 121(16):3237-45).
- ENPP3 As demonstrated herein, the products of ATP hydrolysis by ENPP3, and the corresponding enzymatic constants, were analyzed in order to study the enzymatic activity of this enzyme.
- ENPP3 was found to he a potent _ATP hydrolase, capable of generating PPi and AMP from ATP.
- ENPP3 has an ATP hydrolase activity that is comparable to that of ENPP1.
- ENPP3 catalyzes the hydrolysis of ATP to PPi with nearly the same Michaelis-Menton kinetics as ENPP1, which is another member of the ENPP family of enzymes.
- soluble fusion constructs of ENPP3, including albumin fusion constructs thereof and/or IgG Fc domain constructs thereof are efficacious in treating diseases of ectopic calcification.
- the constructs described herein are efficacious in treating and/or preventing disorders of ectopic vascular calcification.
- NPP3 is poorly exported to the cell surface.
- soluble ENPP3 protein is constructed by replacing the signal sequence of NPP3 with the native signal sequence of other ENPPs.
- soluble ENPP3 constructs are prepared by using the signal export signal sequence of other ENPP enzymes, such as but not limited to ENPP7 and/or ENPPS.
- soluble ENPP3 constructs are prepared by using a signal sequence comprised of a combination of the signal sequences of ENPP1 and ENPP2 (“ENPP1-2-1” hereinafter).
- signal sequences of any other known proteins may be used to target the extracellular domain of ENPP3 for secretion as well, such as but not limited to the signal sequence of the immunoglobulin kappa and lambda light chain proteins.
- the invention should not be construed to be limited to the constructs described herein, but also includes constructs comprising any enzymatically active truncation of the ENPP3 extracellular domain.
- Idiopathic Infantile Arterial Calcification IAC
- Ossification of the Posterior Longitudinal Ligament OPLL
- hypophosphatemic rickets Ossification of the Posterior Longitudinal Ligament
- osteoarthritis calcification of atherosclerotic plaques
- PXE Pseudoxanthoma elasticum
- hereditary and non-hereditary forms of osteoarthritis ankylosing spondylitis
- hardening of the arteries occurring with aging and calciphylaxis resulting from end stage renal disease.
- an element means one element or more than one element.
- abnormal when used in the context of organisms, tissues, cells or components thereof, refers to those organisms, tissues, cells or components thereof that differ in at least one observable or detectable characteristic (e.g., age, treatment, time of day, etc.) from those organisms, tissues, cells or components thereof that display the “normal” (expected) respective characteristic. Characteristics which are normal or expected for one cell or tissue type, might be abnormal for a different cell or tissue type.
- “About” as used herein when referring to a measurable value such as an amount, a temporal duration, and the like, is meant to encompass variations of ⁇ 20% or ⁇ 10%, more preferably ⁇ 5%, even more preferably ⁇ 1%, and still more preferably ⁇ 0.1% from the specified value, as such variations are appropriate to perform the disclosed methods.
- AMR autosomal dominant hypophosphatemic rickets
- albumin refers to the blood plasma protein that is produced in the liver and forms a large proportion of all plasma protein.
- albumin refers to human serum albumin. Usage of other albumins such as bovine serum albumin, equine serum album and porcine serum albumin are also contemplated within the invention.
- a disease or disorder is “alleviated” if the severity of a symptom of the disease or disorder, the frequency with which such a symptom is experienced by a patient, or both, is reduced.
- alteration refers to a mutation in a gene in a cell that affects the function, activity, expression (transcription or translation) or conformation of the polypeptide it encodes.
- Mutations encompassed by the present invention can be any mutation of a gene in a cell that results in the enhancement or disruption of the function, activity, expression or conformation of the encoded polypeptide, including the complete absence of expression of the encoded protein and can include, for example, missense and nonsense mutations, insertions, deletions, frameshifts and premature terminations.
- mutations encompassed by the present invention may alter splicing the mRNA (splice site mutation) or cause a shift in the reading frame (frameshift).
- amino acid sequence variant refers to polypeptides having amino acid sequences that differ to some extent from a native sequence polypeptide. Ordinarily, amino acid sequence variants possess at least about 70% homology, at least about 80% homology, at least about 90% homology, or at least about 95% homology to the native polypeptide. The amino acid sequence variants possess substitutions, deletions, and/or insertions at certain positions within the amino acid sequence of the native amino acid sequence.
- Ap3P refers to adenosine-(5′)-triphospho-(5′)-adenosine or a salt thereof.
- ARHR2 refers to autosomal recessive hypophosphatemic rickets type-2.
- kidney disease refers to chronic kidney disease.
- CKD-MBD chronic kidney disease-bone/mineral disorder
- coding sequence means a sequence of a nucleic acid or its complement, or a part thereof that can be transcribed and/or translated to produce the mRNA and/or the polypeptide or a fragment thereof. Coding sequences include exons in a genomic DNA or immature primary RNA transcripts, which are joined together by the cell's biochemical machinery to provide a mature mRNA. The anti-sense strand is the complement of such a nucleic acid, and the coding sequence can be deduced therefrom.
- non-coding sequence means a sequence of a nucleic acid or its complement, or a part thereof, that is not translated into amino acid in vivo, or where tRNA does not interact to place or attempt to place an amino acid.
- Non-coding sequences include both intron sequences in genomic DNA or immature primary RNA transcripts, and gene-associated sequences such as promoters, enhancers, silencers, and the like.
- the terms “complementary” or “complementarity” are used in reference to polynucleotides (i.e., a sequence of nucleotides) related by the base-pairing rules.
- sequence “A-G-T” is complementary to the sequence “T-C-A.”
- Complementarity may be “partial,” in which only some of the nucleic acids' bases are matched according to the base pairing rules. Or, there may be “complete” or “total” complementarity between the nucleic acids.
- the degree of complementarity between nucleic acid strands has significant effects on the efficiency and strength of hybridization between nucleic acid strands. This is of particular importance in amplification reactions, as well as detection methods that depend upon binding between nucleic acids.
- composition refers to a mixture of at least one compound useful within the invention with a pharmaceutically acceptable carrier.
- the pharmaceutical composition facilitates administration of the compound to a patient.
- Multiple techniques of administering a compound exist in the art including, but not limited to, intravenous, oral, aerosol, inhalational, rectal, vaginal, transdermal, intranasal, buccal, sublingual, parenteral, intrathecal, intragastrical, ophthalmic, pulmonary and topical administration.
- conservative variation refers to the replacement of an amino acid residue by another, biologically similar residue. Conservative variations or substitutions are not likely to change the shape of the peptide chain. Examples of conservative variations, or substitutions, include the replacement of one hydrophobic residue such as isoleucine, valine, leucine or methionine for another, or the substitution of one polar residue for another, such as the substitution of arginine for lysine, glutamic for aspartic acid, or glutamine for asparagine.
- CUA refers to calcific uremic arteriolopaihy.
- a “disease” is a state of health of an animal wherein the animal cannot maintain homeostasis, and wherein if the disease is not ameliorated then the animal's health continues to deteriorate.
- a “disorder” in an animal is a state of health in which the animal is able to maintain homeostasis, but in which the animal's state of health is less favorable than it would be in the absence of the disorder. Left untreated, a disorder does not necessarily cause a further decrease in the animal's state of health.
- domain refers to a part of a molecule or structure that shares common physicochemical features, such as, but not limited to, hydrophobic, polar, globular and helical domains or properties.
- binding domains include, but are not limited to, DNA binding domains and ATP binding domains.
- the terms “effective amount,” “pharmaceutically effective amount” and “therapeutically effective amount” refer to a nontoxic but sufficient amount of an agent to provide the desired biological result. That result may be reduction and/or alleviation of the signs, symptoms, or causes of a disease, or any other desired alteration of a biological system. An appropriate therapeutic amount in any individual ease may be determined by one of ordinary skill in the art using routine experimentation.
- Encoding refers to the inherent property of specific sequences of nucleotides in a polynucleotide, such as a gene, a cDNA, or an mRNA, to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (i.e., rRNA, tRNA and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom.
- a gene encodes a protein if transcription and translation of mRNA corresponding to that gene produces the protein in a cell or other biological system.
- Both the coding strand the nucleotide sequence of which is identical to the mRNA sequence and is usually provided in sequence listings, and the non-coding strand, used as the template for transcription of a gene or cDNA, can be referred to as encoding the protein or other product of that gene or cDNA.
- ESRD refers to end-stage renal disease.
- Fc refers to a human IgG Fc domain. Subtypes of IgG such as IgG1, IgG2, IgG3, and IgG4 are all being contemplated for usage as Fc domains.
- fragment refers to a subsequence of a larger nucleic acid.
- a “fragment” of a nucleic acid can be at least about 15 nucleotides in length; for example, at least about 50 nucleotides to about 100 nucleotides; at least about 100 to about 500 nucleotides, at least about 500 to about 1000 nucleotides; at least about 1000 nucleotides to about 1500 nucleotides; about 1500 nucleotides to about 2500 nucleotides; or about 2500 nucleotides (and any integer value in between).
- fragment refers to a subsequence of a larger protein or peptide.
- a “fragment” of a protein or peptide can be at least about 20 amino acids in length; for example, at least about 50 amino acids in length; at least about 100 amino acids in length; at least about 200 amino acids in length; at least about 300 amino acids in length; or at least about 400 amino acids in length (and any integer value in between).
- HBD hypophosphatemic bone disease
- HHRH hereditary hypophosphatemic rickets with hypercakiuria
- “Homologous” refers to the sequence similarity or sequence identity between two polypeptides or between two nucleic acid molecules. When a position in both of the two compared sequences is occupied by the same base or amino acid monomer subunit, e.g., if a position in each of two DNA molecules is occupied by adenine, then the molecules are homologous at that position.
- the percent of homology between two sequences is a function of the number of matching or homologous positions shared by the two sequences divided by the number of positions compared X 100. For example, if 6 of 10 of the positions in two sequences are matched or homologous then the two sequences are 60% homologous.
- the DNA sequences ATTGCC and TATGGC share 50% homology. Generally, a comparison is made when two sequences are aligned to give maximum homology.
- IIAC refers to idiopathic infantile arterial calcification.
- an “immunoassay” refers to any binding assay that uses an antibody capable of binding specifically to a target molecule to detect and quantify the target molecule.
- immunoglobulin As used herein, the term “immunoglobulin” or “Ig” is defined as a class of proteins that function as antibodies. Antibodies expressed by B cells are sometimes referred to as the BCR (B cell receptor) or antigen receptor. The five members included in this class of proteins are IgA, IgG, IgS9, IgD, and IgE.
- IgA is the primary antibody that is present in body secretions, such as saliva, tears, breast milk, gastrointestinal secretions and mucus secretions of the respiratory and genitourinary tracts.
- IgG is the most common circulating antibody.
- IgM is the main immunoglobulin produced in the primary immune response in most subjects.
- IgD is the immunoglobulin that has no known antibody function, but may serve as an antigen receptor.
- IgE is the immunoglobulin that mediates immediate hypersensitivity by causing release of mediators from mast cells and basophils upon exposure to allergen.
- “Instructional material,” as that term is used herein, includes a publication, a recording, a diagram, or any other medium of expression which can be used to communicate the usefulness of the nucleic acid, peptide, and/or compound of the invention in the kit for identifying or alleviating or treating the various diseases or disorders recited herein.
- the instructional material may describe one or more methods of identifying or alleviating the diseases or disorders in a cell or a tissue of a subject.
- the instructional material of the kit may, for example, be affixed to a container that contains the nucleic acid, polypeptide, and/or compound of the invention or be shipped together with a container that contains the nucleic acid, polypeptide, and/or compound.
- the instructional material may be shipped separately from the container with the intention that the recipient uses the instructional material and the compound cooperatively.
- the kit comprises an applicator that can be used to administer the nucleic acid, peptide, and/or compound of the invention to the subject.
- the application may be for example a drop dispenser, a bottle, a pill dispenser, a syringe and so forth.
- isolated means altered or removed from the natural state.
- a nucleic acid or a polypeptide naturally present in a living animal is not “isolated,” but the same nucleic acid or polypeptide partially or completely separated from the coexisting materials of its natural state is “isolated.”
- An isolated nucleic acid or protein can exist in substantially purified form, or can exist in a non-native environment such as, for example, a host cell.
- isolated nucleic acid refers to a nucleic acid segment or fragment which has been separated from sequences which flank it in a naturally occurring state, e.g., a DNA fragment which has been removed from the sequences which are normally adjacent to the fragment, e.g., the sequences adjacent to the fragment in a genome in which it naturally occurs.
- the term also applies to nucleic acids which have been substantially purified from other components which naturally accompany the nucleic acid, e.g., RNA or DNA or proteins, which naturally accompany it in the cell.
- the term therefore includes, for example, a recombinant DNA which is incorporated into a vector, into an autonomously replicating plasmid or virus, or into the genomic DNA of a prokaryote or eukaryote, or which exists as a separate molecule (e.g., as a cDNA or a genomic or cDNA fragment produced by PCR or restriction enzyme digestion) independent of other sequences. It also includes a recombinant DNA which is part of a hybrid gene encoding additional polypeptide sequence.
- MWVC medial wall vascular calcification
- NPP refers to ectonucleotide pyrophosphatase/phosphodiesterase.
- nucleic acid refers to a polynucleotide and includes poly-ribonucleotides and poly-deoxyribonucleotides.
- Nucleic acids according to the present invention may include any polymer or oligomer of pyrimidine and purine bases, preferably cytosine, thymine, and uracil, and adenine and guanine, respectively (Lehninger, Principles of Biochemistry, at 793-800 (Worth Pub. 1982), which is herein incorporated in its entirety for all purposes).
- the present invention contemplates any deoxyribonucleotide, ribonucleotide or peptide nucleic acid component, and any chemical variants thereof, such as methylated, hydroxymethylated or glucosylated forms of these bases, and the like.
- the polymers or oligomers may be heterogeneous or homogeneous in composition, and may be isolated from naturally occurring sources or may be artificially or synthetically produced.
- the nucleic acids may be DNA or RNA, or a mixture thereof, and may exist permanently or transitionally in single-stranded or double-stranded form, including homoduplex, heteroduplex, and hybrid states.
- oligonucleotide or “polynucleotide” is a nucleic acid ranging from at least 2, preferably at least 8, 15 or 25 nucleotides in length, but may be up to 50, 100, 1000, or 5000 nucleotides long or a compound that specifically hybridizes to a polynucleotide.
- Polynucleotides include sequences of deoxyribonucleic acid (DNA) or ribonucleic acid (RNA) or mimetics thereof which may be isolated from natural sources, recombinantly produced or artificially synthesized.
- a further example of a polynucleotide of the present invention may be a peptide nucleic acid (PNA). (See U.S. Pat. No.
- the invention also encompasses situations in which there is a nontraditional base pairing such as Hoogsteen base pairing which has been identified in certain tRNA molecules and postulated to exist in a triple helix.
- “Polynucleotide” and “oligonucleotide” are used interchangeably herein.
- a nucleotide sequence is represented herein by a DNA sequence (e.g., A, T, G, and C)
- this also includes the corresponding RNA sequence (e.g., A, U, G, C) in which “U” replaces “T.”
- OPLL refers to ossification of posterior longitudinal ligament.
- the term “patient,” “individual” or “subject” refers to a human or a non-human mammal.
- Non-human mammals include, for example, livestock and pets, such as ovine, bovine, porcine, canine, feline and murine mammals.
- livestock and pets such as ovine, bovine, porcine, canine, feline and murine mammals.
- the patient, individual or subject is human.
- the term “pharmaceutically acceptable” refers to a material, such as a carrier or diluent, which does not abrogate the biological activity or properties of the compound, and is relatively non-toxic, i.e., the material may be administered to an individual without causing undesirable biological effects or interacting in a deleterious manner with any of the components of the composition in which it is contained.
- the term “pharmaceutically acceptable carrier” means a pharmaceutically acceptable material, composition or carrier, such as a liquid or solid filler, stabilizer, dispersing agent, suspending agent, diluent, excipient, thickening agent, solvent or encapsulating material, involved in carrying or transporting a compound useful within the invention within or to the patient such that it may perform its intended function.
- a pharmaceutically acceptable material, composition or carrier such as a liquid or solid filler, stabilizer, dispersing agent, suspending agent, diluent, excipient, thickening agent, solvent or encapsulating material, involved in carrying or transporting a compound useful within the invention within or to the patient such that it may perform its intended function.
- Such constructs are carried or transported from one organ, or portion of the body, to another organ, or portion of the body.
- Each carrier must be “acceptable” in the sense of being compatible with the other ingredients of the formulation, including the compound useful within the invention, and not injurious to the patient.
- materials that may serve as pharmaceutically acceptable carriers include: sugars, such as lactose, glucose and sucrose; starches, such as corn starch and potato starch; cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; powdered tragacanth; malt; gelatin; talc; excipients, such as cocoa butter and suppository waxes; oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; glycols, such as propylene glycol; polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol; esters, such as ethyl oleate, and ethyl laurate; agar; buffering agents, such as magnesium hydroxide and aluminum hydroxide; surface active agents; alginic acid; pyrogen-free water; isotonic sa
- “Pharmaceutically acceptable carrier” also includes any and all coatings, antibacterial and antifungal agents, and absorption delaying agents, and the like that are compatible with the activity of the compound useful within the invention, and are physiologically acceptable to the patient. Supplementary active compounds may also be incorporated into the compositions.
- the “pharmaceutically acceptable carrier” may further include a pharmaceutically acceptable salt of the compound useful within the invention.
- Other additional ingredients that may he included in the pharmaceutical compositions used in the practice of the invention are known in the art and described, for example in Remington's Pharmaceutical Sciences (Genaro, Ed., Mack Publishing Co., 1985, Easton, Pa.), which is incorporated herein by reference.
- pharmaceutically acceptable salt refers to a salt of the administered compound prepared from pharmaceutically acceptable non-toxic acids and bases, including inorganic acids, inorganic bases, organic acids, inorganic bases, solvates, hydrates, and clathrates thereof.
- suitable pharmaceutically acceptable acid addition salts may be prepared from an inorganic acid or from an organic acid.
- inorganic acids include sulfate, hydrogen sulfate, hydrochloric, hydrobromic, hydriodic, nitric, carbonic, sulfuric, and phosphoric acids (including hydrogen phosphate and dihydrogen phosphate).
- Appropriate organic acids may be selected from aliphatic, cycloaliphatic, aromatic, araliphatic, heterocyclic, carboxylic and sulfonic classes of organic acids, examples of which include formic, acetic, propionic, succinic, glycolic gluconic, lactic, malic, tartaric, citric, ascorbic, glucuronic, maleic, fumaric, pymvic, aspartic, glutamic, benzoic, anthranilic, 4-hydroxybenzoic, phenylacetic, mandelic, embonic (pamoic), methanesulfonic, ethanesulfonic, benzenesulfonic, pantothenic, trifluoromethanesulfonic, 2-hydroxyethane sulfonic, p-toluenesulfonic, sulfanilic, cyclohexylaminosulfonic, stearic, alginic, ⁇ -hydroxy butyric
- Suitable pharmaceutically acceptable base addition salts of compounds of the invention include, for example, metallic salts including alkali metal, alkaline earth metal and transition metal salts such as, for example, calcium, magnesium, potassium, sodium and zinc salts.
- Pharmaceutically acceptable base addition salts also include organic salts made from basic amines such as, for example, N,N′-dibenzylethylene-diamine, chloroprocaine, choline, diethanolamine, ethylenediamine, meglumine (N-methylglucamine) and procaine. All of these salts may be prepared from the corresponding compound by reacting, for example, the appropriate acid or base with the compound.
- plasma pyrophosphate levels or “plasma PPi” refers to the amount of pyrophosphate (PPi) present in plasma of animals.
- animals include mammals, such as but not limited to rat, mouse, cat, dog, human, cow and horse.
- PPi is measured in plasma rather than serum, because of its release from platelets.
- UDPG uridine-diphosphoglucose
- the plasma PPi levels are about 500 nM, about 600 nM, about 700 nM, about 800 nM, about 900 nM, about 1 ⁇ M, about 1.1 ⁇ M, about 1.2 ⁇ M, about 1.3 ⁇ M, about 1.4 ⁇ M, about 1.5 ⁇ M, about 1.6 ⁇ M, about 1.7 ⁇ M, about 1.8 ⁇ M, about 1.9 ⁇ M, about 2 ⁇ M about 2.2 ⁇ M, about 2.4 ⁇ M, and/or about 2.6 ⁇ M.
- the plasma PPi levels range from about 500 nM to about 2.8 ⁇ M, about 600 nM to about 2.8 ⁇ M, about 700 nM to about 2.8 ⁇ M, about 800 nM to about 2.8 ⁇ M, about 900 nM to about 2.8 ⁇ M, about 1 ⁇ M to about 2.8 ⁇ M, about 1.1 ⁇ M to about 2.8 ⁇ M, about 1.2 ⁇ M to about 2.8 ⁇ M, about 1.3 ⁇ M to about 2.8 ⁇ M, about 1.4 ⁇ M to about 2.8 ⁇ M, about 1.5 ⁇ M to about 2.8 ⁇ M, about 1.6 ⁇ M to about 2.8 ⁇ M, about 1.7 ⁇ M to about 2.8 ⁇ M, about 1.8 ⁇ M to about 2.8 ⁇ M, about 1.9 ⁇ M to about 2.8 ⁇ M, about 2 ⁇ M to about 2.8 ⁇ M, about 2.2 ⁇ M to about 2.8 ⁇ M about 2.4
- polynucleotide includes cDNA, RNA, DNA/RNA hybrid, antisense RNA, ribozyme, genomic DNA, synthetic forms, and mixed polymers, both sense and antisense strands, and may be chemically or biochemically modified to contain non-natural or derivatized, synthetic, or semi-synthetic nucleotide bases. Also, contemplated are alterations of a wild type or synthetic gene, including but not limited to deletion, insertion, substitution of one or more nucleotides, or fusion to other polynucleotide sequences.
- polypeptide refers to a polymer composed of amino acid residues, related naturally occurring structural variants, and synthetic non-naturally occurring analogs thereof linked via peptide bonds. Synthetic polypeptides may be synthesized, for example, using an automated polypeptide synthesizer.
- protein typically refers to large polypeptides.
- peptide typically refers to short polypeptides. Conventional notation is used herein to represent polypeptide sequences: the left-hand end of a polypeptide sequence is the amino-terminus, and the right-hand end of a polypeptide sequence is the carboxyl-terminus.
- amino acids are represented by the full name thereof, by the three letter code corresponding thereto, or by the one-letter code corresponding thereto, as indicated below: Aspartic Acid, Asp, D; Glutamic Acid, (Hu, B; Lysine, Lys, K; Arginine, Arg, R; Histidine, His, H; Tyrosine, Tyr, Y; Cysteine, Cys, C; Asparagine, Asn, N; Glutamine, Gln, Q; Serine, Ser, S; Threonine, Thr, T; Glycine, Gly, G; Alanine, Ala, A; Valine, Val, V; Leucine, Leu, L; Isoleucine, Ile, I; Methionine, Met, M; Proline, Pro, P; Phenylalanine, Phe, F; Tryptophan, W.
- prevent means no disorder or disease development if none had occurred, or no further disorder or disease development if there had already been development of the disorder or disease. Also considered is the ability of one to prevent some or all of the symptoms associated with the disorder or disease.
- PXE refers to pseudoxanthoma elasticum
- sample or “biological sample” as used herein means a biological material isolated from a subject.
- the biological sample may contain any biological material suitable for detecting a mRNA, polypeptide or other marker of a physiologic or pathologic process in a subject, and may comprise fluid, tissue, cellular and/or non-cellular material obtained from the individual.
- substantially purified refers to being essentially free of other components.
- a substantially purified polypeptide is a polypeptide which has been separated from other components with which it is normally associated in its naturally occurring state.
- treatment is defined as the application or administration of a therapeutic agent, i.e., a compound useful within the invention (alone or in combination with another pharmaceutical agent), to a patient, or application or administration of a therapeutic agent to an isolated tissue or cell line from a patient (e.g., for diagnosis or ex vivo applications), who has a disease or disorder, a symptom of a disease or disorder or the potential to develop a disease or disorder, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve or affect the disease or disorder, the symptoms of the disease or disorder, or the potential to develop the disease or disorder.
- a therapeutic agent i.e., a compound useful within the invention (alone or in combination with another pharmaceutical agent
- a therapeutic agent i.e., a compound useful within the invention (alone or in combination with another pharmaceutical agent
- an isolated tissue or cell line from a patient (e.g., for diagnosis or ex vivo applications)
- Such treatments may be specifically tailored or modified, based on knowledge obtained
- XLH refers to X-linked hypophosphatemia, X-linked dominant hypophosphatemic rickets, X-linked vitamin D-resistant rickets, and/or X-linked hypophosphatemic rickets.
- wild-type refers to a gene or gene product isolated from a naturally occurring source.
- a wild-type gene is that which is most frequently observed in a population and is thus arbitrarily designed the “normal” or “wild-type” form of the gene.
- modified or mutant refers to a gene or gene product that displays modifications in sequence and/or functional properties (i.e., altered characteristics) when compared to the wild-type gene or gene product.
- Naturally occurring mutants can be isolated; these are identified by the fact that they have altered characteristics (including altered nucleic acid sequences) when compared to the wild-type gene or gene product.
- ranges throughout this disclosure, various aspects of the invention can be presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible subranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 2.7, 3, 4, 5, 5.3, and 6. This applies regardless of the breadth of the range.
- the polypeptide of the invention has formula (I): EXPORT-PROTEIN-Z-DOMAIN-X-Y (I), wherein in (I): EXPORT is absent, or a signal export sequence or a biologically active fragment thereof; PROTEIN is the extracellular domain of ENPP3 (SEQ IL) NO:1) or a biologically active fragment thereof; DOMAIN is selected from the group consisting of a human IgG Fc domain and human albumin domain; X and Z are independently absent or a polypeptide comprising 1-20 amino acids; and, Y is absent or a sequence selected from the group consisting of (DSS) n (SEQ ID NO:6), (ESS) n (SEQ Ill NO:7), (RQQ) n (SEQ NO:8), (KR) n (SEQ NO:9), R n (SEQ ID NO:10), (KR) n (SEQ ID NO: 11), DSSSEEKFLRRIGRFG (SEQ ID NO:12
- the polypeptide comprises the extracellular domain of ENPP3 (SEQ ID NO:1) or a biologically active fragment (or region) thereof.
- the polypeptide is soluble.
- the nuclease domain of the PROTEIN or mutant thereof is absent.
- EXPORT is absent or selected from the group consisting of SEQ ID NOs:2-5.
- X is selected from the group consisting of: absent, a polypeptide consisting of 20 amino acids, a polypeptide consisting of 19 amino acids, a polypeptide consisting of 18 amino acids, a polypeptide consisting of 17 amino acids, a polypeptide consisting of 16 amino acids, a polypeptide consisting of 15 amino acids, a polypeptide consisting of 14 amino acids, a polypeptide consisting of 13 amino acids, a polypeptide consisting of 12 amino acids, a polypeptide consisting of 11 amino acids, a polypeptide consisting of 10 amino acids, a polypeptide consisting of 9 amino acids, a polypeptide consisting of 8 amino acids, a polypeptide consisting of 7 amino acids, a polypeptide consisting of 6 amino acids, a polypeptide consisting of 5 amino acids, a polypeptide consisting of 4 amino acids, a polypeptide consisting of 3 amino acids, a polypeptide consisting of 2 amino acids, and a polypeptide consisting of
- Z is selected from the group consisting of: absent, a polypeptide consisting of 20 amino acids, a polypeptide consisting of 19 amino acids, a polypeptide consisting of 18 amino acids, a polypeptide consisting of 17 amino acids, a polypeptide consisting of 16 amino acids, a polypeptide consisting of 15 amino acids, a polypeptide consisting of 14 amino acids, a polypeptide consisting of 13 amino acids, a polypeptide consisting of 12 amino acids, a polypeptide consisting of 11 amino acids, a polypeptide consisting of 10 amino acids, a polypeptide consisting of 9 amino acids, a polypeptide consisting of 8 amino acids, a polypeptide consisting of 7 amino acids, a polypeptide consisting of 6 amino acids, a polypeptide consisting of 5 amino acids, a polypeptide consisting of 4 amino acids, a polypeptide consisting of 3 amino acids, a polypeptide consisting of 2 amino acids, and a polypeptide consisting of
- X and Z are independently absent or a polypeptide comprising 1-18 amino acids. In other embodiments, X and Z are independently absent or a polypeptide comprising 1-16 amino acids. In yet other embodiments, X and Z are independently absent or a polypeptide comprising 1-14 amino acids. In yet other embodiments, X and Z are independently absent or a polypeptide comprising 1-12 amino acids. In yet other embodiments, X and Z are independently absent or a polypeptide comprising 1-10 amino acids. In yet other embodiments, X and Z are independently absent or a polypeptide comprising 1-8 amino acids. In yet other embodiments, X and Z are independently absent or a polypeptide comprising 1-6 amino acids.
- X and Z are independently absent or a polypeptide comprising 1-5 amino acids. In yet other embodiments, X and Z are independently absent or a polypeptide comprising 1-4 amino acids, In yet other embodiments, X and Z are independently absent or a polypeptide comprising 1-3 amino acids. In yet other embodiments, X and Z are independently absent or a polypeptide comprising 1-2 amino acids. In yet other embodiments, X and Z are independently absent or a single amino acid.
- DOMAIN is a human IgG Fe domain selected from the group consisting of IgG 1, IgG2, IgG3 and IgG4.
- the polypeptide is selected from the group consisting of SEQ ID NOs: 19, 21 and 22.
- DOMAIN is a human albumin domain.
- the polypeptide is selected from the group consisting of SEQ ID NOs: 24, 25 and 26.
- the soluble polypeptide lacks a transmembrane domain and/or signal peptide. In other embodiments, the soluble polypeptide lacks a transmembrane domain. In yet other embodiments, the soluble polypeptide lacks a signal peptide. In yet other embodiments, the soluble polypeptide lacks a transmembrane domain and signal peptide.
- the polypeptide comprises a soluble region (or fragment) of NPP3 and lacks a transmembrane domain and a signal peptide, or a fusion protein thereof. In other embodiments, the polypeptide comprises a soluble region of NPP3 and lacks a transmembrane domain and/or a signal peptide. In yet other embodiments, the polypeptide comprises a soluble region of NPP3 and lacks a transmembrane domain. In yet other embodiments, the polypeptide comprises a soluble region of NPP3 and lacks a signal peptide. In yet other embodiments, the polypeptide reduces cellular calcification when administered to a subject suffering from diseases of calcification and ossification.
- the polypeptide consists essentially of SEQ ID NO:1 or a biologically active fragment thereof. In other embodiments, the polypeptide consists of SEQ ID NO:1 or a biologically active fragment thereof.
- the soluble ENPP3 fragment or fusion protein thereof comprises the extracellular domain of ENPP3 (SEQ ID NO:1) or a biologically active fragment thereof.
- the soluble ENPP3 fragment consists essentially of SEQ ID NO:1 or a biologically active fragment thereof
- the soluble ENPP3 fragment consists of SEQ ID NO:1 or a biologically active fragment thereof.
- the soluble ENPP3 fragment or fusion protein thereof lacks a transmembrane domain and a signal peptide.
- the polypeptide of the invention is soluble. In other embodiments, the polypeptide of the invention is a recombinant polypeptide. In yet other embodiments, the polypeptide of the invention is further pegylated.
- the invention provides a method of treating or preventing a disease or disorder associated with pathological calcification or pathological ossification in a subject in need thereof.
- the invention further provides a method of reducing or preventing vascular calcification in a subject with low plasma pyrophosphate (PPi) or high serum phosphate (Pi).
- PPi low plasma pyrophosphate
- Pi high serum phosphate
- the invention further provides a method of treating of a subject having NPP1. deficiency or NPP1-associated disease.
- the invention further provides a method of treating or preventing disorders and diseases in a subject where an increased activity or level of ENPP3 polypeptide, fragment, derivative, mutant, or mutant fragment thereof is desirable.
- the subject is administered a therapeutically effective amount of at least one polypeptide of the invention.
- the method comprises administering to the subject a therapeutically effective amount of an isolated recombinant human soluble ENPP3 fragment or fusion protein thereof.
- the disease or disorder comprises at least one selected from the group consisting of GACI, IIAC, PXE, OPLL, hypophosphatemic rickets, osteoarthritis, calcification of atherosclerotic plaques, hereditary and non-hereditary forms of osteoarthritis, ankylosing spondylitis, hardening of the arteries occurring with aging, and calciphylaxis resulting from end stage renal disease (or mineral bone disorder of chronic kidney disease).
- the disease or disorder comprises at least one selected from a group consisting of GACI, IIAC, PXE, OPLL, MWVC, ARHR2, ESRD, CKD-MBD, XLH, age related osteopenia, CUA and hypophosphatemic rickets.
- the disease or disorder is GACI. In other embodiments, the disease or disorder is IIAC. In yet other embodiments, the disease or disorder is PXE. In yet other embodiments, the disease or disorder is OPLL. In yet other embodiments, the disease or disorder is hypophosphatemic rickets. In yet other embodiments, the disease or disorder is osteoarthritis. In yet other embodiments, the disease or disorder is calcification of atherosclerotic plaques. In yet other embodiments, the disease or disorder is hereditary and non-hereditary forms of osteoarthritis. In yet other embodiments, the disease or disorder is ankylosing spondylitis. In yet other embodiments, the disease or disorder is hardening of the arteries occurring with aging.
- the disease or disorder is calciphylaxis resulting from end stage renal disease (or mineral bone disorder of chronic kidney disease). In yet other embodiments, the disease or disorder is age related osteopenia. In yet other embodiments, the disease or disorder is CUA. In yet other embodiments, the disease or disorder is MWVC. In yet other embodiments, the disease or disorder is ARHR2. In yet other embodiments, the disease or disorder is ESRD.
- the at least one polypeptide is administered acutely or chronically to the subject. In other embodiments, the at least one polypeptide is administered locally, regionally or systemically to the subject. In yet other embodiments, the subject is a mammal. In yet other embodiments, the mammal is human.
- the administered amount raises the level of plasma PPi in the subject to at least about 250 nM. In other embodiments, the administered amount raises the level of plasma PPi in the subject to at least about 500 nM. In yet other embodiments, the administered amount raises the level of plasma PPi in the subject to at least about 800 nM. In yet other embodiments, the administered amount raises the level of plasma PPi in the subject to at least about 900 nM, in yet other embodiments, the administered amount raises the level of plasma PPi in the subject to at least about 1 ⁇ M. In yet other embodiments, the administered amount raises the level of plasma PPi in the subject to at least about 1.2 ⁇ M.
- the administered amount raises the level of plasma PPi in the subject to at least about 1.4 ⁇ M. In yet other embodiments, the administered amount raises the level of plasma PPi in the subject to at least about 1.5 ⁇ M. In certain embodiments, the administered amount raises the level of plasma PPi in the subject to at least about 2 ⁇ M. In certain embodiments, the administered amount raises the level of plasma PPi in the subject to at least about 4 ⁇ M.
- the invention is useful in subjects who, in whole (e.g., systemically) or in part (e.g., locally, tissue, organ), are being, or will be, treated for pathological calcification or ossification.
- the invention is useful in treating or preventing pathological calcification or ossification.
- the diseases and disorders treatable by the compositions and methods described herein encompass any disease or disorder where a decrease in calcification or ossification will promote a positive therapeutic outcome.
- the invention is not limited to treatment of a disease or disorder once is established.
- the symptoms of the disease or disorder need not have manifested to the point of detriment to the subject; indeed, the disease or disorder need not be detected in a subject before treatment is administered. That is, significant pathology from disease or disorder does not have to occur before the present invention may provide benefit.
- the present invention includes a method for preventing diseases and disorders in a subject, in that a polypeptide of the invention, or a mutant thereof, as discussed elsewhere herein, can be administered to a subject prior to the onset of the disease or disorder, thereby preventing the disease or disorder from developing.
- the prevention of a disease or disorder in a subject encompasses administering to a subject a polypeptide of the invention, or a mutant thereof as a preventative measure against a disease or disorder.
- the invention encompasses administration of a polypeptide of the invention, or a mutant thereof to practice the methods of the invention; the skilled artisan would understand, based on the disclosure provided herein, how to formulate and administer the polypeptide of the invention, or a mutant thereof to a subject.
- the present invention is not limited to any particular method of administration or treatment regimen. This is especially true where it would be appreciated by one skilled in the art, equipped with the disclosure provided herein, including the reduction to practice using an art-recognized model of pathological calcification or ossification, that methods of administering a compound of the invention can be determined by one of skill in the pharmacological arts.
- the invention envisions the use of a pharmaceutical composition comprising a polypeptide of the invention within the methods of the invention.
- Such a pharmaceutical composition is in a form suitable for administration to a subject, or the pharmaceutical composition may further comprise one or more pharmaceutically acceptable carriers, one or more additional ingredients, or some combination of these.
- the various components of the pharmaceutical composition may be present in the form of a physiologically acceptable salt, such as in combination with a physiologically acceptable cation or anion, as is well known in the art.
- the pharmaceutical compositions useful for practicing the method of the invention may be administered to deliver a dose of between 1 ng/kg/day and 100 mg/kg/day. In other embodiments, the pharmaceutical compositions useful for practicing the invention may be administered to deliver a dose of between 1 ng/kg/day and 500 mg/kg/day.
- compositions of the invention will vary, depending upon the identity, size, and condition of the subject treated and further depending upon the route by which the composition is to be administered.
- the composition may comprise between about 0.1% and about 100% (w/w) active ingredient.
- compositions that are useful in the methods of the invention may be suitably developed for inhalational, oral, rectal, vaginal, parenteral, topical, transdermal, pulmonary, intranasal, buccal, ophthalmic, intrathecal, intravenous or another route of administration.
- Other contemplated formulations include projected nanoparticles, liposomal preparations, resealed erythrocytes containing the active ingredient, and immunologically-based formulations.
- the routes) of administration is readily apparent to the skilled artisan and depends upon any number of factors including the type and severity of the disease being treated, the type and age of the veterinary or human patient being treated, and the like.
- the formulations of the pharmaceutical compositions described herein may be prepared by any method known or hereafter developed in the art of pharmacology. In general, such preparatory methods include the step of bringing the active ingredient into association with a carrier or one or more other accessory ingredients, and then, if necessary or desirable, shaping or packaging the product into a desired single- or multi-dose unit.
- a “unit dose” is a discrete amount of the pharmaceutical composition comprising a predetermined amount of the active ingredient.
- the amount of the active ingredient is generally equal to the dosage of the active ingredient that would be administered to a subject or a convenient fraction of such a dosage such as, for example, one-half or one-third of such a dosage.
- the unit dosage form may be for a single daily dose or one of multiple daily doses (e.g., about 1 to 4 or more times per day). When multiple daily doses are used, the unit dosage form may be the same or different for each dose.
- compositions suitable for ethical administration to humans are principally directed to pharmaceutical compositions suitable for ethical administration to humans, it is understood by the skilled artisan that such compositions are generally suitable for administration o animals of all sorts. Modification of pharmaceutical compositions suitable for administration to humans in order to render the compositions suitable for administration to various animals is well understood, and the ordinarily skilled veterinary pharmacologist can design and perform such modification with merely ordinary, if any, experimentation. Subjects to which administration of the pharmaceutical compositions of the invention is contemplated include, but are not limited to, humans and other primates, mammals including commercially relevant mammals such as cattle, pigs, horses, sheep, cats, and dogs.
- compositions are formulated using one or more pharmaceutically acceptable excipients or carriers.
- the pharmaceutical compositions comprise a therapeutically effective amount of the active agent and a pharmaceutically acceptable carrier.
- Pharmaceutically acceptable carriers include, but are not limited to, glycerol, water, saline, ethanol and other pharmaceutically acceptable salt solutions such as phosphates and salts of organic acids. Examples of these and other pharmaceutically acceptable carriers are described in Remington's Pharmaceutical Sciences, 1991, Mack Publication Co., New Jersey.
- the carrier may be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetable oils.
- the proper fluidity may be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- Prevention of the action of microorganisms may be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like.
- isotonic agents for example, sugars, sodium chloride, or polyalcohols such as mannitol and sorbitol, in the composition.
- Prolonged absorption of the injectable compositions may be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate or gelatin.
- Formulations may be employed in admixtures with conventional excipients, i.e., pharmaceutically acceptable organic or inorganic carrier substances suitable for oral, parenteral, nasal, intravenous, subcutaneous, enteral, or any other suitable mode of administration, known to the art.
- the pharmaceutical preparations may be sterilized and if desired mixed with auxiliary agents, e.g., lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure buffers, coloring, flavoring and/or aromatic substances and the like. They may also be combined where desired with other active agents, e.g., other analgesic agents.
- additional ingredients include, but are not limited to, one or more of the following: excipients; surface active agents; dispersing agents; inert diluents; granulating and disintegrating agents; binding agents; lubricating agents; sweetening agents; flavoring agents; coloring agents; preservatives; physiologically degradable compositions such as gelatin; aqueous vehicles and solvents; oily vehicles and solvents; suspending agents; dispersing or wetting agents; emulsifying agents, demulcents; buffers; salts; thickening agents; fillers; emulsifying agents; antioxidants; antibiotics; antifungal agents; stabilizing agents; and pharmaceutically acceptable polymeric or hydrophobic materials.
- compositions of the invention are known in the art and described, for example in Genaro, ed., 1985, Remington's Pharmaceutical Sciences, Mack Publishing Co., Easton, Pa., which is incorporated herein by reference.
- the composition of the invention may comprise a preservative from about 0.005% to 2.0% by total weight of the composition.
- the preservative is used to prevent spoilage in the case of exposure to contaminants in the environment.
- a particularly preferred preservative is a combination of about 0.5% to 2.0% benzyl alcohol and 0.05% to 0.5% sorbic acid.
- the composition preferably includes an antioxidant and a chelating agent, which inhibit the degradation of the compound.
- Preferred antioxidants for some compounds are BHT, BHA, alpha-tocopherol and ascorbic acid in the preferred range of about 0.01% to 0.3% and more preferably BHT in the range of 0.03% to 0.2% by weight by total weight of the composition.
- the chelating agent is present in an amount ranging from 0.01% to 0.5% by weight by total weight of the composition.
- Particularly preferred chelating agents include edetate salts (e.g. disodium edetate) and citric acid in the weight range of about 0.01% to 0.20% and more preferably in the range of 0.02% to 0.10% by weight by total weight of the composition.
- the chelating agent is useful for chelating metal ions in the composition, which may be detrimental to the shelf life of the formulation. While BHT and disodium edetate are the particularly preferred antioxidant and chelating agent respectively for some compounds, other suitable and equivalent antioxidants and chelating agents may be substituted therefore as would be known to those skilled in the art.
- Liquid suspensions may be prepared using conventional methods to achieve suspension of the active ingredient in an aqueous or oily vehicle.
- Aqueous vehicles include, for example, water, and isotonic saline.
- Oily vehicles include, for example, almond oil, oily esters, ethyl alcohol, vegetable oils such as arachis, olive, sesame, or coconut oil, fractionated vegetable oils, and mineral oils such as liquid paraffin.
- Liquid suspensions may further comprise one or more additional ingredients including, but not limited to, suspending agents, dispersing or wetting agents, emulsifying agents, demulcents, preservatives, buffers, salts, flavorings, coloring agents, and sweetening agents.
- Oily suspensions may further comprise a thickening agent.
- suspending agents include, but are not limited to, sorbitol syrup, hydrogenated edible fats, sodium alginate, polyvinylpyrrolidone, gum tragacanth, gum acacia, and cellulose derivatives (e.g., sodium carboxymethylcellulose, hydroxypropylmethylcellulose, methylcellulose).
- Known dispersing or wetting agents include, but are not limited to, naturally-occurring phosphatides such as lecithin, condensation products of an alkylene oxide with a fatty acid, with a long chain aliphatic alcohol, with a partial ester derived from a fatty acid and a hexitol, or with a partial ester derived from a fatty acid and a hexitol anhydride (e.g., polyoxyethylene stearate, heptadecaethyleneoxycetanol, polyoxyethylene sorbitol monooleate, and polyoxyethylene sorbitan monooleate, respectively).
- Known emulsifying agents include, but are not limited to, lecithin, and acacia.
- Known preservatives include, but are not limited to, methyl, ethyl, or n-propyl para-hydroxybenzoates, ascorbic acid, and sorbic acid.
- Known sweetening agents include, for example, glycerol, propylene glycol, sorbitol, sucrose, and saccharin.
- Known thickening agents for oily suspensions include, for example, beeswax, hard paraffin, and cetyl alcohol.
- Liquid solutions of the active ingredient in aqueous or oily solvents may be prepared in substantially the same manner as liquid suspensions, the primary difference being that the active ingredient is dissolved, rather than suspended in the solvent.
- an “oily” liquid is one that comprises a carbon-containing liquid molecule and which exhibits a less polar character than water.
- Liquid solutions of the pharmaceutical composition of the invention may comprise each of the components described with regard to liquid suspensions, it being understood that suspending agents will not necessarily aid dissolution of the active ingredient in the solvent.
- Aqueous solvents include, for example, water, and isotonic saline.
- Oily solvents include, for example, almond oil, oily esters, ethyl alcohol, vegetable oils such as arachis, olive, sesame, or coconut oil, fractionated vegetable oils, and mineral oils such as liquid paraffin.
- Powdered and granular formulations of a pharmaceutical preparation of the invention may be prepared using known methods. Such formulations may be administered directly to a subject, used, for example, to form tablets, to fill capsules, or to prepare an aqueous or oily suspension or solution by addition of an aqueous or oily vehicle thereto. Each of these formulations may further comprise one or more of dispersing or wetting agent, a suspending agent, and a preservative. Additional excipients, such as fillers and sweetening, flavoring, or coloring agents, may also be included in these formulations.
- a pharmaceutical composition of the invention may also be prepared, packaged, or sold in the form of oil-in-water emulsion or a water-in-oil emulsion.
- the oily phase may be a vegetable oil such as olive or arachis oil, a mineral oil such as liquid paraffin, or a combination of these.
- compositions may further comprise one or more emulsifying agents such as naturally occurring gums such as gum acacia or gum tragacanth, naturally-occurring phosphatides such as soybean or lecithin phosphatide, esters or partial esters derived from combinations of fatty acids and hexitol anhydrides such as sorbitan monooleate, and condensation products of such partial esters with ethylene oxide such as polyoxyethylene sorbitan monooleate.
- emulsions may also contain additional ingredients including, for example, sweetening or flavoring agents.
- Methods for impregnating or coating a material with a chemical composition include, but are not limited to methods of depositing or binding a chemical composition onto a surface, methods of incorporating a chemical composition into the structure of a material during the synthesis of the material such as with a physiologically degradable material), and methods of absorbing an aqueous or oily solution or suspension into an absorbent material, with or without subsequent drying.
- the regimen of administration may affect what constitutes an effective amount. For example, several divided dosages, as well as staggered dosages may he administered daily or sequentially, or the dose may be continuously infused, or may be a bolus injection. Further, the dosages of the therapeutic formulations may be proportionally increased or decreased as indicated by the exigencies of the therapeutic or prophylactic situation.
- compositions of the present invention may be carried out using known procedures, at dosages and for periods of time effective to treat a disease or disorder in the patient.
- An effective amount of the therapeutic compound necessary to achieve a therapeutic effect may vary according to factors such as the activity of the particular compound employed; the time of administration; the rate of excretion of the compound; the duration of the treatment; other drugs, compounds or materials used in combination with the compound; the state of the disease or disorder, age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well-known in the medical arts. Dosage regimens may be adjusted to provide the optimum therapeutic response.
- an effective dose range for a therapeutic compound of the invention is from about 0.01 and 50 mg/kg of body weight/per day.
- One of ordinary skill in the art would be able to study the relevant factors and make the determination regarding the effective amount of the therapeutic compound without undue experimentation.
- the compound can be administered to an animal as frequently as several times daily, or it may be administered less frequently, such as once a day, once a week, once every two weeks, once a month, or even less frequently, such as once every several months or even once a year or less.
- the amount of compound dosed per day may be administered, in non-limiting examples, every day, every other day, every 2 days, every 3 days, every 4 days, or every 5 days.
- a 5 mg per day dose may be initiated on Monday with a first subsequent 5 mg per day dose administered on Wednesday, a second subsequent 5 mg per day dose administered on Friday, and so on.
- the frequency of the dose is readily apparent to the skilled artisan and depends upon any number of factors, such as, but not limited to, the type and severity of the disease being treated, and the type and age of the animal.
- Actual dosage levels of the active ingredients in the pharmaceutical compositions of this invention may be varied so as to obtain an amount of the active ingredient that is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.
- a medical doctor, physician or veterinarian, having ordinary skill in the art may readily determine and prescribe the effective amount of the pharmaceutical composition required.
- the physician or veterinarian could start doses of the compounds of the invention employed in the pharmaceutical composition at levels lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved.
- Dosage unit form refers to physically discrete units suited as unitary dosages for the patients to be treated; each unit containing a predetermined quantity of therapeutic compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical vehicle.
- the dosage unit forms of the invention are dictated by and directly dependent on (a) the unique characteristics of the therapeutic compound and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding/formulating such a therapeutic compound for the treatment of a disease or disorder in a patient.
- compositions of the invention are administered to the patient in dosages that range from one to five times per day or more.
- the compositions of the invention are administered to the patient in range of dosages that include, but are not limited to, once every day, every two, days, every three days to once a week, and once every two weeks.
- the frequency of administration of the various combination compositions of the invention varies from subject to subject depending on many factors including, but not limited to, age, disease or disorder to be treated, gender, overall health, and other factors.
- the invention should not he construed to he limited to any particular dosage regime and the precise dosage and composition to be administered to any patient will he determined by the attending physical taking all other factors about the patient into account.
- Compounds of the invention for administration may be in the range of from about 1 ⁇ g to about 7,500 mg, about 20 ⁇ g to about 7,000 mg, about 40 ⁇ g, to about 6,500 mg, about 80 ⁇ g to about 6,000 mg, about 100 ⁇ g to about 5,500 mg, about 200 ⁇ g to about 5,000 mg, about 400 ⁇ g to about 4,000 mg, about 800 ⁇ g to about 3,000 mg, about 1 mg to about 2,500 mg, about 2 mg to about 2,000 mg, about 5 mg to about 1,000 mg, about 10 mg to about 750 mg, about 20 mg to about 600 mg, about 30 mg to about 500 mg, about 40 mg to about 400 mg, about 50 mg to about 300 mg, about 60 mg to about 250 mg, about 70 mg to about 200 mg, about 80 mg to about 150 mg, and any and all whole or partial increments therebetween.
- the dose of a compound of the invention is from about 0.5 ⁇ g and about 5,000 mg. In some embodiments, a dose of a compound of the invention used in compositions described herein is less than about 5,000 mg, or less than about 4,000 mg, or less than about 3,000 mg, or less than about 2,000 mg, or less than about 1,000 mg, or less than about 800 mg, or less than about 600 mg, or less than about 500 mg, or less than about 200 mg, or less than about 50 mg.
- a dose of a second compound as described herein is less than about 1,000 mg, or less than about 800 mg, or less than about 600 mg, or less than about 500 mg, or less than about 400 mg, or less than about 300 mg, or less than about 200 mg, or less than about 100 mg, or less than about 50 mg, or less than about 40 mg, or less than about 30 mg, or less than about 25 mg, or less than about 20 mg, or less than about 15 mg, or less than about 10 mg, or less than about 5 mg, or less than about 2 mg, or less than about I mg, or less than about 0.5 mg, and any and all whole or partial increments thereof.
- the present invention is directed to a packaged pharmaceutical composition
- a packaged pharmaceutical composition comprising a container holding a therapeutically effective amount of a compound of the invention, alone or in combination with a second pharmaceutical agent; and instructions for using the compound to treat, prevent, or reduce one or more symptoms of a disease or disorder in a patient.
- the term “container” includes any receptacle for holding the pharmaceutical composition.
- the container is the packaging that contains the pharmaceutical composition.
- the container is not the packaging that contains the pharmaceutical composition, i.e., the container is a receptacle, such as a box or vial that contains the packaged pharmaceutical composition or unpackaged pharmaceutical composition and the instructions for use of the pharmaceutical composition.
- packaging techniques are well known in the art. It should be understood that the instructions for use of the pharmaceutical composition may he contained on the packaging containing the pharmaceutical composition, and as such the instructions form an increased functional relationship to the packaged product. However, it should be understood that the instructions may contain information pertaining to the compound's ability to perform its intended function, e.g., treating, preventing, or reducing a disease or disorder in a patient.
- Routes of administration of any of the compositions of the invention include inhalational, oral, nasal, rectal, parenteral, sublingual, transdermal, transmucosal (e.g., sublingual, lingual, (trans)buccal, (trans)urethral, vaginal (e.g., trans- and perivaginally), (intra)nasal, and (trans)rectal), intravesical, intrapulmonary, intraduodenal, intragastrical, intrathecal, subcutaneous, intramuscular, intradermal, intra-arterial, intravenous, intrabronchial, inhalation, and topical administration.
- inhalational e.g., sublingual, lingual, (trans)buccal, (trans)urethral, vaginal (e.g., trans- and perivaginally), intravesical, intrapulmonary, intraduodenal, intragastrical, intrathecal, subcutaneous, intramuscular, intradermal, intra-arterial, intravenous, intrabronchi
- compositions and dosage forms include, for example, tablets, capsules, caplets, pills, gel caps, troches, dispersions, suspensions, solutions, syrups, granules, beads, transdermal patches, gels, powders, pellets, magmas, lozenges, creams, pastes, plasters, lotions, discs, suppositories, liquid sprays for nasal or oral administration, dry powder or aerosolized formulations for inhalation, compositions and formulations for intravesical administration and the like. It should be understood that the formulations and compositions that would be useful in the present invention are not limited to the particular formulations and compositions that are described herein.
- compositions intended for oral use may be prepared according to any method known in the art and such compositions may contain one or more agents selected from the group consisting of inert, non-toxic pharmaceutically excipients that are suitable for the manufacture of tablets.
- excipients include, for example an inert diluent such as lactose; granulating and disintegrating agents such as cornstarch; binding agents such as starch; and lubricating agents such as magnesium stearate.
- Tablets may be non-coated or they may be coated using known methods to achieve delayed disintegration in the gastrointestinal tract of a subject, thereby providing sustained release and absorption of the active ingredient.
- a material such as glyceryl monostearate or glyceryl distearate may be used to coat tablets.
- tablets may be coated using methods described in U.S. Pat. Nos. 4,256,108; 4,160,452; and 4,265,874 to form osmotically controlled release tablets.
- Tablets may further comprise a sweetening agent, a flavoring agent, a coloring agent, a preservative, or some combination of these in order to provide for pharmaceutically elegant and palatable preparation.
- Hard capsules comprising the active ingredient may be made using a physiologically degradable composition, such as gelatin. Such hard capsules comprise the active ingredient, and may further comprise additional ingredients including, for example, an inert solid diluent such as calcium carbonate, calcium phosphate, or kaolin.
- an inert solid diluent such as calcium carbonate, calcium phosphate, or kaolin.
- Soft gelatin capsules comprising the active ingredient may be made using a physiologically degradable composition, such as gelatin.
- Such soft capsules comprise the active ingredient, which may be mixed with water or an oil medium such as peanut oil, liquid paraffin, or olive oil.
- the compounds of the invention may be in the form of tablets or capsules prepared by conventional means with pharmaceutically acceptable excipients such as binding agents; fillers; lubricants; disintegrates; or wetting agents.
- the tablets may be coated using suitable methods and coating materials such as OPADRYTM film coating systems available from Colorcon, West Point, Pa. (e.g., OPADRYTM OY Type, OYC Type, Organic Enteric OY-P Type, Aqueous Enteric OY-A Type, OY-PM Type and OPADRYTM White, 32K18400).
- Liquid preparation for oral administration may be in the form of solutions, syrups or suspensions.
- the liquid preparations may be prepared by conventional means with pharmaceutically acceptable additives such as suspending agents (e.g., sorbitol syrup, methyl cellulose or hydrogenated edible fats); emulsifying agent (e.g., lecithin or acacia); non-aqueous vehicles (e.g., almond oil, oily esters or ethyl alcohol); and preservatives (e.g., methyl or propyl para-hydroxy benzoates or sorbic acid).
- suspending agents e.g., sorbitol syrup, methyl cellulose or hydrogenated edible fats
- emulsifying agent e.g., lecithin or acacia
- non-aqueous vehicles e.g., almond oil, oily esters or ethyl alcohol
- preservatives e.g., methyl or propyl para-hydroxy benzoates or sorbic acid
- a tablet comprising the active ingredient may, for example, be made by compressing or molding the active ingredient, optionally with one or more additional ingredients.
- Compressed tablets may be prepared by compressing, in a suitable device, the active ingredient in a free-flowing form such as a powder or granular preparation, optionally mixed with one or more of a binder, a lubricant, an excipient, a surface active agent, and a dispersing agent.
- Molded tablets may be made by molding, in a suitable device, a mixture of the active ingredient, a pharmaceutically acceptable carrier, and at least sufficient liquid to moisten the mixture.
- compositions used in the manufacture of tablets include, but are not limited to, inert diluents, granulating and disintegrating agents, binding agents, and lubricating agents.
- Known dispersing agents include, but are not limited to, potato starch and sodium starch glycollate.
- Known surface-active agents include, but are not limited to, sodium lauryl sulphate.
- Known diluents include, but are not limited to, calcium carbonate, sodium carbonate, lactose, microcrystalline cellulose, calcium phosphate, calcium hydrogen phosphate, and sodium phosphate.
- Known granulating and disintegrating agents include, but are not limited to, corn starch and alginic acid.
- binding agents include, but are not limited to, gelatin, acacia, pre-gelatinized maize starch, polyvinylpyrrolidone, and hydroxypropyl methylcellulose.
- Known lubricating agents include, but are not limited to, magnesium stearate, stearic acid, silica, and talc.
- Granulating techniques are well known in the pharmaceutical art for modifying starting powders or other particulate materials of an active ingredient.
- the powders are typically mixed with a binder material into larger permanent free-flowing agglomerates or granules referred to as a “granulation.”
- solvent-using “wet” granulation processes are generally characterized in that the powders are combined with a binder material and moistened with water or an organic solvent under conditions resulting in the formation of a wet granulated mass from which the solvent must then be evaporated.
- Melt granulation generally consists in the use of materials that are solid or semi-solid at room temperature (i.e. having a relatively low softening or inciting point range) to promote granulation of powdered or other materials, essentially in the absence of added water or other liquid solvents.
- the low melting solids when heated to a temperature in the melting point range, liquefy to act as a binder or granulating medium.
- the liquefied solid spreads itself over the surface of powdered materials with which it is contacted, and on cooling, forms a solid granulated mass in which the initial materials are bound together.
- the resulting melt granulation may then be provided to a tablet press or be encapsulated for preparing the oral dosage form.
- Melt granulation improves the dissolution rate and bioavailability of an active (i.e. drug) by forming a solid dispersion or solid solution.
- U.S. Pat. No. 5,169,645 discloses directly compressible wax-containing granules having improved flow properties.
- the granules are obtained when waxes are admixed in the melt with certain flow improving additives, followed by cooling and granulation of the admixture.
- certain flow improving additives such as sodium bicarbonate
- the present invention also includes a multi-layer tablet comprising a layer providing for the delayed release of one or more compounds useful within the methods of the invention, and a further layer providing for the immediate release of one or more compounds useful within the methods of the invention.
- a gastric insoluble composition may be obtained in which the active ingredient is entrapped, ensuring its delayed release.
- parenteral administration of a pharmaceutical composition includes any route of administration characterized by physical breaching of a tissue of a subject and administration of the pharmaceutical composition through the breach in the tissue.
- Parenteral administration thus includes, but is not limited to, administration of a pharmaceutical composition by injection of the composition, by application of the composition through a surgical incision, by application of the composition through a tissue-penetrating non-surgical wound, and the like.
- parenteral administration is contemplated to include, but is not limited to, subcutaneous, intravenous, intraperitoneal, intramuscular, intrasternal injection, and kidney dialytic infusion techniques.
- Formulations of a pharmaceutical composition suitable for parenteral administration comprise the active ingredient combined with a pharmaceutically acceptable carrier, such as sterile water or sterile isotonic saline. Such formulations may be prepared, packaged, or sold in a form suitable for bolus administration or for continuous administration. injectable formulations may be prepared, packaged, or sold in unit dosage form, such as in ampules or in multi-dose containers containing a preservative.
- Formulations for parenteral administration include, but are not limited to, suspensions, solutions, emulsions in oily or aqueous vehicles, pastes, and implantable sustained-release or biodegradable formulations. Such formulations may further comprise one or more additional ingredients including, but not limited to, suspending, stabilizing, or dispersing agents.
- the active ingredient is provided in dry (i.e., powder or granular) form for reconstitution with a suitable vehicle sterile pyrogen-free water) prior to parenteral administration of the reconstituted composition.
- compositions may be prepared, packaged, or sold in the form of a sterile injectable aqueous or oily suspension or solution.
- This suspension or solution may he formulated according to the known art, and may comprise, in addition to the active ingredient, additional ingredients such as the dispersing agents, wetting agents, or suspending agents described herein.
- Such sterile injectable formulations may be prepared using a non-toxic parenterally-acceptable diluent or solvent, such as water or 1,3-butanediol, for example.
- Other acceptable diluents and solvents include, but are not limited to, Ringer's solution, isotonic sodium chloride solution, and fixed oils such as synthetic mono- or di-glycerides.
- compositions for sustained release or implantation may comprise pharmaceutically acceptable polymeric or hydrophobic materials such as an emulsion, an ion exchange resin, a sparingly soluble polymer, or a sparingly soluble salt.
- Additional dosage forms of this invention include dosage forces as described in U.S. Pat. Nos. 6,340,475, 6,488,962, 6,451,808, 5,972,389, 5,582,837, and 5,007,790. Additional dosage forms of this invention also include dosage forms as described in U.S. Patent Applications Nos. 20030147952, 20030104062, 20030104053, 20030044466, 20030039688, and 20020051820. Additional dosage forms of this invention also include dosage forms as described in PCT Applications Nos.
- Controlled- or sustained-release formulations of a pharmaceutical composition of the invention may be made using conventional technology.
- the dosage forms to be used can be provided as slow or controlled-release of one or more active ingredients therein using, for example, hydropropylmethyl cellulose, other polymer matrices, gels, permeable membranes, osmotic systems, multilayer coatings, microparticles, liposomes, or microspheres or a combination thereof to provide the desired release profile in varying proportions.
- Suitable controlled-release formulations known to those of ordinary skill in the art, including those described herein, can be readily selected for use with the pharmaceutical compositions of the invention.
- single unit dosage forms suitable for oral administration such as tablets, capsules, gelcaps, and caplets, which are adapted for controlled-release are encompassed by the present invention.
- controlled-release pharmaceutical products have a common goal of improving drug therapy over that achieved by their non-controlled counterparts.
- the use of an optimally designed controlled-release preparation in medical treatment is characterized by a minimum of drug substance being employed to cure or control the condition in a minimum amount of time.
- Advantages of controlled-release formulations include extended activity of the drug, reduced dosage frequency, and increased patient compliance.
- controlled-release formulations can be used to affect the time of onset of action or other characteristics, such as blood level of the drug, and thus can affect the occurrence of side effects.
- controlled-release formulations are designed to initially release an amount of drug that promptly produces the desired therapeutic effect, and gradually and continually release of other amounts of drug to maintain this level of therapeutic effect over an extended period of time.
- the drug In order to maintain this constant level of drug in the body, the drug must be released from the dosage form at a rate that will replace the amount of drug being metabolized and excreted from the body.
- Controlled-release of an active ingredient can be stimulated by various inducers, for example pH, temperature, enzymes, water, or other physiological conditions or compounds.
- controlled-release component in the context of the present invention is defined herein as a compound or compounds, including, but not limited to, polymers, polymer matrices, gels, permeable membranes, liposomes, or microspheres or a combination thereof that facilitates the controlled-release of the active ingredient.
- the formulations of the present invention may be, but are not limited to, short-term, rapid-offset, as well as controlled, for example, sustained release, delayed release and pulsatile release formulations.
- sustained release is used in its conventional sense to refer to a drug formulation that provides for gradual release of a drug over an extended period of time, and that may, although not necessarily, result in substantially constant blood levels of a drug over an extended time period.
- the period of time may be as long as a month or more and should be a release which is longer that the same amount of agent administered in bolus form.
- the compounds may be formulated with a suitable polymer or hydrophobic material which provides sustained, release properties to the compounds.
- the compounds for use the method of the invention may be administered in the form of microparticles, for example, by injection or in the form of wafers or discs by implantation.
- the compounds of the invention are administered to a patient, alone or in combination with another pharmaceutical agent, using a sustained release formulation.
- delayed release is used herein in its conventional sense to refer to a drug formulation that provides for an initial release of the drug after some delay following drug administration and that mat, although not necessarily, includes a delay of from about 10 minutes up to about 12 hours.
- pulsatile release is used herein in its conventional sense to refer to a drug formulation that provides release of the drug in such a way as to produce pulsed plasma profiles of the drug after drug administration.
- immediate release is used in its conventional sense to refer to a drug formulation that provides for release of the drug immediately after drug administration.
- short-term refers to any period of time up to and including about 8 hours, about 7 hours, about 6 hours, about 5 hours, about 4 hours, about 3 hours, about 2 hours, about 1 hour, about 40 minutes, about 20 minutes, or about 10 minutes and any or all whole or partial increments thereof after drug administration after drug administration.
- rapid-offset refers to any period of time up to and including about 8 hours, about 7 hours, about 6 hours, about 5 hours, about 4 hours, about 3 hours, about 2 hours, about 1 hour, about 40 minutes, about 20 minutes, or about 10 minutes, and any and all whole or partial increments thereof after drug administration.
- reaction conditions including but not limited to reaction times, reaction size/volume, and experimental reagents, such as solvents, catalysts, pressures, atmospheric conditions, e.g., nitrogen atmosphere, and reducing/oxidizing agents, with art-recognized alternatives and using no more than routine experimentation, are within the scope of the present application.
- SEQ ID NO: 7 (ESS) n wherein n is an integer ranging between 1 and 20.
- SEQ ID NO: 8 (RQQ) n wherein n is an integer ranging between 1 and 20.
- SEQ ID NO: 9 (KR) n wherein n is an integer ranging between 1 and 20.
- SEQ ID NO: 10 R n wherein n is an integer ranging between 1 and 20.
- SEQ ID NO: 11 (KR) n wherein n is an integer ranging between 1 and 20.
- SEQ ID NO: 12 DSSSEEKFLRRIGRFG SEQ ID NO: 13 EEEEEEEPRGDT SEQ ID NO: 14 APWHLSSQYSRT SEQ ID NO: 15 STLPIPHEFSRE SEQ ID NO: 16 VTKHLNQISQSY SEQ ID NO: 17 E n , wherein n is an integer ranging between 1 and 20.
- SEQ ID NO: 18 D n wherein n is an integer ranging between 1 and 20.
- ENPP121-NPP3-Fc sequence (SEQ ID NO: 19) MERDGCAGGG SRGGEGGRAP REGPAGNGRD RGRSHAAEAP GDPQAAASLL APMDVGEEPL EKAARARTAK DPNTYKIIS L FTFAVGVNIC LGFTA KQGSC RKKCFDASFR GLENCRCDVA CKDRGDCCWD FEDTCVESTR IWMCNKFRCG ERLEASLCSC SDDCLQRKDC CADYKSVCQG ETSWLEENCD TAQQSQCPEG FDLPPVILFS MDGFRAEYLY TWDTLMPNIN KLKTCGIHSK YMRAMYPTKT FPNHYTIVTG LYPESHGIID NNMYDVNLNK NFSLSSKEQN NPAWWHGQPM WLTAMYQGLK AATYFWPGSE VAINGSFPSI YMPYNGSVPF EERISTLLKW LDLPKAERPR FYTMYEEEPD SSGHAGGPVS ARVIKALQVV
- IgG Fe domain is selected from any of the subclasses IgG1, IgG2, IgG3 and IgG4. In other embodiments, instead of Fc domain, albumin domain is used.
- the NPP3 C-terminus and the Fc/albumin domain are connected by a linker.
- the linker comprises at least two amino acids.
- the linker comprises 2-40 amino acids, 2-30 amino acids, 2-20 amino acids, 2-18 amino acids, 2-16 amino acids, 2-14 amino acids, 2-12 amino acids, 2-10 amino acids, 2-8 amino acids, 2-6 amino acids, 2-4 amino acids, or 2 amino acids.
- the flexible linker comprises a polyethylene glycol chain and/or a hydrocarbon chain (such as an alkylene chain).
- IgG Fc sequence (SEQ ID NO: 20) DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAK TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRE EMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPGK ENPP7-NPP3-Fc sequence (SEQ ID NO: 21) MRGPAVLLTV ALATLLAPGA KQGSC RKKCFDASFR GLENCRCDVA CKDRGDCCWD FEDTCVESTR IWMCNKFRCG ERLEASLCSC SDDCLQRKDC CADYKSVCQG ETSWLEENCD TAQQSQCPEG FDLPPVIL
- the IgG Fc domain is selected from any of the subclasses IgG1, IgG2, IgG3 and IgG4. In other embodiments, instead of Fc domain, albumin domain is used.
- the NPP3 C-terminus and the Fc/albumin domain are connected by a linker.
- the linker comprises at least two amino acids.
- the linker comprises 2-40 amino acids, 2-30 amino acids, 2-20 amino acids, 2-18 amino acids, 2-16 amino acids, 2-14 amino acids, 2-12 amino acids, 2-10 amino acids, 2-8 amino acids, 2-6 amino acids, 2-4 amino acids, or 2 amino acids.
- the flexible linker comprises a polyethylene glycol chain and/or a hydrocarbon chain (such as an alkylene chain).
- ENPP5-NPP3-Fc sequence (SEQ ID NO: 22) MTSKFLLVSF ILAALSLSTT FS KQGSC RKKCFDASFR GLENCRCDVA CKDRGDCCWD FEDTCVESTR IWMCNKFRCG ERLEASLCSC SDDCLQRKDC CADYKSVCQG ETSWLEENCD TAQQSQCPEG FDLPPVILFS MDGFRAEYLY TWDTLMPNIN KLKTCGIHSK YMRAMYPTKT FPNHYTIVTG LYPESHGIID NNMYDVNLNK NTSLSSKEQN NPAWWHGQPM WLTAMYQGLK AATYFWPGSE VAINGSFPSI YMPYNGSVPF EERISTLLKW LDLPKAERPR FYTMYFEEPD SSGHAGGPVS ARVIKALQVV DHAFGMLMEG LKQRNLHNCV NIILLADHGM DQTYCNKMEY MTDYFPRINF FYMYEGPAPR
- the IgG Fc domain is selected from any of the subclasses IgG1, IgG2, IgG3 and IgG4. In other embodiments, instead of Fe domain, albumin domain is used.
- the NPP3 C-terminus and the Fe/albumin domain are connected by a linker.
- the linker comprises at least two amino acids.
- the linker comprises 2-40 amino acids, 2-30 amino acids, 2-20 amino acids. 2-18 amino acids, 2-16 amino acids, 2-14 amino acids, 2-12 amino acids, 2-10 amino acids, 2-8 amino acids, 2-6 amino acids, 2-4 amino acids, or 2 amino acids.
- the flexible linker comprises a polyethylene glycol chain and/or a hydrocarbon chain (such as an alkylene chain).
- the NPP3 C-terminus and the albumin domain are connected by a linker.
- the linker comprises at least two amino acids.
- the linker comprises 2-40 amino acids, 2-30 amino acids, 2-20 amino acids, 2-18 amino acids, 2-16 amino acids, 2-14 amino acids, 2-12 amino acids, 2-10 amino acids, 2-8 amino acids, 2-6 amino acids, 2-4 amino acids, or 2 amino acids.
- the flexible linker comprises a polyethylene glycol chain and/or a hydrocarbon chain (such as an alkylene chain).
- ENPP7-NPP3-Albumin sequence (SEQ ID NO: 25) MRGPAVLLTV ALATLLAPGA KQGSC RKKCFDASFR GLENCRCDVA CKDRGDCCWD FEDTCVESTR IWMCNKFRCG ERLEASLCSC SDDCLQRKDC CADYKSVCQG ETSWLEENCD TAQQSQCPEG FDLPPVILFS MDGFRAEYLY TWDTLMPNIN KLKTCGIHSK YMRAMYPTKT FPNHYTIVTG LYPESHGIID NNMYDVNLNK NFSLSSKEQN NPAWWHGQPM WLTAMYQGLK AATYFWPGSE VAINGSFPSI YMPYNGSVPF EERISTLLKW LDLPKAERPR FYTMYFEEPD SSGHAGGPVS ARVIKALQVV DHAFGMLMEG LKQRNLHNCV NIILLADHGM DQTYCNKMEY MTDYFPRINF FYMYEGPAPR IRA
- Double underlined residues amino acid sequence of spacer sequence and albumin domain.
- the NPP3 C-terminus and the albumin domain are connected by a linker.
- the linker comprises at least two amino acids.
- the linker comprises 2-40 amino acids, 2-30 amino acids, 2-20 amino acids, 2-18 amino acids, 2-16 amino acids, 2-14 amino acids, 2-12 amino acids, 2-10 amino acids, 2-8 amino acids, 2-6 amino acids, 2-4 amino acids, or 2 amino acids.
- the flexible linker comprises a polyethylene glycol chain and/or a hydrocarbon chain (such as an alkylene chain).
- ENPP5-NPP3-albumin sequence (SEQ ID NO: 26) MTSKFLLVSF ILAALSLSTT FS KQGSC RKKCFDASFR GLENCRCDVA CKDRGDCCWD FEDTCVESTR IWMCNKFRCG ERLEASLCSC SDDCLQRKDC CADYKSVCQG ETSWLEENCD TAQQSQCPEG FDLPPVILFS MDGFRAEYLY TWDTLMPNIN KLKTCGIHSK YMRAMYPTKT FPNHYTIVTG LYPESHGIID NNMYDVNLNK NFSISSKEQN NPAWWHGQPM WLTAMYQGLK AATYFWPGSE VAINGSFPSI YMPYNGSVPF EERISTLLKW LDLPKAERPR FYTMYFEEPD SSGHAGGPVS ARVIKALQVV DHAFGMLMEG LKQRNLHNCV NIILLADHGM DQTYCNKMEY MTDYFPRINF FYMYEGPAPR
- the NPP3 C-terminus and the albumin domain are connected by a linker.
- the linker comprises at least two amino acids.
- the linker comprises 2-40 amino acids, 2-30 amino acids, 2-20 amino acids, 2-18 amino acids, 2-16 amino acids, 2-14 amino acids, 2-12 amino acids, 2-10 amino acids, 2-8 amino acids, 2-6 amino acids, 2-4 amino acids, or 2 amino acids.
- the flexible linker comprises a polyethylene glycol chain and/or a hydrocarbon chain (such as an alkylene chain).
- NPP121-NPP3-Fc Nucleotide sequence of NPP121-NPP3-Fc (SEQ ID NO: 27) ATGGAAAGGGACGGATGCGCCGGTGGTGGATCTCG CGGAGGCGAAGGTGGAAGGGCCCCTAGGGAAGGACCTGCCGGAAACGGAAGGGACAGGGG ACGCTCACGCCGCTGAAGCTCCAGGCGACCCTCAGGCCGCTGCCTCTCTGCTGGCTCC TATGGACGTCGGAGAAGAACCCCTGGAAAAGGCCGCCAGGGCCAGGACTGCCAAGGACCC CAACACCTACAAGATCATCTCCCTCTCTTCACTTTCGCCGTCGGAGTCAACATCTGCCTGGG ATTCACCGCCGAAAAGCAAGGCAGCTGCAGGAAGAAGTGCTTTGATGCATCATTTAGAGG ACTGGAGAACTGCCGGTGTGATGTGGCATGTAAAGACCGAGGTGATTGCTGCTGGGATTT TGAAGACACCTGTGTGTGCAATAAATTTCGTTGTGGAGA GACCAGATT
- FIGS. 1A-1C comprise graphs illustrating studies of hNPP3 steady state ATP hydrolysis activity.
- time courses of AMP product formation after addition of 50 nM hNPP3 with (from bottom to top) 0.98, 1.95, 3.9, 7.8, 15.6, 31.3, 62.5, 125, 250 or 500 ⁇ M ATP were analyzed.
- the enzyme reaction was quenched with equal volume of 3 M formic acid at different times and the reaction product, AMP, was quantified by HPLC analysis with an AMP standard curve. The smooth line through the data points were best fits to a non-linear enzyme kinetic model with product inhibition and substrate depletion.
- FIG. 1B illustrates steady state ATPase cycling rate comparison hNPP3 substrate concentration dependence of initial steady state enzyme cycling rate was compared with that measured for hNPP1.
- ATPase cycling reaction of both 50 nM hNPP3 and hNPP1 depleted ATP substrate within 1 minute at 0.98, 1.95 and 3.9 ⁇ M ATP. The uncertainty at these low ATP concentrations was significant, and thus these three rates were omitted from the data set during fitting.
- the hNPP3 steady state ATPase reaction reached the maximum (k cat ) of 2.59( ⁇ 0.04) s ⁇ 1 enzyme ⁇ 1 , from the weighted average of the measured rates at 7.8, 15.6, 31.3, 62.5, 125 ⁇ M substrate.
- the turnover rate of hNPP1 was 3.46( ⁇ 0.44) s ⁇ 1 enzyme ⁇ 1 .
- the K M for ATP substrate was estimated to be ⁇ 8 ⁇ M.
- FIG. 1C illustrates substrate concentration dependence of the ⁇ value.
- the decreasing ⁇ value with substrate concentration for both enzymes indicates that substrate depletion contributes to the non-linearity in the enzyme reaction time courses much more than product inhibition at lower initial substrate concentrations.
- the similarity of hNPP3 and hNPP1 ⁇ values was consistent with the two enzymes having similar reaction rates and product inhibition.
- ENPP3 is produced by establishing stable transfections in either CHO or HEK293 mammalian cells.
- the protein can be produced in either adherent or suspension cells.
- To establish stable cell lines the nucleic acid sequence encoding NPP3 fusion proteins ( FIGS. 3-5 & SEQ ID NO:s 1-29) into an appropriate vector for large scale protein production. There are a variety of these vectors available from commercial sources and any of those can be used.
- FIG. 3 illustrates a plasmid map of ENPP1-2-1-exENPP3-Fc cloned into the pcDNA3 plasmid with appropriate endonuclease restriction sites.
- the protein subdomains are color coded to illustrate the signal sequence, extracellular domain of ENPP3, and Fc domains of the fusion protein.
- the amino acid sequence of the cloned protein is also displayed below the plasmid map and also color coded to illustrate the domains of the fusion protein.
- the pcDNA3 plasmid containing the desired protein constructs can be stably transfected into expression plasmid using established techniques such as electroporation or lipofectamine, and the cells can be grown under antibiotic selection to enhance for stably transfected cells.
- Clones of single, stably transfected cells are then established and screened for high expressing clones of the desired fusion protein.
- Screening of the single cell clones for ENPP3 protein expression can be accomplished in a high-throughput manner in 96 well plates using the synthetic enzymatic substrate pNP-TMP as previously described for ENPP1 (Saunders, et al., 2008, Mol. Cancer Therap, 7(10):3352-62; Albright, et al., 2015, Nat Commun. 6:10006).
- protein production can be accomplished in shaking flasks or bio-reactors previously described for ENPP1 (Albright, et al., 2015, Nat Commun. 6:10006).
- Purification of ENPP3 can be accomplished using a combination of standard purification techniques known in the art. These techniques are well known in art and are selected from techniques such as column chromatograph, ultracentrifugation, filtration, and precipitation. Column chromatographic purification is accomplished using affinity chromatography such as protein-A and protein-G resins, metal affinity resins such as nickel or copper, hydrophobic exchange chromatography, and reverse-phase high-pressure chromatography (HPLC) using C8-C14 resins.
- affinity chromatography such as protein-A and protein-G resins
- metal affinity resins such as nickel or copper
- HPLC reverse-phase high-pressure chromatography
- Ion exchange may also be employed, such as anion and cation exchange chromatography using commercially available resins such as Q-sepharose (anion exchange) and SP-sepharose (cation exchange), blue sepharose resin and blue-sephadex resin, and hydroxyapatite resins. Size exclusion chromatography using commercially available S-75 and 5200 Superdex resins can also be employed, as known in the art. Buffers used to solubilize the protein, and provide the selection media for the above described chromatographic steps, are standard biological buffers known to practitioners of the art and science of protein chemistry.
- buffers that are used in preparation include citrate, phosphate, acetate, tris(hydroxymethyl)aminomethane, saline buffers, glycine-HCL buffers, Cacodylate buffers, and sodium barbital buffers, which are well known in art.
- Using a single techniques, or a series of techniques in combination, and the appropriate buffer systems adjusted to the appropriate one can purify the fusion proteins described to greater than 99% purity from crude material (see, for example, FIG. 2 ).
- This figure compares partially purified ENPP3 and the crude starting material side by side on a Coomasie stained polyacrylamide gel after a single purification step. As demonstrated in FIG.
- a protein of molecular weight slightly greater than 105 kD corresponding to the appropriate molecular weight of ENPP3 was enriched from the crude starting material displayed in the right lane after a single purification step.
- This material can then be additionally purified using additional techniques and/or chromatographic steps as described above, to reach substantially higher purity such as ⁇ 99% purity.
- the purified protein has enzymatic activity comparable to the enzymatic activity described and demonstrated in FIGS. 1A-1C .
- Certain embodiments of the invention contemplate the usage of plasma pyrophosphate as a biomarker to determine which individuals are at risk for diseases of ectopic calcification of the soft tissues, calcification of the medial vascular wall, low bone mineral density, osteopenia, stroke, arthritis, and/or hereditary forms of rickets.
- Plasma PPi has not been clinically used to predict individuals at risk for the above disorders, as demonstrated by the lack of a plasma PPi test in catalogs of laboratory tests offered by leading clinical laboratories, such as Mayo Medical Laboratory (www dot mayomedicallaboratories dot com/test-catalog/alphabetical/P) or Yale University, or leading commercial reference laboratories such as ARUP (ltd dot aruplab dot com/Search/Browse/P) or The Quest Diagnostics Nichols Institute (www dot specialtylabs dot com/about_us/).
- plasma PPi has clinical utility as a predictive and diagnostic agent to identify individuals at risk for the above disorders of calcification, ossification, stroke, osteopenia, low bone mineral density, and/or arthritis.
- the measurement of plasma PPi can be accomplished by several published methods including radio-isotopic (Cheung, et al., 1977, Anal. Biochem. 83(1):61-3) and fluorescent (Jansen, et al., 2013, PNAS USA 110(50):20206-11; Jansen, et al., 2014, Arterioscler. Thromb. Vasc. Biol. 34(9):1985-9).
- Correct measurement of plasma PPi requires that platelets are removed from the plasma and that the whole blood, when collected, is not hemolyzed. Platelets can be removed from the blood either by high speed centrifugation or by ultrafiltration.
- Plasma that has been collected from non-hemolyzed blood and removed of platelets can be used to reliable measure PPi concentrations, and can provide clinical utility as predictive diagnostic identifying patients at risk for the above mentioned disorders.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- Wood Science & Technology (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- General Engineering & Computer Science (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Microbiology (AREA)
- Molecular Biology (AREA)
- Immunology (AREA)
- Biomedical Technology (AREA)
- Epidemiology (AREA)
- Biotechnology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Physical Education & Sports Medicine (AREA)
- Mycology (AREA)
- Rheumatology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Toxicology (AREA)
- Biophysics (AREA)
- Obesity (AREA)
- Diabetes (AREA)
- Hematology (AREA)
- Vascular Medicine (AREA)
- Urology & Nephrology (AREA)
- Heart & Thoracic Surgery (AREA)
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US15/777,446 US20180371434A1 (en) | 2015-11-20 | 2016-11-21 | Compositions for Treating Ectopic Calcification Disorders, and Methods Using Same |
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562257883P | 2015-11-20 | 2015-11-20 | |
| US15/777,446 US20180371434A1 (en) | 2015-11-20 | 2016-11-21 | Compositions for Treating Ectopic Calcification Disorders, and Methods Using Same |
| PCT/US2016/063034 WO2017087936A1 (en) | 2015-11-20 | 2016-11-21 | Compositions for treating ectopic calcification disorders, and methods using same |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/063034 A-371-Of-International WO2017087936A1 (en) | 2015-11-20 | 2016-11-21 | Compositions for treating ectopic calcification disorders, and methods using same |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/075,398 Continuation US20210032610A1 (en) | 2015-11-20 | 2020-10-20 | Compositions for Treating Ectopic Calcification Disorders, and Methods Using Same |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20180371434A1 true US20180371434A1 (en) | 2018-12-27 |
Family
ID=58719303
Family Applications (4)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/777,446 Abandoned US20180371434A1 (en) | 2015-11-20 | 2016-11-21 | Compositions for Treating Ectopic Calcification Disorders, and Methods Using Same |
| US17/075,398 Abandoned US20210032610A1 (en) | 2015-11-20 | 2020-10-20 | Compositions for Treating Ectopic Calcification Disorders, and Methods Using Same |
| US18/068,256 Active US12234489B2 (en) | 2015-11-20 | 2022-12-19 | Compositions for treating ectopic calcification disorders, and methods using same |
| US19/033,863 Pending US20250388882A1 (en) | 2015-11-20 | 2025-01-22 | Compositions for treating ectopic calcification disorders, and methods using same |
Family Applications After (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/075,398 Abandoned US20210032610A1 (en) | 2015-11-20 | 2020-10-20 | Compositions for Treating Ectopic Calcification Disorders, and Methods Using Same |
| US18/068,256 Active US12234489B2 (en) | 2015-11-20 | 2022-12-19 | Compositions for treating ectopic calcification disorders, and methods using same |
| US19/033,863 Pending US20250388882A1 (en) | 2015-11-20 | 2025-01-22 | Compositions for treating ectopic calcification disorders, and methods using same |
Country Status (6)
| Country | Link |
|---|---|
| US (4) | US20180371434A1 (cg-RX-API-DMAC7.html) |
| EP (2) | EP3377105A4 (cg-RX-API-DMAC7.html) |
| JP (3) | JP2018537093A (cg-RX-API-DMAC7.html) |
| AU (2) | AU2016355715A1 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3005142A1 (cg-RX-API-DMAC7.html) |
| WO (1) | WO2017087936A1 (cg-RX-API-DMAC7.html) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12134790B2 (en) | 2017-09-27 | 2024-11-05 | Inozyme Pharma, Inc. | Methods of improving cardiovascular function and treating cardiovascular disease using a recombinant ectonucleotide pyrophosphatase phosphodiesterase (NPP1) |
| US12234489B2 (en) | 2015-11-20 | 2025-02-25 | Yale University | Compositions for treating ectopic calcification disorders, and methods using same |
| EP4225927A4 (en) * | 2020-10-08 | 2025-05-07 | Inozyme Pharma, Inc. | LIVER-SPECIFIC PRODUCTION OF ENPP1 OR ENPP3 |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3967755B1 (en) * | 2014-12-19 | 2024-03-27 | Inozyme Pharma, Inc. | Soluble npp1 for use in a method for treating pseudoxanthoma elasticum |
| EP3471747A1 (en) | 2016-06-16 | 2019-04-24 | Alexion Pharmaceuticals, Inc. | Methods of treating myointimal proliferation |
| CA3032467A1 (en) | 2016-08-05 | 2018-02-08 | Yale University | Compositions and methods for stroke prevention in pediatric sickle cell anemia patients |
| CN120383683A (zh) | 2018-08-31 | 2025-07-29 | 耶鲁大学 | Enpp1多肽及其使用方法 |
| CA3184349A1 (en) * | 2020-07-02 | 2022-01-06 | Damon BANKS | Compositions and methods for treating allograft vasculopathy, moyamoya disease, moyamoya syndrome and intimal proliferation |
Family Cites Families (41)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4160452A (en) | 1977-04-07 | 1979-07-10 | Alza Corporation | Osmotic system having laminated wall comprising semipermeable lamina and microporous lamina |
| US4256108A (en) | 1977-04-07 | 1981-03-17 | Alza Corporation | Microporous-semipermeable laminated osmotic system |
| US4265874A (en) | 1980-04-25 | 1981-05-05 | Alza Corporation | Method of delivering drug with aid of effervescent activity generated in environment of use |
| US5007790A (en) | 1989-04-11 | 1991-04-16 | Depomed Systems, Inc. | Sustained-release oral drug dosage form |
| US5169645A (en) | 1989-10-31 | 1992-12-08 | Duquesne University Of The Holy Ghost | Directly compressible granules having improved flow properties |
| US5582837A (en) | 1992-03-25 | 1996-12-10 | Depomed, Inc. | Alkyl-substituted cellulose-based sustained-release oral drug dosage forms |
| ES2124303T3 (es) | 1992-03-25 | 1999-02-01 | Depomed Inc | Formas de dosificacion de farmacos orales de liberacion retardada a base de hidroxietilcelulosa. |
| US6156501A (en) | 1993-10-26 | 2000-12-05 | Affymetrix, Inc. | Arrays of modified nucleic acid probes and methods of use |
| WO1995019570A1 (en) | 1994-01-14 | 1995-07-20 | Genentech, Inc. | Antagonists to insulin receptor tyrosine kinase inhibitor |
| AU3290397A (en) | 1996-06-10 | 1998-01-07 | Depomed, Inc. | Gastric-retentive oral controlled drug delivery system with enhanced retention properties |
| US5972389A (en) | 1996-09-19 | 1999-10-26 | Depomed, Inc. | Gastric-retentive, oral drug dosage forms for the controlled-release of sparingly soluble drugs and insoluble matter |
| US6635280B2 (en) | 1997-06-06 | 2003-10-21 | Depomed, Inc. | Extending the duration of drug release within the stomach during the fed mode |
| WO1998055107A1 (en) | 1997-06-06 | 1998-12-10 | Depomed, Inc. | Gastric-retentive oral drug dosage forms for controlled release of highly soluble drugs |
| US6043056A (en) | 1998-11-06 | 2000-03-28 | Incyte Pharmaceuticals, Inc. | Cell surface glycoproteins |
| HK1050135A1 (zh) | 1999-11-02 | 2003-06-13 | Depomed, Inc. | 用於促进将药物给予胃的饭後模式药理学诱导 |
| DE60123384T2 (de) | 2000-02-04 | 2007-08-02 | DepoMed, Inc., Menlo Park | Dosierungsform des typs "hülle und kern" mit einer wirkstofffreisetzung, die sich der nullten ordnung annähert |
| US6488962B1 (en) | 2000-06-20 | 2002-12-03 | Depomed, Inc. | Tablet shapes to enhance gastric retention of swellable controlled-release oral dosage forms |
| US6451808B1 (en) | 2000-10-17 | 2002-09-17 | Depomed, Inc. | Inhibition of emetic effect of metformin with 5-HT3 receptor antagonists |
| US7888372B2 (en) | 2001-03-23 | 2011-02-15 | National Institutes Of Health (Nih) | Compositions and methods for modulating bone mineral deposition |
| US20030191073A1 (en) * | 2001-11-07 | 2003-10-09 | Challita-Eid Pia M. | Nucleic acid and corresponding protein entitled 161P2F10B useful in treatment and detection of cancer |
| MXPA03011096A (es) | 2001-05-29 | 2004-12-06 | Depomed Dev Ltd | Metodo para el tratamiento de la enfermedad de reflujo gastroesofagico y la saturacion acida nocturna. |
| AU2002324700A1 (en) | 2001-08-14 | 2003-03-03 | Bayer Ag | Nucleic acid and amino acid sequences involved in pain |
| US20030091630A1 (en) | 2001-10-25 | 2003-05-15 | Jenny Louie-Helm | Formulation of an erodible, gastric retentive oral dosage form using in vitro disintegration test data |
| TWI312285B (en) | 2001-10-25 | 2009-07-21 | Depomed Inc | Methods of treatment using a gastric retained gabapentin dosage |
| JP2005508358A (ja) | 2001-10-25 | 2005-03-31 | デポメド・インコーポレイテッド | 胃滞留型ロサルタン投与量を用いる治療方法 |
| CA2409552A1 (en) | 2001-10-25 | 2003-04-25 | Depomed, Inc. | Gastric retentive oral dosage form with restricted drug release in the lower gastrointestinal tract |
| US6723340B2 (en) | 2001-10-25 | 2004-04-20 | Depomed, Inc. | Optimal polymer mixtures for gastric retentive tablets |
| US6682759B2 (en) | 2002-02-01 | 2004-01-27 | Depomed, Inc. | Manufacture of oral dosage forms delivering both immediate-release and sustained-release drugs |
| WO2003072593A2 (en) | 2002-02-21 | 2003-09-04 | University Of Virginia Patent Foundation | Bone targeting peptides |
| JP5199077B2 (ja) | 2005-06-10 | 2013-05-15 | アルタス ファーマシューティカルズ インコーポレイテッド | シュウ酸オキシダーゼ結晶の投与による、シュウ酸塩濃度を低下させるための方法 |
| WO2008105911A2 (en) | 2006-08-02 | 2008-09-04 | Altus Pharmaceuticals Inc. | Crystallized oxalate decarboxylase and methods of use |
| US20080273206A1 (en) * | 2007-04-23 | 2008-11-06 | University Of South Carolina | Biomimetic Mineralization Method and System |
| WO2009030254A1 (en) | 2007-09-04 | 2009-03-12 | Curevac Gmbh | Complexes of rna and cationic peptides for transfection and for immunostimulation |
| GB0803352D0 (en) | 2008-02-22 | 2008-04-02 | Ntnu Technology Transfer As | Oligopeptidic compounds and uses thereof |
| US8846603B2 (en) | 2010-03-12 | 2014-09-30 | Synageva Biopharma Corp. | NPP1 fusion proteins |
| RU2601154C2 (ru) | 2011-03-11 | 2016-10-27 | Синаджива Байофарма Корп | Гибридные белки npp1 |
| WO2014126965A2 (en) | 2013-02-13 | 2014-08-21 | Yale University | Compositions and methods for treating pathological calcification and ossification |
| ES2708565T3 (es) | 2013-03-15 | 2019-04-10 | Atyr Pharma Inc | Conjugados de Fc-histidil-ARNt sintetasa |
| EP3967755B1 (en) | 2014-12-19 | 2024-03-27 | Inozyme Pharma, Inc. | Soluble npp1 for use in a method for treating pseudoxanthoma elasticum |
| EP4414028A3 (en) | 2015-05-19 | 2024-11-27 | Yale University | Compositions for treating pathological calcification conditions, and methods using same |
| EP3377105A4 (en) * | 2015-11-20 | 2019-04-24 | Yale University | COMPOSITIONS FOR THE TREATMENT OF ECTOPIC CALIBRATION DISORDERS AND METHODS THEREWITH |
-
2016
- 2016-11-21 EP EP16867323.4A patent/EP3377105A4/en not_active Withdrawn
- 2016-11-21 EP EP22160246.9A patent/EP4079322A1/en active Pending
- 2016-11-21 JP JP2018526182A patent/JP2018537093A/ja active Pending
- 2016-11-21 CA CA3005142A patent/CA3005142A1/en active Pending
- 2016-11-21 WO PCT/US2016/063034 patent/WO2017087936A1/en not_active Ceased
- 2016-11-21 AU AU2016355715A patent/AU2016355715A1/en not_active Abandoned
- 2016-11-21 US US15/777,446 patent/US20180371434A1/en not_active Abandoned
-
2020
- 2020-10-20 US US17/075,398 patent/US20210032610A1/en not_active Abandoned
-
2021
- 2021-12-23 JP JP2021208914A patent/JP2022046619A/ja active Pending
-
2022
- 2022-12-19 US US18/068,256 patent/US12234489B2/en active Active
-
2023
- 2023-09-07 AU AU2023226739A patent/AU2023226739A1/en active Pending
-
2024
- 2024-02-02 JP JP2024014533A patent/JP2024032952A/ja active Pending
-
2025
- 2025-01-22 US US19/033,863 patent/US20250388882A1/en active Pending
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12234489B2 (en) | 2015-11-20 | 2025-02-25 | Yale University | Compositions for treating ectopic calcification disorders, and methods using same |
| US12134790B2 (en) | 2017-09-27 | 2024-11-05 | Inozyme Pharma, Inc. | Methods of improving cardiovascular function and treating cardiovascular disease using a recombinant ectonucleotide pyrophosphatase phosphodiesterase (NPP1) |
| EP4225927A4 (en) * | 2020-10-08 | 2025-05-07 | Inozyme Pharma, Inc. | LIVER-SPECIFIC PRODUCTION OF ENPP1 OR ENPP3 |
Also Published As
| Publication number | Publication date |
|---|---|
| EP4079322A1 (en) | 2022-10-26 |
| EP3377105A1 (en) | 2018-09-26 |
| EP3377105A4 (en) | 2019-04-24 |
| AU2023226739A1 (en) | 2023-09-28 |
| JP2022046619A (ja) | 2022-03-23 |
| US12234489B2 (en) | 2025-02-25 |
| AU2016355715A1 (en) | 2018-05-31 |
| US20250388882A1 (en) | 2025-12-25 |
| CA3005142A1 (en) | 2017-05-26 |
| US20210032610A1 (en) | 2021-02-04 |
| JP2018537093A (ja) | 2018-12-20 |
| JP2024032952A (ja) | 2024-03-12 |
| US20230227800A1 (en) | 2023-07-20 |
| WO2017087936A1 (en) | 2017-05-26 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12234489B2 (en) | Compositions for treating ectopic calcification disorders, and methods using same | |
| AU2022235636B2 (en) | Compositions for treating pathological calcification conditions, and methods using same | |
| JP2025090742A (ja) | 治療用組換えクロトータンパク質ならびにそれを含む組成物および方法 | |
| EP3493829B1 (en) | Compositions and methods for stroke prevention in pediatric sickle cell anemia patients | |
| HK40082720A (en) | Compositions for treating ectopic calcification disorders, and methods using same | |
| HK1252797B (en) | Compositions for treating pathological calcification conditions, and methods using same | |
| BR112017024141B1 (pt) | Composto compreendendo um polipeptídeo solúvel de ectonucleotídeo pirofosfato/fosfodiesterase-1 (enpp1), e seu uso | |
| BR122025001586A2 (pt) | Composto compreendendo um polipeptídeo solúvel de ectonucleotídeo pirofosfato/fosfodiesterase-1 (enpp1), e seu uso |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: YALE UNIVERSITY, CONNECTICUT Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:DE LA CRUZ, ENRIQUE;REEL/FRAME:046027/0260 Effective date: 20180604 |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |