US20170145078A1 - Engineered heterodimeric protein domains - Google Patents
Engineered heterodimeric protein domains Download PDFInfo
- Publication number
- US20170145078A1 US20170145078A1 US15/362,319 US201615362319A US2017145078A1 US 20170145078 A1 US20170145078 A1 US 20170145078A1 US 201615362319 A US201615362319 A US 201615362319A US 2017145078 A1 US2017145078 A1 US 2017145078A1
- Authority
- US
- United States
- Prior art keywords
- seed
- domains
- domain
- seq
- protein
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
- C07K16/244—Interleukins [IL]
- C07K16/246—IL-2
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/46—Hybrid immunoglobulins
- C07K16/468—Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/524—CH2 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/526—CH3 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
Definitions
- the invention relates to engineered heterodimeric protein domains and methods of making the same.
- BsAbs bispecific antibodies capable of binding to at least two different antigens have significant potential in a wide range of clinical applications as targeting agents for in vitro and in vivo immunodiagnosis and therapy, and for diagnostic immunoassays. In the diagnostic area, BsAbs have been very useful in probing the functional properties of cell surface molecules and in defining the ability of the different Fc receptors to mediate cytotoxicity (Fanger et al.
- the present invention provides a novel approach for designing protein domains that preferentially heterodimerize or heteromultimerize.
- the invention uses a “Strand Exchange Engineered Domain” (SEED) strategy to engineer a protein-protein interaction interface that promotes heterodimerization or heteromultimerization.
- SEED Single Exchange Engineered Domain
- the invention also provides proteins containing domains engineered using the method of the present invention.
- the multidomain protein of the invention includes a first subunit containing the first engineered domain and a second subunit containing the second engineered domain.
- an “amino acid sequence segment” includes any sequence segment containing two or more amino acids (e.g., three or more, four or more, five or more, six or more, seven or more, eight or more nine or more, or ten or more).
- the multidomain protein includes nonidentical domains engineered from naturally-occurring homologous parent domains that are immunoglobulin superfamily domains, such as, for example, antibody CH3 domains.
- the engineered domains are derived from IgG and IgA CH3 domains.
- the multidomain protein of the invention includes engineered domains that are part of polypeptide chains that are connected by a disulfide bond.
- one of the engineered domains contained in the multidomain protein of the invention includes at least two non-adjacent sequence segments derived from the same parent domain.
- each of the first and second engineered domains includes at least two, three, or four or more non-adjacent sequence segments derived from the same parent domain.
- at least one of the engineered domains includes sequence segments from each parent domain that are at least two amino acids in length.
- at least one of the engineered domains includes sequence segments from each parent domain that are at least three, four, five or six amino acids in length.
- the multidomain protein of the present invention can be used to generate bispecific antibodies.
- the multidomain protein may include a first bio-active domain containing an antibody variable domain and a second bio-active domain containing a second antibody variable domain with distinct specificity.
- the invention provides a multidomain protein, wherein the first bio-active region contains two or more antibody variable domains of a first specificity or of a first combination of specificities.
- the multidomain protein may also contain a second bio-active region including two or more antibody variable domains of a second specificity or second combination of specificities.
- the multidomain protein may include one or more single-chain Fv moieties, a diabody (one VH-VL chain), a single-chain diabody [a VH(1)-VL(2)-VH(2)-VL(1)], or other single-chain Fv fused repeats (of the same or different specificities.
- the present invention further contemplates a method of colocalizing bio-active domains when administered to a biological system.
- the method includes the step of administering to the biological system the multimeric protein including first and second bio-active domains as described above in various embodiments.
- the biological system is a mammal. In more preferred embodiment, the biological system is a human.
- the present invention provides a multidomain protein including at least first and second nonidentical engineered domains that meet at an interface.
- the interface of the first engineered domain contains at least two amino acid sequence segments, each segment being derived from a different naturally-occurring homologous parent domain, thereby conferring an assembly specificity distinct from the assembly specificity of the parent domains, wherein the first and second engineered domains form heterodimers with one another preferentially over forming homodimers.
- the second engineered domain also contains at least two amino acid sequence segments, each segment being derived from a different naturally-occurring homologous parent domain, thereby conferring an assembly specificity distinct from the assembly specificity of the parent domains, wherein the first and second engineered domains form heterodimers with one another preferentially over forming homodimers.
- the present invention provides a multimeric protein including a domain with an amino acid sequence derived from two or more homologous parent domains and an interaction surface on said domain that mediates multimerization and that comprises amino acids derived from more than one of the parent domains; and wherein the specificity of multimerization is enhanced by the presence of amino acids from different parent domains.
- the domain is part of a polypeptide chain with a disulfide bond that enhances assembly.
- the present invention provides an engineered immunoglobulin superfamily domain containing a protein-protein interaction interface including amino acids from two or more parent immunoglobulin superfamily domains such that the protein-protein interaction interface confers on the engineered immunoglobulin superfamily domain interaction properties that are distinct from interaction properties of the parent immunoglobulin superfamily domains.
- the invention also provides a multidomain protein comprising an engineered domain with the following properties.
- the engineered domain comprises a protein-protein interaction interface.
- the engineered domain is homologous to a family of naturally occurring domains, preferably such that the amino acid sequence of the engineered domain can be aligned with amino acid sequences of naturally occurring domains, which can further be aligned with each other.
- the alignment of the amino acid sequences of the naturally occurring domains corresponds to an alignment of the three-dimensional structures of the naturally occurring domains.
- the interaction interface of the engineered domain comprises amino acids from corresponding sequence positions from two or more naturally-occurring parental domains.
- the amino acids in the interface of the engineered domain are not all found in the corresponding interface of any single member of the homologous naturally occurring domains.
- the interaction interface of the engineered domain confers assembly properties distinct from any of the parental domains.
- the assembly properties of the engineered domain are distinctive because the interaction interface has amino acids from two or more different parents that make specific contacts with assembly partners, thus acquiring an assembly specificity that is a hybrid between the assembly specificities of the parent domains.
- the present invention provides nucleic acid encoding a multidomain protein as described in various embodiments above.
- the present invention provides nucleic acid encoding a multidomain protein including at least one bio-active domain.
- the present invention also provides cells containing the nucleic acid of the invention.
- the present invention provides a method of designing a multidomain protein with domains that preferentially heterodimerize.
- the method includes the following steps: (a) selecting a first polypeptide, a second polypeptide, a third polypeptide and a fourth polypeptide, wherein the first and third polypeptides dimerize with each other, but not with the second or fourth polypeptide, and wherein said second and fourth polypeptides dimerize with each other, (b) composing an amino acid sequence of a first domain from the first and the second polypeptides comprising at least one assembly element from the first polypeptide, and (c) composing an amino acid sequence of a second domain from the third and fourth polypeptides comprising at least one assembly element from the third polypeptide, such that the assembly elements from the first and third polypeptides assemble with each other, promoting heterodimerization of the first and second domains.
- the method of the invention composes an amino acid sequence of the first domain further including an assembly element from the second polypeptide and an amino acid sequence of the second domain further including an assembly element from the fourth polypeptide such that the assembly elements from the second and fourth polypeptides assemble with each other, promoting heterodimerization of the first and second domains.
- step (b) or step (c) of the above-described method includes comparing three-dimensional structures of two or more of the first, second, third or fourth polypeptides. In some embodiments, identical first and third polypeptides are selected. In other embodiments, identical first and third polypeptides are selected and identical second and fourth polypeptides are selected.
- step (b) or step (c) of the above-described method includes comparing aligned amino acid sequences of two or more of the first, second, third or fourth polypeptides. In some embodiments, identical first and third polypeptides are selected. In other embodiments, identical first and third polypeptides are selected and identical second and fourth polypeptides are selected.
- FIG. 1A schematically depicts an exemplary method of designing SEED constructs.
- Two related parent domains X and Y are aligned.
- the sequences of the two SEED subunits (XY and YX) are then generated by choosing for one SEED subunit alternating sequence segments from the two parental sequences, and choosing the complementary sequence segments to generate the other SEED subunit sequence.
- SEEDs engineered by this method are referred to as “Full” SEEDs.
- FIG. 1B schematically depicts a second exemplary method of designing SEED constructs, which is similar to FIG. 1A except that only amino acids forming the dimerization interface are chosen from one of the parental sequences.
- SEEDs engineered by this method are also referred to as “Surface” SEEDs.
- FIG. 2 depicts the structural alignment of human IgG1 CH3 (SEQ ID NO:51) and human IgA CH3 (SEQ ID NO:52) domains. Residue numbers are shown above and below the sequences. IgG1 is numbered according to Kabat EU numbering, while IgA is sequentially numbered as in the PDB structure 1OW0. Bold letters designate the backbone positions that were included in the alignment described in Table 2 in Example 1. Diamonds designate residues that contact or come close to the dimerization interface in IgG1 and IgA homodimers.
- FIG. 3A depicts the sequence alignments and secondary structure of human IgA (SEQ ID NO:52), IgG1 (SEQ ID NO:51) and daughter “Surface” SEED sequences “AG SURF” (SEQ ID NO: 10) and “GA SURF” (SEQ ID NO: 11), while FIG. 3B depicts the sequence alignments and secondary structure of human IgA, IgG1 and daughter “Full” SEED sequences “AG SEED” (SEQ ID NO:3) and “GA SEED” (SEQ ID NO:6).
- IgG1 is numbered according to Kabat EU numbering, while IgA is sequentially numbered as in the PDB structure 1OW0 (native numbers in center of alignment).
- the sequential numbering of the SEED sequence is interrupted at extra loop residues, which are designated with letters “A”, “B”, etc. (e.g., 18A), to illustrate the structural alignment of the molecules.
- Strand exchange points are designated by bold sequence letters. The two exchange points that contain no common residues are italicized. Modeled secondary structures (arrows above and below sequences) of the two SEEDs illustrate the strand exchanges, and are colored to indicate the manner in which the domain was divided, as shown in FIGS. 6B and 6C .
- White segments ⁇ are from IgA; gray segments are from IgG, and black segments ⁇ are common residues at exchange points. Twelve (12) residues in IgA segments are underlined.
- FIG. 5 is a representation of a bispecific, antibody-like molecule having two different Fab domains, paired by the heterodimeric SEED analogue of the CH3 domain.
- the hashed, gray portion represents the IgG-derived portion, while the white ⁇ represents the IgA-derived portion.
- the symmetry of the CH3 complex is broken in the AG/GA heterodimer, as represented by the “X” on the vertical bar designating the axis of two-fold rotational symmetry.
- FIGS. 6A-C are schematic representations of the secondary structure of IgG CH3 and the two CH3-based SEEDs.
- FIG. 6A depicts the secondary structure of wild type CH3.
- FIG. 6B depicts the secondary structure of the “GA SEED,” and shows the strand exchange pattern.
- Gray represents IgG sequence
- white ⁇ represents IgA sequence
- black ⁇ shows the exchange points, with a broader black band indicating residues that are conserved in both IgA and IgG.
- FIG. 6C depicts the secondary structure of the “AG SEED,” which contains a pattern opposite to the pattern of the “GA SEED”.
- FIGS. 7A-C are ribbon diagram representations of the three-dimensional structure of the “GA SEED” and “AG SEED” CH3 domains and of their putative heterodimeric structure depicting exchange crossover point and CH3 domain interactions.
- white or light gray ribbons represent IgA sequence and structure
- dark gray corresponds to IgG sequence and structure
- black sections denote where the sequence exchanges from G to A or vice versa.
- all black residues are shared by IgA and IgG, in sequence and in basic structure.
- FIG. 7B depicts the “AG SEED,” beginning with IgA sequence.
- the front ⁇ -strands form the interface, while the ⁇ -strands behind are on the outside of the dimer.
- FIG. 7C depicts the putative heterodimeric structure of the “GA SEED” and “AG SEED.”
- Translating the structure shown in FIG. 7A over the structure shown in FIG. 7B brings the interface surfaces together.
- the black residues form an approximate plane that is oriented vertically and perpendicular to the page.
- All residues to the left are dark gray (IgG), while all residues to the right are white (IgA).
- IgG dark gray
- IgA white
- the alternative homodimers, (AG/AG and GA/GA) would each have their IgA side juxtaposed to their IgG side (on both sides of the dividing plane), and so are disfavored.
- FIGS. 8A-F , 9 A-F, and 10 diagrammatically show a series of protein molecules that can be made using the SEED moieties described herein. For all of these figures, different moieties are indicated as follows.
- polypeptide chains that include the GA SEED are colored black, while the polypeptide chains that include the AG SEED are colored white.
- antibody V regions that are part of the GA SEED-containing polypeptide chain are black with thin white stripes, while antibody V regions that are part of the AG SEED-containing polypeptide chain are white with thin black stripes.
- Light chain constant regions are shown with a checkerboard pattern.
- Antibody hinge regions are shown as thin ovals connected by an “S—S” and a thick line to represent the disulfide bonds between the hinge regions.
- Polypeptide linkers are represented with dashed lines.
- FIGS. 8A-F , FIGS. 9A-F , and FIG. 10 are numerically labeled as follows. In some cases, to simplify the figures, numerical labels are not shown, but the identity of the various domains and regions can be inferred from figures with corresponding domains and regions.
- FIGS. 8A-F illustrate types of antibody-type SEED configurations comprising moieties with essentially naturally occurring V regions, such as the Fab ( FIG. 8A and FIG. 8B ), single-chain Fab ( FIG. 8C and FIG. 8D ), and single-domain or camelid single-domain V regions ( FIG. 8E and FIG. 8F ).
- FIG. 8A , FIG. 8C , and FIG. 8E show molecules comprising an essentially intact Fc region, including CH2 domains, as well as a hinge.
- FIG. 8B , FIG. 8D , and FIG. 8F show molecules lacking a CH2 domain, in which the hinge is optionally replaced by a linker that optionally possesses or lacks cysteine residues capable of disulfide bonding.
- FIGS. 9A-F illustrate types of antibody-type SEED configurations comprising moieties with artificially configured V regions, such as single-chain Fvs ( FIG. 9A and FIG. 9B ), diabodies ( FIG. 9C and FIG. 9D ), and single-chain Fvs with additional moieties attached to the N- and/or C-termini of the two polypeptide chains ( FIG. 9E and FIG. 9F ).
- FIG. 9A , FIG. 9C , and FIG. 9E show molecules comprising an essentially intact Fc region, including CH2 domains, as well as a hinge.
- FIG. 9B , FIG. 9D , and FIG. 9F show molecules lacking a CH2 domain, in which the hinge is optionally replaced by a linker that optionally possesses or lacks cysteine residues capable of disulfide bonding.
- FIG. 10 diagrammatically illustrates a molecule in which a GA/AG SEED pair essentially replaces the CH1-CL pairing in an antibody.
- Additional moieties indicated by X and Y, may be placed at the N-termini of the GA and AG SEEDs.
- Moiety X and moiety Y can be, for example, a Fab, a single-chain Fab, a camelid single-domain V region, a single-chain Fv, a single-chain diabody such as that illustrated by “14” and “15” in FIG. 9C and FIG. 9D .
- Additional moieties may be fused to the C-termini of the CH3 domains indicated by “21”.
- FIG. 11A shows an Fc heterodimer produced as described in Example 5, in which an AG SEED moiety has an IL-2 moiety fused to its C-terminus.
- the CH2 and hinge moieties are identical in this case.
- FIG. 11B shows an antibody produced as described in Example 7, in which an AG SEED moiety has an IL-2 moiety fused to its C-terminus.
- Each antibody domain is represented by an oval, and the IL-2 moiety is represented by a white square.
- the CH2, CH1, hinge, VH, VL, and CL moieties are identical in this case.
- the hinge regions are attached by disulfide bonds represented by “S—S” in the figure.
- the light chain constant region is represented with a checkerboard pattern.
- the light chain V region is represented with a vertical-striped pattern.
- the VH, CH1, and CH2 regions are black.
- FIGS. 12A-C depict the preferential assembly of AG/GA SEEDS into heterodimers as represented by the results of expression of Fc and Fc-IL2 in the same cell.
- FIG. 12A depicts the possible configurations of molecules resulting from coexpression of Fc and Fc-IL2, such that each dimeric species has a different molecular weight.
- FIG. 12A depicts the possible configurations of molecules resulting from coexpression of Fc and Fc-IL2, such that each dimeric species has a different molecular weight.
- FIG. 12B depicts a non-reducing SDS gel in which the following samples were loaded: lane 1—molecular weight standards; lane 2-4—about 1, 2, and 4 micrograms of total protein of the “full” Fc(GA SEED)/Fc(AG SEED)-IL2 expressed from NS/0 cells; lane 5-7—about 1, 2, and 4 micrograms of total protein of the “surface” Fc(GA SEED)/Fc(AG SEED)-IL2 expressed from NS/0 cells; lane 8-10—about 1, 2, and 4 micrograms of total protein of the parental IgG Fc/Fc-IL2 expressed from NS/0 cells.
- FIG. 12C is a reducing gel showing the ratio of expression of IgG-derived Fc and Fc-IL2.
- FIGS. 12D-E depict Western blot analysis of non-reduced samples ( FIG. 12D ) and reduced samples ( FIG. 12E ) of the Fc/Fc-IL2 proteins of FIGS. 12B-C .
- Duplicate samples of “full” Fc(GA SEED)/Fc(AG SEED)-IL2 (lanes 1 and 4), “surface” Fc(GA SEED)/Fc(AG SEED)-IL2 (lanes 2 and 5), and parental Fc/Fc-IL2 (lanes 3 and 6) were loaded and the blot was probed using anti-human IgG Fe (lanes 1-3) and anti-human IL-2 (lanes 4-6) antibodies.
- the present invention provides methods for designing protein domains that preferentially heterodimerize or heteromultimerize.
- the invention uses a “Strand Exchange Engineered Domain” (SEED) strategy to engineer a protein-protein interaction interface that promotes heterodimerization or heteromultimerization.
- SEED Single Exchange Engineered Domain
- the invention also provides multidomain proteins containing domains engineered using this approach.
- the present invention represents a significant advance in protein engineering.
- a “multidomain protein” includes any protein containing two or more domains.
- the domains may be on single polypeptide; they may also be on different polypeptides.
- “Heteromultimerization” refers to nonidentical domains forming a multimeric complex mediated by domain interactions.
- a “heteromultimeric protein” is a protein molecule comprising at least a first subunit and a second subunit, each subunit contains a nonidentical domain.
- the heteromultimer can include a “heterodimer” formed by the first and second subunit or can form higher order structures (e.g., ternary) where subunit polypeptides in addition to the first and second subunit are present. Typically, each subunit contains a domain.
- Exemplary structures for the heteromultimer include heterodimers, heterotrimers, heterotetramers (e.g., a bispecific antibody) and further oligomeric structures.
- a “domain” includes any region of a polypeptide that is responsible for selectively assembling with an assembly partner of interest (e.g., another domain, ligand, receptor, substrate or inhibitor).
- exemplary domains include an immunoglobulin superfamily constant domain such as a CH2 or CH3 domain, a receptor binding domain, a ligand binding domain, an enzymatic domain, or any polypeptide that has been engineered and/or selected to bind to a target. When two domains assemble with each other, they meet at a protein-protein interaction interface.
- a “protein-protein interaction interface,” an “interaction interface,” or an “interface” includes those “contact” residues (amino acid or other non-amino acid residues such as carbohydrate groups, NADH, biotin, FAD or heme group) in the first domain that interact with one or more “contact” residues (amino acid or other non-amino acid groups) in the interface of the second domain.
- a “contact” residue refers to any amino acid or non-amino acid residue from one domain that interacts with another amino acid or non-amino acid residue from a different domain by van der Waals forces, hydrogen bonds, water-mediated hydrogen bonds, salt bridges or other electrostatic forces, attractive interactions between aromatic side chains, the formation of disulfide bonds, or other forces known to one skilled in the art.
- the distance between alpha carbons of two interacting contact amino acid residues in the interaction interface is no greater than 12 ⁇ . More typically, the distance between alpha carbons of two interacting contact amino acid residues in the interaction interface is no greater than 11 ⁇ .
- a “parent domain” refers to any existing assembly domain as described above that can be used as a parent sequence for designing an engineered domain by the strand exchange strategy. Suitable parent domains are typically related or homologous and have particular assembly specificity. “Homologous” typically means two domains sharing at least 35%, 40%, 45%, 50%, 55%, 60%, 62%, 65%, 68%, 70%, 75%, 80%, 85%, 90%, 95% or 99% sequence identity. If parent domains are present in a common solution, they may tend to homodimerize rather than heterodimerize with one another.
- “existing assembly domains” include wild-type or naturally-occurring sequences from organisms such as human, mouse, yeast, bacteria, to name but a few, as well as derivative sequences that have been modified from the wild-type sequences, such as, for example, sequences that have been stabilized; rendered less immunogenic; given altered, enhanced or diminished assembly specificity, altered enzymatic properties, altered solubility, or enhanced expression; truncated; or fused to another polypeptide.
- “Existing assembly domains” can also be partially- or fully-synthetic sequences that are synthesized based on molecular design, in vitro or in vivo selection methods (e.g., yeast two-hybrid system, phage display), or combinations thereof.
- an “engineered domain” refers to a domain engineered from at least two nonidentical parent domains.
- An engineered domain is also referred to as a daughter domain.
- an engineered domain of the present invention contains amino acid sequence segments derived from two or more existing homologous parent domains.
- the interface of an engineered domain includes amino acids derived from more than one parent domain.
- the presence of amino acids from different parent domains confers a assembly specificity distinct from the assembly specificities of the parent domains. For example, the presence of the amino acids from different parent domains promotes or enhances heterodimerization or heteromultimerization.
- a Strand Exchange Engineered Domain is an engineered domain that is engineered from at least two nonidentical parent domains by the strand exchange engineering method described in detail below.
- polypeptide refers generally to any polypeptide or protein having more than about ten amino acids.
- mammalian polypeptides polypeptides that were originally derived from a mammalian organism
- SEED engineering more preferably those which are directly secreted into the medium.
- bacterial polypeptides include, e.g., alkaline phosphatase and ⁇ -lactamase.
- mammalian polypeptides include molecules such as renin, a growth hormone, including human growth hormone; bovine growth hormone; growth hormone releasing factor, parathyroid hormone; thyroid stimulating hormone; lipoproteins; ⁇ -1-antitrypsin; insulin A-chain; insulin B-chain; proinsulin; follicle stimulating hormone; calcitonin; luteinizing hormone; glucagon; clotting factors such as factor VIIIC, factor IX, tissue factor, and von-Willebrands factor, anti-clotting factors such as Protein C; atrial natriuretic factor lung surfactant; a plasminogen activator, such as urokinase or human urine or tissue-type plasminogen activator (t-PA); bombesin; thrombin; hemopoietic growth factor tumor necrosis factor- ⁇ and - ⁇ ; enkephalinase; RANTES (regulated on activation normally T-cell expressed and secreted); human macrophage inflammatory protein (MIP-1-
- first polypeptide or “first subunit” is any polypeptide which is to be associated with a second polypeptide through the interaction between the engineered domains.
- second polypeptide or “second subunit” is any polypeptide which is to be associated with the first polypeptide through the interaction between the engineered domains.
- the first and/or the second polypeptide may include one or more additional bio-active domains, such as, for example, an antibody variable domain, receptor binding domain, ligand binding domain or enzymatic domain) or other “binding domains” such as antibody constant domains (or parts thereof) including CH3 and CH2 domains.
- the first polypeptide may include at least one engineered domain of the invention, such as an engineered CH3 domain of an immunoglobulin and can form the interface of the first polypeptide.
- the first polypeptide may further include other antibody heavy chain binding domains (e.g., CH1, CH2, or CH4), and additional bio-active domains, such as receptor polypeptides (especially those which form dimers with another receptor polypeptide, e.g., interleukin-8 receptor and integrin heterodimers, e.g., LFA-1 or GPIIIb/IIIa), ligand polypeptides (e.g., cytokines, nerve growth factor, neurotrophin-3, and brain-derived neurotrophic factor—see Arakawa et al.
- assembly refers to a protein-protein interaction that occurs during the production of a multisubunit protein.
- the heavy and light chains are synthesized from ribosomes associated with the endoplasmic reticulum. The individual chains then fold, and then assemble into mature antibodies through proper association of heavy and light chains.
- the assembly of the Fab portion is initially driven primarily by interactions between the CH1 and CL domains, and also by interactions between the VH and VL regions.
- the initial assembly reaction is the association of the two CH3 domains.
- assembly is distinct from “binding”; assembly refers to the protein interaction events that occur during production of a mature protein, such as an antibody before it is secreted from a cell, while binding refers to protein interaction events that occur after secretion, such as the interaction of an antibody with an antigen or with an Fc receptor.
- assembly of a therapeutic or diagnostic protein occurs during the preparation of the therapeutic protein up to and including the placement of a product in a vial, and binding of a therapeutic or diagnostic protein refers to events that occur after a therapeutic protein is administered to a patient or when a diagnostic protein is used in a diagnostic test.
- binding is meant the interaction of a protein with a target protein subsequent to the synthesis and assembly of the protein.
- the invention uses the fact that natural protein domains mediating protein-protein interactions are often homologous or, in the case of homodimers, identical, and that such proteins and domains often only homodimerize with themselves but typically do not heterodimerize with other family members or do not heterodimerize with other family members with an affinity equal to or greater than their affinities for homodimerization.
- such proteins may be used to design heterodimeric or heteromultimeric proteins using strand exchange engineered methods described in detail below.
- engineered domains are also referred to as “Strand Exchange Engineered Domains” (“SEEDs”).
- SEEDs String Exchange Engineered Domains
- Multidomain proteins containing such engineered domains are also referred to as strand exchange engineered proteins.
- Strand exchange engineering typically begins with a structural model of a dimeric parent protein domain.
- Two parent domains that can each homodimerize or dimerize with its own assembly partner but not heterodimerize with each other are structurally aligned.
- the parent domains may dimerize in a face-to-face manner, i.e., the dimer partners may be related by a 180-degree rotational symmetry.
- the parent domains may also dimerize in a front-to-back manner.
- the engineered domains of the invention are not leucine-zipper domains.
- the CH3 family domains are particular useful because a significant portion of the interaction surface lies outside the line of symmetry. It however will be recognized by those skilled in the art that the line of symmetry (i.e., a line of homotypically interacting amino acids) may be an oversimplification. For example, the side-chains of amino acids on the line of symmetry may point toward the hydrophobic core of the domain.
- a new dimerization interface is conceptually designed and divided into at least two regions which typically lie on either side of the homotypic interaction line (i.e., the line of symmetry). New domains are then designed by strand exchange wherein two daughter domain linear amino acid sequences are constructed from two aligned parent domain amino acid sequences by taking complementary segments from each parent sequence. As a result, in the regions of the dimerization interface, the two daughter domains (i.e., two SEEDs) have complementary amino acid segments from parent domains. This concept is illustrated in FIGS. 1A and 1B . As shown in FIG. 1A , two daughter SEED sequences, 1 and 2, are engineered from two parent sequences, A and B, in an entirely complementary manner.
- the interaction interface is designed such that at least one amino acid sequence segment on Daughter 1 interacts with an amino acid sequence segment on daughter 2 that derived from the same parent domain.
- the daughter SEED domains are derived primarily from one parent domain. However, the amino acids at the dimerization interface on either daughter SEED domain are derived from either one parent or another in a complementary manner.
- FIG. 1A and FIG. 1B represent two extreme examples of the invention, and that SEEDs may be engineered by methods of the invention that have designs intermediate between FIG. 1A and FIG. 1B .
- SEEDs may be engineered by methods of the invention that have designs intermediate between FIG. 1A and FIG. 1B .
- the daughter SEEDs may be derived primarily in a complementary manner from IgG and IgA, but the amino acids that interact with FcRn are derived from IgG to preserve the interaction with FcRn.
- SEEDs are typically engineered by combining two or more homologous parent domains.
- the parent domains are polypeptides that differ from one another by at least four amino acids.
- the sequences of the original polypeptides are aligned based on their homologies, theoretical structural models, crystal or solution structures, or any combinations thereof.
- the parent sequences are then divided into at least two segments including at least one amino acid each.
- a SEED sequence may be composed by choosing, from among the original sequences, the one desired for each divided segment.
- a SEED will often differ from each individual parent sequence by at least two consecutive amino acids, and sometimes by three, four or more consecutive amino acids.
- a SEED can contain any desired amino acids at any positions, such as positions outside the designed interface, in order to satisfy the other design needs.
- exchange points or exchange positions can include one or more amino acids whose identity may be shared by both parents. Typically, exchange points are chosen from the amino acids on or near the line of symmetry, although other exchange points can also be chosen. Exchange points can also include amino acids not shared by the parents. In this case, the sequence abruptly switches from one parent to another. Furthermore, exchange points can include one or more novel amino acids not belonging to any of the parents. In this case, typically, different parent sequences appear on either side of the novel amino acids.
- the total number of parent segments can be greater than two, up to a number one greater than the number of exchange points. These parent segments can be selected from distinct parent domains.
- the present invention contemplates SEEDs that are engineered from more than two parent domains.
- each SEED is typically named according to the order of its parent sequences, beginning with the N-terminus of the SEED.
- an AG SEED has an IgA1 sequence segment on the N-terminal end, which then changes to an IgG1 sequence segment at the first exchange point.
- a GA SEED has an IgG1 sequence segment on the N-terminal end, which then changes to an IgA1 sequence at the first exchange point.
- the interaction interface of the SEEDs of the invention includes amino acid sequence segments derived from two or more parent domains.
- the interface of the SEEDs has interaction properties distinct from interaction properties of the parent domains.
- the presence of amino acids from different parent domains confers an assembly specificity distinct from the assembly specificity of either of the parent domains.
- the specificity of heterodimerization or heteromultimerization is enhanced by the presence of amino acids from different parent domains on the interface of a SEED.
- a pair of SEEDs form heterodimers with one another preferentially over forming homodimers.
- heterodimers of the SEEDs can specifically assemble such that the heterodimeric SEEDs can be directly recovered from the cell culture system without the need for elaborate separation steps to remove the homodimers.
- the classes of immunoglobulin proteins are a useful source for parent domains.
- SEEDS can be created by using parental sequences from two different immunoglobulin classes.
- SEEDs can be engineered from CH3 family domains by the method of the invention.
- CH3 family domains suitable for designing SEEDs include, but are not limited to, CH3 domains of IgG1, IgG2, IgG3, IgG4, IgA, and IgD, and the CH4 domains of IgE and IgM.
- CH3 domains of human IgG1 and IgA form homodimers but do not form heterodimers with each other. Therefore, pairs of SEEDs (e.g., an AG SEED and a GA SEED) can be engineered from IgG1 and IgA CH3 domains such that they can heterodimerize with each other but their ability to homodimerize is minimal.
- the assembly interface on the CH3 domain is divided into two regions, which lie on either side of the line of homotypic interactions. Homotypic interactions for the IgA and IgG1 CH3 domains can be determined by observation and probing the crystal structure with a 1.4 ⁇ sphere to determine whether or not the two side chains are close enough to exclude water.
- the homotypically interacting amino acids include, but are not limited to, L351, P352, T366, T394, P395, and Y407.
- the homotypically interacting amino acids include, but are not limited to, L352, P353, T368, W398, A399 and T414.
- those amino acids with outwardly-pointing side-chains that lie to the left of the line of homotypic interaction are taken from the CH3 of IgG1, and those with outwardly-pointing side-chains to the right of the line of homotypic interaction are taken from the CH3 of IgA.
- those amino acids with outwardly-pointing side-chains that lie to the left of the line of homotypic interaction are taken from the CH3 of IgA, and those with outwardly-pointing side-chains to the right of the line of homotypic interaction are taken from the CH3 of IgG1.
- the choice of amino acids along the line of homotypic interaction is based on structural considerations and performed on a case-by-case basis, although it is likely that the amino acids from either parent domain can be selected for a particular region of a SEED.
- a CH3-based AG SEED may have a polypeptide sequence as shown in SEQ ID NO:1, wherein X 1 , X 2 , or X 3 may be any amino acids.
- X 1 is K or S
- X 2 is V or T
- X 3 is T or S.
- X 1 is S
- X 2 is V or T
- X 3 is S.
- a CH3-based GA SEED may have a polypeptide sequence as shown in SEQ ID NO:2, wherein X 1 , X 2 , X 3 , X 4 , X 5 , or X 6 may be any amino acids.
- X 1 is L or Q
- X 2 is A or T
- X 3 is L, V, D, or T
- X 4 is F, A, D, E, G, H, K, N, P, Q, R, S, or T
- X 5 is A or T
- X 6 is E or D.
- X 1 is Q
- X 2 is A or T
- X 3 is L, V, D, or T
- X 4 is F, A, D, E, G, H, K, N, P, Q, R, S, or T
- X 5 is T
- X 6 is D.
- Exemplary SEED heterodimers may include one SEED subunit selected from AG(f0) SEED (SEQ ID NO:3), AG(f1) SEED (SEQ ID NO:4), or AG(f2) SEED (SEQ ID NO:5), and the other SEED subunit selected from GA(f0) SEED (SEQ ID NO:6), GA(f1) SEED (SEQ ID NO:7), GA(f2) SEED (SEQ ID NO:8), or GA(f3) SEED (SEQ ID NO:9).
- a SEED heterodimer may include AG(f0) SEED (SEQ ID NO:3) and GA(f0) SEED (SEQ ID NO:6) subunits.
- a SEED heterodimer may include AG(f2) SEED (SEQ ID NO:5) and GA(f2) SEED (SEQ ID NO:8) subunits.
- a SEED heterodimer may include AG(s0) SEED (SEQ ID NO: 10) and GA(s0) SEED (SEQ ID NO: 11) subunits.
- the SEEDs according to this invention are particularly useful when coupled with a fusion partner.
- a fusion partner (X) can be fused to the N-terminus of the SEED (X-SEED), it can also be fused to the C-terminus of the SEED (SEED-X).
- SEED-X the C-terminus of the SEED
- a fusion partner can be fused to the N-terminus and the C-terminus of the SEED at the same time (X-SEED-X).
- Two different fusion partners can be fused to a SEED (X-SEED-Y).
- the first daughter SEED has one fusion partner
- the second daughter SEED has no fusion partner, resulting in the following exemplary configurations: SEED-X heterodimerized to SEED; or X-SEED heterodimerized to SEED.
- the first daughter SEED has two different fusion partners (X, Y), and the second daughter SEED has two different fusion partners (W, Z) differing from the fusion partners of the first daughter SEED.
- Possible exemplary configurations includes, but are not limited to: X-SEED-Y heterodimerized to W-SEED-Z; X-SEED-Y heterodimerized to Z-SEED-W; Y-SEED-X heterodimerized to W-SEED-Z; or Y-SEED-X heterodimerized to Z-SEED-W.
- a SEED can also have two or more fusion partners (X) fused sequentially to, for example, the N-terminus (X-X-SEED).
- the first daughter SEED has one fusion partner (X), and the second daughter SEED has one fusion partner (Y), resulting in the following exemplary configurations: X-SEED heterodimerized to Y-SEED; X-SEED heterodimerized to SEED-Y; or SEED-X heterodimerized to SEED-Y.
- the first daughter SEED has one fusion partner (X), and the second daughter SEED has two fusion partners (Z, Y).
- Possible exemplary configurations include, but are not limited to: X-SEED heterodimerized to Y-SEED-Z; X-SEED heterodimerized to Z-SEED-Y; SEED-X heterodimerized to Z-SEED-Y; or SEED-X heterodimerized to Y-SEED-Z. Exemplary configurations are illustrated in FIG. 1C .
- a fusion partner can be one or more bio-active domains including any biologically active protein or a biologically active portion thereof.
- a bio-active domain can include an antibody constant or variable region, including, but not limited to, a VL domain, a VH domain, an Fv, a single-chain Fv, a diabody, an Fab fragment, a single-chain Fab, or an F(ab′) 2 .
- the fusion partners can be coupled to the SEED moieties directly or indirectly.
- a fusion partner may be linked to a SEED moiety by a peptide linker, such as described in U.S. Pat. No. 5,258,498 and U.S. Pat. No. 5,482,858 to Huston et al., or U.S. Pat. No. 5,856,456 and U.S. Pat. No. 5,990,275 to Whitlow et al., the teaching of which are hereby incorporated by reference.
- a suitable peptide linker may contain glycine and serine residues.
- a suitable peptide linker may also have different properties.
- a linker may further include a protease cleavage site, such as a matrix metalloproteinase recognition site.
- a multispecific antibody is a molecule having binding specificities for at least two different antigens. While such molecules typically will only bind two antigens (i.e. BsAbs), antibodies with additional specificities such as trispecific or tetraspecific antibodies are encompassed by this expression when used herein.
- BsAbs include those that bind to different antigens on the same cell surface, or those that bind to a cell surface antigen and a non-cell surface antigen.
- a non-cell surface antigen includes, but is not limited to, an extracellular or intracellular antigen, a soluble or insoluble antigen.
- the multispecific antibodies may bind to different antigens simultaneously, although simultaneous binding is not required for the function of the multispecific antibodies.
- the antigens are preferentially functionally related, such as EGFR and HER2.
- Particularly useful types of multispecific antibodies include, but are not limited to, anti-EGFR/anti-HER2; anti-EGFR/anti-HER2/anti-HER3; anti-EGFR/anti-HER3; anti-EGFR/anti-HER2/anti-IGF1R; anti-EGFR/anti-HER2/anti-HER3/anti-IGF1R; anti-EGFR/anti-HER3/anti-IGF1R; anti-EGFR/anti-IGF1R; and anti-HER2/anti-IGF1R.
- Other combinations of specificities involving the EGFR, HER family and IGF1R are within the scope of the present invention.
- BsAbs include those with one arm directed against a tumor cell antigen and the other arm directed against a cytotoxic trigger molecule such as anti-Fc ⁇ RI/anti-CD15, anti-p185 HER2 /Fc ⁇ RIII (CD16), anti-CD3/anti-malignant B-cell (1D10), anti-CD3/anti-p185 HER2 , anti-CD3/anti-p97, anti-CD3/anti-renal cell carcinoma, anti-CD3/anti-OVCAR-3, anti-CD3/L-D1 (anti-colon carcinoma), anti-CD3/anti-melanocyte stimulating hormone analog, anti-EGF receptor/anti-CD3, anti-CD3/anti-CAMA1, anti-CD3/anti-CD19, anti-CD3/MoV18, anti-neural cell adhesion molecule (NCAM)/anti-CD3, anti-folate binding protein (FBP)/anti-CD3, anti-pan carcinoma associated antigen (AMOC-31)/anti-CD3; BsAbs with one arm which binds
- bio-active domains include hormones, cytokines, chemokines, secreted enzymes, ligands, extracellular portions of trans-membrane receptors, or receptors.
- Hormones include, but are not limited to, growth hormones, or glucagon-like peptide (GLP-1).
- Cytokines include, but are not limited to, interleukin-2 (IL-2), IL-4, IL-5, IL-6, IL-7, IL-10, IL-12, IL-13, IL-14, IL-15, IL-16, IL-18, IL-21, IL-23, IL-31; hematopoeitic factors such as granulocyte-macrophage colony stimulating factor (GM-CSF), G-SCF and erythropoietin; tumor necrosis factors such as TNF- ⁇ ; lymphokines such as lymphotoxin; regulators of metabolic processes such as leptin; and interferons (IFN) such as IFN- ⁇ , IFN- ⁇ , and IFN- ⁇ .
- IL-2 interleukin-2
- IL-4 interleukin-5, IL-6, IL-7, IL-10, IL-12, IL-13, IL-14, IL-15, IL-16, IL-18, IL-21, IL-23,
- the engineered heteromeric proteins of the present invention permit the colocalization of different bio-active domains in a biological system. This can be accomplished, for example, in the context of a multimeric protein incorporating two different antibody variable domains, where one antibody variable domain is fused to one engineered domain and a second antibody variable domain is fused to a second engineered domain that preferentially assembles with the first engineered domain.
- Administration of such an engineered protein causes two distinct activities—in this case, binding activities—to be present in the same molecule in the biological system, colocalizing the activities within the biological system.
- the present invention provides a system to require that the activities be present at the same place permitting, for example, the targeting of a therapeutic activity to a particular cell type or location; the crosslinking of different receptors or cells; the colocalization of an antigen and adjuvant; etc.
- This can be accomplished by direct administration of an engineered heteromeric protein to a biological system or by expression of nucleic acid encoding the subunits within the biological system. Nucleic acid expression permits the engineering of additional levels of control in the system. For example, the expression of each subunit can be differentially regulated, such that the complete heteromeric protein and the resulting colocalization of activities occurs only upon the occurrence of all conditions required for expression of each subunit.
- the SEED sequences can be modified to reduce their potential immunogenicity. Because SEED polypeptides are hybrids between two different naturally occurring human sequences, they include sequence segments at their junctions that are not found in natural human proteins. In an organism, these sequence segments may be processed into non-self T-cell epitopes.
- ProPred http://www.imtech.res.in/raghava/propred; Singh and Raghava (2001) Bioinformatics 17:1236-1237
- ProPred is a publically available web-based tool that can be used for the prediction of peptides that bind HLA-DR alleles.
- ProPred is based on a matrix prediction algorithm described by Sturniolo for a set of 50 HLA-DR alleles (Sturniolo et al., (1999) Nature Biotechnol. 17:555-561). Using such an algorithm, various peptide sequences were discovered within AG SEED and GA SEED polypeptide sequences which are predicted to bind to multiple MHC class II alleles with significant binding strength and are therefore potentially immunogenic.
- the AG SEED and GA SEED sequences are modified to remove one or more T-cell epitopes present in the SEED sequence.
- This modification may include substitution, deletion, or modification of one or more amino acid residues in order to remove the T-cell epitope.
- Table 1 presents a list of peptide sequences that are potential T-cell epitopes in the AG SEED and GA SEED, and possible amino acid substitutions that are predicted to reduce or remove the T-cell epitope.
- AG(f0) SEED SEQ ID NO:3
- GA SEED GA SEED
- GA(f0) SEED SEQ ID NO:6
- AG(f1) SEED SEQ ID NO:4
- AG(f2) SEED SEQ ID NO:5
- GA(f1) SEED SEQ ID NO:7
- GA(f2) SEED SEQ ID NO:8
- GA(f3) SEED SEQ ID NO:9
- Example 1 Identifying Homologous Structures to Become Parents of a SEED
- the goal is to produce two distinct CH3-homolog SEEDs that will form dimers that favor the formation of a heterodimer over formation of the two possible homodimers, thus resulting in a predominance of CH3-homolog heterodimers.
- the first task is to identify two or more CH3 domains that may produce this result when they are used as parents of a pair of SEEDs.
- the CH3 homodimer forms a dimerization interface between ⁇ -sheets. It is important to find two CH3 domains that have significant differences in this interface, in order to make an effective pair of SEEDs that will preferentially heterodimerize.
- CH3 domains from IgG are structurally highly conserved across the animal kingdom, containing a classic immunoglobulin domain ⁇ -sandwich fold. While there are significant differences between species in the identities of the amino acids found on the outer surface, the dimerization interface surface that is buried upon dimerization is mostly conserved.
- Each different class of immunoglobulin has its own Fc, and in particular has its own equivalent of the IgG CH3 sequence and structure.
- Examination of the CH3 domain in the crystal structure of the Fc portion of a human IgA1 revealed that the overall fold was homologous to human IgG CH3.
- the backbone RMSD root mean square deviation of the alignment of single CH3 domains from the IgA Fc 1OW0 and from the IgG Fc 1L6X, excluding turns where alignment had different lengths, was about 0.99 ⁇ . (See table 2).
- the CH3 homodimer interface of IgA1 is significantly different than that of IgG1.
- two SEEDs made from the CH3 of human IgA1 and the CH3 of human IgG1 each contain some portion of the interface from IgA1, and some from IgG1, and are designed to not dimerize with themselves, nor with either parent CH3, but to dimerize preferentially with the other complementary SEED.
- the CH3 domain from human IgA1 and the CH3 domain from human IgG1 were used as parental polypeptides.
- IgG1 PDB entries 1DN2 (resolution 2.7 ⁇ ) and 1L6X (CH3 sequence highly homologous to 1DN2, with two minor differences, resolution 1.65 ⁇ ), and IgA1 PDB entry 1OW0 (resolution 3.1 ⁇ ) were used.
- FIG. 2 shows the structural alignment of the two sequences.
- the CH3 domain of IgG1 is numbered according to Kabat EU Index (Kabat et al., (1991) Sequences of Proteins of Immunological Interest, 5 th Edition, NIH Publication 91-3242), while the CH3 domain of IgA is sequentially numbered as in the PDB structure 1OW0.
- Bold letters designate the backbone positions that were included in the alignment described in Table 2, which were further used to design junctional crossover points in designing SEEDs.
- the CH3 homodimer has 180° rotational symmetry around an axis that runs between the domains approximately perpendicular to the beta strands ( FIG. 4 ). Each domain has the N-terminus and C-terminus on opposite sides of the axis of symmetry. Therefore, CH3 domains dimerize in a hand-shaking manner, where only in a line down the center of the interface along the symmetry axis do residues on one side contact the same residue in the other partner. Residues on either side of that line contact the partner domain in opposite fashion: e.g., residues on the N-terminal side of the first domain make contact with residues in the second domain that are on the C-terminal side, and vice versa.
- a CH3-based SEED is designed to break the symmetry, making the two sides different. For example, strand exchange will make one side of the dimer more like IgA1, and the other side more like IgG.
- This approach creates two different CH3-based SEEDs that are approximately complementary in their use of IgG and IgA-derived amino acids.
- the linear polypeptide sequence runs back and forth between IgG and IgA sequences in order to make one physical side of the dimeric structure IgA-like and the other side IgG-like.
- each final SEED sequence contains multiple exchange points, at each of which the linear sequence changes from IgA to IgG or from IgG to IgA ( FIGS. 3A and 3B ).
- FIGS. 3A and 3B show the sequence alignment with the exchange points highlighted in bold letters.
- FIGS. 5 and 6A -C show the molecular structure illustrating the 3-dimensional locations of the exchange points.
- SEEDs Two types can be designed and designated as “Full” for the SEEDs in which most or all of the residues in the domain were involved in the strand exchange (corresponding to FIG. 1A ) or “Surface” for the SEEDs in which the only altered residues are at the CH3 dimerization interface (corresponding to FIG. 1B ).
- the simplest way to make a “Full” SEED would be to use pure IgA sequence on the first side of the exchange point, and pure IgG1 sequence on the second side of the exchange point. If the exchange point is properly chosen, this would result in a SEED that should fold properly and would have an IgA1-like dimerizing surface on one side (e.g., approximately half) of the domain, and an IgG-like dimerizing surface on the other side.
- a ‘mirror image’ SEED can be made similarly, in which the first side is composed of IgG1 sequence and the second side is composed of IgA sequence.
- heterodimers When these two SEEDs are expressed together, they will preferentially form heterodimers because only in the heterodimer will each surface be contacting a surface on the other domain that matches its class: that is, the first half of the first SEED, which is IgA1-like, will contact the second half of the second SEED, which is also IgA1-like, while the second half of the first SEED, which is IgG1-like, will contact the first half of the second SEED, which is also IgG1-like. Since both sides of the contact surface are highly complementary, the association should be strong.
- each half of the dimerization surface will contact a surface on the partner SEED that comes from a different class: that is, the first half of one SEED, which is IgA-like, will contact the second half of the partner domain, which is IgG-like; and the second half of the first SEED, which is IgG1-like, will contact the first half of the partner domain, which is IgA-like. Since these surfaces are not highly complementary, their affinity will be diminished, resulting in thermodynamics favoring the formation of fewer homodimers and more heterodimers.
- the CH3 is the only part of the Fc or antibody that was altered.
- the rest of the Fc or immunoglobulin is from human IgG1. Altering the amino acid sequence where the CH3 contacts or interacts with CH2 could potentially create problems with the interface between the CH3 SEEDs and the IgG1 CH2 domains. In addition, this interface contains the binding site for FcRn, which confers important properties to the Fc that are desirable to retain. Therefore, structural information (Martin et al. (2001) Molec. Cell 7:867) was used to identify the CH3 residues involved in the interactions between CH3 and CH2, and between Fc and FcRn. Human IgG1 sequences were used for those residues in all SEEDs.
- FIG. 3B has the “Full” SEED sequences aligned with the IgG1 and IgA sequences in structural alignment. Residues that reside at the exchange points are highlighted in bold. Residues that were unaltered due to their importance in maintaining the interaction with C H 2 and/or with FcRn are underlined.
- HuFc and HuFc-IL2 constructs were made using HuFc and HuFc-IL2 constructs, as well as antibody and antibody-IL2 constructs, containing CH3 SEED domains in place of IgG1 CH3 domains.
- the CH3 domain of IgG1 is almost entirely contained in an approximately 0.4 kb Ngo MIV/Sma I genomic DNA fragment, which is present in pdCs or pdHL expression plasmids that express the constant region of an IgG1 heavy chain.
- Exemplary expression plasmids are, for example, pdCs-huFc-IL2 (see, for example, Lo et al., Protein Engineering [1998] 11:495), or pdHL7-KS-IL2 (see, for example U.S.
- the Ngo MIV site lies within the intron sequence immediately 5′ of the exon encoding IgG1 CH3, and the Sma I site lies in a sequence encoding Ser 444 Pro 445 Gly 446 near the C-terminus of IgG1 (Kabat EU Index).
- An exemplary DNA sequence of a mature human IgG1 Fc expressed from a pdCs vector is shown in SEQ ID NO:27. Replacement of the parental Ngo MIV/Sma I fragment with a Ngo MIV/Sma I fragment encoding a CH3 SEED of the invention generates upon expression a polypeptide containing a constant region with a CH3 SEED.
- Standard techniques were used to obtain DNA sequences encoding the CH3 SEEDs of the invention.
- DNA molecules with following sequences as shown in SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:31, SEQ ID NO:32, and SEQ ID NO:53 were synthesized de novo and propagated in a pUC-derived carrier plasmid (Blue Heron Biotechnology, Bothell, Wash.).
- DNA fragment Ngo MIV/SmaI containing sequence encoding AG(f0) SEED (underlined corresponding to FIG. 3B, ′′Full AG SEED′′): SEQ ID NO: 28 gccggctcggcccaccctctgccctgagagtgaccgctgtaccaacctct gtccctaca GGGCAGCCCTTCCGGCCAGAGGTCCACCTGCTGCCCCCATC ACGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGCACGCG GCTTCTATCCCAAGGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCG GAGAACAACTACAAGACCACGCCTTCCCGGCAGGAGCCCAGCCAGGGCAC CACCACCTTCGCTGTGACCTCGAAGCTCACCGTGGACAAGAGCAGATGGC AGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAAC CACTACACGCAGAAGACCATCTC
- pdCs-HuFc(AG(f0))-IL2 containing the Ngo MIV/Sma I fragment for AG(f0) SEED (SEQ ID NO:28), and pdCs-HuFc(GA(f0)), containing the Ngo MIV/Sma I fragment for GA(f0) SEED (SEQ ID NO:30), were obtained.
- pdCs-HuFc(AG(f0))-IL2 and pdCs-HuFc(GA(f0)) encode an Fc(AG(f0) SEED)-IL-2 polypeptide chain and an Fc(GA(f0) SEED) polypeptide chain, respectively.
- Exemplary sequences of Fc(AG(f0) SEED)-IL-2 and of Fc(GA(f1) SEED) are shown as SEQ ID NO:33 and SEQ ID NO:34, respectively, below.
- a diagram of the resulting heterodimeric protein is shown in FIG. 11A .
- the transcription units for these Fc polypeptides were combined on a single expression vector as described below in Example 5.
- Polypeptide sequence of a Fc(AG(f0) SEED)-IL2 SEQ ID NO: 33 EPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKALPAPIEKTISKAKGQPFRPEVHLLPPSREEMTKNQVSL TCLARGFYPKDIAVEWESNGQPENNYKTTPSRQEPSQGTTTFAVTSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKTISLSPGKAPTSSSTKKTQLQLE HLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKP LEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADETATIV EFLNRWITFCQSIISTLT Polypeptide sequence of a Fc(GA
- pdHL-DI-KS(AG(f0))-IL2 containing the Ngo MIV/Sma I fragment for AG(f0) SEED (SEQ ID NO:28), and pdHL-DI-KS(GA(f0)), containing the Ngo MIV/Sma I fragment for GA(f0) SEED (SEQ ID NO:30), were obtained.
- pdHL-DI-KS(AG(f0))-IL2 and pdHL-DI-KS(GA(f0)) encode DI-KS(AG(f0) SEED)-IL-2 heavy chain (SEQ ID NO:35), DI-KS(GA(f0) SEED) heavy chain (SEQ ID NO:36), respectively. Both expression vectors also encode the DI-KS light chain (SEQ ID NO:37).
- a construct was prepared essentially as follows: an approximately 3.9 kb Sal I/Mfe I fragment containing the sequence encoding KS(AG(f0) SEED)-IL-2 was excised from the pdHL-10 expression construct (pdHL-10 is a later generation pdHL expression vector containing a single Sal I site outside of the transcription unit) and ligated into a Sal I/Bam HI digested pBS plasmid, together with a Bam HI/Mfe I duplex linker fragment.
- This duplex linker fragment is composed of Oligo11 (SEQ ID NO:38) and Oligo12 (SEQ ID NO:39) and contains an internal Sal I site.
- Oligo11 (SEQ ID NO: 38) AATTGCCGGGTCGACATACG Oligol2 (SEQ ID NO: 39) GATCCGTATGTCGACCCGGC
- the 3.9 kb fragment was then excised from pBS as a Sal I fragment and inserted into the unique Sal I site of a pdHL-10 expression construct already containing the transcription units encoding DI-KS(GA(f0) SEED) heavy chain and the DI-KS light chain.
- CH3 dimerization is an important step in nucleating the formation of Fc and immunoglobulin heavy chain dimers.
- a and B two distinct Fc moieties containing CH3 domains
- they could pair and form Fc dimeric molecules in the following configurations: A:A, A:B, and B:B.
- the CH3 domains and hinge domains are identical, the configurations A:A, A:B, and B:B are expected to occur in a 1:2:1 ratio if A and B are expressed in equal amounts.
- the ratio [A ⁇ B]/2*[A]*[B] is greater than 2, and preferably greater than 3, and more preferably greater than 5.
- constructs were prepared to express both human Fc (HuFc) and human Fc fused to human IL-2 (HuFc-IL-2) in one cell.
- the constructs were prepared as follows: The gene for HuFc was excised from a vector containing an Fc moiety (see, for example, Lo et al., Protein Engineering [1998] 11:495) by enzymatic restriction at a 5′ XbaI site and a 3′ XhoI site. The 1.4 Kb fragment containing the HuFc gene was gel purified and subcloned into a second vector, pdCS-MuFc-KS-kappa, replacing its muFc with HuFc. The HuFc gene was flanked by two SalI sites outside the promoter region.
- a third vector containing a gene coding for HuFc-IL-2 and a single SalI site was chosen to receive the HuFc gene.
- the vector was cut with SalI, treated with Calf Intestinal Phosphatase (CIP) and gel purified.
- CIP Calf Intestinal Phosphatase
- the second vector was digested with Sail and a 2.5 Kb fragment was gel purified. This fragment contained the HuFc gene and a promoter, and was inserted into the gel-purified third vector.
- the final resulting vector contained two different transcription units with duplicated versions of the same regulatory elements, one transcription unit controlling the expression of wild type HuFc and the other controlling the expression of wild type HuFc-IL-2. Expression constructs containing SEED-based HuFc and SEED-based HuFc-IL-2 were similarly made.
- This final vector was expanded using Qiagen maxi-prep. 10 mg of the DNA was used to transiently transfect baby hamster kidney (BHK) cells, using the Lipofectamine TM2000 kit (Invitrogen). Cells were split, half grown in regular medium, the other half in serum-free medium, for two days. Supernatants (e.g., 100 ul) were harvested. 10 microliters of protein-A beads were added and mixed overnight at 4.degree. C. to bind the protein. After washing 3.times. with PBS containing 1% Triton-X100, samples were loaded onto Nu-Page (Invitrogen) 4-12% gradient Bis-Tris gels, under both reducing and non-reducing conditions. Gels were stained with colloidal blue (Invitrogen) for direct protein visualization.
- Nu-Page Invitrogen
- Typical control results are shown in lanes 8-10 in the gels shown in FIGS. 12D-E .
- the reducing gel in FIG. 12C shows the ratio of HuFc and HuFc-IL-2 subunits.
- the non-reducing gel in FIG. 12B shows that the HuFc and HuFc-IL2 molecules dimerize randomly, with no preference for heterodimerization as compared to homodimerization.
- AG and GA SEED protein sequences are hybrids between two different naturally occurring human sequences, these sequences include peptide segments that are not found in normal human proteins and that may be processed into non-self MHC Class II T cell epitopes. Therefore, the following sequences were designed to reduce the number of potential non-self T-cell epitopes in the AG SEED and GA SEED sequences, depicted by the polypeptide sequence shown in SEQ ID NO: 1 and SEQ ID NO:2, respectively, wherein X 1 , X 2 , X 3 , X 4 , X 5 , or X 6 may be any amino acid.
- SEQ ID NO:1 X 1 is S
- X 2 is V or T
- X 3 is S.
- X 1 is Q
- X 2 is A or T
- X 3 is L
- X 4 is F, A, D, E, G, H, K, N, P, Q, R, S, or T
- X 5 is T
- X 6 is D.
- the DNA molecule (SEQ ID NO:32) encoding exemplary SEED variant GA(f1) SEED (SEQ ID NO:7) was made by de novo synthesis and was introduced into the pdCs expression vector as described in Example 4, producing the polypeptide Fc(GA(f1) SEED).
- Oligo1 SEQ ID NO:40
- Oligo3 SEQ ID NO:42
- Oligo4 SEQ ID NO:43
- Oligo1 SEQ ID NO:40
- Oligo4 SEQ ID NO:43
- Oligo1 (SEQ ID NO: 40) GCCGGCTCGGCCCACCCTCT Oligo2 (SEQ ID NO: 41) CGGCGATGTCGCTGGGATAGAA Oligo3 (SEQ ID NO: 42) TTCTATCCCAGCGACATCGCCG Oligo4 (SEQ ID NO: 43) CCCGGGGACAGGGAGATGGACTTCTGCGTGT Oligo5 (SEQ ID NO: 45) GCTCTTGTCTGTGGTGAGCTT Oligo6 (SEQ ID NO: 46) AAGCTCACCACAGACAAGAGC Oligo7 (SEQ ID NO: 49) CCTGACTTGGGCACCCGTGGACGACTCCGACGGCTCCCACTTCCTCTATA Oligo9 (SEQ ID NO: 50) CCCGGGGAGCGGTCGAGGCTC Oligo10 (SEQ ID NO: 48) TATAGAGGAAGTGGGAGCCGTCGGAGTCGTCCACGGGTGCCCAAGTCAGG DNA fragment Ngo MIV/Sma I, containing sequence encoding AG(f1) SEED
- Fc(AG(f1) SEED), Fc(AG(f2) SEED), Fc(GA(f1) SEED)-IL2 and Fc(GA(f2) SEED)-IL2 sequences were expressed individually and in combinations in HEK 293T cells, and the resulting secreted proteins were partially purified based on Fc binding to Staphylococcus A protein and characterized by SDS-PAGE. When the samples were run on a reducing SDS gel, it was apparent that the Fc(AG(f1) SEED) and Fc(AG(f2) SEED) proteins were expressed very poorly by themselves, which is similar to the parent Fc(AG(f0) SEED) protein.
- the poor expression most likely results from the proteolysis of the monomeric protein that has no dimerization partner.
- the Fc(GA(f1) SEED)-IL2 protein was expressed at high level, while the Fc(GA(f2) SEED)-IL2 protein, differing by the additional amino acid substitution Val75Thr, was expressed at a very low level.
- the poor expression may result from the proteolysis of the monomeric protein that has no dimerization partner.
- Example 4 An intact antibody with a single IL-2 moiety was constructed as described in Example 4. A diagram of this protein is shown in FIG. 11B . Specifically, the protein contained antibody V regions that bind to EpCAM and that have the sequences as described in U.S. Pat. No. 6,696,517, human IgG1 CH1 and CH2 domains, human Ckappa, the GA and AG SEED domains, and human IL-2 fused to the C-terminus of the AG SEED-containing heavy chain.
- the protein was expressed in mammalian cells according to standard techniques producing a protein with the polypeptide chains shown in SEQ ID NO:37, SEQ ID NO:36, and SEQ ID NO:35.
- the resulting protein was characterized to determine the extent to which heterodimeric forms were secreted from the mammalian cells.
- the secreted protein was characterized by non-reducing SDS-polyacrylamide gel electrophoresis.
- three bands might be identified, corresponding to antibodies with no, one or two IL-2 moieties.
- the actual non-reducing gel showed predominantly a single band with a molecular weight corresponding to an antibody with a single IL-2 moiety.
- a much less intense band with a molecular weight corresponding to no IL-2 moieties was seen, and a band with a molecular weight corresponding to two IL-2 moieties was not detectable.
- approximately equal amounts of protein corresponding to antibody heavy chain and heavy chain-IL2 were detected.
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Life Sciences & Earth Sciences (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Abstract
The present invention provides an engineered multidomain protein including at least two nonidentical engineered domains, each of which contains a protein-protein interaction interface containing amino acid sequence segments derived from two or more existing homologous parent domains, thereby conferring on the engineered domains assembly specificities distinct from assembly specificities of the parent domains. In particular, the engineered domains form heterodimers with one another preferentially over forming homodimers. Methods of designing and using the engineered proteins are also included.
Description
- This application is a divisional of U.S. application Ser. No. 14/505,653, filed on Oct. 3, 2014, which is a divisional of U.S. application Ser. No. 11/728,048, filed Mar. 23, 2007, which claims priority to and the benefit of U.S. Provisional Patent Application No. 60/785,474, filed on Mar. 24, 2006, the entire contents of each of which are incorporated by reference herein.
- The instant application contains a Sequence Listing which has been submitted as a paper copy and in electronic form by reference to the computer readable form of the sequence listing submitted in U.S. patent application Ser. No. 11/728,048 on Mar. 23, 2007, and is hereby incorporated by reference in its entirety.
- The invention relates to engineered heterodimeric protein domains and methods of making the same.
- Nature provides a large number of homodimeric proteins and protein domains that fall into families of related proteins. Such proteins and domains often form homodimers with themselves but do not form heterodimers with other family members. On the other hand, heterodimeric or heteromultimeric proteins are often useful. They provide novel therapeutics and research tools. For example, bispecific antibodies (BsAbs) capable of binding to at least two different antigens have significant potential in a wide range of clinical applications as targeting agents for in vitro and in vivo immunodiagnosis and therapy, and for diagnostic immunoassays. In the diagnostic area, BsAbs have been very useful in probing the functional properties of cell surface molecules and in defining the ability of the different Fc receptors to mediate cytotoxicity (Fanger et al. (1992) Crit. Rev. Immunol. 12:101-124, the teachings of which are hereby incorporated by reference.) However, when BsAbs are generated simply by co-expression of multiple components that can interact without specificity, a large number of species are often generated, and it is often difficult to separate the desired species from the undesired species. Therefore, it is desirable to have techniques for efficiently making heteromultimers. It is particularly desirable to generate antibody subunits that form heterodimers preferentially over forming homodimers so that BsAbs can be directly recovered from recombinant cell culture.
- Methods for making heterodimeric proteins have been reported. For example, Stahl and Yancopoulos described the use of fusion proteins including two different receptor subunits to form soluble heterodimeric receptors that could bind to a given cytokine in circulation, and thus block the activity of that cytokine (see U.S. Pat. No. 6,472,179). Carter et al. described a “protuberance-into-cavity” approach for generating a heterodimeric Fc moiety (see U.S. Pat. No. 5,807,706).
- These existing methods allow constructions of individual heterodimers, but do not provide general techniques for construction of multimeric proteins involving multiple domain interactions. Therefore, there is a need for a general system for designing heterodimeric pairs that can specifically assemble in an environment containing multiple different potential assembly partners.
- The present invention provides a novel approach for designing protein domains that preferentially heterodimerize or heteromultimerize. In particular, the invention uses a “Strand Exchange Engineered Domain” (SEED) strategy to engineer a protein-protein interaction interface that promotes heterodimerization or heteromultimerization. The invention also provides proteins containing domains engineered using the method of the present invention.
- In one aspect, the present invention features a multidomain protein including at least first and second nonidentical engineered domains, each of which contains a protein-protein interaction interface containing amino acid sequence segments derived from two or more naturally-occurring homologous parent domains, thereby conferring on the first and second engineered domains assembly specificities distinct from assembly specificities of the parent domains, wherein the first and second engineered domains form heterodimers with one another preferentially over forming homodimers (e.g., the heterodimers constitute more than 55%, 65%, 75%, 80%, 85%, 90%, or 95% of the total amount of dimers). The first and second engineered domains are not antibody variable domains. In some embodiments, the multidomain protein of the invention includes a first subunit containing the first engineered domain and a second subunit containing the second engineered domain. As used herein, an “amino acid sequence segment” includes any sequence segment containing two or more amino acids (e.g., three or more, four or more, five or more, six or more, seven or more, eight or more nine or more, or ten or more).
- In preferred embodiments, the multidomain protein includes nonidentical domains engineered from naturally-occurring homologous parent domains that are immunoglobulin superfamily domains, such as, for example, antibody CH3 domains. In particular, the engineered domains are derived from IgG and IgA CH3 domains.
- In some embodiments, the multidomain protein of the invention includes engineered domains that are part of polypeptide chains that are connected by a disulfide bond.
- In one embodiment, one of the engineered domains contained in the multidomain protein of the invention includes at least two non-adjacent sequence segments derived from the same parent domain. In another embodiment, each of the first and second engineered domains includes at least two, three, or four or more non-adjacent sequence segments derived from the same parent domain. In another embodiment, at least one of the engineered domains includes sequence segments from each parent domain that are at least two amino acids in length. In another embodiment, at least one of the engineered domains includes sequence segments from each parent domain that are at least three, four, five or six amino acids in length.
- In some embodiments, the multidomain protein of the invention includes a first bio-active domain. The first bio-active domain may occupy a position N-terminal or C-terminal to the first engineered domain.
- In further embodiments, the multidomain protein may further include a second bio-active domain in addition to the first bio-active domain. In one embodiment, the second bio-active domain is associated with the second engineered domain and may occupy a position N-terminal or C-terminal to the second engineered domain. In an alternate embodiment, the second bio-active domain is also associated with the first engineered domain and may occupy a position opposite the first bio-active domain. For example, the first and second bio-active domains may occupy positions N-terminal and C-terminal, respectively, to the first engineered domain.
- The multidomain protein of the present invention can be used to generate bispecific antibodies. For example, the multidomain protein may include a first bio-active domain containing an antibody variable domain and a second bio-active domain containing a second antibody variable domain with distinct specificity.
- In another aspect, the invention provides a multidomain protein, wherein the first bio-active region contains two or more antibody variable domains of a first specificity or of a first combination of specificities. The multidomain protein may also contain a second bio-active region including two or more antibody variable domains of a second specificity or second combination of specificities. For example, the multidomain protein may include one or more single-chain Fv moieties, a diabody (one VH-VL chain), a single-chain diabody [a VH(1)-VL(2)-VH(2)-VL(1)], or other single-chain Fv fused repeats (of the same or different specificities.
- In another aspect, the invention provides a multidomain protein, wherein the first bio-active region comprises two or more antibody variable domains of a first specificity or of a first combination of specificities. The multidomain protein further comprises a second bio-active region comprising two or more antibody variable domains of a second specificity or second combination of specificities that are substantially distinct from the first combination of specificities.
- The present invention further contemplates a method of colocalizing bio-active domains when administered to a biological system. The method includes the step of administering to the biological system the multimeric protein including first and second bio-active domains as described above in various embodiments. In one embodiment, the biological system is a mammal. In more preferred embodiment, the biological system is a human.
- In another aspect, the present invention provides a multidomain protein including at least first and second nonidentical engineered domains that meet at an interface. The interface of the first engineered domain contains at least two amino acid sequence segments, each segment being derived from a different naturally-occurring homologous parent domain, thereby conferring an assembly specificity distinct from the assembly specificity of the parent domains, wherein the first and second engineered domains form heterodimers with one another preferentially over forming homodimers. In a preferred embodiment, the second engineered domain also contains at least two amino acid sequence segments, each segment being derived from a different naturally-occurring homologous parent domain, thereby conferring an assembly specificity distinct from the assembly specificity of the parent domains, wherein the first and second engineered domains form heterodimers with one another preferentially over forming homodimers.
- In yet another aspect, the present invention provides a multidomain protein including at least first and second nonidentical engineered domains that meet at an interface, wherein (1) the first and second engineered domains are derived from two or more naturally-occurring homologous parent domains, (2) the interface from the first engineered domain comprises at least one amino acid sequence segment interacting with an amino acid sequence segment on the interface of the second engineered domain derived from the same parent domain, and (3) the first and second engineered domains form heterodimers with one another preferentially over forming homodimers.
- In another aspect, the present invention provides a multimeric protein including a domain with an amino acid sequence derived from two or more homologous parent domains and an interaction surface on said domain that mediates multimerization and that comprises amino acids derived from more than one of the parent domains; and wherein the specificity of multimerization is enhanced by the presence of amino acids from different parent domains. In some embodiments, the domain is part of a polypeptide chain with a disulfide bond that enhances assembly.
- In further aspect, the present invention features an engineered immunoglobulin domain containing a protein-protein interaction interface including amino acids from two or more parent immunoglobulin domains such that the protein-protein interaction interface confers on the engineered immunoglobulin domain assembly specificities that are distinct from assembly specificities of the parent immunoglobulin domains, wherein the engineered immunoglobulin domain is not an antibody variable domain. In preferred embodiments, the engineered immunoglobulin domain of the invention assembles with a partner domain with enhanced specificity compared to the parent domains. In some embodiments, the partner domain is an engineered immunoglobulin domain of the invention.
- In yet another aspect, the present invention provides an engineered immunoglobulin superfamily domain containing a protein-protein interaction interface including amino acids from two or more parent immunoglobulin superfamily domains such that the protein-protein interaction interface confers on the engineered immunoglobulin superfamily domain interaction properties that are distinct from interaction properties of the parent immunoglobulin superfamily domains.
- The invention also provides a multidomain protein comprising an engineered domain with the following properties. Firstly, the engineered domain comprises a protein-protein interaction interface. Secondly, the engineered domain is homologous to a family of naturally occurring domains, preferably such that the amino acid sequence of the engineered domain can be aligned with amino acid sequences of naturally occurring domains, which can further be aligned with each other. Preferably, the alignment of the amino acid sequences of the naturally occurring domains corresponds to an alignment of the three-dimensional structures of the naturally occurring domains. Thirdly, the interaction interface of the engineered domain comprises amino acids from corresponding sequence positions from two or more naturally-occurring parental domains. Fourthly, the amino acids in the interface of the engineered domain, considered as a group, are not all found in the corresponding interface of any single member of the homologous naturally occurring domains. Fifthly, the interaction interface of the engineered domain confers assembly properties distinct from any of the parental domains. Preferably, the assembly properties of the engineered domain are distinctive because the interaction interface has amino acids from two or more different parents that make specific contacts with assembly partners, thus acquiring an assembly specificity that is a hybrid between the assembly specificities of the parent domains.
- Furthermore, the present invention provides nucleic acid encoding a multidomain protein as described in various embodiments above. In particular, the present invention provides nucleic acid encoding a multidomain protein including at least one bio-active domain. The present invention also provides cells containing the nucleic acid of the invention.
- In another aspect, the present invention provides a method of designing a multidomain protein with domains that preferentially heterodimerize. The method includes the following steps: (a) selecting a first polypeptide, a second polypeptide, a third polypeptide and a fourth polypeptide, wherein the first and third polypeptides dimerize with each other, but not with the second or fourth polypeptide, and wherein said second and fourth polypeptides dimerize with each other, (b) composing an amino acid sequence of a first domain from the first and the second polypeptides comprising at least one assembly element from the first polypeptide, and (c) composing an amino acid sequence of a second domain from the third and fourth polypeptides comprising at least one assembly element from the third polypeptide, such that the assembly elements from the first and third polypeptides assemble with each other, promoting heterodimerization of the first and second domains.
- In some embodiments, the method of the invention composes an amino acid sequence of the first domain further including an assembly element from the second polypeptide and an amino acid sequence of the second domain further including an assembly element from the fourth polypeptide such that the assembly elements from the second and fourth polypeptides assemble with each other, promoting heterodimerization of the first and second domains.
- In some embodiments, step (b) or step (c) of the above-described method includes comparing three-dimensional structures of two or more of the first, second, third or fourth polypeptides. In some embodiments, identical first and third polypeptides are selected. In other embodiments, identical first and third polypeptides are selected and identical second and fourth polypeptides are selected.
- In some embodiments, step (b) or step (c) of the above-described method includes comparing aligned amino acid sequences of two or more of the first, second, third or fourth polypeptides. In some embodiments, identical first and third polypeptides are selected. In other embodiments, identical first and third polypeptides are selected and identical second and fourth polypeptides are selected.
- Other features, objects, and advantages of the present invention are apparent in the detailed description that follows. It should be understood, however, that the detailed description, while indicating preferred embodiments of the present invention, is given by way of illustration only, not limitation. Various changes and modifications within the scope of the invention will become apparent to those skilled in the art from the detailed description.
- The Figures are provided for illustration, not limitation.
-
FIG. 1A schematically depicts an exemplary method of designing SEED constructs. Two related parent domains X and Y are aligned. The sequences of the two SEED subunits (XY and YX) are then generated by choosing for one SEED subunit alternating sequence segments from the two parental sequences, and choosing the complementary sequence segments to generate the other SEED subunit sequence. SEEDs engineered by this method are referred to as “Full” SEEDs. -
FIG. 1B schematically depicts a second exemplary method of designing SEED constructs, which is similar toFIG. 1A except that only amino acids forming the dimerization interface are chosen from one of the parental sequences. SEEDs engineered by this method are also referred to as “Surface” SEEDs. -
FIG. 1C depicts diagrammatically exemplary configurations of a SEED heterodimer, composed of a first daughter SEED (white oval) and a second daughter SEED (black oval), and a fusion partner, such as a bioactive domain (stalked white diamond). The SEED moiety and the fusion partner may be coupled by a linker segment (not depicted). In configurations with more than one fusion partner, the fusion partners may be identical to one another or distinct from one another, although in the diagrams they are shown generically as a stalked white diamond. The fusion partner may be N-terminal (A) or C-terminal (B) to the SEED moiety. There may be multiple concatenated fusion partners on one end of a SEED, as in (C), or the fusion partners may be located at opposite ends of a SEED (D). One fusion partner may be placed at N-terminal to a first daughter SEED and a second fusion partner may be placed N-terminal (F) or C-terminal (G) to a second daughter SEED. The SEED heterodimer may contain three (H) or four (I) fusion partners. -
FIG. 2 depicts the structural alignment of human IgG1 CH3 (SEQ ID NO:51) and human IgA CH3 (SEQ ID NO:52) domains. Residue numbers are shown above and below the sequences. IgG1 is numbered according to Kabat EU numbering, while IgA is sequentially numbered as in the PDB structure 1OW0. Bold letters designate the backbone positions that were included in the alignment described in Table 2 in Example 1. Diamonds designate residues that contact or come close to the dimerization interface in IgG1 and IgA homodimers. -
FIG. 3A depicts the sequence alignments and secondary structure of human IgA (SEQ ID NO:52), IgG1 (SEQ ID NO:51) and daughter “Surface” SEED sequences “AG SURF” (SEQ ID NO: 10) and “GA SURF” (SEQ ID NO: 11), whileFIG. 3B depicts the sequence alignments and secondary structure of human IgA, IgG1 and daughter “Full” SEED sequences “AG SEED” (SEQ ID NO:3) and “GA SEED” (SEQ ID NO:6). IgG1 is numbered according to Kabat EU numbering, while IgA is sequentially numbered as in the PDB structure 1OW0 (native numbers in center of alignment). For the purposes of this figure, the sequential numbering of the SEED sequence is interrupted at extra loop residues, which are designated with letters “A”, “B”, etc. (e.g., 18A), to illustrate the structural alignment of the molecules. Strand exchange points are designated by bold sequence letters. The two exchange points that contain no common residues are italicized. Modeled secondary structures (arrows above and below sequences) of the two SEEDs illustrate the strand exchanges, and are colored to indicate the manner in which the domain was divided, as shown inFIGS. 6B and 6C . White segments □ are from IgA; gray segments are from IgG, and black segments ▪ are common residues at exchange points. Twelve (12) residues in IgA segments are underlined. These are residues that were kept as IgG because of their proximity to the CH3/CH2 interface region. These residues are not involved in CH3 dimerization, but they are potentially important for the interaction with CH2, and/or with the complex with FcRn. Since the CH2 is human IgG for both SEEDs, these residues were kept to maintain both the native CH2/CH3 interaction and the various well-known advantages conferred by FcRn binding. -
FIG. 4 is a representation of an IgG antibody molecule illustrating the symmetry of the CH3 homodimer. The vertical bar designates the axis of 2-fold rotational symmetry. -
FIG. 5 is a representation of a bispecific, antibody-like molecule having two different Fab domains, paired by the heterodimeric SEED analogue of the CH3 domain. The hashed, gray portion represents the IgG-derived portion, while the white □ represents the IgA-derived portion. The symmetry of the CH3 complex is broken in the AG/GA heterodimer, as represented by the “X” on the vertical bar designating the axis of two-fold rotational symmetry. -
FIGS. 6A-C are schematic representations of the secondary structure of IgG CH3 and the two CH3-based SEEDs.FIG. 6A depicts the secondary structure of wild type CH3. -
-
FIG. 6C depicts the secondary structure of the “AG SEED,” which contains a pattern opposite to the pattern of the “GA SEED”. -
FIGS. 7A-C are ribbon diagram representations of the three-dimensional structure of the “GA SEED” and “AG SEED” CH3 domains and of their putative heterodimeric structure depicting exchange crossover point and CH3 domain interactions. In all diagrams, white or light gray ribbons represent IgA sequence and structure, dark gray corresponds to IgG sequence and structure, and black sections denote where the sequence exchanges from G to A or vice versa. Aside from the two exchange points at 55-56 and 101-102 (numbered according toFIG. 3B ), all black residues are shared by IgA and IgG, in sequence and in basic structure. -
FIG. 7A depicts the “GA SEED,” where the N-terminus begins as IgG sequence and ends as IgA after exchanging seven times. In this structure, the upper layer of β-strands are in the outside sheet, while the layer behind forms the interface with the other CH3 domain. -
FIG. 7B depicts the “AG SEED,” beginning with IgA sequence. Here, the front β-strands form the interface, while the β-strands behind are on the outside of the dimer. -
FIG. 7C depicts the putative heterodimeric structure of the “GA SEED” and “AG SEED.” Translating the structure shown inFIG. 7A over the structure shown inFIG. 7B brings the interface surfaces together. The black residues form an approximate plane that is oriented vertically and perpendicular to the page. All residues to the left are dark gray (IgG), while all residues to the right are white (IgA). Thus, with white opposite white and gray opposite gray, the whole of the interface is well formed, as a fusion of the IgA and IgG interfaces. The alternative homodimers, (AG/AG and GA/GA) would each have their IgA side juxtaposed to their IgG side (on both sides of the dividing plane), and so are disfavored. -
FIGS. 8A-F , 9A-F, and 10 diagrammatically show a series of protein molecules that can be made using the SEED moieties described herein. For all of these figures, different moieties are indicated as follows. InFIGS. 8A-F andFIGS. 9A-F , polypeptide chains that include the GA SEED are colored black, while the polypeptide chains that include the AG SEED are colored white. Within such polypeptide chains, antibody V regions that are part of the GA SEED-containing polypeptide chain are black with thin white stripes, while antibody V regions that are part of the AG SEED-containing polypeptide chain are white with thin black stripes. Light chain constant regions are shown with a checkerboard pattern. Antibody hinge regions are shown as thin ovals connected by an “S—S” and a thick line to represent the disulfide bonds between the hinge regions. Polypeptide linkers are represented with dashed lines. - Portions of
FIGS. 8A-F ,FIGS. 9A-F , andFIG. 10 are numerically labeled as follows. In some cases, to simplify the figures, numerical labels are not shown, but the identity of the various domains and regions can be inferred from figures with corresponding domains and regions. -
- “1” indicates a GA-associated set of heavy and light chain V regions.
- “2” indicates an AG-associated set of heavy and light chain V regions.
- “3” indicates a GA-associated light chain V region.
- “4” indicates an Fab region.
- “5” indicates a GA-associated heavy chain V region.
- “6” indicates an AG-associated heavy chain V region.
- “7” indicates a AG-associated light chain V region.
- “8” indicates a light chain constant region.
- “9” indicates an Fc region comprising a SEED pair.
- “10” indicates SEED pair.
- “11” indicates an artificial linker.
- “12” indicates a GA-associated single-domain or camelid V region.
- “13” indicates an AG-associated single-domain or camelid V region.
- “14” indicates a diabody or single chain fused diabody that is incorporated into the polypeptide chain comprising the GA SEED.
- “15” indicates a diabody or single chain fused diabody that is incorporated into the polypeptide chain comprising the AG SEED.
- “16”, “17”, “18”, or “19” refers to any protein or peptide, such as a non-Ig domain. Such domains may include, for example, cytokines, hormones, toxins, enzymes, antigens, and extracellular domains of cell surface receptors.
- “20” indicates a canonical homodimeric Fc region.
- “21” indicates a canonical homodimeric pair of CH3 domains.
-
FIGS. 8A-F illustrate types of antibody-type SEED configurations comprising moieties with essentially naturally occurring V regions, such as the Fab (FIG. 8A andFIG. 8B ), single-chain Fab (FIG. 8C andFIG. 8D ), and single-domain or camelid single-domain V regions (FIG. 8E andFIG. 8F ).FIG. 8A ,FIG. 8C , andFIG. 8E show molecules comprising an essentially intact Fc region, including CH2 domains, as well as a hinge.FIG. 8B ,FIG. 8D , andFIG. 8F show molecules lacking a CH2 domain, in which the hinge is optionally replaced by a linker that optionally possesses or lacks cysteine residues capable of disulfide bonding. -
FIGS. 9A-F illustrate types of antibody-type SEED configurations comprising moieties with artificially configured V regions, such as single-chain Fvs (FIG. 9A andFIG. 9B ), diabodies (FIG. 9C andFIG. 9D ), and single-chain Fvs with additional moieties attached to the N- and/or C-termini of the two polypeptide chains (FIG. 9E andFIG. 9F ).FIG. 9A ,FIG. 9C , andFIG. 9E show molecules comprising an essentially intact Fc region, including CH2 domains, as well as a hinge.FIG. 9B ,FIG. 9D , andFIG. 9F show molecules lacking a CH2 domain, in which the hinge is optionally replaced by a linker that optionally possesses or lacks cysteine residues capable of disulfide bonding. -
FIG. 10 diagrammatically illustrates a molecule in which a GA/AG SEED pair essentially replaces the CH1-CL pairing in an antibody. Additional moieties, indicated by X and Y, may be placed at the N-termini of the GA and AG SEEDs. Moiety X and moiety Y can be, for example, a Fab, a single-chain Fab, a camelid single-domain V region, a single-chain Fv, a single-chain diabody such as that illustrated by “14” and “15” inFIG. 9C andFIG. 9D . Additional moieties may be fused to the C-termini of the CH3 domains indicated by “21”. -
FIG. 11A shows an Fc heterodimer produced as described in Example 5, in which an AG SEED moiety has an IL-2 moiety fused to its C-terminus. The CH2 and hinge moieties are identical in this case.FIG. 11B shows an antibody produced as described in Example 7, in which an AG SEED moiety has an IL-2 moiety fused to its C-terminus. Each antibody domain is represented by an oval, and the IL-2 moiety is represented by a white square. The CH2, CH1, hinge, VH, VL, and CL moieties are identical in this case. The hinge regions are attached by disulfide bonds represented by “S—S” in the figure. The light chain constant region is represented with a checkerboard pattern. The light chain V region is represented with a vertical-striped pattern. The VH, CH1, and CH2 regions are black. -
FIGS. 12A-C depict the preferential assembly of AG/GA SEEDS into heterodimers as represented by the results of expression of Fc and Fc-IL2 in the same cell.FIG. 12A depicts the possible configurations of molecules resulting from coexpression of Fc and Fc-IL2, such that each dimeric species has a different molecular weight.FIG. 12B depicts a non-reducing SDS gel in which the following samples were loaded:lane 1—molecular weight standards; lane 2-4—about 1, 2, and 4 micrograms of total protein of the “full” Fc(GA SEED)/Fc(AG SEED)-IL2 expressed from NS/0 cells; lane 5-7—about 1, 2, and 4 micrograms of total protein of the “surface” Fc(GA SEED)/Fc(AG SEED)-IL2 expressed from NS/0 cells; lane 8-10—about 1, 2, and 4 micrograms of total protein of the parental IgG Fc/Fc-IL2 expressed from NS/0 cells.FIG. 12C is a reducing gel showing the ratio of expression of IgG-derived Fc and Fc-IL2. -
FIGS. 12D-E depict Western blot analysis of non-reduced samples (FIG. 12D ) and reduced samples (FIG. 12E ) of the Fc/Fc-IL2 proteins ofFIGS. 12B-C . Duplicate samples of “full” Fc(GA SEED)/Fc(AG SEED)-IL2 (lanes 1 and 4), “surface” Fc(GA SEED)/Fc(AG SEED)-IL2 (lanes 2 and 5), and parental Fc/Fc-IL2 (lanes 3 and 6) were loaded and the blot was probed using anti-human IgG Fe (lanes 1-3) and anti-human IL-2 (lanes 4-6) antibodies. - The present invention provides methods for designing protein domains that preferentially heterodimerize or heteromultimerize. In particular, the invention uses a “Strand Exchange Engineered Domain” (SEED) strategy to engineer a protein-protein interaction interface that promotes heterodimerization or heteromultimerization. The invention also provides multidomain proteins containing domains engineered using this approach. Thus, the present invention represents a significant advance in protein engineering.
- Various aspects of the invention are described in further detail in the following subsections. The use of subsections is not meant to limit the invention. Each subsection may apply to any aspect of the invention.
- As used herein, a “multidomain protein” includes any protein containing two or more domains. The domains may be on single polypeptide; they may also be on different polypeptides. “Heteromultimerization” refers to nonidentical domains forming a multimeric complex mediated by domain interactions. A “heteromultimeric protein” is a protein molecule comprising at least a first subunit and a second subunit, each subunit contains a nonidentical domain. The heteromultimer can include a “heterodimer” formed by the first and second subunit or can form higher order structures (e.g., ternary) where subunit polypeptides in addition to the first and second subunit are present. Typically, each subunit contains a domain. Exemplary structures for the heteromultimer include heterodimers, heterotrimers, heterotetramers (e.g., a bispecific antibody) and further oligomeric structures.
- As used herein, a “domain” includes any region of a polypeptide that is responsible for selectively assembling with an assembly partner of interest (e.g., another domain, ligand, receptor, substrate or inhibitor). Exemplary domains include an immunoglobulin superfamily constant domain such as a CH2 or CH3 domain, a receptor binding domain, a ligand binding domain, an enzymatic domain, or any polypeptide that has been engineered and/or selected to bind to a target. When two domains assemble with each other, they meet at a protein-protein interaction interface. As used herein, a “protein-protein interaction interface,” an “interaction interface,” or an “interface” includes those “contact” residues (amino acid or other non-amino acid residues such as carbohydrate groups, NADH, biotin, FAD or heme group) in the first domain that interact with one or more “contact” residues (amino acid or other non-amino acid groups) in the interface of the second domain. As used herein, a “contact” residue refers to any amino acid or non-amino acid residue from one domain that interacts with another amino acid or non-amino acid residue from a different domain by van der Waals forces, hydrogen bonds, water-mediated hydrogen bonds, salt bridges or other electrostatic forces, attractive interactions between aromatic side chains, the formation of disulfide bonds, or other forces known to one skilled in the art. Typically, the distance between alpha carbons of two interacting contact amino acid residues in the interaction interface is no greater than 12 Å. More typically, the distance between alpha carbons of two interacting contact amino acid residues in the interaction interface is no greater than 11 Å.
- As used herein, a “parent domain” refers to any existing assembly domain as described above that can be used as a parent sequence for designing an engineered domain by the strand exchange strategy. Suitable parent domains are typically related or homologous and have particular assembly specificity. “Homologous” typically means two domains sharing at least 35%, 40%, 45%, 50%, 55%, 60%, 62%, 65%, 68%, 70%, 75%, 80%, 85%, 90%, 95% or 99% sequence identity. If parent domains are present in a common solution, they may tend to homodimerize rather than heterodimerize with one another. As used herein, “existing assembly domains” include wild-type or naturally-occurring sequences from organisms such as human, mouse, yeast, bacteria, to name but a few, as well as derivative sequences that have been modified from the wild-type sequences, such as, for example, sequences that have been stabilized; rendered less immunogenic; given altered, enhanced or diminished assembly specificity, altered enzymatic properties, altered solubility, or enhanced expression; truncated; or fused to another polypeptide. “Existing assembly domains” can also be partially- or fully-synthetic sequences that are synthesized based on molecular design, in vitro or in vivo selection methods (e.g., yeast two-hybrid system, phage display), or combinations thereof.
- An “engineered domain” refers to a domain engineered from at least two nonidentical parent domains. An engineered domain is also referred to as a daughter domain. Typically, an engineered domain of the present invention contains amino acid sequence segments derived from two or more existing homologous parent domains. Preferably, the interface of an engineered domain includes amino acids derived from more than one parent domain. The presence of amino acids from different parent domains confers a assembly specificity distinct from the assembly specificities of the parent domains. For example, the presence of the amino acids from different parent domains promotes or enhances heterodimerization or heteromultimerization.
- A Strand Exchange Engineered Domain (SEED) is an engineered domain that is engineered from at least two nonidentical parent domains by the strand exchange engineering method described in detail below.
- As used herein, a “polypeptide” refers generally to any polypeptide or protein having more than about ten amino acids. Preferably, mammalian polypeptides (polypeptides that were originally derived from a mammalian organism) are used for SEED engineering, more preferably those which are directly secreted into the medium. Examples of bacterial polypeptides include, e.g., alkaline phosphatase and β-lactamase. Examples of mammalian polypeptides include molecules such as renin, a growth hormone, including human growth hormone; bovine growth hormone; growth hormone releasing factor, parathyroid hormone; thyroid stimulating hormone; lipoproteins; α-1-antitrypsin; insulin A-chain; insulin B-chain; proinsulin; follicle stimulating hormone; calcitonin; luteinizing hormone; glucagon; clotting factors such as factor VIIIC, factor IX, tissue factor, and von-Willebrands factor, anti-clotting factors such as Protein C; atrial natriuretic factor lung surfactant; a plasminogen activator, such as urokinase or human urine or tissue-type plasminogen activator (t-PA); bombesin; thrombin; hemopoietic growth factor tumor necrosis factor-α and -β; enkephalinase; RANTES (regulated on activation normally T-cell expressed and secreted); human macrophage inflammatory protein (MIP-1-α); a serum albumin such as human serum albumin; Muellerian-inhibiting substance; relaxin A-chain; relaxin B-chain; prorelaxin; mouse gonadotropin-associated peptide; DNase; inhibin; activin; vascular endothelial growth factor (VEGF); receptors for hormones or growth factors; integrin; protein A or D; rheumatoid factors; a neurotrophic factor such as bone-derived neurotrophic factor (BDNF), neurotrophin-3, -4, -5, or -6 (NT-3, NT-4, NT-5, or NT-6), or a nerve growth factor such as NGF-beta; platelet-derived growth factor (PDGF); fibroblast growth factor such as AFGF and bFGF; epidermal growth factor (EGF); transforming growth factor (TGF) such as TGF-α and TGF-β, including TGF-β1, TGF-β2, TGF-β3, TGF-β4, or TGF-β5; insulin-like growth factor-I and -II (IGF-I and IGF-II); des(1-3)-IGF-I (brain IGF-I), insulin-like growth factor binding proteins; CD proteins such as CD-3, CD-4, CD-8, and CD-19; erythropoietin; osteoinductive factors; immunotoxins; a bone morphogenetic protein (BMP); an interferon such as interferon-alpha, -beta, and -gamma; colony stimulating factors (CSFs), e.g., M-CSF, GM-CSF, and G-CSF; interleukins (ILs), e.g., IL-1 to IL-10; superoxide dismutase; T-cell receptors; surface membrane proteins; decay accelerating factor; transport proteins; homing receptors; addressins; regulatory proteins; immunoglobulins (antibodies); and fragments of any of the above-listed polypeptides.
- As used herein, the “first polypeptide” or “first subunit” is any polypeptide which is to be associated with a second polypeptide through the interaction between the engineered domains. The “second polypeptide” or “second subunit” is any polypeptide which is to be associated with the first polypeptide through the interaction between the engineered domains. In addition to the engineered domains, the first and/or the second polypeptide may include one or more additional bio-active domains, such as, for example, an antibody variable domain, receptor binding domain, ligand binding domain or enzymatic domain) or other “binding domains” such as antibody constant domains (or parts thereof) including CH3 and CH2 domains. As an example, the first polypeptide may include at least one engineered domain of the invention, such as an engineered CH3 domain of an immunoglobulin and can form the interface of the first polypeptide. The first polypeptide may further include other antibody heavy chain binding domains (e.g., CH1, CH2, or CH4), and additional bio-active domains, such as receptor polypeptides (especially those which form dimers with another receptor polypeptide, e.g., interleukin-8 receptor and integrin heterodimers, e.g., LFA-1 or GPIIIb/IIIa), ligand polypeptides (e.g., cytokines, nerve growth factor, neurotrophin-3, and brain-derived neurotrophic factor—see Arakawa et al. (1994) J. Biol. Chem. 269(45):27833-27839 and Radziejewski et al. (1993) Biochem. 32(48):1350) and antibody variable domain polypeptides (e.g., diabodies and BsAbs).
- As used herein, “assembly” refers to a protein-protein interaction that occurs during the production of a multisubunit protein. For example, during antibody production, the heavy and light chains are synthesized from ribosomes associated with the endoplasmic reticulum. The individual chains then fold, and then assemble into mature antibodies through proper association of heavy and light chains. For example, in the case of IgG antibodies, the assembly of the Fab portion is initially driven primarily by interactions between the CH1 and CL domains, and also by interactions between the VH and VL regions. In the case of the two heavy chains, the initial assembly reaction is the association of the two CH3 domains. These initial assembly reactions are usually, but not always, followed by disulfide bond formation between the assembled subunit polypeptides. As used herein, “assembly” is distinct from “binding”; assembly refers to the protein interaction events that occur during production of a mature protein, such as an antibody before it is secreted from a cell, while binding refers to protein interaction events that occur after secretion, such as the interaction of an antibody with an antigen or with an Fc receptor. In an operational sense, assembly of a therapeutic or diagnostic protein occurs during the preparation of the therapeutic protein up to and including the placement of a product in a vial, and binding of a therapeutic or diagnostic protein refers to events that occur after a therapeutic protein is administered to a patient or when a diagnostic protein is used in a diagnostic test.
- By “binding” is meant the interaction of a protein with a target protein subsequent to the synthesis and assembly of the protein.
- The invention uses the fact that natural protein domains mediating protein-protein interactions are often homologous or, in the case of homodimers, identical, and that such proteins and domains often only homodimerize with themselves but typically do not heterodimerize with other family members or do not heterodimerize with other family members with an affinity equal to or greater than their affinities for homodimerization. According to the invention, such proteins may be used to design heterodimeric or heteromultimeric proteins using strand exchange engineered methods described in detail below. Such engineered domains are also referred to as “Strand Exchange Engineered Domains” (“SEEDs”). Multidomain proteins containing such engineered domains are also referred to as strand exchange engineered proteins.
- Strand exchange engineering typically begins with a structural model of a dimeric parent protein domain. Two parent domains that can each homodimerize or dimerize with its own assembly partner but not heterodimerize with each other are structurally aligned. The parent domains may dimerize in a face-to-face manner, i.e., the dimer partners may be related by a 180-degree rotational symmetry. The parent domains may also dimerize in a front-to-back manner.
- Due to the geometry of rotational symmetry of homodimeric proteins, there is usually a line of amino acids in the interaction surface that interact in a homotypic manner. In other words, there are amino acids that interact with their counterparts in the other subunit. For example, in the CH3 domain of IgG1, these amino acids include L351, P352, T366, T394, P395, and Y407. This line of amino acids will generally be parallel to the axis of rotational symmetry of the dimer. In choosing parent domains, it is often useful to choose proteins that homodimerize such that the long axis of the dimerization interface is not strongly parallel to the axis of rotational symmetry. For example, SEEDs based on leucine-zipper family members are difficult to construct, because the dimerization interface is parallel to the axis of symmetry, and many of the amino acid interactions are homotypic. Accordingly, in some preferred embodiments, the engineered domains of the invention are not leucine-zipper domains. In contrast, the CH3 family domains are particular useful because a significant portion of the interaction surface lies outside the line of symmetry. It however will be recognized by those skilled in the art that the line of symmetry (i.e., a line of homotypically interacting amino acids) may be an oversimplification. For example, the side-chains of amino acids on the line of symmetry may point toward the hydrophobic core of the domain.
- A new dimerization interface is conceptually designed and divided into at least two regions which typically lie on either side of the homotypic interaction line (i.e., the line of symmetry). New domains are then designed by strand exchange wherein two daughter domain linear amino acid sequences are constructed from two aligned parent domain amino acid sequences by taking complementary segments from each parent sequence. As a result, in the regions of the dimerization interface, the two daughter domains (i.e., two SEEDs) have complementary amino acid segments from parent domains. This concept is illustrated in
FIGS. 1A and 1B . As shown inFIG. 1A , two daughter SEED sequences, 1 and 2, are engineered from two parent sequences, A and B, in an entirely complementary manner. IfDaughter 1 has an amino acid segment from Parent A at a given region of the interaction interface,Daughter 2 will have the corresponding amino acid segment from Parent B. The interaction interface is designed such that at least one amino acid sequence segment onDaughter 1 interacts with an amino acid sequence segment ondaughter 2 that derived from the same parent domain. InFIG. 1B , the daughter SEED domains are derived primarily from one parent domain. However, the amino acids at the dimerization interface on either daughter SEED domain are derived from either one parent or another in a complementary manner. - It should be noted that
FIG. 1A andFIG. 1B represent two extreme examples of the invention, and that SEEDs may be engineered by methods of the invention that have designs intermediate betweenFIG. 1A andFIG. 1B . For example, as described in the Examples in more detail, it is possible to construct a SEED based on parent domains from the immunoglobulin CH3 domain family. The daughter SEEDs may be derived primarily in a complementary manner from IgG and IgA, but the amino acids that interact with FcRn are derived from IgG to preserve the interaction with FcRn. - Thus, SEEDs are typically engineered by combining two or more homologous parent domains. The parent domains are polypeptides that differ from one another by at least four amino acids. In making a SEED, the sequences of the original polypeptides are aligned based on their homologies, theoretical structural models, crystal or solution structures, or any combinations thereof. There is at least one different amino acid at one or more aligned sequence positions, or a different number of amino acids in at least one pair of aligned original sequences. The parent sequences are then divided into at least two segments including at least one amino acid each. A SEED sequence may be composed by choosing, from among the original sequences, the one desired for each divided segment. A SEED will often differ from each individual parent sequence by at least two consecutive amino acids, and sometimes by three, four or more consecutive amino acids. In addition to selecting sequences from the original parent polypeptides, a SEED can contain any desired amino acids at any positions, such as positions outside the designed interface, in order to satisfy the other design needs.
- There are positions on the sequence of the SEED where the parent sequence changes from one parent to a second parent. These positions are called exchange points or exchange positions. Exchange points or exchange positions can include one or more amino acids whose identity may be shared by both parents. Typically, exchange points are chosen from the amino acids on or near the line of symmetry, although other exchange points can also be chosen. Exchange points can also include amino acids not shared by the parents. In this case, the sequence abruptly switches from one parent to another. Furthermore, exchange points can include one or more novel amino acids not belonging to any of the parents. In this case, typically, different parent sequences appear on either side of the novel amino acids. If there are multiple exchange points in the sequence of a SEED, the total number of parent segments can be greater than two, up to a number one greater than the number of exchange points. These parent segments can be selected from distinct parent domains. Thus, the present invention contemplates SEEDs that are engineered from more than two parent domains.
- For purposes of convenience, each SEED is typically named according to the order of its parent sequences, beginning with the N-terminus of the SEED. In the examples given below, an AG SEED has an IgA1 sequence segment on the N-terminal end, which then changes to an IgG1 sequence segment at the first exchange point. A GA SEED has an IgG1 sequence segment on the N-terminal end, which then changes to an IgA1 sequence at the first exchange point.
- Thus, the interaction interface of the SEEDs of the invention includes amino acid sequence segments derived from two or more parent domains. As a result, the interface of the SEEDs has interaction properties distinct from interaction properties of the parent domains. In particular, the presence of amino acids from different parent domains confers an assembly specificity distinct from the assembly specificity of either of the parent domains. For example, the specificity of heterodimerization or heteromultimerization is enhanced by the presence of amino acids from different parent domains on the interface of a SEED. As a result, a pair of SEEDs form heterodimers with one another preferentially over forming homodimers. Thus, when a pair of SEEDs are expressed in an expression system, heterodimers of the SEEDs can specifically assemble such that the heterodimeric SEEDs can be directly recovered from the cell culture system without the need for elaborate separation steps to remove the homodimers.
- Backbone homology and differences between the dimerization interfaces of the parent domains are important for creating SEEDs. Thus, according to one embodiment of the invention, the classes of immunoglobulin proteins are a useful source for parent domains. SEEDS can be created by using parental sequences from two different immunoglobulin classes. For example, SEEDs can be engineered from CH3 family domains by the method of the invention. CH3 family domains suitable for designing SEEDs include, but are not limited to, CH3 domains of IgG1, IgG2, IgG3, IgG4, IgA, and IgD, and the CH4 domains of IgE and IgM.
- CH3 domains of human IgG1 and IgA form homodimers but do not form heterodimers with each other. Therefore, pairs of SEEDs (e.g., an AG SEED and a GA SEED) can be engineered from IgG1 and IgA CH3 domains such that they can heterodimerize with each other but their ability to homodimerize is minimal. According to one embodiment, the assembly interface on the CH3 domain is divided into two regions, which lie on either side of the line of homotypic interactions. Homotypic interactions for the IgA and IgG1 CH3 domains can be determined by observation and probing the crystal structure with a 1.4 Å sphere to determine whether or not the two side chains are close enough to exclude water. If the surfaces joined together across the interface, this implies that the side chains are closely interacting. For example, in the wild type CH3 domain of IgG1, the homotypically interacting amino acids include, but are not limited to, L351, P352, T366, T394, P395, and Y407. For the wild type CH3 domain of IgA1, the homotypically interacting amino acids include, but are not limited to, L352, P353, T368, W398, A399 and T414. In one exemplary SEED subunit, those amino acids with outwardly-pointing side-chains that lie to the left of the line of homotypic interaction are taken from the CH3 of IgG1, and those with outwardly-pointing side-chains to the right of the line of homotypic interaction are taken from the CH3 of IgA. In the other SEED subunit, those amino acids with outwardly-pointing side-chains that lie to the left of the line of homotypic interaction are taken from the CH3 of IgA, and those with outwardly-pointing side-chains to the right of the line of homotypic interaction are taken from the CH3 of IgG1. The choice of amino acids along the line of homotypic interaction is based on structural considerations and performed on a case-by-case basis, although it is likely that the amino acids from either parent domain can be selected for a particular region of a SEED.
- For example, a CH3-based AG SEED may have a polypeptide sequence as shown in SEQ ID NO:1, wherein X1, X2, or X3 may be any amino acids. In some embodiments, X1 is K or S, X2 is V or T, and X3 is T or S. Preferably, X1 is S, X2 is V or T, and X3 is S. A CH3-based GA SEED may have a polypeptide sequence as shown in SEQ ID NO:2, wherein X1, X2, X3, X4, X5, or X6 may be any amino acids. In some embodiments, X1 is L or Q, X2 is A or T, X3 is L, V, D, or T, X4 is F, A, D, E, G, H, K, N, P, Q, R, S, or T, X5 is A or T, and X6 is E or D. Preferably, X1 is Q, X2 is A or T, X3 is L, V, D, or T, X4 is F, A, D, E, G, H, K, N, P, Q, R, S, or T, X5 is T, and X6 is D. Exemplary SEED heterodimers may include one SEED subunit selected from AG(f0) SEED (SEQ ID NO:3), AG(f1) SEED (SEQ ID NO:4), or AG(f2) SEED (SEQ ID NO:5), and the other SEED subunit selected from GA(f0) SEED (SEQ ID NO:6), GA(f1) SEED (SEQ ID NO:7), GA(f2) SEED (SEQ ID NO:8), or GA(f3) SEED (SEQ ID NO:9). For example, a SEED heterodimer may include AG(f0) SEED (SEQ ID NO:3) and GA(f0) SEED (SEQ ID NO:6) subunits. In another example, a SEED heterodimer may include AG(f2) SEED (SEQ ID NO:5) and GA(f2) SEED (SEQ ID NO:8) subunits. In yet another embodiment, a SEED heterodimer may include AG(s0) SEED (SEQ ID NO: 10) and GA(s0) SEED (SEQ ID NO: 11) subunits.
- The SEEDs according to this invention are particularly useful when coupled with a fusion partner. A fusion partner (X) can be fused to the N-terminus of the SEED (X-SEED), it can also be fused to the C-terminus of the SEED (SEED-X). In addition, a fusion partner can be fused to the N-terminus and the C-terminus of the SEED at the same time (X-SEED-X). Two different fusion partners can be fused to a SEED (X-SEED-Y).
- Given that two SEED sequences typically form heterodimers, it is possible that at least one, two, three, or four fusion partners can be contemplated in the SEED heterodimer. For example, according to one embodiment, the first daughter SEED has one fusion partner, and the second daughter SEED has no fusion partner, resulting in the following exemplary configurations: SEED-X heterodimerized to SEED; or X-SEED heterodimerized to SEED. In a further example, the first daughter SEED has two different fusion partners (X, Y), and the second daughter SEED has two different fusion partners (W, Z) differing from the fusion partners of the first daughter SEED. Possible exemplary configurations includes, but are not limited to: X-SEED-Y heterodimerized to W-SEED-Z; X-SEED-Y heterodimerized to Z-SEED-W; Y-SEED-X heterodimerized to W-SEED-Z; or Y-SEED-X heterodimerized to Z-SEED-W. According to the invention, a SEED can also have two or more fusion partners (X) fused sequentially to, for example, the N-terminus (X-X-SEED). Alternately, in another embodiment of the invention, the first daughter SEED has one fusion partner (X), and the second daughter SEED has one fusion partner (Y), resulting in the following exemplary configurations: X-SEED heterodimerized to Y-SEED; X-SEED heterodimerized to SEED-Y; or SEED-X heterodimerized to SEED-Y. In yet another embodiment of the invention, the first daughter SEED has one fusion partner (X), and the second daughter SEED has two fusion partners (Z, Y). Possible exemplary configurations include, but are not limited to: X-SEED heterodimerized to Y-SEED-Z; X-SEED heterodimerized to Z-SEED-Y; SEED-X heterodimerized to Z-SEED-Y; or SEED-X heterodimerized to Y-SEED-Z. Exemplary configurations are illustrated in
FIG. 1C . - In particular, a fusion partner can be one or more bio-active domains including any biologically active protein or a biologically active portion thereof. For example, a bio-active domain can include an antibody constant or variable region, including, but not limited to, a VL domain, a VH domain, an Fv, a single-chain Fv, a diabody, an Fab fragment, a single-chain Fab, or an F(ab′)2.
- According to the invention, the fusion partners can be coupled to the SEED moieties directly or indirectly. For example, a fusion partner may be linked to a SEED moiety by a peptide linker, such as described in U.S. Pat. No. 5,258,498 and U.S. Pat. No. 5,482,858 to Huston et al., or U.S. Pat. No. 5,856,456 and U.S. Pat. No. 5,990,275 to Whitlow et al., the teaching of which are hereby incorporated by reference. Typically, a suitable peptide linker may contain glycine and serine residues. Typically, a suitable peptide linker may also have different properties. For example, in some embodiments, a linker may further include a protease cleavage site, such as a matrix metalloproteinase recognition site.
- Thus, the present invention provides a novel method to produce multispecific antibodies based on SEED technology. A multispecific antibody is a molecule having binding specificities for at least two different antigens. While such molecules typically will only bind two antigens (i.e. BsAbs), antibodies with additional specificities such as trispecific or tetraspecific antibodies are encompassed by this expression when used herein. Examples of BsAbs include those that bind to different antigens on the same cell surface, or those that bind to a cell surface antigen and a non-cell surface antigen. A non-cell surface antigen includes, but is not limited to, an extracellular or intracellular antigen, a soluble or insoluble antigen. The multispecific antibodies may bind to different antigens simultaneously, although simultaneous binding is not required for the function of the multispecific antibodies. In some applications, the antigens are preferentially functionally related, such as EGFR and HER2. Particularly useful types of multispecific antibodies include, but are not limited to, anti-EGFR/anti-HER2; anti-EGFR/anti-HER2/anti-HER3; anti-EGFR/anti-HER3; anti-EGFR/anti-HER2/anti-IGF1R; anti-EGFR/anti-HER2/anti-HER3/anti-IGF1R; anti-EGFR/anti-HER3/anti-IGF1R; anti-EGFR/anti-IGF1R; and anti-HER2/anti-IGF1R. Other combinations of specificities involving the EGFR, HER family and IGF1R are within the scope of the present invention.
- Further examples of BsAbs include those with one arm directed against a tumor cell antigen and the other arm directed against a cytotoxic trigger molecule such as anti-FcγRI/anti-CD15, anti-p185HER2/FcγRIII (CD16), anti-CD3/anti-malignant B-cell (1D10), anti-CD3/anti-p185HER2, anti-CD3/anti-p97, anti-CD3/anti-renal cell carcinoma, anti-CD3/anti-OVCAR-3, anti-CD3/L-D1 (anti-colon carcinoma), anti-CD3/anti-melanocyte stimulating hormone analog, anti-EGF receptor/anti-CD3, anti-CD3/anti-CAMA1, anti-CD3/anti-CD19, anti-CD3/MoV18, anti-neural cell adhesion molecule (NCAM)/anti-CD3, anti-folate binding protein (FBP)/anti-CD3, anti-pan carcinoma associated antigen (AMOC-31)/anti-CD3; BsAbs with one arm which binds specifically to a tumor antigen and one arm which binds to a toxin such as anti-saporin/anti-Id-1, anti-CD22/anti-saporin, anti-CD7/anti-saporin, anti-CD38/anti-saporin, anti-CEA/anti-ricin A chain, anti-interferon-α(IFN-α)/anti-hybridoma idiotype, anti-CEA/anti-vinca alkaloid; BsAbs for converting enzyme activated prodrugs such as anti-CD30/anti-alkaline phosphatase (which catalyzes conversion of mitomycin phosphate prodrug to mitomycin alcohol); BsAbs which can be used as fibrinolytic agents such as anti-fibrin/anti-tissue plasminogen activator (tPA), anti-fibrin/anti-urokinase-type plasminogen activator (uPA); BsAbs for targeting immune complexes to cell surface receptors such as anti-low density lipoprotein (LDL)/anti-Fc receptor (e.g., FcγRI, FcγRII or FcγRIII); BsAbs for use in therapy of infectious diseases such as anti-CD3/anti-herpes simplex virus (HSV), anti-T-cell receptor:CD3 complex/anti-influenza, anti-FcγR/anti-HIV; BsAbs for tumor detection in vitro or in vivo such as anti-CEA/anti-EOTUBE, anti-CEA/anti-DPTA, anti-p185HER2/anti-hapten; BsAbs as vaccine adjuvants; and BsAbs as diagnostic tools such as anti-rabbit IgG/anti-ferritin, anti-horse radish peroxidase (HRP)/anti-hormone, anti-somatostatin/anti-substance P, anti-HRP/anti-FITC, anti-CEA/anti-β-galactosidase. Examples of trispecific antibodies include anti-CD3/anti-CD4/anti-CD37, anti-CD3/anti-CD5/anti-CD37 and anti-CD3/anti-CD8/anti-CD37.
- According to the invention, other bio-active domains include hormones, cytokines, chemokines, secreted enzymes, ligands, extracellular portions of trans-membrane receptors, or receptors. Hormones include, but are not limited to, growth hormones, or glucagon-like peptide (GLP-1). Cytokines include, but are not limited to, interleukin-2 (IL-2), IL-4, IL-5, IL-6, IL-7, IL-10, IL-12, IL-13, IL-14, IL-15, IL-16, IL-18, IL-21, IL-23, IL-31; hematopoeitic factors such as granulocyte-macrophage colony stimulating factor (GM-CSF), G-SCF and erythropoietin; tumor necrosis factors such as TNF-α; lymphokines such as lymphotoxin; regulators of metabolic processes such as leptin; and interferons (IFN) such as IFN-α, IFN-β, and IFN-γ.
- Thus, the engineered heteromeric proteins of the present invention permit the colocalization of different bio-active domains in a biological system. This can be accomplished, for example, in the context of a multimeric protein incorporating two different antibody variable domains, where one antibody variable domain is fused to one engineered domain and a second antibody variable domain is fused to a second engineered domain that preferentially assembles with the first engineered domain. Administration of such an engineered protein causes two distinct activities—in this case, binding activities—to be present in the same molecule in the biological system, colocalizing the activities within the biological system. Whether the activities involve binding to other molecules (as an antibody variable domain/antigen interaction, a ligand/receptor interaction, etc.), enzymatic activities, or a combination thereof, the present invention provides a system to require that the activities be present at the same place permitting, for example, the targeting of a therapeutic activity to a particular cell type or location; the crosslinking of different receptors or cells; the colocalization of an antigen and adjuvant; etc. This can be accomplished by direct administration of an engineered heteromeric protein to a biological system or by expression of nucleic acid encoding the subunits within the biological system. Nucleic acid expression permits the engineering of additional levels of control in the system. For example, the expression of each subunit can be differentially regulated, such that the complete heteromeric protein and the resulting colocalization of activities occurs only upon the occurrence of all conditions required for expression of each subunit.
- Engineered Domains with Reduced Immunogenicity
- In another embodiment of the invention, the SEED sequences can be modified to reduce their potential immunogenicity. Because SEED polypeptides are hybrids between two different naturally occurring human sequences, they include sequence segments at their junctions that are not found in natural human proteins. In an organism, these sequence segments may be processed into non-self T-cell epitopes.
- Methods to analyze peptide sequences for their potential to create T-cell epitopes are well known in the art. For example, ProPred (http://www.imtech.res.in/raghava/propred; Singh and Raghava (2001) Bioinformatics 17:1236-1237) is a publically available web-based tool that can be used for the prediction of peptides that bind HLA-DR alleles. ProPred is based on a matrix prediction algorithm described by Sturniolo for a set of 50 HLA-DR alleles (Sturniolo et al., (1999) Nature Biotechnol. 17:555-561). Using such an algorithm, various peptide sequences were discovered within AG SEED and GA SEED polypeptide sequences which are predicted to bind to multiple MHC class II alleles with significant binding strength and are therefore potentially immunogenic.
- For example, in one embodiment, the AG SEED and GA SEED sequences are modified to remove one or more T-cell epitopes present in the SEED sequence. This modification may include substitution, deletion, or modification of one or more amino acid residues in order to remove the T-cell epitope. Table 1 presents a list of peptide sequences that are potential T-cell epitopes in the AG SEED and GA SEED, and possible amino acid substitutions that are predicted to reduce or remove the T-cell epitope.
-
TABLE 1 AG(f0) SEED Pos Peptide Amino Acid Substitution 32 FYPKDIAVE (SEQ ID NO: 12) K35S 67 FAVTSKLTV (SEQ ID NO: 13) V75T 69 VTSKLTVDK (SEQ ID NO: 14) 99 YTQKTISLS (SEQ ID NO: 15) T103S 18 LALNELVTL (SEQ ID NO: 16) L23Q 20 LNELVTLTC (SEQ ID NO: 17) 23 LVTLTCLVK (SEQ ID NO: 18) 54 YLTWAPVLD (SEQ ID NO: 19) A58T 55 LTWAPVLDS (SEQ ID NO: 20) L61V,D, T 61 LDSDGSFFL (SEQ ID NO: 21) L6IV,D,T 67 FFLYSILRV (SEQ ID NO: 22) F67A,D,E,G,H,K,N,P,Q,R,S,T 68 FLYSILRVA (SEQ ID NO: 23) A76T 69 LYSILRVAA (SEQ ID NO: 24) E78D 70 YSILRVAAE (SEQ ID NO: 25) 72 ILRVAAEDW (SEQ ID NO: 26) Table 1 shows peptides in AG(f0) SEED or GA(f0) SEED which are predicted to bind to HLA-DR alleles and are potential T-cell epitopes, and amino acid substitutions at specific residues (indicated in bold) within the peptides that are predicted to reduce the binding to HLA,DR alleles. ″Pos″ indicates the position of the peptide within the sequence. The numbering of the amino acids is sequential and relative to the first amino acid of the SEED molecule. - The original “full” AG SEED (AG(f0) SEED (SEQ ID NO:3)) and GA SEED (GA(f0) SEED (SEQ ID NO:6)) polypeptides, and some exemplary variant polypeptides, including AG(f1) SEED (SEQ ID NO:4), AG(f2) SEED (SEQ ID NO:5), GA(f1) SEED (SEQ ID NO:7), GA(f2) SEED (SEQ ID NO:8), and GA(f3) SEED (SEQ ID NO:9) are shown in the following alignments.
-
Alignment of AG SEEDs (dot indicates residue identity) 1 GQPFRPEVHLLPPSREEMTKNQVSLTCLARGFYPKDIAVEWESNGQPENNYKTTPSRQEP AG (f0) SEED 1 ..................................S......................... AG (f1) SEED 1 ..................................S......................... AG (f2) SEED 61 SQGTTTFAVTSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKTISL AG (f0) SEED 61 ..........................................S... AG (f1) SEED 61 ..............T...........................S... AG (f2) SEED Alignment of GA SEEDs (dot indicates residue identity) 1 GQPREPQVYTLPPPSEELALNELVTLTCLVKGFYPSDIAVEWLQGSQELPREKYLTWAPV GA (f0) SEED 1 ......................Q..................................T.. GA (f1) SEED 1 ......................Q..................................... GA (f2) SEED 1 ......................Q..................................T.. GA (f3) SEED 61 LDSDGSFFLYSILRVAAEDWKKGDTFSCSVMHEALHNHYTQKSLDR GA (f0) SEED 61 V..............T.D............................ GA (f1) SEED 61 D.....H........T.D............................ GA (f2) SEED 61 T.....D........T.D............................ GA (f3) SEED - Further exemplary embodiments according to the invention are detailed in the examples that follow.
- In this set of examples, the goal is to produce two distinct CH3-homolog SEEDs that will form dimers that favor the formation of a heterodimer over formation of the two possible homodimers, thus resulting in a predominance of CH3-homolog heterodimers. The first task is to identify two or more CH3 domains that may produce this result when they are used as parents of a pair of SEEDs. The CH3 homodimer forms a dimerization interface between β-sheets. It is important to find two CH3 domains that have significant differences in this interface, in order to make an effective pair of SEEDs that will preferentially heterodimerize.
- CH3 domains from IgG are structurally highly conserved across the animal kingdom, containing a classic immunoglobulin domain β-sandwich fold. While there are significant differences between species in the identities of the amino acids found on the outer surface, the dimerization interface surface that is buried upon dimerization is mostly conserved.
- Each different class of immunoglobulin has its own Fc, and in particular has its own equivalent of the IgG CH3 sequence and structure. Examination of the CH3 domain in the crystal structure of the Fc portion of a human IgA1 (PDB number 1OW0, resolution 3.1 Å) revealed that the overall fold was homologous to human IgG CH3. The backbone RMSD (root mean square deviation) of the alignment of single CH3 domains from the IgA Fc 1OW0 and from the IgG Fc 1L6X, excluding turns where alignment had different lengths, was about 0.99 Å. (See table 2). However, the CH3 homodimer interface of IgA1 is significantly different than that of IgG1. Thus, two SEEDs made from the CH3 of human IgA1 and the CH3 of human IgG1 each contain some portion of the interface from IgA1, and some from IgG1, and are designed to not dimerize with themselves, nor with either parent CH3, but to dimerize preferentially with the other complementary SEED.
-
TABLE 2 Structural alignment of CH3 domains from IgG and IgA* Human IgG Human IgA Q342-M358 N343-L359 N361-P387 E363-E389 N390-S400 K394-P404 G402-L443 T409-R450 *Portions of IgG and IgA sequences were used to overlay structures and determine backbone RMSD. The program InsightII (Accelrys, San Diego, CA) superimposed the backbone atoms of the residues included in the structurally homologous sequences listed above. The RMSD between the two backbones (within the ranges in the table) was 0.99 Å. - For example, the CH3 domain from human IgA1 and the CH3 domain from human IgG1 were used as parental polypeptides. For structural alignment and modeling, IgG1 PDB entries 1DN2 (resolution 2.7 Å) and 1L6X (CH3 sequence highly homologous to 1DN2, with two minor differences, resolution 1.65 Å), and IgA1 PDB entry 1OW0 (resolution 3.1 Å) were used.
FIG. 2 shows the structural alignment of the two sequences. The CH3 domain of IgG1 is numbered according to Kabat EU Index (Kabat et al., (1991) Sequences of Proteins of Immunological Interest, 5th Edition, NIH Publication 91-3242), while the CH3 domain of IgA is sequentially numbered as in the PDB structure 1OW0. Bold letters designate the backbone positions that were included in the alignment described in Table 2, which were further used to design junctional crossover points in designing SEEDs. - Once the structural alignment is determined and the interface residues identified, the exchange points are ready to be chosen for creating the SEEDs. The CH3 homodimer has 180° rotational symmetry around an axis that runs between the domains approximately perpendicular to the beta strands (
FIG. 4 ). Each domain has the N-terminus and C-terminus on opposite sides of the axis of symmetry. Therefore, CH3 domains dimerize in a hand-shaking manner, where only in a line down the center of the interface along the symmetry axis do residues on one side contact the same residue in the other partner. Residues on either side of that line contact the partner domain in opposite fashion: e.g., residues on the N-terminal side of the first domain make contact with residues in the second domain that are on the C-terminal side, and vice versa. - In one embodiment, a CH3-based SEED is designed to break the symmetry, making the two sides different. For example, strand exchange will make one side of the dimer more like IgA1, and the other side more like IgG. This approach creates two different CH3-based SEEDs that are approximately complementary in their use of IgG and IgA-derived amino acids. As shown in
FIGS. 3A and 3B , the linear polypeptide sequence runs back and forth between IgG and IgA sequences in order to make one physical side of the dimeric structure IgA-like and the other side IgG-like. Thus, each final SEED sequence contains multiple exchange points, at each of which the linear sequence changes from IgA to IgG or from IgG to IgA (FIGS. 3A and 3B ). - In general, there are many potential multiple exchange points in the polypeptide sequence that can be chosen to alternate between IgA and IgG1 sequences. An important consideration is that the final structure should have good structural characteristics (e.g., stability, folding, expression, homology to the original). This can be achieved by inspection, simple modeling, extensive calculation, trial and error, selection, or by other means. In the specific embodiment described here, the sequence homology between the CH3 domains of IgA and IgG1 was used to decide the exchange points. Alignment of the crystal structures of the IgG1 and IgA CH3 revealed approximately parallel lines of amino acids along an approximate plane angled across the middle of the domain. The residues on the plane were identical in both CH3 classes in all but two strands in the IgG1/IgA structural alignment. Furthermore, the structure alignment generally showed the side chains of those amino acids in the same rotamer orientations, particularly in the hydrophobic core. It was therefore hypothesized that these residues could be used as exchange points, and the residues on one or the other side could be altered without disrupting the overall structure.
FIGS. 3A and 3B show the sequence alignment with the exchange points highlighted in bold letters.FIGS. 5 and 6A -C show the molecular structure illustrating the 3-dimensional locations of the exchange points. - In the two cases where the residues are not the same at a junction region, the choices of exchange points were based on structural considerations. In one instance, Pro395 and Pro396 in IgG1 correspond structurally to Ala399 and Ser400 in IgA1. The division was made between these two residues. The other location is near the C-terminus, Leu441 and Ser442 in IgG1 correspond structurally to Ile448 and Asp449 in IgA1. Again the division was made between these residues.
- Protein-protein interactions are mediated by the complementarity of the two interacting surfaces. The dominant factor for the interaction is the composition and shape of those surfaces. Since the underlying backbone structures and hydrophobic interiors of the CH3 domains of IgA and IgG1 are similar, it was contemplated according to the principles of the invention that only the surface would have to be altered, while the rest of the domain could contain IgG sequences. In this case, the exchange points were designed on the strands that form the interface and were very close to one another, allowing only the residues critical for dimerization to be exchanged. Thus, as an alternative, it is possible that the rest of the structure could help stabilize the assembly domain, and so CH3 SEEDs with a single exchange point in each of the seven strands could have advantages.
- Therefore, two types of SEEDs can be designed and designated as “Full” for the SEEDs in which most or all of the residues in the domain were involved in the strand exchange (corresponding to
FIG. 1A ) or “Surface” for the SEEDs in which the only altered residues are at the CH3 dimerization interface (corresponding toFIG. 1B ). - Based on this Example, it will be appreciated by those skilled in the art that a variety of strategies can be used to generate SEEDs based on immunoglobulin superfamily constant domains.
- As an example, the simplest way to make a “Full” SEED would be to use pure IgA sequence on the first side of the exchange point, and pure IgG1 sequence on the second side of the exchange point. If the exchange point is properly chosen, this would result in a SEED that should fold properly and would have an IgA1-like dimerizing surface on one side (e.g., approximately half) of the domain, and an IgG-like dimerizing surface on the other side. A ‘mirror image’ SEED can be made similarly, in which the first side is composed of IgG1 sequence and the second side is composed of IgA sequence. When these two SEEDs are expressed together, they will preferentially form heterodimers because only in the heterodimer will each surface be contacting a surface on the other domain that matches its class: that is, the first half of the first SEED, which is IgA1-like, will contact the second half of the second SEED, which is also IgA1-like, while the second half of the first SEED, which is IgG1-like, will contact the first half of the second SEED, which is also IgG1-like. Since both sides of the contact surface are highly complementary, the association should be strong. On the other hand, when either SEED attempts to form a homodimer, each half of the dimerization surface will contact a surface on the partner SEED that comes from a different class: that is, the first half of one SEED, which is IgA-like, will contact the second half of the partner domain, which is IgG-like; and the second half of the first SEED, which is IgG1-like, will contact the first half of the partner domain, which is IgA-like. Since these surfaces are not highly complementary, their affinity will be diminished, resulting in thermodynamics favoring the formation of fewer homodimers and more heterodimers.
- In this example, the CH3 is the only part of the Fc or antibody that was altered. The rest of the Fc or immunoglobulin is from human IgG1. Altering the amino acid sequence where the CH3 contacts or interacts with CH2 could potentially create problems with the interface between the CH3 SEEDs and the IgG1 CH2 domains. In addition, this interface contains the binding site for FcRn, which confers important properties to the Fc that are desirable to retain. Therefore, structural information (Martin et al. (2001) Molec. Cell 7:867) was used to identify the CH3 residues involved in the interactions between CH3 and CH2, and between Fc and FcRn. Human IgG1 sequences were used for those residues in all SEEDs. Molecular modeling was also used to help choose the neighboring residues to avoid altering the structure of the FcRn interaction surface. The portion of CH3 that interacts with CH2 and with FcRn is not part of the dimerization interface, therefore, these alterations were unlikely to hinder the formation of heterodimers.
-
FIG. 3B has the “Full” SEED sequences aligned with the IgG1 and IgA sequences in structural alignment. Residues that reside at the exchange points are highlighted in bold. Residues that were unaltered due to their importance in maintaining the interaction withC H2 and/or with FcRn are underlined. - The following general approach was used to make HuFc and HuFc-IL2 constructs, as well as antibody and antibody-IL2 constructs, containing CH3 SEED domains in place of IgG1 CH3 domains. The CH3 domain of IgG1 is almost entirely contained in an approximately 0.4 kb Ngo MIV/Sma I genomic DNA fragment, which is present in pdCs or pdHL expression plasmids that express the constant region of an IgG1 heavy chain. Exemplary expression plasmids are, for example, pdCs-huFc-IL2 (see, for example, Lo et al., Protein Engineering [1998] 11:495), or pdHL7-KS-IL2 (see, for example U.S. Pat. No. 6,696,517). The Ngo MIV site lies within the intron sequence immediately 5′ of the exon encoding IgG1 CH3, and the Sma I site lies in a sequence encoding Ser444Pro445Gly446 near the C-terminus of IgG1 (Kabat EU Index). An exemplary DNA sequence of a mature human IgG1 Fc expressed from a pdCs vector is shown in SEQ ID NO:27. Replacement of the parental Ngo MIV/Sma I fragment with a Ngo MIV/Sma I fragment encoding a CH3 SEED of the invention generates upon expression a polypeptide containing a constant region with a CH3 SEED.
-
DNA sequence in pdCs encoding mature human IgG1 Fc including terminal Lysine residue SEQ ID NO: 27 GAGCCCAAATCTTCTGACAAAACTCACACATGCCCACCGTGCCCAGGTAA GCCAGCCCAGGCCTCGCCCTCCAGCTCAAGGCGGGACAGGTGCCCTAGAG TAGCCTGCATCCAGGGACAGGCCCCAGCCGGGTGCTGACACGTCCACCTC CATCTCTTCCTCAGCACCTGAACTCCTGGGGGGACCGTCAGTCTTCCTCT TCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTC ACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTTCAA CTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGG AGGAGCAGTACAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTG CACCAGGACTGGCTGAATGGCAAGGAGTAGAAGTGCAAGGTCTCCAACAA AGCCCTCCCAGCCCCCATCGAGAAAACCATCTCCAAAGCCAAAGGTGGGA CCCGTGGGGTGCGAGGGCCACATGGACAGAGGCCGGCTCGGCCCACCCTC TGCCCTGAGAGTGACCGCTGTACCAACCTCTGTCCCTACAGGGCAGCCCC GAGAACCACAGGTGTACACCCTGCCCCCATCACGGGAGGAGATGACCAAG AACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACAT CGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCA CGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATAGCAAGCTC ACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGT GATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGT CCCCGGGTAAATGA - Standard techniques were used to obtain DNA sequences encoding the CH3 SEEDs of the invention. For example, DNA molecules with following sequences as shown in SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:31, SEQ ID NO:32, and SEQ ID NO:53 were synthesized de novo and propagated in a pUC-derived carrier plasmid (Blue Heron Biotechnology, Bothell, Wash.).
-
DNA fragment Ngo MIV/SmaI, containing sequence encoding AG(f0) SEED (underlined corresponding to FIG. 3B, ″Full AG SEED″): SEQ ID NO: 28 gccggctcggcccaccctctgccctgagagtgaccgctgtaccaacctct gtccctacaGGGCAGCCCTTCCGGCCAGAGGTCCACCTGCTGCCCCCATC ACGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGCACGCG GCTTCTATCCCAAGGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCG GAGAACAACTACAAGACCACGCCTTCCCGGCAGGAGCCCAGCCAGGGCAC CACCACCTTCGCTGTGACCTCGAAGCTCACCGTGGACAAGAGCAGATGGC AGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAAC CACTACACGCAGAAGACCATCTCCCTGtccccggg DNA fragment Ngo MIW/Sma I, containing sequence encoding AG(s0) SEED (underlined corresponding to FIG. 3A, ″Surface AG SEED″): SEQ ID NO: 29 gccggctcggcccaccctctgccctgagagtgaccgctgtaccaacctct gtccctacaGGGCAGCCCTTCGAACCAGAGGTCCACACCCTGCCCCCATC ACGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCCGCG GCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCG GAGAACAACTACAAGACCACGCCTTCCCGGCTGGAGCCCAGCCAGGGCAC CACCACCTTCGCTGTGACCTCGAAGCTCACCGTGGACAAGAGCAGATGGC AGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAAC CACTACACGCAGAAGAGCCTCTCCCTGtccccggg DNA fragment Ngo MIW/Sma I, containing sequence coding GA(f0) SEED (underlined corresponding to FIG. 3B, ″Full GA SEED″): SEQ ID NO: 30 gccggctcggcccaccctctgccctgagagtgaccgctgtaccaacctct gtccctacaGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCACC GTCGGAGGAGCTGGCCCTGAACGAGCTGGTGACGCTGACCTGCCTGGTCA AAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGCTGCAGGGGTCCCAG GAGCTGCCCCGCGAGAAGTACCTGACTTGGGCACCCGTGCTGGACTCCGA CGGCTCCTTCTTCCTCTATAGTATACTGCGCGTGGCAGCCGAGGACTGGA AGAAGGGGGACACCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAAC CACTACACGCAGAAGAGCCTCGACCGCtccccggg DNA fragment Ngo MIV/Sma I, containing sequence encoding GA(s0) SEED (underlined corresponding to FIG. 3A, ″Surface GA SEED″): SEQ ID NO: 31 gccggctcggcccaccctctgccctgagagtgaccgctgtaccaacctct gtccctacaGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCACC GTCGGAGGAGCTGGCCCTGAACAACCAGGTGACGCTGACCTGCCTGGTCA AAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAG CCGGAGCCCCGCGAGAAGTACCTGACTTGGGCACCCGTGCTGGACTCCGA CGGCTCCTTCTTCCTCTATTCGATACTGCGCGTGGACGCAAGCAGGTGGC AGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAAC CACTACACGCAGAAGAGCCTCTCCCTGtccccggg DNA fragment Ngo MIV/Sma I, containing sequence encoding GA(f1) SEED (underlined): SEQ ID NO: 32 gccggctcggcccaccctctgccctgagagtgaccgctgtaccaacctct gtccctacaGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCACC GTCGGAGGAGCTGGCCCTGAACGAGCaGGTGACGCTGACCTGCCTGGTCA AAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGCTGCAGGGGTCCCAG GAGCTGCCCCGCGAGAAGTACCTGACTTGGaCcCCCGTGgTGGACTCCGA CGGCTCCTTCTTCCTCTATAGTATACTGCGCGTGaCAGCCGAtGACTGGA AGAAGGGGGACACCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAAC CACTACACCTCAGAAGAGCCTCGACCGCtccccggg DNA fragment Ngo MIW/Sma I, containing sequence encoding GA(f2) SEED (underlined): SEQ ID NO: 53 gccggctcggcccaccctctgccctgagagtgaccgctgtaccaacctct gtccctacaGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCACC GTCGGAGGAGCTGGCCCTGAACGAGCaGGTGACGCTGACCTGCCTGGTCA AAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGCTGCAGGGGTCCCAG GAGCTGCCCCGCGAGAAGTACCTGACTTGGgCaCCCGTGgacGACTCCGA CGGCTCCcaCTTCCTCTATAGTATACTGCGCGTGaCAGCCGAtGACTGGA AGAAGGGGGACACCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAAC CACTACACGCAGAAGAGCCTCGACCGCtccccggg In addition, a polypeptide containing GA(f3) SEED may be encoded by the following DNA sequence: DNA fragment Ngo MIW/Sma I, containing sequence encoding GA(f3) SEED (underlined): SEQ ID NO: 54 gccggctcggcccaccctctgccctgagagtgaccgctgtaccaacctct gtccctacaGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCACC GTCGGAGGAGCTGGCCCTGAACGAGCaGGTGACGCTGACCTGCCTGGTCA AAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGCTGCAGGGGTCCCAG GAGCTGCCCCGCGAGAAGTACCTGACTTGGaCcCCCGTGaccGACTCCGA CGGCTCCgacTTCCTCTATAGTATACTGCGCGTGaCAGCCGAtGACTGGA AGAAGGGGGACACCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAAC CACTACACGCAGAAGAGCCTCGACCGCtccccggg - These synthetic sequences were additionally extended at their 3′ end with an approximately 50 bp stretch of random DNA so as to allow easy separation of excised Ngo MIV/Sma I desired insert fragment and a similarly sized plasmid vector fragment during fragment purification. The gel purified Ngo MIV/Sma I fragments were then ligated to a similarly treated pdCs vector containing either an Fc moiety or an Fc-IL2 moiety, or alternatively, to a similarly treated pdHL vector containing either a DI-KS or a DI-KS-IL2 moiety. Thus, for example, pdCs-HuFc(AG(f0))-IL2, containing the Ngo MIV/Sma I fragment for AG(f0) SEED (SEQ ID NO:28), and pdCs-HuFc(GA(f0)), containing the Ngo MIV/Sma I fragment for GA(f0) SEED (SEQ ID NO:30), were obtained. pdCs-HuFc(AG(f0))-IL2 and pdCs-HuFc(GA(f0)) encode an Fc(AG(f0) SEED)-IL-2 polypeptide chain and an Fc(GA(f0) SEED) polypeptide chain, respectively. Exemplary sequences of Fc(AG(f0) SEED)-IL-2 and of Fc(GA(f1) SEED) are shown as SEQ ID NO:33 and SEQ ID NO:34, respectively, below. A diagram of the resulting heterodimeric protein is shown in
FIG. 11A . To obtain simultaneous expression of both polypeptide chains from a host cell, the transcription units for these Fc polypeptides were combined on a single expression vector as described below in Example 5. -
Polypeptide sequence of a Fc(AG(f0) SEED)-IL2: SEQ ID NO: 33 EPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKALPAPIEKTISKAKGQPFRPEVHLLPPSREEMTKNQVSL TCLARGFYPKDIAVEWESNGQPENNYKTTPSRQEPSQGTTTFAVTSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKTISLSPGKAPTSSSTKKTQLQLE HLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKP LEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADETATIV EFLNRWITFCQSIISTLT Polypeptide sequence of a Fc(GA(f0) SEED): SEQ ID NO: 34 EPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPPSEELALNELVT LTCLVKGFYPSDIAVEWLQGSQELPREKYLTWAPVLDSDGSFFLYSILRV AAEDWKKGDTFSCSVMHEALHNHYTQKSLDRSPGK - Similarly, pdHL-DI-KS(AG(f0))-IL2, containing the Ngo MIV/Sma I fragment for AG(f0) SEED (SEQ ID NO:28), and pdHL-DI-KS(GA(f0)), containing the Ngo MIV/Sma I fragment for GA(f0) SEED (SEQ ID NO:30), were obtained. pdHL-DI-KS(AG(f0))-IL2 and pdHL-DI-KS(GA(f0)) encode DI-KS(AG(f0) SEED)-IL-2 heavy chain (SEQ ID NO:35), DI-KS(GA(f0) SEED) heavy chain (SEQ ID NO:36), respectively. Both expression vectors also encode the DI-KS light chain (SEQ ID NO:37).
-
Polypeptide sequence of DI-KS(AG(f0) SEED)-IL2 heavy chain: SEQ ID NO: 35 QIQLVQSGPELKKPGSSVKISCKASGYTFTNYGMNWVRQAPGKGLKWMG WINTYTGEPTYADDFKGRFTITAETSTSTLYLQLNNLRSEDTATYFCVR FISKGDYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT YICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPATELLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPF RPEVHLLPPSREEMTKNQVSLTCLARGFYPKDIAVEWESNGQPENNYTT PSRQEPSQGTTTFAVTSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKT ISLSPGAAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTF KFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINV IVLELKGSETTFMCEYADETATIVEFLNRWITFCQSIISTLT Polypeptide sequence of DI-KS(GA(f0) SEED) heavy chain: SEQ ID NO: 36 QIQLVQSGPELKKPGSSVKISCKASGYTFTNYGMNWVRQAPGKGLKWMG WINTYTGEPTYADDFKGRFTITAETSTSTLYLQLNNLRSEDTATYFCVR FISKGDYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT YICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPR EPQVYTLPPPSEELALNELVTLTCLVKGFYPSDIAVEWLQGSQELPREK YLTWAPVLDSDGSFFLYSILRVAAEDWKKGDTFSCSVMHEALHNHYTQK SLDRSPGK Polypeptide sequence of DI-KS light Chain: SEQ ID NO: 37 QIVLTQSPASLAVSPGQRATITCSASSSVSYILWYQQKPGQPPKPWIFD TSNLASGFPSRFSGSGSGTSYLLTINSLEAEDAATYYCHQRSGYPYTFG GGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQW KVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT HQGLSSPVTKSFNRGEC - To obtain a single expression vector expressing both DI-KS(AG(f0) SEED)-IL-2 and DI-KS(GA(f0) SEED) heavy chain transcription units as well as the common light chain transcription unit, a construct was prepared essentially as follows: an approximately 3.9 kb Sal I/Mfe I fragment containing the sequence encoding KS(AG(f0) SEED)-IL-2 was excised from the pdHL-10 expression construct (pdHL-10 is a later generation pdHL expression vector containing a single Sal I site outside of the transcription unit) and ligated into a Sal I/Bam HI digested pBS plasmid, together with a Bam HI/Mfe I duplex linker fragment. This duplex linker fragment is composed of Oligo11 (SEQ ID NO:38) and Oligo12 (SEQ ID NO:39) and contains an internal Sal I site.
-
Oligo11 (SEQ ID NO: 38) AATTGCCGGGTCGACATACG Oligol2 (SEQ ID NO: 39) GATCCGTATGTCGACCCGGC
The 3.9 kb fragment was then excised from pBS as a Sal I fragment and inserted into the unique Sal I site of a pdHL-10 expression construct already containing the transcription units encoding DI-KS(GA(f0) SEED) heavy chain and the DI-KS light chain. - The examples described here involve CH3 dimerization, which is an important step in nucleating the formation of Fc and immunoglobulin heavy chain dimers. In theory, if two distinct Fc moieties (e.g., termed A and B) containing CH3 domains are expressed simultaneously in a cell, they could pair and form Fc dimeric molecules in the following configurations: A:A, A:B, and B:B. If the CH3 domains and hinge domains are identical, the configurations A:A, A:B, and B:B are expected to occur in a 1:2:1 ratio if A and B are expressed in equal amounts. The relative amounts, the kinetics and thermodynamics of A-A, A-B, and B-B interactions are important governing factors for the observed ratio of these three final species, as would the expression levels. In general, when protein A and protein B are expressed in relative amounts [A] and [B], where [A]+[B]=1, and homodimers and heterodimers are produced in relative concentrations [A−A], [A−B], and [B−B], if there is unbiased association, these dimeric species will respectively be present in a ratio of [A]2:2*[A]*[B]:[B]2. If the relative concentration [A−B]>2*[A]*[B], then heterodimerization is favored, while if the relative concentration [A−B]<2*[A]*[B], then homodimerization is favored. For a preferred SEED pair, the ratio [A−B]/2*[A]*[B] is greater than 2, and preferably greater than 3, and more preferably greater than 5.
- To determine the ratios of the different species, one needs a way to distinguish them by an assay. An easy way to do this is to attach a fusion partner to one of the Fc subunits (e.g., “A”), which would result in each of the three final species having a significantly different molecular weight. Accordingly, constructs were prepared to express both human Fc (HuFc) and human Fc fused to human IL-2 (HuFc-IL-2) in one cell. The constructs were prepared as follows: The gene for HuFc was excised from a vector containing an Fc moiety (see, for example, Lo et al., Protein Engineering [1998] 11:495) by enzymatic restriction at a 5′ XbaI site and a 3′ XhoI site. The 1.4 Kb fragment containing the HuFc gene was gel purified and subcloned into a second vector, pdCS-MuFc-KS-kappa, replacing its muFc with HuFc. The HuFc gene was flanked by two SalI sites outside the promoter region.
- A third vector containing a gene coding for HuFc-IL-2 and a single SalI site was chosen to receive the HuFc gene. The vector was cut with SalI, treated with Calf Intestinal Phosphatase (CIP) and gel purified. The second vector was digested with Sail and a 2.5 Kb fragment was gel purified. This fragment contained the HuFc gene and a promoter, and was inserted into the gel-purified third vector. The final resulting vector contained two different transcription units with duplicated versions of the same regulatory elements, one transcription unit controlling the expression of wild type HuFc and the other controlling the expression of wild type HuFc-IL-2. Expression constructs containing SEED-based HuFc and SEED-based HuFc-IL-2 were similarly made.
- This final vector was expanded using Qiagen maxi-prep. 10 mg of the DNA was used to transiently transfect baby hamster kidney (BHK) cells, using the Lipofectamine TM2000 kit (Invitrogen). Cells were split, half grown in regular medium, the other half in serum-free medium, for two days. Supernatants (e.g., 100 ul) were harvested. 10 microliters of protein-A beads were added and mixed overnight at 4.degree. C. to bind the protein. After washing 3.times. with PBS containing 1% Triton-X100, samples were loaded onto Nu-Page (Invitrogen) 4-12% gradient Bis-Tris gels, under both reducing and non-reducing conditions. Gels were stained with colloidal blue (Invitrogen) for direct protein visualization.
- Typical control results are shown in lanes 8-10 in the gels shown in
FIGS. 12D-E . The reducing gel inFIG. 12C shows the ratio of HuFc and HuFc-IL-2 subunits. The non-reducing gel inFIG. 12B shows that the HuFc and HuFc-IL2 molecules dimerize randomly, with no preference for heterodimerization as compared to homodimerization. - Gels were also transferred to nitrocellulose membranes for Western blot analysis. In the Western blots, protein was detected in two ways in order to measure both the Fc and the IL-2. Antibodies against human IgG Fc (Jackson Immunolabs) conjugated to horseradish peroxidase (HRP) were used to detect Fc. The blots were detected with ECL substrate and film exposure. A biotinylated antibody against human IL-2 (R&D systems) was used to detect IL-2, and the signal was developed by adding avidin conjugated to HRP, and detecting with ECL substrate and film exposure. These experiments confirmed the identity of bands shown in
FIGS. 12D-E . - To measure the levels of heterodimers and homodimers formed during expression of “Full” GA SEED/AG SEED and “Surface” GA SEED/AG SEED proteins, similar experiments were performed. Single expression vector constructs expressing an AG SEED-IL2 fusion protein and a GA SEED protein were constructed as described above for the expression of Fc/Fc-IL2. As shown in lanes 2-4 in
FIGS. 12B and 12C , when the “Full” GA SEED (Fc(GA(f0) SEED) and the “Full” AG SEED-IL-2 (Fc(AG(f0) SEED)-IL2) proteins were co-expressed in NS/O cells, heterodimerization was strongly preferred, with no detectable Fc(AG SEED)-IL2 homodimers, and only very small amounts of the Fc(GA SEED) homodimers were detected. Similarly, as shown in lanes 5-7 inFIGS. 12B and 12C , when the “Surface” GA SEED (Fc(GA(s0) SEED) and the “Surface” AG SEED-IL-2 (Fc(AG(s0) SEED)-IL2) proteins were co-expressed in NS/0 cells, heterodimerization was strongly favored, with no detectable Fc(AG SEED)-IL-2 homodimers, and only small amounts of the Fc(GA SEED) homodimer detected. It was estimated that heterodimers constituted about >90% of the total amount of the proteins assembled in the cell. - Because the AG and GA SEED protein sequences are hybrids between two different naturally occurring human sequences, these sequences include peptide segments that are not found in normal human proteins and that may be processed into non-self MHC Class II T cell epitopes. Therefore, the following sequences were designed to reduce the number of potential non-self T-cell epitopes in the AG SEED and GA SEED sequences, depicted by the polypeptide sequence shown in SEQ ID NO: 1 and SEQ ID NO:2, respectively, wherein X1, X2, X3, X4, X5, or X6 may be any amino acid. In some embodiments, in SEQ ID NO:1, X1 is S, X2 is V or T, and X3 is S. In some embodiments, in SEQ ID NO:2, X1 is Q, X2 is A or T, X3 is L, V, D, or T, X4 is F, A, D, E, G, H, K, N, P, Q, R, S, or T, X5 is T, and X6 is D.
-
Polypeptide sequence of AG SEED, with variant amino acids X1-X3: SEQ ID NO: 1 GQPFRPEVHLLPPSREEMTKNQVSLTCLARGFYPX1DIAVEWESNGQPENN YKTTPSRQEPSQGTTTFAVTSKLTX2DKSRWQQGNVFSCSVMHEALHNHYT QKX3ISL Polypeptide sequence of GA SEED, with variant amino acids X1-X6: SEQ ID NO: 2 GQPREPQVYTLPPPSEELALNEX1VTLTCLVKGFYPSDIAVEWLQGSQELP REKYLTWX2PVX3DSDGSX4FLYSILRVX5AX6DWKKGDTFSCSVMHEALH NHYTQKSLDR - The DNA molecule (SEQ ID NO:32) encoding exemplary SEED variant GA(f1) SEED (SEQ ID NO:7) was made by de novo synthesis and was introduced into the pdCs expression vector as described in Example 4, producing the polypeptide Fc(GA(f1) SEED).
-
Polypeptide sequence of GA(f1) SEED: SEQ ID NO: 7 GQPREPQVYTLPPPSEELALNEQVTLTCLVKGFYPSDIAVEWLQGSQEL PREKYLTWTPVVDSDGSFFINSILRVTADDWKKGDTFSCSVMHEAHNHY TQKSLDR - Mutations were introduced into the exemplary variant SEED moieties, AG(f1) SEED (SEQ ID NO:4), AG(f2) SEED (SEQ ID NO:5), and GA(f2) SEED (SEQ ID NO:8), by a two-step PCR approach in which two mutagenized, partially overlapping PCR fragments from a first round of PCR amplification are combined in a second round of PCR amplification to generate the final full-length fragment, using standard methods familiar to those skilled in the art. Essentially, two PCR reactions were performed in the first round, each with a PCR primer incorporating the mutant sequence paired with an appropriate flanking primer containing suitable restriction sites, Ngo MIV for the upstream primer and Sma I for the downstream primer, and a DNA template encoding the appropriate parent SEED moiety. The same flanking PCR primers were used in the second PCR amplification reaction, using the products of the first PCR amplification as templates. The resultant fragment was cloned into a pCR2.1 vector (Invitrogen) and its sequence was verified. Finally, the 0.4 kb Ngo MIV/Sma I DNA fragment was excised from the vector, gel purified, and ligated into a similarly treated recipient expression plasmid, as described in Example 4.
- Specifically, for AG(f1) SEED, primer pairs Oligo1 (SEQ ID NO:40)/Oligo2 (SEQ ID NO:41) and Oligo3 (SEQ ID NO:42)/Oligo4 (SEQ ID NO:43) with template pdCs-Fc(AG(f0) SEED)-IL2 were used in the first round of PCR reactions. Oligo1 (SEQ ID NO:40)/Oligo4 (SEQ ID NO:43) were used in the second round of PCR reactions, generating the DNA fragment shown in SEQ ID NO:44 which was introduced into pdCs-Fc(AG(f0) SEED)-IL2. For AG(f1) SEED, primer pairs Oligo1 (SEQ ID NO:40)/Oligo5 (SEQ ID NO:45) and Oligo6 (SEQ ID NO:46)/Oligo4 (SEQ ID NO:43) with template pCR2.1 containing the sequence shown in SEQ ID NO:44 were used in the first round of PCR reactions. Oligo1 (SEQ ID NO:40)/Oligo4 (SEQ ID NO:43) were used in the second round of PCR reactions, generating the DNA fragment shown in SEQ ID NO:47 which was introduced into pdCs-Fc(AG(f0) SEED)-IL2. For GA(f2) SEED, primer pairs Oligo1 (SEQ ID NO:40)/Oligo10 (SEQ ID NO:48) and Oligo7 (SEQ ID NO:49)/Oligo9 (SEQ ID NO:50) with template carrier plasmid pUC containing the sequence shown in SEQ ID NO:32 were used in the first round of PCR reactions. Oligo1 (SEQ ID NO:40)/Oligo9 (SEQ ID NO:50) were used in the second round of PCR reactions, generating the DNA fragment shown in SEQ ID NO:47 which was introduced into pdCs-Fc(GA(f2) SEED). All the sequences referred to above are shown below.
-
Oligo1 (SEQ ID NO: 40) GCCGGCTCGGCCCACCCTCT Oligo2 (SEQ ID NO: 41) CGGCGATGTCGCTGGGATAGAA Oligo3 (SEQ ID NO: 42) TTCTATCCCAGCGACATCGCCG Oligo4 (SEQ ID NO: 43) CCCGGGGACAGGGAGATGGACTTCTGCGTGT Oligo5 (SEQ ID NO: 45) GCTCTTGTCTGTGGTGAGCTT Oligo6 (SEQ ID NO: 46) AAGCTCACCACAGACAAGAGC Oligo7 (SEQ ID NO: 49) CCTGACTTGGGCACCCGTGGACGACTCCGACGGCTCCCACTTCCTCTATA Oligo9 (SEQ ID NO: 50) CCCGGGGAGCGGTCGAGGCTC Oligo10 (SEQ ID NO: 48) TATAGAGGAAGTGGGAGCCGTCGGAGTCGTCCACGGGTGCCCAAGTCAGG DNA fragment Ngo MIV/Sma I, containing sequence encoding AG(f1) SEED (underlined): SEQ ID NO: 44 gccggctcggcccaccctctgccctgagagtgaccgctgtaccaacctct gtccctacaGGGCAGCCCTTCCGGCCAGAGGTCCACCTGCTGCCCCCATC ACGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGCACGCG GCTTCTATCCCAgcGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCG GAGAACAACTACAAGACCACGCCTTCCCGGCAGGAGCCCAGCCAGGGCAC CACCACCTTCGCTGTGACCTCGAAGCTCACCGTGGACAAGAGCAGATGGC AGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAAC CACTACACGCAGAAGtCCATCTCCCTGtccccggg DNA fragment Ngo MIV/Sma I, containing sequence encoding AG(f2) SEED (underlined): SEQ ID NO: 47 gccggctcggcccaccctctgccctgagagtgaccgctgtaccaacctct gtccctacaGGGCAGCCCTTCCGGCCAGAGGTCCACCTGCTGCCCCCATC ACGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGCACGCG GCTTCTATCCCAgcGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCG GAGAACAACTACAAGACCACGCCTTCCCGGCAGGAGCCCAGCCAGGGCAC CACCACCTTCGCTGTGACCTCGAAGCTCACCacaGACAAGAGCAGATGGC AGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAAC CACTACACGCAGAAGtCCATCTCCCTGtccccggg - Fc(AG(f1) SEED), Fc(AG(f2) SEED), Fc(GA(f1) SEED)-IL2 and Fc(GA(f2) SEED)-IL2 sequences were expressed individually and in combinations in HEK 293T cells, and the resulting secreted proteins were partially purified based on Fc binding to Staphylococcus A protein and characterized by SDS-PAGE. When the samples were run on a reducing SDS gel, it was apparent that the Fc(AG(f1) SEED) and Fc(AG(f2) SEED) proteins were expressed very poorly by themselves, which is similar to the parent Fc(AG(f0) SEED) protein. Without wishing to be bound by theory, the poor expression most likely results from the proteolysis of the monomeric protein that has no dimerization partner. The Fc(GA(f1) SEED)-IL2 protein was expressed at high level, while the Fc(GA(f2) SEED)-IL2 protein, differing by the additional amino acid substitution Val75Thr, was expressed at a very low level. Again, without wishing to be bound by theory, the poor expression may result from the proteolysis of the monomeric protein that has no dimerization partner. The combinations Fc(AG(f1) SEED) plus Fc(GA(f1) SEED)-IL2, Fc(AG(f2) SEED) plus Fc(GA(f1) SEED)-IL2, Fc(AG(f1) SEED) plus Fc(GA(f2) SEED)-IL2, and Fc(AG(f2) SEED) plus Fc(GA(f2) SEED)-IL2, were tested and all were expressed at high levels. The same samples were run on a non-reducing gel and confirmed these results. This analysis indicated that, for the combinations, essentially all of the expressed protein was heterodimeric. These results indicate that certain variant GA and AG SEED proteins with reduced immunogenicity retain their preference for heterodimerization.
- To further demonstrate the versatility of the SEED-based Fc regions, an intact antibody with a single IL-2 moiety was constructed as described in Example 4. A diagram of this protein is shown in
FIG. 11B . Specifically, the protein contained antibody V regions that bind to EpCAM and that have the sequences as described in U.S. Pat. No. 6,696,517, human IgG1 CH1 and CH2 domains, human Ckappa, the GA and AG SEED domains, and human IL-2 fused to the C-terminus of the AG SEED-containing heavy chain. - The protein was expressed in mammalian cells according to standard techniques producing a protein with the polypeptide chains shown in SEQ ID NO:37, SEQ ID NO:36, and SEQ ID NO:35.
- The resulting protein was characterized to determine the extent to which heterodimeric forms were secreted from the mammalian cells. For example, the secreted protein was characterized by non-reducing SDS-polyacrylamide gel electrophoresis. In principle, three bands might be identified, corresponding to antibodies with no, one or two IL-2 moieties. The actual non-reducing gel showed predominantly a single band with a molecular weight corresponding to an antibody with a single IL-2 moiety. A much less intense band with a molecular weight corresponding to no IL-2 moieties was seen, and a band with a molecular weight corresponding to two IL-2 moieties was not detectable. When the samples were reduced before running on the gel, approximately equal amounts of protein corresponding to antibody heavy chain and heavy chain-IL2 were detected.
- The foregoing description of the present invention provides illustration and description, but is not intended to be exhaustive or to limit the invention to the precise one disclosed. Modifications and variations consistent with the above teachings may be acquired from practice of the invention. Thus, it is noted that the scope of the invention is defined by the claims and their equivalents
- All sequence and structure access numbers, publications and patent documents cited in this application are incorporated by reference in their entirety for all purposes to the same extent as if the contents of each individual publication or patent document were incorporated herein.
Claims (6)
1-30. (canceled)
31. A method of designing a multidomain protein with domains that preferentially heterodimerize, the method comprising the steps of:
(a) selecting a first polypeptide, a second polypeptide, a third polypeptide and a fourth polypeptide, wherein the first and third polypeptides dimerize with each other, but not with the second or fourth polypeptide, and wherein said second and fourth polypeptides dimerize with each other,
(b) composing an amino acid sequence of a first domain from the first and the second polypeptides comprising at least one assembly element from the first polypeptide, and
(c) composing an amino acid sequence of a second domain from the third and fourth polypeptides comprising at least one assembly element from the third polypeptide, such that the assembly elements from the first and third polypeptides assemble with each other, thereby promoting heterodimerization of the first and second domains.
32. The method of claim 31 , wherein the first domain further comprises an assembly element from the second polypeptide and the second domain further comprises a assembly element from the fourth polypeptide such that the assembly elements from the second and fourth polypeptides bind assemble with other promoting heterodimerization of the first and second domains.
33. The method of claim 31 , wherein step (b) or step (c) comprises comparing three-dimensional structures of two or more of the first, second, third or fourth polypeptides.
34. The method of claim 31 , wherein the first and third polypeptides are identical.
35. The method of claim 34 , wherein the second and fourth polypeptides are identical.
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US15/362,319 US20170145078A1 (en) | 2006-03-24 | 2016-11-28 | Engineered heterodimeric protein domains |
US16/217,613 US20190211079A1 (en) | 2006-03-24 | 2018-12-12 | Engineered heterodimeric protein domains |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US78547406P | 2006-03-24 | 2006-03-24 | |
US11/728,048 US8871912B2 (en) | 2006-03-24 | 2007-03-23 | Engineered heterodimeric protein domains |
US14/505,653 US9505848B2 (en) | 2006-03-24 | 2014-10-03 | Engineered heterodimeric protein domains |
US15/362,319 US20170145078A1 (en) | 2006-03-24 | 2016-11-28 | Engineered heterodimeric protein domains |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/505,653 Division US9505848B2 (en) | 2006-03-24 | 2014-10-03 | Engineered heterodimeric protein domains |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/217,613 Division US20190211079A1 (en) | 2006-03-24 | 2018-12-12 | Engineered heterodimeric protein domains |
Publications (1)
Publication Number | Publication Date |
---|---|
US20170145078A1 true US20170145078A1 (en) | 2017-05-25 |
Family
ID=38541456
Family Applications (4)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US11/728,048 Active 2032-01-07 US8871912B2 (en) | 2006-03-24 | 2007-03-23 | Engineered heterodimeric protein domains |
US14/505,653 Active US9505848B2 (en) | 2006-03-24 | 2014-10-03 | Engineered heterodimeric protein domains |
US15/362,319 Abandoned US20170145078A1 (en) | 2006-03-24 | 2016-11-28 | Engineered heterodimeric protein domains |
US16/217,613 Abandoned US20190211079A1 (en) | 2006-03-24 | 2018-12-12 | Engineered heterodimeric protein domains |
Family Applications Before (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US11/728,048 Active 2032-01-07 US8871912B2 (en) | 2006-03-24 | 2007-03-23 | Engineered heterodimeric protein domains |
US14/505,653 Active US9505848B2 (en) | 2006-03-24 | 2014-10-03 | Engineered heterodimeric protein domains |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/217,613 Abandoned US20190211079A1 (en) | 2006-03-24 | 2018-12-12 | Engineered heterodimeric protein domains |
Country Status (13)
Country | Link |
---|---|
US (4) | US8871912B2 (en) |
EP (1) | EP1999154B1 (en) |
JP (3) | JP5474531B2 (en) |
AR (1) | AR060070A1 (en) |
AU (1) | AU2007229698B9 (en) |
CA (1) | CA2646965C (en) |
DK (1) | DK1999154T3 (en) |
ES (1) | ES2395969T3 (en) |
IL (1) | IL194145A (en) |
PL (1) | PL1999154T3 (en) |
PT (1) | PT1999154E (en) |
SI (1) | SI1999154T1 (en) |
WO (1) | WO2007110205A2 (en) |
Cited By (9)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10501543B2 (en) | 2016-10-14 | 2019-12-10 | Xencor, Inc. | IL15/IL15Rα heterodimeric Fc-fusion proteins |
WO2020242884A1 (en) * | 2019-05-24 | 2020-12-03 | Proviva Therapeutics (Hong Kong) Limited | Il-2 compositions and methods of use thereof |
US11084863B2 (en) | 2017-06-30 | 2021-08-10 | Xencor, Inc. | Targeted heterodimeric Fc fusion proteins containing IL-15 IL-15alpha and antigen binding domains |
US11377477B2 (en) | 2018-10-12 | 2022-07-05 | Xencor, Inc. | PD-1 targeted IL-15/IL-15RALPHA fc fusion proteins and uses in combination therapies thereof |
US11505595B2 (en) | 2018-04-18 | 2022-11-22 | Xencor, Inc. | TIM-3 targeted heterodimeric fusion proteins containing IL-15/IL-15RA Fc-fusion proteins and TIM-3 antigen binding domains |
US11524991B2 (en) | 2018-04-18 | 2022-12-13 | Xencor, Inc. | PD-1 targeted heterodimeric fusion proteins containing IL-15/IL-15Ra Fc-fusion proteins and PD-1 antigen binding domains and uses thereof |
US11618776B2 (en) | 2018-12-20 | 2023-04-04 | Xencor, Inc. | Targeted heterodimeric Fc fusion proteins containing IL-15/IL-15RA and NKG2D antigen binding domains |
US11739160B2 (en) | 2018-12-24 | 2023-08-29 | Sanofi | PseudoFab-based multispecific binding proteins |
US11932675B2 (en) | 2019-10-11 | 2024-03-19 | Genentech, Inc. | PD-1 targeted IL-15/IL-15Rα Fc fusion proteins with improved properties |
Families Citing this family (520)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JP5179689B2 (en) | 2000-02-11 | 2013-04-10 | メルク パテント ゲゼルシャフト ミット ベシュレンクテル ハフツング | Enhancing the half-life of antibody-based fusion proteins in the circulation |
PL206701B1 (en) | 2001-03-07 | 2010-09-30 | Merck Patent Gmbh | Expression technology for proteins containing a hybrid isotype antibody moiety |
US6992174B2 (en) | 2001-03-30 | 2006-01-31 | Emd Lexigen Research Center Corp. | Reducing the immunogenicity of fusion proteins |
DE60239454D1 (en) | 2001-05-03 | 2011-04-28 | Merck Patent Gmbh | RECOMBINANT, TUMOR-SPECIFIC ANTIBODY AND ITS USE |
BR0214650A (en) | 2001-12-04 | 2005-05-03 | Merck Patent Gmbh | Modulated selectivity immunocytokines |
DK2314629T4 (en) | 2002-07-18 | 2023-02-06 | Merus Nv | RECOMBINANT PRODUCTION OF MIXTURES OF ANTIBODIES |
USRE47770E1 (en) | 2002-07-18 | 2019-12-17 | Merus N.V. | Recombinant production of mixtures of antibodies |
AU2004309050B2 (en) | 2003-12-30 | 2010-10-14 | Merck Patent Gmbh | IL-7 fusion proteins |
US7670595B2 (en) | 2004-06-28 | 2010-03-02 | Merck Patent Gmbh | Fc-interferon-beta fusion proteins |
JP5620626B2 (en) | 2005-03-31 | 2014-11-05 | 中外製薬株式会社 | Polypeptide production method by association control |
AR060070A1 (en) | 2006-03-24 | 2008-05-21 | Merck Patent Gmbh | HETERODYMERIC PROTEIN DOMAINS OBTAINED BY ENGINEERING |
US9670269B2 (en) | 2006-03-31 | 2017-06-06 | Chugai Seiyaku Kabushiki Kaisha | Methods of modifying antibodies for purification of bispecific antibodies |
BRPI0717431A2 (en) | 2006-09-29 | 2013-11-12 | Oncomed Pharm Inc | CANCER DIAGNOSTIC AND TREATMENT COMPOSITIONS AND METHODS |
CN104497143B (en) | 2007-03-29 | 2020-08-25 | 健玛保 | Bispecific antibody and method for producing same |
US9266967B2 (en) | 2007-12-21 | 2016-02-23 | Hoffmann-La Roche, Inc. | Bivalent, bispecific antibodies |
US20090162359A1 (en) | 2007-12-21 | 2009-06-25 | Christian Klein | Bivalent, bispecific antibodies |
PL2235064T3 (en) | 2008-01-07 | 2016-06-30 | Amgen Inc | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
AU2015202560B2 (en) * | 2008-01-07 | 2017-06-15 | Amgen Inc. | Method for Making Antibody Fc-Heterodimeric Molecules Using Electrostatic Steering Effects |
JP2011519276A (en) * | 2008-04-25 | 2011-07-07 | メルク パテント ゲゼルシャフト ミット ベシュレンクテル ハフツング | Artificial protein scaffold |
SG190572A1 (en) | 2008-04-29 | 2013-06-28 | Abbott Lab | Dual variable domain immunoglobulins and uses thereof |
AR072001A1 (en) | 2008-06-03 | 2010-07-28 | Abbott Lab | IMMUNOGLOBULIN WITH DUAL VARIABLE DOMAIN AND USES OF THE SAME |
WO2010112193A1 (en) * | 2009-04-02 | 2010-10-07 | Roche Glycart Ag | Multispecific antibodies comprising full length antibodies and single chain fab fragments |
PT2417156E (en) | 2009-04-07 | 2015-04-29 | Roche Glycart Ag | Trivalent, bispecific antibodies |
KR20120030383A (en) | 2009-04-22 | 2012-03-28 | 메르크 파텐트 게엠베하 | Antibody fusion proteins with modified fcrn binding sites |
ES2708124T3 (en) | 2009-04-27 | 2019-04-08 | Oncomed Pharm Inc | Procedure for preparing heteromultimeric molecules |
US9676845B2 (en) | 2009-06-16 | 2017-06-13 | Hoffmann-La Roche, Inc. | Bispecific antigen binding proteins |
EP2451840B1 (en) | 2009-07-08 | 2018-12-26 | Amgen Inc. | Design of stable and aggregation free antibody fc molecules through ch3 domain interface engineering |
US9493578B2 (en) | 2009-09-02 | 2016-11-15 | Xencor, Inc. | Compositions and methods for simultaneous bivalent and monovalent co-engagement of antigens |
SG179196A1 (en) | 2009-09-16 | 2012-04-27 | Genentech Inc | Coiled coil and/or tether containing protein complexes and uses thereof |
ES2895226T3 (en) | 2009-10-16 | 2022-02-18 | Mereo Biopharma 5 Inc | Therapeutic combination and use of DLL4 antagonist antibodies and antihypertensive agents |
TW201138821A (en) | 2010-03-26 | 2011-11-16 | Roche Glycart Ag | Bispecific antibodies |
WO2011131746A2 (en) | 2010-04-20 | 2011-10-27 | Genmab A/S | Heterodimeric antibody fc-containing proteins and methods for production thereof |
UY33492A (en) | 2010-07-09 | 2012-01-31 | Abbott Lab | IMMUNOGLOBULINS WITH DUAL VARIABLE DOMAIN AND USES OF THE SAME |
US8637641B2 (en) | 2010-07-29 | 2014-01-28 | Xencor, Inc. | Antibodies with modified isoelectric points |
AR082461A1 (en) | 2010-08-03 | 2012-12-12 | Abbott Lab | IMMUNOGLOBULINS WITH DUAL VARIABLE DOMAIN AND USES OF THE SAME |
JP5758004B2 (en) | 2010-08-24 | 2015-08-05 | エフ.ホフマン−ラ ロシュ アーゲーF. Hoffmann−La Roche Aktiengesellschaft | Bispecific antibodies comprising Fv fragments stabilized by disulfides |
US8551479B2 (en) | 2010-09-10 | 2013-10-08 | Oncomed Pharmaceuticals, Inc. | Methods for treating melanoma |
EP2635607B1 (en) * | 2010-11-05 | 2019-09-04 | Zymeworks Inc. | Stable heterodimeric antibody design with mutations in the fc domain |
WO2012064792A2 (en) * | 2010-11-09 | 2012-05-18 | Altimab Therapeutics, Inc. | Protein complexes for antigen binding and methods of use |
EP4303236A3 (en) | 2010-11-30 | 2024-03-20 | Chugai Seiyaku Kabushiki Kaisha | Cytotoxicity-inducing therapeutic agent |
WO2012085111A1 (en) | 2010-12-23 | 2012-06-28 | F. Hoffmann-La Roche Ag | Polypeptide-polynucleotide-complex and its use in targeted effector moiety delivery |
CA2824824A1 (en) | 2011-02-28 | 2012-09-07 | F. Hoffmann-La Roche Ag | Monovalent antigen binding proteins |
CN103502271B (en) | 2011-02-28 | 2016-10-26 | 霍夫曼-拉罗奇有限公司 | Antigen-binding proteins |
CA2812739A1 (en) * | 2011-03-25 | 2012-10-04 | Glenmark Pharmaceuticals S.A. | Hetero-dimeric immunoglobulins |
PT2697257T (en) | 2011-04-13 | 2016-12-28 | Bristol Myers Squibb Co | Fc fusion proteins comprising novel linkers or arrangements |
JP2014514314A (en) | 2011-04-20 | 2014-06-19 | ゲンマブ エー/エス | Bispecific antibodies against HER2 and CD3 |
CN107903325B (en) * | 2011-05-16 | 2021-10-29 | 埃泰美德(香港)有限公司 | Multispecific FAB fusion proteins and methods of use thereof |
UA117901C2 (en) | 2011-07-06 | 2018-10-25 | Ґенмаб Б.В. | Antibody variants and uses thereof |
JP6159724B2 (en) | 2011-08-23 | 2017-07-05 | ロシュ グリクアート アーゲー | Bispecific antibodies and tumor antigens specific for T cell activating antigens and methods of use |
GB201116092D0 (en) | 2011-09-16 | 2011-11-02 | Bioceros B V | Antibodies and uses thereof |
PL3485903T3 (en) | 2011-09-23 | 2023-06-12 | Mereo Biopharma 5, Inc. | Vegf/dll4 binding agents and uses thereof |
US10851178B2 (en) | 2011-10-10 | 2020-12-01 | Xencor, Inc. | Heterodimeric human IgG1 polypeptides with isoelectric point modifications |
SI2771364T1 (en) | 2011-10-27 | 2019-10-30 | Genmab As | Production of heterodimeric proteins |
CA2853230C (en) * | 2011-10-31 | 2021-11-23 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule having regulated conjugation between heavy-chain and light-chain |
JP6326371B2 (en) | 2011-11-04 | 2018-05-16 | ザイムワークス,インコーポレイテッド | Stable heterodimeric antibody design with mutations in the Fc domain |
EP2776061B1 (en) | 2011-11-07 | 2019-08-14 | MedImmune, LLC | Multispecific and multivalent binding proteins and uses thereof |
CA2859667C (en) | 2011-12-20 | 2022-05-24 | Medimmune, Llc | Modified polypeptides for bispecific antibody scaffolds |
MX2014009565A (en) | 2012-02-10 | 2014-11-10 | Genentech Inc | Single-chain antibodies and other heteromultimers. |
CN114163530A (en) | 2012-04-20 | 2022-03-11 | 美勒斯公司 | Methods and means for producing immunoglobulin-like molecules |
US9090694B2 (en) | 2012-04-30 | 2015-07-28 | Janssen Biotech, Inc. | ST2L antibody antagonists |
WO2014004586A1 (en) | 2012-06-25 | 2014-01-03 | Zymeworks Inc. | Process and methods for efficient manufacturing of highly pure asymmetric antibodies in mammalian cells |
WO2014001325A1 (en) | 2012-06-27 | 2014-01-03 | F. Hoffmann-La Roche Ag | Method for making antibody fc-region conjugates comprising at least one binding entity that specifically binds to a target and uses thereof |
BR112014032193A2 (en) | 2012-06-27 | 2017-06-27 | Hoffmann La Roche | bispecific antibody production and combination determination methods, bispecific antibody, formulation and use of bispecific antibody |
BR112015000167B1 (en) | 2012-07-06 | 2021-11-23 | Genmab B.V. | DIMERIC PROTEIN, PROTEIN, COMPOSITION, KIT OF PARTS AND THEIR USES, AS WELL AS A METHOD TO INCREASE THE OLIGOMERIZATION IN SOLUTION OF A DIMERIC PROTEIN COMPRISING A FIRST AND SECOND POLYPEPTIDE, EACH COMPRISING AT LEAST ONE CH2 AND CH3 REGIONS HUMAN AND VARIANT DIMER PROTEIN |
EP3632462A1 (en) | 2012-07-06 | 2020-04-08 | Genmab B.V. | Dimeric protein with triple mutations |
IN2015MN00139A (en) | 2012-09-25 | 2015-10-16 | Glenmark Pharmaceuticals Sa | |
EP2904093B1 (en) | 2012-10-03 | 2019-04-10 | Zymeworks Inc. | Methods of quantitating heavy and light chain polypeptide pairs |
ES2773107T3 (en) | 2012-10-05 | 2020-07-09 | Kyowa Kirin Co Ltd | Heterodimeric protein composition |
CA2879768A1 (en) | 2012-10-08 | 2014-04-17 | Roche Glycart Ag | Fc-free antibodies comprising two fab-fragments and methods of use |
WO2014065945A1 (en) | 2012-10-23 | 2014-05-01 | The Board Of Regents Of The University Of Texas System | Antibodies with engineered igg fc domains |
JP6371294B2 (en) | 2012-10-31 | 2018-08-08 | オンコメッド ファーマシューティカルズ インコーポレイテッド | Methods and monitoring of treatment with DLL4 antagonists |
WO2014079000A1 (en) * | 2012-11-21 | 2014-05-30 | Wuhan Yzy Biopharma Co., Ltd. | Bispecific antibody |
US9914785B2 (en) | 2012-11-28 | 2018-03-13 | Zymeworks Inc. | Engineered immunoglobulin heavy chain-light chain pairs and uses thereof |
KR102545617B1 (en) | 2012-11-28 | 2023-06-20 | 자임워크스 비씨 인코포레이티드 | Engineered immunoglobulin heavy chain-light chain pairs and uses thereof |
KR20200134340A (en) | 2013-01-10 | 2020-12-01 | 젠맵 비. 브이 | Human igg1 fc region variants and uses thereof |
US10131710B2 (en) | 2013-01-14 | 2018-11-20 | Xencor, Inc. | Optimized antibody variable regions |
AU2014205086B2 (en) | 2013-01-14 | 2019-04-18 | Xencor, Inc. | Novel heterodimeric proteins |
US9701759B2 (en) | 2013-01-14 | 2017-07-11 | Xencor, Inc. | Heterodimeric proteins |
US10968276B2 (en) | 2013-03-12 | 2021-04-06 | Xencor, Inc. | Optimized anti-CD3 variable regions |
US9605084B2 (en) | 2013-03-15 | 2017-03-28 | Xencor, Inc. | Heterodimeric proteins |
US10487155B2 (en) | 2013-01-14 | 2019-11-26 | Xencor, Inc. | Heterodimeric proteins |
US11053316B2 (en) | 2013-01-14 | 2021-07-06 | Xencor, Inc. | Optimized antibody variable regions |
AU2014207549B2 (en) | 2013-01-15 | 2018-12-06 | Xencor, Inc. | Rapid clearance of antigen complexes using novel antibodies |
EP3617220B1 (en) | 2013-02-12 | 2021-03-24 | Bristol-Myers Squibb Company | High ph protein refolding methods |
EP2956468B1 (en) | 2013-02-12 | 2020-06-10 | Bristol-Myers Squibb Company | Tangential flow filtration based protein refolding methods |
EP2961773B1 (en) | 2013-02-26 | 2019-03-20 | Roche Glycart AG | Bispecific t cell activating antigen binding molecules |
EP3708584A1 (en) | 2013-02-26 | 2020-09-16 | Roche Glycart AG | Bispecific t cell activating antigen binding molecules |
US10519242B2 (en) | 2013-03-15 | 2019-12-31 | Xencor, Inc. | Targeting regulatory T cells with heterodimeric proteins |
US10106624B2 (en) | 2013-03-15 | 2018-10-23 | Xencor, Inc. | Heterodimeric proteins |
US10544187B2 (en) | 2013-03-15 | 2020-01-28 | Xencor, Inc. | Targeting regulatory T cells with heterodimeric proteins |
AU2014235003A1 (en) | 2013-03-15 | 2015-09-17 | Janssen Biotech, Inc. | Interferon alpha and omega antibody antagonists |
US10858417B2 (en) | 2013-03-15 | 2020-12-08 | Xencor, Inc. | Heterodimeric proteins |
SG10201708048XA (en) | 2013-03-18 | 2017-10-30 | Biocerox Prod Bv | Humanized anti-cd134 (ox40) antibodies and uses thereof |
WO2014177460A1 (en) | 2013-04-29 | 2014-11-06 | F. Hoffmann-La Roche Ag | Human fcrn-binding modified antibodies and methods of use |
SG10201810481UA (en) | 2013-04-29 | 2018-12-28 | Hoffmann La Roche | Fcrn-binding abolished anti-igf-1r antibodies and their use in the treatment of vascular eye diseases |
EP3878866A1 (en) | 2013-04-29 | 2021-09-15 | F. Hoffmann-La Roche AG | Fc-receptor binding modified asymmetric antibodies and methods of use |
NZ715896A (en) | 2013-07-05 | 2022-02-25 | Genmab As | Humanized or chimeric cd3 antibodies |
RU2758952C1 (en) | 2013-09-27 | 2021-11-03 | Чугаи Сейяку Кабусики Кайся | Method for producing a polypeptide heteromultimer |
JP6422956B2 (en) | 2013-10-11 | 2018-11-14 | エフ.ホフマン−ラ ロシュ アーゲーF. Hoffmann−La Roche Aktiengesellschaft | Multispecific domain exchange common variable light chain antibody |
EP3466445A1 (en) | 2013-11-06 | 2019-04-10 | Janssen Biotech, Inc. | Anti-ccl17 antibodies |
CA2931356A1 (en) | 2013-11-27 | 2015-06-04 | Zymeworks Inc. | Bispecific antigen-binding constructs targeting her2 |
BR122021025087B1 (en) | 2013-12-17 | 2023-04-04 | Genentech, Inc | ANTI-CD3 ANTIBODY, PROKARYOTIC HOST CELL, BISPECIFIC ANTIBODY PRODUCTION METHOD, IMMUNOCONJUGATE, COMPOSITION, BISPECIFIC ANTIBODY USE AND KIT |
CR20160270A (en) | 2013-12-20 | 2016-09-05 | Hoffmann La Roche | ANTI-TAU ANTIBODIES (pS422) HUMANIZED AND USED METHODS |
US10561737B2 (en) | 2014-01-03 | 2020-02-18 | Hoffmann-La Roche Inc. | Bispecific anti-hapten/anti-blood brain barrier receptor antibodies, complexes thereof and their use as blood brain barrier shuttles |
CN111057147B (en) | 2014-01-06 | 2023-11-10 | 豪夫迈·罗氏有限公司 | Monovalent blood brain barrier shuttle module |
KR20160107190A (en) | 2014-01-15 | 2016-09-13 | 에프. 호프만-라 로슈 아게 | Fc-region variants with modified fcrn- and maintained protein a-binding properties |
JOP20200094A1 (en) | 2014-01-24 | 2017-06-16 | Dana Farber Cancer Inst Inc | Antibody molecules to pd-1 and uses thereof |
JOP20200096A1 (en) | 2014-01-31 | 2017-06-16 | Children’S Medical Center Corp | Antibody molecules to tim-3 and uses thereof |
US9732154B2 (en) | 2014-02-28 | 2017-08-15 | Janssen Biotech, Inc. | Anti-CD38 antibodies for treatment of acute lymphoblastic leukemia |
SG11201607109QA (en) | 2014-02-28 | 2016-09-29 | Merus Nv | Antibodies that bind egfr and erbb3 |
SI3110849T1 (en) | 2014-02-28 | 2021-01-29 | Merus N.V. | Antibody that binds erbb-2 and erbb-3 |
CR20160425A (en) | 2014-03-14 | 2017-05-26 | Novartis Ag | ANTIBODY MOLECULES THAT JOIN LAG-3 AND USES OF THE SAME |
WO2015142675A2 (en) | 2014-03-15 | 2015-09-24 | Novartis Ag | Treatment of cancer using chimeric antigen receptor |
AP2016009475A0 (en) | 2014-03-28 | 2016-09-30 | Xencor Inc | Bispecific antibodies that bind to cd38 and cd3 |
UA117289C2 (en) | 2014-04-02 | 2018-07-10 | Ф. Хоффманн-Ля Рош Аг | Multispecific antibodies |
EP3126389A1 (en) | 2014-04-02 | 2017-02-08 | F. Hoffmann-La Roche AG | Method for detecting multispecific antibody light chain mispairing |
NZ724710A (en) | 2014-04-07 | 2024-02-23 | Chugai Pharmaceutical Co Ltd | Immunoactivating antigen-binding molecule |
TW201623333A (en) | 2014-05-13 | 2016-07-01 | Chugai Pharmaceutical Co Ltd | T cell-redirected antigen-binding molecule for cells having immunosuppression function |
DK3107938T3 (en) | 2014-05-28 | 2022-07-11 | Zymeworks Inc | MODIFIED, ANTIGEN-BINDING POLYPEPTIDE CONSTRUCTS AND USES THEREOF |
TWI713453B (en) | 2014-06-23 | 2020-12-21 | 美商健生生物科技公司 | Interferon alpha and omega antibody antagonists |
AR100978A1 (en) | 2014-06-26 | 2016-11-16 | Hoffmann La Roche | ANTI-Tau HUMANIZED ANTIBODY BRAIN LAUNCHERS (pS422) AND USES OF THE SAME |
EP3164419A1 (en) | 2014-06-26 | 2017-05-10 | F. Hoffmann-La Roche AG | Anti-brdu antibodies and methods of use |
EP3164417A1 (en) | 2014-07-01 | 2017-05-10 | Pfizer Inc. | Bispecific heterodimeric diabodies and uses thereof |
SI3169706T1 (en) | 2014-07-11 | 2020-04-30 | Genmab A/S | Antibodies binding axl |
KR102612313B1 (en) | 2014-07-21 | 2023-12-12 | 노파르티스 아게 | Treatment of cancer using humanized anti-bcma chimeric antigen receptor |
KR102594343B1 (en) | 2014-07-21 | 2023-10-26 | 노파르티스 아게 | Treatment of cancer using a cd33 chimeric antigen receptor |
US11542488B2 (en) | 2014-07-21 | 2023-01-03 | Novartis Ag | Sortase synthesized chimeric antigen receptors |
JP2017528433A (en) | 2014-07-21 | 2017-09-28 | ノバルティス アーゲー | Low immunoenhancing dose of mTOR inhibitor and CAR combination |
EP4205749A1 (en) | 2014-07-31 | 2023-07-05 | Novartis AG | Subset-optimized chimeric antigen receptor-containing cells |
CA2951599A1 (en) | 2014-08-04 | 2016-02-11 | F. Hoffmann-La Roche Ag | Bispecific t cell activating antigen binding molecules |
EP2982692A1 (en) | 2014-08-04 | 2016-02-10 | EngMab AG | Bispecific antibodies against CD3epsilon and BCMA |
EP3180359A1 (en) | 2014-08-14 | 2017-06-21 | Novartis AG | Treatment of cancer using gfr alpha-4 chimeric antigen receptor |
SG11201700770PA (en) | 2014-08-19 | 2017-03-30 | Novartis Ag | Anti-cd123 chimeric antigen receptor (car) for use in cancer treatment |
CR20170086A (en) | 2014-09-09 | 2017-05-22 | Janssen Biotech Inc | COMBINATION THERAPIES WITH ANTI-CD38 ANTIBODIES |
MX2017003022A (en) | 2014-09-12 | 2017-05-12 | Genentech Inc | Anti-cll-1 antibodies and immunoconjugates. |
AU2015317608B2 (en) | 2014-09-17 | 2021-03-11 | Novartis Ag | Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy |
MA40764A (en) | 2014-09-26 | 2017-08-01 | Chugai Pharmaceutical Co Ltd | THERAPEUTIC AGENT INDUCING CYTOTOXICITY |
AU2015329965A1 (en) | 2014-10-09 | 2017-04-27 | Engmab Sàrl | Bispecific antibodies against CD3epsilon and ROR1 |
ES2952717T3 (en) | 2014-10-14 | 2023-11-03 | Novartis Ag | Antibody molecules against PD-L1 and uses thereof |
CN107530419B (en) | 2014-10-31 | 2021-05-18 | 昂考梅德药品有限公司 | Combination therapy for treating disease |
US11773166B2 (en) | 2014-11-04 | 2023-10-03 | Ichnos Sciences SA | CD3/CD38 T cell retargeting hetero-dimeric immunoglobulins and methods of their production |
PT3215528T (en) | 2014-11-06 | 2019-10-11 | Hoffmann La Roche | Fc-region variants with modified fcrn-binding and methods of use |
WO2016071377A1 (en) | 2014-11-06 | 2016-05-12 | F. Hoffmann-La Roche Ag | Fc-region variants with modified fcrn- and protein a-binding properties |
EP3023437A1 (en) | 2014-11-20 | 2016-05-25 | EngMab AG | Bispecific antibodies against CD3epsilon and BCMA |
DK3221355T3 (en) | 2014-11-20 | 2020-12-07 | Hoffmann La Roche | Combination therapy with T cell activating bispecific antigen binding molecules CD3 and folate receptor 1 (FolR1) as well as PD-1 axis binding antagonists |
MX2017006918A (en) | 2014-11-26 | 2018-01-25 | Xencor Inc | Heterodimeric antibodies that bind cd3 and cd38. |
PE20171324A1 (en) | 2014-11-26 | 2017-09-11 | Xencor Inc | HETERODIMERIC ANTIBODIES THAT BIND CD3 AND TUMOR ANTIGENS |
US10259887B2 (en) | 2014-11-26 | 2019-04-16 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and tumor antigens |
JP6721590B2 (en) | 2014-12-03 | 2020-07-15 | エフ.ホフマン−ラ ロシュ アーゲーF. Hoffmann−La Roche Aktiengesellschaft | Multispecific antibody |
WO2016090034A2 (en) | 2014-12-03 | 2016-06-09 | Novartis Ag | Methods for b cell preconditioning in car therapy |
US10982008B2 (en) | 2014-12-05 | 2021-04-20 | Merck Patent Gmbh | Domain-exchanged antibody |
DK3233907T3 (en) | 2014-12-19 | 2021-06-07 | Genmab As | Bispecific heterodimeric proteins in rodents |
WO2016105450A2 (en) | 2014-12-22 | 2016-06-30 | Xencor, Inc. | Trispecific antibodies |
WO2016130516A1 (en) | 2015-02-09 | 2016-08-18 | Research Development Foundation | Engineered immunoglobulin fc polypeptides displaying improved complement activation |
WO2016141387A1 (en) | 2015-03-05 | 2016-09-09 | Xencor, Inc. | Modulation of t cells with bispecific antibodies and fc fusions |
JP7082484B2 (en) | 2015-04-01 | 2022-06-08 | 中外製薬株式会社 | Method for Producing Polypeptide Heterogeneous Multimer |
KR20170134642A (en) | 2015-04-08 | 2017-12-06 | 노파르티스 아게 | CD20 therapy, CD22 therapy, and combination therapy with CD19 chimeric antigen receptor (CAR) -expressing cells |
EP3286211A1 (en) | 2015-04-23 | 2018-02-28 | Novartis AG | Treatment of cancer using chimeric antigen receptor and protein kinase a blocker |
CN108136218B (en) | 2015-05-20 | 2022-12-13 | 詹森生物科技公司 | anti-CD 38 antibodies for the treatment of light chain amyloidosis and other CD 38-positive hematologic malignancies |
CN104833797B (en) * | 2015-06-04 | 2017-02-01 | 武汉友芝友生物制药有限公司 | ELISA method of detecting bispecific antibody MSBODY and application of the method |
TWI773646B (en) | 2015-06-08 | 2022-08-11 | 美商宏觀基因股份有限公司 | Lag-3-binding molecules and methods of use thereof |
EP3310378B1 (en) | 2015-06-16 | 2024-01-24 | F. Hoffmann-La Roche AG | Anti-cll-1 antibodies and methods of use |
AU2016280102B2 (en) | 2015-06-16 | 2022-06-16 | Genentech, Inc. | Humanized and affinity matured antibodies to FcRH5 and methods of use |
JP6816038B2 (en) | 2015-06-22 | 2021-01-20 | ヤンセン バイオテツク,インコーポレーテツド | Combination therapy for hematological malignancies with anti-CD38 antibody and survivin inhibitor |
CN113929779A (en) | 2015-06-24 | 2022-01-14 | 豪夫迈·罗氏有限公司 | Humanized anti-Tau (pS422) antibodies and methods of use |
BR112017027990A2 (en) | 2015-06-24 | 2018-08-28 | Janssen Biotech, Inc. | immune modulation and treatment of solid tumors with antibodies that specifically bind to cd38 |
WO2017005649A1 (en) | 2015-07-09 | 2017-01-12 | Genmab A/S | Bispecific and multispecific antibodies and method for isolation of such |
LT3319993T (en) | 2015-07-10 | 2020-05-11 | Genmab A/S | Axl-specific antibody-drug conjugates for cancer treatment |
CA2991880A1 (en) | 2015-07-10 | 2017-01-19 | Merus N.V. | Human cd3 binding antibody |
EP3322727A1 (en) | 2015-07-15 | 2018-05-23 | Genmab A/S | Humanized or chimeric cd3 antibodies |
WO2017019897A1 (en) | 2015-07-29 | 2017-02-02 | Novartis Ag | Combination therapies comprising antibody molecules to tim-3 |
LT3317301T (en) | 2015-07-29 | 2021-07-26 | Novartis Ag | Combination therapies comprising antibody molecules to lag-3 |
CN114272371A (en) | 2015-07-29 | 2022-04-05 | 诺华股份有限公司 | Combination therapy comprising anti-PD-1 antibody molecules |
HUE056201T2 (en) | 2015-07-30 | 2022-02-28 | Macrogenics Inc | Pd-1-binding molecules and methods of use thereof |
CA2994825A1 (en) | 2015-08-05 | 2017-02-09 | Janssen Biotech, Inc. | Anti-cd154 antibodies and methods of using them |
ES2968074T3 (en) | 2015-09-23 | 2024-05-07 | Mereo Biopharma 5 Inc | Bi-specific anti-VEGF/DLL4 antibody for use in the treatment of platinum-resistant ovarian cancer |
WO2017059196A2 (en) | 2015-09-30 | 2017-04-06 | Janssen Biotech, Inc. | Antagonistic antibodies specifically binding human cd40 and methods of use |
AR106188A1 (en) | 2015-10-01 | 2017-12-20 | Hoffmann La Roche | ANTI-CD19 HUMANIZED HUMAN ANTIBODIES AND METHODS OF USE |
WO2017055392A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Anti-cd3xcd44v6 bispecific t cell activating antigen binding molecules |
US20180282410A1 (en) | 2015-10-02 | 2018-10-04 | Hoffmann-La Roche Inc. | Anti-cd3xrob04 bispecific t cell activating antigen binding molecules |
RU2729371C1 (en) | 2015-10-02 | 2020-08-06 | Ф. Хоффманн-Ля Рош Аг | Bispecific antibodies specific to pd1 and tim3 |
WO2017055393A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Anti-cd3xtim-3 bispecific t cell activating antigen binding molecules |
CN108026177B (en) | 2015-10-02 | 2021-11-26 | 豪夫迈·罗氏有限公司 | Bispecific anti-CD 19XCD 3T cell activating antigen binding molecules |
CR20180162A (en) | 2015-10-02 | 2018-05-25 | Hoffmann La Roche | BISPECIFIC MOLECULES OF ANTIGEN BINDING TO T-CELL ACTIVATORS |
EP3356417A1 (en) | 2015-10-02 | 2018-08-08 | H. Hoffnabb-La Roche Ag | Bispecific t cell activating antigen binding molecules binding mesothelin and cd3 |
WO2017055399A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Cellular based fret assay for the determination of simultaneous binding |
EP3150637A1 (en) | 2015-10-02 | 2017-04-05 | F. Hoffmann-La Roche AG | Multispecific antibodies |
US20170096495A1 (en) | 2015-10-02 | 2017-04-06 | Hoffmann-La Roche Inc. | Bispecific t cell activating antigen binding molecules |
WO2017055385A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Anti-cd3xgd2 bispecific t cell activating antigen binding molecules |
KR20180069839A (en) | 2015-10-08 | 2018-06-25 | 자임워크스 인코포레이티드 | Antigen-binding polypeptide constructs including kappa and lambda light chains and uses thereof |
MX2018004177A (en) | 2015-10-08 | 2018-09-11 | Macrogenics Inc | Combination therapy for the treatment of cancer. |
CN115925944A (en) | 2015-10-23 | 2023-04-07 | 美勒斯公司 | Binding molecules for inhibiting cancer growth |
MX2018005036A (en) | 2015-10-29 | 2018-08-01 | Hoffmann La Roche | Anti-variant fc-region antibodies and methods of use. |
BR112018008891A8 (en) | 2015-11-03 | 2019-02-26 | Janssen Biotech Inc | antibodies that specifically bind to pd-1 and tim-3 and their uses |
MA53356B1 (en) | 2015-11-03 | 2022-05-31 | Janssen Biotech Inc | Subcutaneous anti-cd38 antibody formulations and uses thereof |
JP2019500011A (en) * | 2015-11-03 | 2019-01-10 | メルク パテント ゲゼルシャフト ミット ベシュレンクテル ハフツングMerck Patent Gesellschaft mit beschraenkter Haftung | Bispecific antibodies with enhanced tumor selectivity and inhibition and uses thereof |
JP6931329B2 (en) | 2015-11-18 | 2021-09-01 | 中外製薬株式会社 | Combination therapy using T cell redirection antigen-binding molecule for cells with immunosuppressive function |
US11649293B2 (en) | 2015-11-18 | 2023-05-16 | Chugai Seiyaku Kabushiki Kaisha | Method for enhancing humoral immune response |
EP3387013B1 (en) | 2015-12-07 | 2022-06-08 | Xencor, Inc. | Heterodimeric antibodies that bind cd3 and psma |
CN115920030A (en) | 2015-12-09 | 2023-04-07 | 豪夫迈·罗氏有限公司 | Use of type II anti-CD 20 antibodies for reducing anti-drug antibody formation |
EP3178848A1 (en) | 2015-12-09 | 2017-06-14 | F. Hoffmann-La Roche AG | Type ii anti-cd20 antibody for reducing formation of anti-drug antibodies |
TWI758267B (en) | 2015-12-14 | 2022-03-21 | 美商宏觀基因股份有限公司 | Bispecific molecules having immunoreactivity with pd-1 and ctla-4, and methods of use thereof |
BR112018012344A2 (en) | 2015-12-17 | 2018-12-04 | Janssen Biotech Inc | antibodies that specifically bind to hla-dr and their uses |
EP3389712B1 (en) | 2015-12-17 | 2024-04-10 | Novartis AG | Antibody molecules to pd-1 and uses thereof |
US20200261573A1 (en) | 2015-12-17 | 2020-08-20 | Novartis Ag | Combination of c-met inhibitor with antibody molecule to pd-1 and uses thereof |
KR20180091918A (en) | 2015-12-28 | 2018-08-16 | 추가이 세이야쿠 가부시키가이샤 | A method for efficiently purifying the Fc region-containing polypeptide |
CA3006529A1 (en) | 2016-01-08 | 2017-07-13 | F. Hoffmann-La Roche Ag | Methods of treating cea-positive cancers using pd-1 axis binding antagonists and anti-cea/anti-cd3 bispecific antibodies |
WO2017125897A1 (en) | 2016-01-21 | 2017-07-27 | Novartis Ag | Multispecific molecules targeting cll-1 |
US20170233472A1 (en) | 2016-02-17 | 2017-08-17 | Macrogenics, Inc. | ROR1-Binding Molecules, and Methods of Use Thereof |
EP3423482A1 (en) | 2016-03-04 | 2019-01-09 | Novartis AG | Cells expressing multiple chimeric antigen receptor (car) molecules and uses therefore |
MX2018010988A (en) | 2016-03-14 | 2019-01-21 | Chugai Pharmaceutical Co Ltd | Cell injury inducing therapeutic drug for use in cancer therapy. |
US10870701B2 (en) | 2016-03-15 | 2020-12-22 | Generon (Shanghai) Corporation Ltd. | Multispecific fab fusion proteins and use thereof |
CA3016563A1 (en) | 2016-03-21 | 2017-09-28 | Elstar Therapeutics, Inc. | Multispecific and multifunctional molecules and uses thereof |
DK3433280T3 (en) | 2016-03-22 | 2023-06-19 | Hoffmann La Roche | Protease-activated T-cell bispecific molecules |
WO2017165683A1 (en) | 2016-03-23 | 2017-09-28 | Novartis Ag | Cell secreted minibodies and uses thereof |
KR20220133318A (en) | 2016-04-15 | 2022-10-04 | 노파르티스 아게 | Compositions and methods for selective protein expression |
KR102514317B1 (en) | 2016-04-15 | 2023-03-27 | 마크로제닉스, 인크. | Novel B7-H3-binding molecules, antibody drug conjugates thereof and methods of use thereof |
TW201803981A (en) | 2016-04-20 | 2018-02-01 | 再生元醫藥公司 | Compositions and methods for making antibodies based on use of an expression-enhancing locus |
MX2018012868A (en) | 2016-04-20 | 2019-03-11 | Regeneron Pharma | Compositions and methods for making antibodies based on use of expression-enhancing loci. |
BR112018069890A2 (en) | 2016-05-02 | 2019-02-05 | Hoffmann La Roche | target-specific fusion polypeptide, dimeric fusion polypeptide, isolated nucleic acid, isolated nucleic acid pair, host cell, method for producing a fusion polypeptide, immunoconjugate, pharmaceutical formulation, fusion polypeptide and use of the fusion polypeptide |
EP3252078A1 (en) | 2016-06-02 | 2017-12-06 | F. Hoffmann-La Roche AG | Type ii anti-cd20 antibody and anti-cd20/cd3 bispecific antibody for treatment of cancer |
US20210177896A1 (en) | 2016-06-02 | 2021-06-17 | Novartis Ag | Therapeutic regimens for chimeric antigen receptor (car)- expressing cells |
RU2767357C2 (en) | 2016-06-14 | 2022-03-17 | Ксенкор, Инк. | Bispecific checkpoint inhibitors antibodies |
JP2019527678A (en) | 2016-06-28 | 2019-10-03 | ユーエムセー・ユトレヒト・ホールディング・ベー・フェー | Treatment of IgE-mediated diseases with antibodies that specifically bind to CD38 |
CA3029328A1 (en) | 2016-06-28 | 2018-01-04 | Xencor, Inc. | Heterodimeric antibodies that bind somatostatin receptor 2 |
CN109415435B (en) | 2016-07-04 | 2024-01-16 | 豪夫迈·罗氏有限公司 | Novel antibody forms |
KR20240017129A (en) | 2016-07-14 | 2024-02-06 | 젠맵 에이/에스 | Multispecific antibodies against cd40 and cd137 |
CA3030837A1 (en) | 2016-07-15 | 2018-01-18 | Novartis Ag | Treatment and prevention of cytokine release syndrome using a chimeric antigen receptor in combination with a kinase inhibitor |
EP3491016A1 (en) | 2016-07-28 | 2019-06-05 | Novartis AG | Combination therapies of chimeric antigen receptors and pd-1 inhibitors |
RU2019105693A (en) | 2016-08-01 | 2020-09-01 | Новартис Аг | TREATMENT OF CANCER USING ANTIGENIC CHIMERIC RECEPTOR IN COMBINATION WITH A MOLECULE INHIBITOR PROMOTING THE M2 PHENOTYPE OF MACROPHAG |
KR102050463B1 (en) | 2016-08-10 | 2019-11-29 | 아주대학교산학협력단 | Heterodimeric Fc-fused cytokine and pharmaceutical composition comprising the same |
KR102587941B1 (en) | 2016-08-12 | 2023-10-11 | 얀센 바이오테크 인코포레이티드 | Engineered antibodies and other Fc-domain containing molecules with improved agonism and effector functions |
EP3497126A4 (en) | 2016-08-12 | 2020-04-08 | Janssen Biotech, Inc. | Fc engineered anti-tnfr superfamily member antibodies having enhanced agonistic activity and methods of using them |
US10793632B2 (en) | 2016-08-30 | 2020-10-06 | Xencor, Inc. | Bispecific immunomodulatory antibodies that bind costimulatory and checkpoint receptors |
SI3512882T1 (en) * | 2016-09-14 | 2021-08-31 | Merck Patent Gmbh | Anti-c-met antibodies and antibody drug conjugates thereof for efficient tumor inhibition |
CA3037230A1 (en) | 2016-09-20 | 2018-03-29 | Merck Patent Gmbh | Diagnostic anti-pd-l1 antibody and use thereof |
PL3519437T3 (en) | 2016-09-30 | 2022-01-17 | F. Hoffmann-La Roche Ag | Bispecific antibodies against p95her2 |
JP6785372B2 (en) | 2016-09-30 | 2020-11-18 | エフ.ホフマン−ラ ロシュ アーゲーF. Hoffmann−La Roche Aktiengesellschaft | SPR-based double bond assay for functional analysis of multispecific molecules |
US10525083B2 (en) | 2016-10-07 | 2020-01-07 | Novartis Ag | Nucleic acid molecules encoding chimeric antigen receptors comprising a CD20 binding domain |
WO2018083126A1 (en) | 2016-11-01 | 2018-05-11 | Genmab B.V. | Polypeptide variants and uses thereof |
AU2017361081A1 (en) | 2016-11-15 | 2019-05-23 | Genentech, Inc. | Dosing for treatment with anti-CD20/anti-CD3 bispecific antibodies |
TW201829463A (en) | 2016-11-18 | 2018-08-16 | 瑞士商赫孚孟拉羅股份公司 | Anti-hla-g antibodies and use thereof |
WO2018095932A1 (en) | 2016-11-22 | 2018-05-31 | Merck Patent Gmbh | Monoclonal antibody directed to fgfr1 |
AR110424A1 (en) | 2016-12-23 | 2019-03-27 | Macrogenics Inc | ADAM9 BINDING MOLECULES AND SAME USE METHODS |
EP3574005B1 (en) | 2017-01-26 | 2021-12-15 | Novartis AG | Cd28 compositions and methods for chimeric antigen receptor therapy |
CN110382537B (en) | 2017-02-02 | 2023-07-25 | 默克专利有限公司 | Preferential pairing of antibody domains |
BR112019015900A2 (en) | 2017-02-10 | 2020-04-07 | Genmab B.V. | polypeptide, methods to increase the agonistic activity of a polypeptide, to increase the cdc activity of a polypeptide and to treat an individual having a disease, composition, kit of parts, and, use of a polypeptide or composition |
US20200291089A1 (en) | 2017-02-16 | 2020-09-17 | Elstar Therapeutics, Inc. | Multifunctional molecules comprising a trimeric ligand and uses thereof |
JPWO2018155611A1 (en) * | 2017-02-24 | 2019-12-12 | 中外製薬株式会社 | Pharmaceutical composition, antigen binding molecule, therapeutic method, and screening method |
JP7116736B2 (en) | 2017-03-02 | 2022-08-10 | ノバルティス アーゲー | engineered heterodimeric proteins |
AU2018231618A1 (en) | 2017-03-09 | 2019-10-03 | Genmab A/S | Antibodies against PD-L1 |
RU2750721C2 (en) | 2017-03-10 | 2021-07-01 | Ф. Хоффманн-Ля Рош Аг | Method for the production of multi-specific antibodies |
AU2018234810B2 (en) | 2017-03-15 | 2023-05-11 | Pandion Operations, Inc. | Targeted immunotolerance |
WO2018182422A1 (en) | 2017-03-31 | 2018-10-04 | Merus N.V. | Erbb-2 and erbb3 binding bispecific antibodies for use in the treatment f cells that have an nrg1 fusion gene |
US20200270359A1 (en) | 2017-03-31 | 2020-08-27 | Genmab Holding B.V. | Bispecific anti-cd37 antibodies, monoclonal anti-cd37 antibodies and methods of use thereof |
AU2018249493A1 (en) | 2017-04-03 | 2019-09-19 | Oncxerna Therapeutics, Inc. | Methods for treating cancer using PS-targeting antibodies with immuno-oncology agents |
WO2018184965A1 (en) | 2017-04-03 | 2018-10-11 | F. Hoffmann-La Roche Ag | Immunoconjugates of il-2 with an anti-pd-1 and tim-3 bispecific antibody |
ES2928718T3 (en) | 2017-04-03 | 2022-11-22 | Hoffmann La Roche | Immunoconjugates of an anti-PD-1 antibody with a mutant IL-2 or with IL-15 |
BR112019018767A2 (en) | 2017-04-03 | 2020-05-05 | Hoffmann La Roche | antibodies, bispecific antigen binding molecule, one or more isolated polynucleotides, one or more vectors, host cell, method for producing an antibody, pharmaceutical composition, uses, method for treating a disease in an individual and invention |
KR102346336B1 (en) | 2017-04-05 | 2022-01-04 | 에프. 호프만-라 로슈 아게 | Bispecific antibodies that specifically bind to PD1 and LAG3 |
CA3058279A1 (en) | 2017-04-13 | 2018-10-18 | F.Hoffmann-La Roche Ag | An interleukin-2 immunoconjugate, a cd40 agonist, and optionally a pd-1 axis binding antagonist for use in methods of treating cancer |
EP3615068A1 (en) | 2017-04-28 | 2020-03-04 | Novartis AG | Bcma-targeting agent, and combination therapy with a gamma secretase inhibitor |
EP3615055A1 (en) | 2017-04-28 | 2020-03-04 | Novartis AG | Cells expressing a bcma-targeting chimeric antigen receptor, and combination therapy with a gamma secretase inhibitor |
SG11201909949XA (en) | 2017-05-24 | 2019-11-28 | Pandion Therapeutics Inc | Targeted immunotolerance |
WO2018222901A1 (en) | 2017-05-31 | 2018-12-06 | Elstar Therapeutics, Inc. | Multispecific molecules that bind to myeloproliferative leukemia (mpl) protein and uses thereof |
KR20200014304A (en) | 2017-06-02 | 2020-02-10 | 에프. 호프만-라 로슈 아게 | Type II anti-CD20 antibodies and anti-CD20 / anti-CD3 bispecific antibodies for the treatment of cancer |
MA49259A (en) | 2017-06-07 | 2020-04-15 | Genmab Bv | THERAPEUTIC ANTIBODIES BASED ON MUTATED IGG HEXAMERS |
CN110785187B (en) | 2017-06-22 | 2024-04-05 | 诺华股份有限公司 | Antibody molecules against CD73 and uses thereof |
GB201709970D0 (en) | 2017-06-22 | 2017-08-09 | Kymab Ltd | Bispecific antigen-binding molecules |
US20200223924A1 (en) | 2017-06-27 | 2020-07-16 | Novartis Ag | Dosage regimens for anti-tim-3 antibodies and uses thereof |
AR112603A1 (en) | 2017-07-10 | 2019-11-20 | Lilly Co Eli | BIS SPECIFIC ANTIBODIES CONTROL POINT INHIBITORS |
SG10201913144TA (en) | 2017-07-11 | 2020-03-30 | Compass Therapeutics Llc | Agonist antibodies that bind human cd137 and uses thereof |
JP2020527572A (en) | 2017-07-20 | 2020-09-10 | ノバルティス アーゲー | Anti-LAG-3 antibody dosage regimen and its use |
AU2018309339A1 (en) | 2017-08-04 | 2020-02-20 | BioNTech SE | Binding agents binding to PD-L1 and CD137 and use thereof |
EP3665198A1 (en) | 2017-08-09 | 2020-06-17 | Merus N.V. | Antibodies that bind egfr and cmet |
WO2019035938A1 (en) | 2017-08-16 | 2019-02-21 | Elstar Therapeutics, Inc. | Multispecific molecules that bind to bcma and uses thereof |
MX2020002070A (en) | 2017-08-22 | 2020-03-24 | Sanabio Llc | Soluble interferon receptors and uses thereof. |
CN111032674B (en) | 2017-08-30 | 2024-02-27 | 阿雷斯贸易股份有限公司 | Protein purification method |
MX2020003211A (en) | 2017-09-21 | 2020-09-21 | Merck Patent Gmbh | Fusion protein comprising an fgf-18 moiety. |
CN111278862A (en) | 2017-09-21 | 2020-06-12 | Umc乌德勒支控股有限公司 | anti-GD 2 antibodies for treatment of neuroblastoma |
MX2020003497A (en) | 2017-10-20 | 2020-07-22 | Hoffmann La Roche | Method for generating multispecific antibodies from monospecific antibodies. |
WO2019086362A1 (en) | 2017-10-30 | 2019-05-09 | F. Hoffmann-La Roche Ag | Method for in vivo generation of multispecific antibodies from monospecific antibodies |
WO2019089753A2 (en) | 2017-10-31 | 2019-05-09 | Compass Therapeutics Llc | Cd137 antibodies and pd-1 antagonists and uses thereof |
CN111295392A (en) | 2017-11-01 | 2020-06-16 | 豪夫迈·罗氏有限公司 | Compbody-multivalent target binders |
JP2021500902A (en) | 2017-11-01 | 2021-01-14 | エフ・ホフマン−ラ・ロシュ・アクチェンゲゼルシャフト | New TNF family ligand trimer-containing antigen-binding molecule |
WO2019086500A2 (en) | 2017-11-01 | 2019-05-09 | F. Hoffmann-La Roche Ag | Bispecific 2+1 contorsbodies |
KR102559706B1 (en) | 2017-11-01 | 2023-07-25 | 에프. 호프만-라 로슈 아게 | TRIFAB-Contols Body |
US10981992B2 (en) | 2017-11-08 | 2021-04-20 | Xencor, Inc. | Bispecific immunomodulatory antibodies that bind costimulatory and checkpoint receptors |
CN112272563A (en) | 2017-11-08 | 2021-01-26 | Xencor股份有限公司 | Bispecific and monospecific antibodies using novel anti-PD-1 sequences |
BR112020008888A2 (en) | 2017-11-16 | 2020-10-20 | Novartis Ag | combination therapies |
EP3713961A2 (en) | 2017-11-20 | 2020-09-30 | Compass Therapeutics LLC | Cd137 antibodies and tumor antigen-targeting antibodies and uses thereof |
US10946068B2 (en) | 2017-12-06 | 2021-03-16 | Pandion Operations, Inc. | IL-2 muteins and uses thereof |
US10174092B1 (en) | 2017-12-06 | 2019-01-08 | Pandion Therapeutics, Inc. | IL-2 muteins |
MX2020006155A (en) | 2017-12-12 | 2020-08-13 | Macrogenics Inc | Bispecific cd 16-binding molecules and their use in the treatment of disease. |
KR20200100098A (en) | 2017-12-19 | 2020-08-25 | 젠코어 인코포레이티드 | Engineered IL-2 FC fusion protein |
SG11202005632SA (en) | 2017-12-21 | 2020-07-29 | Hoffmann La Roche | Antibodies binding to hla-a2/wt1 |
JP7074859B2 (en) | 2017-12-22 | 2022-05-24 | エフ.ホフマン-ラ ロシュ アーゲー | Method of depletion of light chain mismatched antibody variants by hydrophobic interaction chromatography |
MX2020007444A (en) | 2018-01-12 | 2020-09-14 | Genzyme Corp | Methods for the quantitation of polypeptides. |
EP3743440A1 (en) | 2018-01-24 | 2020-12-02 | Genmab B.V. | Polypeptide variants and uses thereof |
EP3746116A1 (en) | 2018-01-31 | 2020-12-09 | Novartis AG | Combination therapy using a chimeric antigen receptor |
CN111699004A (en) | 2018-02-06 | 2020-09-22 | 豪夫迈·罗氏有限公司 | Treatment of ophthalmic disorders |
BR112020016169A2 (en) | 2018-02-08 | 2020-12-15 | Genentech, Inc. | MOLECULES FOR BINDING THE BIESPECIFIC ANTIGEN, INSULATED NUCLEIC ACID, VECTOR, HOSTING CELL, METHODS FOR PRODUCING THE BINDING MOLECULE, SET OF NUCLEIC ACIDS, ISOLATED, VEGETABLE CONTAINER, VEGETABLE CONTAINERS, TO TREAT OR DELAY CANCER PROGRESSION, METHODS TO IMPROVE THE IMMUNE FUNCTION AND KIT |
TWI829667B (en) | 2018-02-09 | 2024-01-21 | 瑞士商赫孚孟拉羅股份公司 | Antibodies binding to gprc5d |
EP3753956A4 (en) | 2018-02-14 | 2021-12-22 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule and combination |
SG11202007572VA (en) | 2018-02-15 | 2020-09-29 | Macrogenics Inc | Variant cd3-binding domains and their use in combination therapies for the treatment of disease |
BR112020018490A2 (en) | 2018-03-12 | 2020-12-29 | Genmab A/S | ANTIBODY, IMMUNOCONJUGATE OR ANTIBODY-DRUG CONJUGATE, NUCLEIC ACID CONSTRUCTION, EXPRESSION VECTOR, CELL, COMPOSITION, PHARMACEUTICAL COMPOSITION, ANTIBODY, METHOD, METHOD FOR PRODUCING AN ANTIBODY, KIT OF PARTS, AND, ANTI-IDIOTYPIC ANTIBODY |
EP3765516A2 (en) | 2018-03-14 | 2021-01-20 | Elstar Therapeutics, Inc. | Multifunctional molecules and uses thereof |
EP3765517A1 (en) | 2018-03-14 | 2021-01-20 | Elstar Therapeutics, Inc. | Multifunctional molecules that bind to calreticulin and uses thereof |
WO2019195623A2 (en) | 2018-04-04 | 2019-10-10 | Xencor, Inc. | Heterodimeric antibodies that bind fibroblast activation protein |
US20210147547A1 (en) | 2018-04-13 | 2021-05-20 | Novartis Ag | Dosage Regimens For Anti-Pd-L1 Antibodies And Uses Thereof |
AR115052A1 (en) | 2018-04-18 | 2020-11-25 | Hoffmann La Roche | MULTI-SPECIFIC ANTIBODIES AND THE USE OF THEM |
WO2019210153A1 (en) | 2018-04-27 | 2019-10-31 | Novartis Ag | Car t cell therapies with enhanced efficacy |
MX2020011552A (en) | 2018-05-03 | 2020-11-24 | Genmab Bv | Antibody variant combinations and uses thereof. |
EP3793599A1 (en) | 2018-05-16 | 2021-03-24 | Janssen Biotech, Inc. | Bcma/cd3 and gprdc5d/cd3 bispecific antibodies for use in cancer therapy |
RS64379B1 (en) | 2018-05-18 | 2023-08-31 | Glycotope Gmbh | Anti-muc1 antibody |
CA3099308A1 (en) | 2018-05-21 | 2019-11-28 | Compass Therapeutics Llc | Compositions and methods for enhancing the killing of target cells by nk cells |
WO2019226658A1 (en) | 2018-05-21 | 2019-11-28 | Compass Therapeutics Llc | Multispecific antigen-binding compositions and methods of use |
MA52777A (en) | 2018-05-24 | 2021-04-14 | Janssen Biotech Inc | PSMA LIAISON OFFICERS AND CORRESPONDING USES |
MA52772A (en) | 2018-05-24 | 2021-04-14 | Janssen Biotech Inc | MONOSPECIFIC AND MULTISPECIFIC ANTI-TMEFF2 ANTIBODIES AND THEIR USES |
EA202092847A1 (en) | 2018-05-24 | 2021-04-20 | Янссен Байотек, Инк. | ANTIBODIES TO CD3 AND THEIR APPLICATION |
WO2019227003A1 (en) | 2018-05-25 | 2019-11-28 | Novartis Ag | Combination therapy with chimeric antigen receptor (car) therapies |
US20210214459A1 (en) | 2018-05-31 | 2021-07-15 | Novartis Ag | Antibody molecules to cd73 and uses thereof |
BR112020025048A2 (en) | 2018-06-13 | 2021-04-06 | Novartis Ag | BCMA CHEMICAL ANTIGEN RECEPTORS AND USES OF THE SAME |
KR20210035173A (en) | 2018-06-19 | 2021-03-31 | 아타르가, 엘엘씨 | Antibody molecule against complement component 5 and use thereof |
EP3810194A1 (en) | 2018-06-22 | 2021-04-28 | Genmab Holding B.V. | Anti-cd37 antibodies and anti-cd20 antibodies, compositions and methods of use thereof |
DE202019005887U1 (en) | 2018-07-03 | 2023-06-14 | Marengo Therapeutics, Inc. | Anti-TCR antibody molecules and uses thereof |
AR116109A1 (en) | 2018-07-10 | 2021-03-31 | Novartis Ag | DERIVATIVES OF 3- (5-AMINO-1-OXOISOINDOLIN-2-IL) PIPERIDINE-2,6-DIONA AND USES OF THE SAME |
KR20210031932A (en) | 2018-07-13 | 2021-03-23 | 젠맵 에이/에스 | Variants of CD38 antibody and uses thereof |
EP3820890A1 (en) | 2018-07-13 | 2021-05-19 | Genmab A/S | Trogocytosis-mediated therapy using cd38 antibodies |
WO2020021465A1 (en) | 2018-07-25 | 2020-01-30 | Advanced Accelerator Applications (Italy) S.R.L. | Method of treatment of neuroendocrine tumors |
AU2019332100A1 (en) | 2018-08-29 | 2021-03-18 | Merck Biodevelopment S.A.S. | New purification method |
US20210188957A1 (en) | 2018-08-29 | 2021-06-24 | Chugai Seiyaku Kabushiki Kaisha | Antibody half-molecule, and method for inhibiting homodimer formation of antibody half-molecule |
GB2576914A (en) | 2018-09-06 | 2020-03-11 | Kymab Ltd | Antigen-binding molecules comprising unpaired variable domains produced in mammals |
US11667721B2 (en) | 2018-09-24 | 2023-06-06 | Medical College Of Wisconsin, Inc. | CD30 bispecific antibodies and method of immunotherapy of CD30+ malignancies |
WO2020072821A2 (en) | 2018-10-03 | 2020-04-09 | Xencor, Inc. | Il-12 heterodimeric fc-fusion proteins |
SG11202103100SA (en) | 2018-10-04 | 2021-04-29 | Genmab Holding B V | Pharmaceutical compositions comprising bispecific anti-cd37 antibodies |
AU2019366956A1 (en) | 2018-10-23 | 2021-05-20 | Dragonfly Therapeutics, Inc. | Heterodimeric Fc-fused proteins |
MX2021004774A (en) | 2018-10-29 | 2021-08-24 | Hoffmann La Roche | Antibody formulation. |
US11820800B2 (en) | 2018-11-02 | 2023-11-21 | University Of Washington | Orthogonal protein heterodimers |
BR112021008774A2 (en) | 2018-11-06 | 2021-11-30 | BioNTech SE | Pharmaceutical formulation, binding agent, methods for treating a disease, for producing a pharmaceutical formulation, for inducing cell death or inhibiting the growth and/or proliferation of a tumor cell, and, use of a pharmaceutical formulation |
MX2021005594A (en) | 2018-11-13 | 2021-10-22 | Compass Therapeutics Llc | Multispecific binding constructs against checkpoint molecules and uses thereof. |
CA3121699A1 (en) | 2018-12-05 | 2020-06-11 | Morphosys Ag | Multispecific antigen-binding molecules |
GB201820687D0 (en) | 2018-12-19 | 2019-01-30 | Kymab Ltd | Antagonists |
WO2020128972A1 (en) | 2018-12-20 | 2020-06-25 | Novartis Ag | Dosing regimen and pharmaceutical combination comprising 3-(1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives |
AU2019400980A1 (en) | 2018-12-20 | 2021-06-24 | Novartis Ag | Pharmaceutical combinations |
AU2019410075B2 (en) | 2018-12-21 | 2022-08-25 | F. Hoffmann-La Roche Ag | Antibodies binding to CD3 |
DK3723858T3 (en) | 2018-12-21 | 2022-01-24 | Kymab Ltd | FIXAXFX BISPECIFIC ANTIBODY WITH COMMON LIGHT CHAIN |
US11965030B2 (en) | 2018-12-24 | 2024-04-23 | Sanofi | Multispecific binding proteins with mutant fab domains |
EP3902560A1 (en) | 2018-12-28 | 2021-11-03 | F. Hoffmann-La Roche AG | A peptide-mhc-i-antibody fusion protein for therapeutic use in a patient with amplified immune response |
TW202043256A (en) | 2019-01-10 | 2020-12-01 | 美商健生生物科技公司 | Prostate neoantigens and their uses |
CN113597433A (en) | 2019-01-18 | 2021-11-02 | 詹森生物科技公司 | GPRC5D chimeric antigen receptors and cells expressing these receptors |
US10871640B2 (en) | 2019-02-15 | 2020-12-22 | Perkinelmer Cellular Technologies Germany Gmbh | Methods and systems for automated imaging of three-dimensional objects |
US20220144807A1 (en) | 2019-02-15 | 2022-05-12 | Novartis Ag | 3-(1-oxo-5-(piperidin-4-yl)isoindolin-2-yl)piperidine-2,6-dione derivatives and uses thereof |
CN113329792A (en) | 2019-02-15 | 2021-08-31 | 诺华股份有限公司 | Substituted 3- (1-oxoisoindolin-2-yl) piperidine-2, 6-dione derivatives and uses thereof |
GB2597851B (en) | 2019-02-21 | 2024-05-29 | Marengo Therapeutics Inc | Antibody molecules that bind to NKP30 and uses thereof |
SG11202109061YA (en) | 2019-02-21 | 2021-09-29 | Marengo Therapeutics Inc | Multifunctional molecules that bind to t cell related cancer cells and uses thereof |
SG11202109122SA (en) | 2019-02-21 | 2021-09-29 | Marengo Therapeutics Inc | Anti-tcr antibody molecules and uses thereof |
JP2022522662A (en) | 2019-02-21 | 2022-04-20 | マレンゴ・セラピューティクス,インコーポレーテッド | Multifunctional molecules that bind to T cells and their use for treating autoimmune disorders |
JP2022521750A (en) | 2019-02-21 | 2022-04-12 | マレンゴ・セラピューティクス,インコーポレーテッド | Multifunctional molecule that binds to calreticulin and its use |
EP3927371A1 (en) | 2019-02-22 | 2021-12-29 | Novartis AG | Combination therapies of egfrviii chimeric antigen receptors and pd-1 inhibitors |
EP3931224A4 (en) | 2019-02-26 | 2023-03-01 | Janssen Biotech, Inc. | Combination therapies and patient stratification with bispecific anti-egfr/c-met antibodies |
MX2021010390A (en) | 2019-03-01 | 2021-11-17 | Xencor Inc | Heterodimeric antibodies that bind enpp3 and cd3. |
KR20220004979A (en) | 2019-03-27 | 2022-01-12 | 유엠씨 우트레크트 홀딩 비.브이. | Engineered IGA Antibodies and Methods of Use |
CN113677701A (en) | 2019-03-29 | 2021-11-19 | 豪夫迈·罗氏有限公司 | Method for generating affinity binding multispecific antibodies |
TW202102261A (en) | 2019-03-29 | 2021-01-16 | 美商艾特加有限責任公司 | Antibody molecules to fgf23 and uses thereof |
JP7249432B2 (en) | 2019-03-29 | 2023-03-30 | エフ. ホフマン-ラ ロシュ アーゲー | SPR-based binding assays for functional analysis of multivalent molecules |
CA3136888A1 (en) | 2019-04-19 | 2020-10-22 | Janssen Biotech, Inc. | Methods of treating prostate cancer with an anti- psma/cd3 antibody |
AU2020261250A1 (en) | 2019-04-25 | 2021-10-14 | F. Hoffmann-La Roche Ag | Generation of antibody-derived polypeptides by polypeptide chain exchange |
MX2021012872A (en) | 2019-04-25 | 2021-11-17 | Hoffmann La Roche | Therapeutic multispecific polypeptides activated by polypeptide chain exchange. |
CN113767114A (en) | 2019-04-25 | 2021-12-07 | 豪夫迈·罗氏有限公司 | Activatable therapeutic multispecific polypeptides with extended half-lives |
MX2021013532A (en) | 2019-05-08 | 2022-02-11 | Janssen Biotech Inc | Materials and methods for modulating t cell mediated immunity. |
EP3966241A1 (en) | 2019-05-09 | 2022-03-16 | Genmab B.V. | Dosage regimens for a combination of anti-dr5 antibodies for use in treating cancer |
JP7273195B2 (en) | 2019-05-13 | 2023-05-12 | エフ. ホフマン-ラ ロシュ アーゲー | Interference suppression pharmacokinetic immunoassay |
JOP20210304A1 (en) | 2019-05-14 | 2023-01-30 | Janssen Biotech Inc | Combination therapies with bispecific anti-egfr/c-met antibodies and third generation egfr tyrosine kinase inhibitors |
TW202110885A (en) | 2019-05-20 | 2021-03-16 | 美商潘迪恩治療公司 | Madcam targeted immunotolerance |
MX2021015536A (en) | 2019-06-19 | 2022-02-10 | Hoffmann La Roche | Method for the generation of a protein expressing cell by targeted integration using cre mrna. |
EP3990646A1 (en) | 2019-06-26 | 2022-05-04 | F. Hoffmann-La Roche AG | Mammalian cell lines with sirt-1 gene knockout |
TW202115115A (en) | 2019-07-02 | 2021-04-16 | 瑞士商赫孚孟拉羅股份公司 | Immunoconjugates |
AR119393A1 (en) | 2019-07-15 | 2021-12-15 | Hoffmann La Roche | ANTIBODIES THAT BIND NKG2D |
UY38803A (en) | 2019-07-26 | 2021-01-29 | Janssen Biotech Inc | PROTEINS INCLUDING CALICREIN-RELATED PEPTIDASE 2 ANTIGEN BINDING DOMAINS AND USES |
CA3144524A1 (en) | 2019-07-31 | 2021-02-04 | F. Hoffmann-La Roche Ag | Antibodies binding to gprc5d |
CN114174338A (en) | 2019-07-31 | 2022-03-11 | 豪夫迈·罗氏有限公司 | Antibodies that bind to GPRC5D |
CA3148121A1 (en) | 2019-08-15 | 2021-02-18 | Janssen Biotech, Inc. | Materials and methods for improved single chain variable fragments |
TW202128191A (en) | 2019-10-21 | 2021-08-01 | 瑞士商諾華公司 | Tim-3 inhibitors and uses thereof |
BR112022007376A2 (en) | 2019-10-21 | 2022-07-05 | Novartis Ag | COMBINATION THERAPIES WITH VENETOCLAX AND TIM-3 INHIBITORS |
EP4055046A1 (en) | 2019-11-06 | 2022-09-14 | Genmab B.V. | Antibody variant combinations and uses thereof |
PE20221273A1 (en) | 2019-11-18 | 2022-09-01 | Janssen Biotech Inc | RECEPTORS OF THE ANTI-CD79 CHIMERIC ANTIGEN, CAR-T CELLS, AND THEIR USES |
AR120566A1 (en) | 2019-11-26 | 2022-02-23 | Novartis Ag | CHIMERIC ANTIGEN RECEPTORS AND THEIR USES |
WO2021119505A1 (en) | 2019-12-13 | 2021-06-17 | Genentech, Inc. | Anti-ly6g6d antibodies and methods of use |
WO2021122875A1 (en) | 2019-12-18 | 2021-06-24 | F. Hoffmann-La Roche Ag | Antibodies binding to hla-a2/mage-a4 |
IL293310A (en) | 2019-12-18 | 2022-07-01 | Hoffmann La Roche | Bispecific anti-ccl2 antibodies |
US20230056470A1 (en) | 2019-12-20 | 2023-02-23 | Novartis Ag | Uses of anti-tgf-beta antibodies and checkpoint inhibitors for the treatment of proliferative diseases |
TWI766512B (en) | 2020-01-02 | 2022-06-01 | 瑞士商赫孚孟拉羅股份公司 | Method for determining the amount of a therapeutic antibody in the brain |
EP4084821A4 (en) | 2020-01-03 | 2024-04-24 | Marengo Therapeutics Inc | Multifunctional molecules that bind to cd33 and uses thereof |
JP2023510397A (en) | 2020-01-16 | 2023-03-13 | ジェンマブ エー/エス | Formulations of CD38 antibodies and uses thereof |
CN114980902A (en) | 2020-01-17 | 2022-08-30 | 诺华股份有限公司 | Combination comprising a TIM-3 inhibitor and a hypomethylated drug for the treatment of myelodysplastic syndrome or chronic myelomonocytic leukemia |
US20210222244A1 (en) | 2020-01-17 | 2021-07-22 | Becton, Dickinson And Company | Methods and compositions for single cell secretomics |
KR20220144377A (en) | 2020-01-30 | 2022-10-26 | 우모자 바이오파마 인코포레이티드 | Bispecific transduction promoter |
WO2021155916A1 (en) | 2020-02-04 | 2021-08-12 | BioNTech SE | Treatment involving antigen vaccination and binding agents binding to pd-l1 and cd137 |
TW202144389A (en) | 2020-02-14 | 2021-12-01 | 美商健生生物科技公司 | Neoantigens expressed in multiple myeloma and their uses |
TW202144388A (en) | 2020-02-14 | 2021-12-01 | 美商健生生物科技公司 | Neoantigens expressed in ovarian cancer and their uses |
EP4107187A1 (en) | 2020-02-21 | 2022-12-28 | Pandion Operations, Inc. | Tissue targeted immunotolerance with a cd39 effector |
JP2023515211A (en) | 2020-02-27 | 2023-04-12 | ノバルティス アーゲー | Method for producing chimeric antigen receptor-expressing cells |
PE20230001A1 (en) | 2020-03-13 | 2023-01-05 | Janssen Biotech Inc | MATERIALS AND METHODS FOR THE LINK OF SIGLEC-3/CD33 |
JP2023517753A (en) | 2020-03-18 | 2023-04-26 | ジェンマブ エー/エス | Antibody that binds to B7H4 |
WO2021190980A1 (en) | 2020-03-22 | 2021-09-30 | Quadrucept Bio Limited | Multimers for viral strain evolution |
KR20220156912A (en) | 2020-03-25 | 2022-11-28 | 일라이 릴리 앤드 캄파니 | Multispecific binding proteins and methods for their development |
CN116249712A (en) | 2020-04-15 | 2023-06-09 | 沃雅戈治疗公司 | TAU binding compounds |
KR20230004494A (en) | 2020-04-15 | 2023-01-06 | 에프. 호프만-라 로슈 아게 | immunoconjugate |
CA3180321A1 (en) | 2020-04-24 | 2021-10-28 | Marengo Therapeutics, Inc. | Multifunctional molecules that bind to t cell related cancer cells and uses thereof |
BR112022020673A2 (en) | 2020-04-30 | 2023-01-24 | Bristol Myers Squibb Co | METHODS OF TREATMENT OF ADVERSE EVENTS RELATED TO CYTOKINE |
WO2021231278A1 (en) | 2020-05-11 | 2021-11-18 | F. Hoffmann-La Roche Ag | Combination therapy with modified pbmcs and an immunoconjugate |
US11919956B2 (en) | 2020-05-14 | 2024-03-05 | Xencor, Inc. | Heterodimeric antibodies that bind prostate specific membrane antigen (PSMA) and CD3 |
CA3184189A1 (en) | 2020-05-27 | 2021-12-02 | Janssen Biotech, Inc. | Proteins comprising cd3 antigen binding domains and uses thereof |
US20230310629A1 (en) | 2020-06-03 | 2023-10-05 | Merck Patent Gmbh | Bispecific antibody-drug conjugates targeting egfr and muc1 and uses thereof |
TW202216767A (en) | 2020-06-19 | 2022-05-01 | 瑞士商赫孚孟拉羅股份公司 | Antibodies binding to cd3 and folr1 |
WO2021255146A1 (en) | 2020-06-19 | 2021-12-23 | F. Hoffmann-La Roche Ag | Antibodies binding to cd3 and cea |
IL298402A (en) | 2020-06-19 | 2023-01-01 | Hoffmann La Roche | Antibodies binding to cd3 and cd19 |
JP2023529981A (en) | 2020-06-19 | 2023-07-12 | エフ・ホフマン-ラ・ロシュ・アクチェンゲゼルシャフト | Immunostimulatory Fc domain binding molecules |
AR122658A1 (en) | 2020-06-19 | 2022-09-28 | Hoffmann La Roche | ANTIBODIES THAT BIND TO CD3 |
WO2021260528A1 (en) | 2020-06-23 | 2021-12-30 | Novartis Ag | Dosing regimen comprising 3-(1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives |
AU2021308712A1 (en) | 2020-07-16 | 2023-02-02 | Novartis Ag | Anti-betacellulin antibodies, fragments thereof, and multi-specific binding molecules |
JP2023534726A (en) | 2020-07-23 | 2023-08-10 | ジェンマブ ビー.ブイ. | Combining anti-DR5 antibodies with immunomodulatory imide drugs for use in treating multiple myeloma |
WO2022026592A2 (en) | 2020-07-28 | 2022-02-03 | Celltas Bio, Inc. | Antibody molecules to coronavirus and uses thereof |
CA3190307A1 (en) | 2020-07-29 | 2022-02-03 | Janssen Biotech, Inc. | Proteins comprising hla-g antigen binding domains and their uses |
EP4188549A1 (en) | 2020-08-03 | 2023-06-07 | Novartis AG | Heteroaryl substituted 3-(1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives and uses thereof |
CA3187061A1 (en) | 2020-08-06 | 2022-02-10 | Karsten Beckmann | Binding agents for coronavirus s protein |
WO2022040482A1 (en) | 2020-08-19 | 2022-02-24 | Xencor, Inc. | Anti-cd28 and/or anti-b7h3 compositions |
JP2023542080A (en) | 2020-08-26 | 2023-10-05 | マレンゴ・セラピューティクス,インコーポレーテッド | Multifunctional molecules that bind to calreticulin and their uses |
WO2022047046A1 (en) | 2020-08-26 | 2022-03-03 | Marengo Therapeutics, Inc. | Methods of detecting trbc1 or trbc2 |
KR20230074144A (en) | 2020-08-26 | 2023-05-26 | 마렝고 테라퓨틱스, 인크. | Antibody molecules that bind to NKp30 and uses thereof |
EP4204020A1 (en) | 2020-08-31 | 2023-07-05 | Advanced Accelerator Applications International S.A. | Method of treating psma-expressing cancers |
EP4204021A1 (en) | 2020-08-31 | 2023-07-05 | Advanced Accelerator Applications International S.A. | Method of treating psma-expressing cancers |
BR112023003868A2 (en) | 2020-09-02 | 2023-04-04 | Genmab As | METHOD FOR PREVENTING OR REDUCING THE GROWTH OF A TUMOR, BINDING AGENT FOR USE IN PREVENTING OR REDUCING TUMOR GROWTH, IMMUNOGENIC COMPOSITION COMPRISING AT LEAST ONE VACCINE ANTIGEN FOR USE, USES OF A BINDING AGENT AND AN IMMUNOGENIC COMPOSITION, AND , KIT OF PARTS COMPRISING A BINDING AGENT |
CA3190349A1 (en) | 2020-09-10 | 2022-03-17 | Brian Elliott | Bispecific antibodies against cd3 and cd20 for treating chronic lymphocytic leukemia |
CA3192251A1 (en) | 2020-09-10 | 2022-03-17 | Genmab A/S | Bispecific antibody against cd3 and cd20 in combination therapy for treating diffuse large b-cell lymphoma |
AU2021342284A1 (en) | 2020-09-14 | 2023-04-20 | Sutro Biopharma, Inc. | Method for large scale production of antibodies using a cell-free protein synthesis system |
MX2023003328A (en) | 2020-09-24 | 2023-03-27 | Hoffmann La Roche | Mammalian cell lines with gene knockout. |
KR20230080437A (en) | 2020-10-02 | 2023-06-07 | 젠맵 에이/에스 | Antibodies capable of binding ROR2 and bispecific antibodies binding ROR2 and CD3 |
UY39467A (en) | 2020-10-13 | 2022-04-29 | Janssen Biotech Inc | BIOENGINEERED T-CELL-MEDIATED IMMUNITY, MATERIALS, AND OTHER METHODS TO MODULATE DIFFERENTIATION GROUP IV AND/OR VIII |
WO2022084915A1 (en) | 2020-10-22 | 2022-04-28 | Janssen Biotech, Inc. | Proteins comprising delta-like ligand 3 (dll3) antigen binding domains and their uses |
US20240002509A1 (en) | 2020-11-06 | 2024-01-04 | Novartis Ag | ANTIBODY Fc VARIANTS |
US20240010748A1 (en) | 2020-11-10 | 2024-01-11 | Shanghai Qilu Pharmaceutical Research And Development Centre Ltd. | Bispecific antibody for claudin 18a2 and cd3 and application of bispecific antibody |
IL302700A (en) | 2020-11-13 | 2023-07-01 | Novartis Ag | Combination therapies with chimeric antigen receptor (car)-expressing cells |
WO2022128716A1 (en) | 2020-12-17 | 2022-06-23 | Merck Patent Gmbh | Pharmaceutical composition comprising a bispecific anti-muc1/egfr antibody-drug conjugate |
WO2022129120A1 (en) | 2020-12-17 | 2022-06-23 | F. Hoffmann-La Roche Ag | Anti-hla-g antibodies and use thereof |
WO2022129313A1 (en) | 2020-12-18 | 2022-06-23 | F. Hoffmann-La Roche Ag | Precursor proteins and kit for targeted therapy |
JP2024501662A (en) | 2020-12-22 | 2024-01-15 | エフ. ホフマン-ラ ロシュ アーゲー | Oligonucleotide targeting XBP1 |
CA3207090A1 (en) | 2021-01-06 | 2022-07-14 | F. Hoffmann-La Roche Ag | Combination therapy employing a pd1-lag3 bispecific antibody and a cd20 t cell bispecific antibody |
WO2022148853A1 (en) | 2021-01-11 | 2022-07-14 | F. Hoffmann-La Roche Ag | Immunoconjugates |
KR20230137393A (en) | 2021-01-28 | 2023-10-04 | 얀센 바이오테크 인코포레이티드 | PSMA binding protein and its uses |
JP2024505049A (en) | 2021-01-29 | 2024-02-02 | ノバルティス アーゲー | Administration modes for anti-CD73 and anti-ENTPD2 antibodies and their uses |
US11639396B2 (en) | 2021-02-16 | 2023-05-02 | Janssen Biotech, Inc. | Antibody binding to a linker peptide |
JP2024512240A (en) | 2021-02-18 | 2024-03-19 | エフ. ホフマン-ラ ロシュ アーゲー | Methods for elucidating complex multistep antibody interactions |
WO2022184659A1 (en) | 2021-03-01 | 2022-09-09 | Quadrucept Bio Limited | Antibody domains & multimers |
IL305736A (en) | 2021-03-09 | 2023-11-01 | Xencor Inc | Heterodimeric antibodies that bind cd3 and cldn6 |
CN116997358A (en) | 2021-03-09 | 2023-11-03 | 詹森生物科技公司 | Treatment of cancers lacking EGFR activating mutations |
EP4305065A1 (en) | 2021-03-10 | 2024-01-17 | Xencor, Inc. | Heterodimeric antibodies that bind cd3 and gpc3 |
MX2023010567A (en) | 2021-03-12 | 2023-09-21 | Genmab As | Non-activating antibody variants. |
EP4314056A1 (en) | 2021-03-24 | 2024-02-07 | Janssen Biotech, Inc. | Proteins comprising cd3 antigen binding domains and uses thereof |
TW202304986A (en) | 2021-03-24 | 2023-02-01 | 美商健生生物科技公司 | Antibody targeting cd22 and cd79b |
WO2022206872A1 (en) | 2021-03-31 | 2022-10-06 | 江苏恒瑞医药股份有限公司 | Truncated taci polypeptide and fusion protein and use thereof |
TW202304979A (en) | 2021-04-07 | 2023-02-01 | 瑞士商諾華公司 | USES OF ANTI-TGFβ ANTIBODIES AND OTHER THERAPEUTIC AGENTS FOR THE TREATMENT OF PROLIFERATIVE DISEASES |
CN117597359A (en) | 2021-04-08 | 2024-02-23 | 马伦戈治疗公司 | Multifunctional molecules binding to TCR and uses thereof |
KR20230160389A (en) | 2021-04-22 | 2023-11-23 | 광동 파폰 바이오파마 인크. | Dual specificity multifunctional fusion polypeptide |
WO2022228706A1 (en) | 2021-04-30 | 2022-11-03 | F. Hoffmann-La Roche Ag | Dosing for treatment with anti-cd20/anti-cd3 bispecific antibody |
KR20240005691A (en) | 2021-04-30 | 2024-01-12 | 에프. 호프만-라 로슈 아게 | Dosage for combination therapy with anti-CD20/anti-CD3 bispecific antibody and anti-CD79B antibody drug conjugate |
BR112023021089A2 (en) | 2021-05-07 | 2023-12-12 | Genmab As | PHARMACEUTICAL COMPOSITION, METHOD FOR TREATING A DISEASE, METHOD FOR TREATING CANCER IN AN INDIVIDUAL, USE OF THE PHARMACEUTICAL COMPOSITION, UNIT DOSAGE FORM, KIT OF PARTS, AND, METHOD FOR PREPARING A PHARMACEUTICAL COMPOSITION |
EP4339207A1 (en) | 2021-05-12 | 2024-03-20 | Jiangsu Hengrui Pharmaceuticals Co., Ltd. | Antigen binding molecule specifically binding to rankl and ngf, and medical use thereof |
AU2022273737A1 (en) | 2021-05-14 | 2023-11-16 | Jiangsu Hengrui Pharmaceuticals Co., Ltd. | Antigen-binding molecule |
AR125874A1 (en) | 2021-05-18 | 2023-08-23 | Novartis Ag | COMBINATION THERAPIES |
TW202309094A (en) | 2021-05-18 | 2023-03-01 | 美商健生生物科技公司 | Methods for identifying cancer patients for combination treatment |
CA3221735A1 (en) | 2021-06-18 | 2022-12-22 | F. Hoffmann-La Roche Ag | Bispecific anti-ccl2 antibodies |
WO2022268740A1 (en) | 2021-06-21 | 2022-12-29 | Genmab A/S | Combination dosage regime of cd137 and pd-l1 binding agents |
WO2023279092A2 (en) | 2021-07-02 | 2023-01-05 | Genentech, Inc. | Methods and compositions for treating cancer |
TW202317635A (en) | 2021-07-14 | 2023-05-01 | 大陸商江蘇恆瑞醫藥股份有限公司 | Antigen-binding molecule that specifically binds to hgfr and egfr and the pharmaceutical use thereof |
CN117730102A (en) | 2021-07-22 | 2024-03-19 | 豪夫迈·罗氏有限公司 | Heterodimeric Fc domain antibodies |
CA3227537A1 (en) | 2021-07-27 | 2023-02-02 | Morphosys Ag | Combinations of antigen binding molecules |
IL309120A (en) | 2021-07-28 | 2024-02-01 | Hoffmann La Roche | Methods and compositions for treating cancer |
KR20240051280A (en) | 2021-09-06 | 2024-04-19 | 젠맵 에이/에스 | Antibodies capable of binding CD27, variants thereof and uses thereof |
KR20240055002A (en) | 2021-09-13 | 2024-04-26 | 얀센 바이오테크 인코포레이티드 | CD33 x Vδ2 multispecific antibody for cancer treatment |
WO2023044483A2 (en) | 2021-09-20 | 2023-03-23 | Voyager Therapeutics, Inc. | Compositions and methods for the treatment of her2 positive cancer |
CN117813323A (en) | 2021-09-23 | 2024-04-02 | 江苏恒瑞医药股份有限公司 | Anti-KLB antibodies and uses |
WO2023046322A1 (en) | 2021-09-24 | 2023-03-30 | Janssen Pharmaceutica Nv | Proteins comprising cd20 binding domains, and uses thereof |
CN117916273A (en) | 2021-09-30 | 2024-04-19 | 江苏恒瑞医药股份有限公司 | Anti-IL 23 antibody fusion proteins and uses |
AR127298A1 (en) | 2021-10-08 | 2024-01-10 | Genmab As | ANTIBODIES THAT BIND CD30 AND CD3 |
WO2023062050A1 (en) | 2021-10-14 | 2023-04-20 | F. Hoffmann-La Roche Ag | New interleukin-7 immunoconjugates |
WO2023062048A1 (en) | 2021-10-14 | 2023-04-20 | F. Hoffmann-La Roche Ag | Alternative pd1-il7v immunoconjugates for the treatment of cancer |
WO2023092004A1 (en) | 2021-11-17 | 2023-05-25 | Voyager Therapeutics, Inc. | Compositions and methods for the treatment of tau-related disorders |
WO2023089587A1 (en) | 2021-11-22 | 2023-05-25 | Janssen Biotech, Inc. | Compositions comprising enhanced multispecific binding agents for an immune response |
WO2023094282A1 (en) | 2021-11-25 | 2023-06-01 | F. Hoffmann-La Roche Ag | Quantification of low amounts of antibody sideproducts |
US20230183360A1 (en) | 2021-12-09 | 2023-06-15 | Janssen Biotech, Inc. | Use of Amivantamab to Treat Colorectal Cancer |
AR127887A1 (en) | 2021-12-10 | 2024-03-06 | Hoffmann La Roche | ANTIBODIES THAT BIND CD3 AND PLAP |
TW202342057A (en) | 2022-02-07 | 2023-11-01 | 美商健生生物科技公司 | Methods for reducing infusion-related reactions in patients treated with egfr/met bispecific antibodies |
WO2023150778A1 (en) | 2022-02-07 | 2023-08-10 | Visterra, Inc. | Anti-idiotype antibody molecules and uses thereof |
WO2023174521A1 (en) | 2022-03-15 | 2023-09-21 | Genmab A/S | Binding agents binding to epcam and cd137 |
WO2023175064A1 (en) | 2022-03-17 | 2023-09-21 | Astrazeneca Ab | Methods for purifying bispecific antibodies |
US20230414750A1 (en) | 2022-03-23 | 2023-12-28 | Hoffmann-La Roche Inc. | Combination treatment of an anti-cd20/anti-cd3 bispecific antibody and chemotherapy |
TW202346337A (en) | 2022-03-29 | 2023-12-01 | 美商恩格姆生物製藥公司 | Ilt3 and cd3 binding agents and methods of use thereof |
TW202404637A (en) | 2022-04-13 | 2024-02-01 | 瑞士商赫孚孟拉羅股份公司 | Pharmaceutical compositions of anti-cd20/anti-cd3 bispecific antibodies and methods of use |
WO2023202967A1 (en) | 2022-04-19 | 2023-10-26 | F. Hoffmann-La Roche Ag | Improved production cells |
WO2023209568A1 (en) | 2022-04-26 | 2023-11-02 | Novartis Ag | Multispecific antibodies targeting il-13 and il-18 |
WO2023218051A1 (en) | 2022-05-12 | 2023-11-16 | Genmab A/S | Binding agents capable of binding to cd27 in combination therapy |
WO2023218046A1 (en) | 2022-05-12 | 2023-11-16 | Genmab A/S | Binding agents capable of binding to cd27 in combination therapy |
WO2023220695A2 (en) | 2022-05-13 | 2023-11-16 | Voyager Therapeutics, Inc. | Compositions and methods for the treatment of her2 positive cancer |
WO2023232961A1 (en) | 2022-06-03 | 2023-12-07 | F. Hoffmann-La Roche Ag | Improved production cells |
WO2024003837A1 (en) | 2022-06-30 | 2024-01-04 | Janssen Biotech, Inc. | Use of anti-egfr/anti-met antibody to treat gastric or esophageal cancer |
WO2024030976A2 (en) | 2022-08-03 | 2024-02-08 | Voyager Therapeutics, Inc. | Compositions and methods for crossing the blood brain barrier |
WO2024059739A1 (en) | 2022-09-15 | 2024-03-21 | Voyager Therapeutics, Inc. | Tau binding compounds |
WO2024079015A1 (en) | 2022-10-10 | 2024-04-18 | F. Hoffmann-La Roche Ag | Combination therapy of a gprc5d tcb and imids |
WO2024079010A1 (en) | 2022-10-10 | 2024-04-18 | F. Hoffmann-La Roche Ag | Combination therapy of a gprc5d tcb and cd38 antibodies |
WO2024079009A1 (en) | 2022-10-10 | 2024-04-18 | F. Hoffmann-La Roche Ag | Combination therapy of a gprc5d tcb and proteasome inhibitors |
WO2024079069A1 (en) | 2022-10-12 | 2024-04-18 | F. Hoffmann-La Roche Ag | Method for classifying cells |
WO2024089551A1 (en) | 2022-10-25 | 2024-05-02 | Janssen Biotech, Inc. | Msln and cd3 binding agents and methods of use thereof |
WO2024094660A1 (en) | 2022-10-31 | 2024-05-10 | Genmab A/S | Cd38 antibodies and uses thereof |
WO2024095173A1 (en) | 2022-11-02 | 2024-05-10 | Janssen Biotech, Inc. | Methods of treating cancers |
WO2024100170A1 (en) | 2022-11-11 | 2024-05-16 | F. Hoffmann-La Roche Ag | Antibodies binding to hla-a*02/foxp3 |
WO2024104933A1 (en) | 2022-11-15 | 2024-05-23 | F. Hoffmann-La Roche Ag | Antigen binding molecules |
WO2024107752A2 (en) | 2022-11-15 | 2024-05-23 | Onestone Therapeutics Llc | Compositions and methods for immunomodulatory bifunctional fusion molecules |
WO2024104988A1 (en) | 2022-11-15 | 2024-05-23 | F. Hoffmann-La Roche Ag | Recombinant binding proteins with activatable effector domain |
Family Cites Families (12)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5258498A (en) | 1987-05-21 | 1993-11-02 | Creative Biomolecules, Inc. | Polypeptide linkers for production of biosynthetic proteins |
WO1994012520A1 (en) | 1992-11-20 | 1994-06-09 | Enzon, Inc. | Linker for linked fusion polypeptides |
US5731168A (en) * | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
US20020062010A1 (en) | 1997-05-02 | 2002-05-23 | Genentech, Inc. | Method for making multispecific antibodies having heteromultimeric and common components |
US6472179B2 (en) | 1998-09-25 | 2002-10-29 | Regeneron Pharmaceuticals, Inc. | Receptor based antagonists and methods of making and using |
EP1194539A2 (en) | 1999-06-25 | 2002-04-10 | Universität Zürich | Hetero-associating coiled-coil peptides and screening method therefor |
DE60239454D1 (en) | 2001-05-03 | 2011-04-28 | Merck Patent Gmbh | RECOMBINANT, TUMOR-SPECIFIC ANTIBODY AND ITS USE |
US6833441B2 (en) * | 2001-08-01 | 2004-12-21 | Abmaxis, Inc. | Compositions and methods for generating chimeric heteromultimers |
US20050249723A1 (en) * | 2003-12-22 | 2005-11-10 | Xencor, Inc. | Fc polypeptides with novel Fc ligand binding sites |
JP2008511337A (en) * | 2004-09-02 | 2008-04-17 | ジェネンテック・インコーポレーテッド | Heteromultimeric molecule |
JP5620626B2 (en) * | 2005-03-31 | 2014-11-05 | 中外製薬株式会社 | Polypeptide production method by association control |
AR060070A1 (en) | 2006-03-24 | 2008-05-21 | Merck Patent Gmbh | HETERODYMERIC PROTEIN DOMAINS OBTAINED BY ENGINEERING |
-
2007
- 2007-03-23 AR ARP070101189 patent/AR060070A1/en unknown
- 2007-03-23 PT PT07723539T patent/PT1999154E/en unknown
- 2007-03-23 PL PL07723539T patent/PL1999154T3/en unknown
- 2007-03-23 JP JP2009501919A patent/JP5474531B2/en active Active
- 2007-03-23 AU AU2007229698A patent/AU2007229698B9/en active Active
- 2007-03-23 WO PCT/EP2007/002590 patent/WO2007110205A2/en active Application Filing
- 2007-03-23 DK DK07723539T patent/DK1999154T3/en active
- 2007-03-23 EP EP20070723539 patent/EP1999154B1/en active Active
- 2007-03-23 SI SI200731095T patent/SI1999154T1/en unknown
- 2007-03-23 ES ES07723539T patent/ES2395969T3/en active Active
- 2007-03-23 US US11/728,048 patent/US8871912B2/en active Active
- 2007-03-23 CA CA2646965A patent/CA2646965C/en active Active
-
2008
- 2008-09-16 IL IL194145A patent/IL194145A/en active IP Right Grant
-
2013
- 2013-10-01 JP JP2013206531A patent/JP6104121B2/en active Active
-
2014
- 2014-10-03 US US14/505,653 patent/US9505848B2/en active Active
-
2016
- 2016-11-28 US US15/362,319 patent/US20170145078A1/en not_active Abandoned
- 2016-12-01 JP JP2016234369A patent/JP2017046720A/en active Pending
-
2018
- 2018-12-12 US US16/217,613 patent/US20190211079A1/en not_active Abandoned
Cited By (12)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10501543B2 (en) | 2016-10-14 | 2019-12-10 | Xencor, Inc. | IL15/IL15Rα heterodimeric Fc-fusion proteins |
US10550185B2 (en) | 2016-10-14 | 2020-02-04 | Xencor, Inc. | Bispecific heterodimeric fusion proteins containing IL-15-IL-15Rα Fc-fusion proteins and PD-1 antibody fragments |
US11584794B2 (en) | 2016-10-14 | 2023-02-21 | Xencor, Inc. | Bispecific heterodimeric fusion proteins containing IL-15-IL-15Ralpha Fc-fusion proteins and immune checkpoint antibody fragments |
US11084863B2 (en) | 2017-06-30 | 2021-08-10 | Xencor, Inc. | Targeted heterodimeric Fc fusion proteins containing IL-15 IL-15alpha and antigen binding domains |
US11505595B2 (en) | 2018-04-18 | 2022-11-22 | Xencor, Inc. | TIM-3 targeted heterodimeric fusion proteins containing IL-15/IL-15RA Fc-fusion proteins and TIM-3 antigen binding domains |
US11524991B2 (en) | 2018-04-18 | 2022-12-13 | Xencor, Inc. | PD-1 targeted heterodimeric fusion proteins containing IL-15/IL-15Ra Fc-fusion proteins and PD-1 antigen binding domains and uses thereof |
US11377477B2 (en) | 2018-10-12 | 2022-07-05 | Xencor, Inc. | PD-1 targeted IL-15/IL-15RALPHA fc fusion proteins and uses in combination therapies thereof |
US11618776B2 (en) | 2018-12-20 | 2023-04-04 | Xencor, Inc. | Targeted heterodimeric Fc fusion proteins containing IL-15/IL-15RA and NKG2D antigen binding domains |
US11739160B2 (en) | 2018-12-24 | 2023-08-29 | Sanofi | PseudoFab-based multispecific binding proteins |
WO2020242884A1 (en) * | 2019-05-24 | 2020-12-03 | Proviva Therapeutics (Hong Kong) Limited | Il-2 compositions and methods of use thereof |
CN113874390A (en) * | 2019-05-24 | 2021-12-31 | 普罗维瓦疗法香港有限公司 | IL-2 compositions and methods of use thereof |
US11932675B2 (en) | 2019-10-11 | 2024-03-19 | Genentech, Inc. | PD-1 targeted IL-15/IL-15Rα Fc fusion proteins with improved properties |
Also Published As
Publication number | Publication date |
---|---|
JP5474531B2 (en) | 2014-04-16 |
DK1999154T3 (en) | 2012-12-03 |
US20150104865A1 (en) | 2015-04-16 |
US9505848B2 (en) | 2016-11-29 |
WO2007110205A2 (en) | 2007-10-04 |
US8871912B2 (en) | 2014-10-28 |
AU2007229698A1 (en) | 2007-10-04 |
SI1999154T1 (en) | 2013-01-31 |
AU2007229698B2 (en) | 2012-10-04 |
JP2017046720A (en) | 2017-03-09 |
PL1999154T3 (en) | 2013-03-29 |
JP2009531040A (en) | 2009-09-03 |
EP1999154A2 (en) | 2008-12-10 |
CA2646965A1 (en) | 2007-10-04 |
AU2007229698B9 (en) | 2012-11-08 |
AR060070A1 (en) | 2008-05-21 |
JP6104121B2 (en) | 2017-03-29 |
IL194145A0 (en) | 2011-08-01 |
WO2007110205A3 (en) | 2008-02-28 |
JP2014023535A (en) | 2014-02-06 |
EP1999154B1 (en) | 2012-10-24 |
CA2646965C (en) | 2016-06-21 |
ES2395969T3 (en) | 2013-02-18 |
US20070287170A1 (en) | 2007-12-13 |
PT1999154E (en) | 2013-01-24 |
US20190211079A1 (en) | 2019-07-11 |
IL194145A (en) | 2013-11-28 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20190211079A1 (en) | Engineered heterodimeric protein domains | |
ES2246069T3 (en) | PROCEDURE FOR THE PREPARATION OF MULTI-SPECIFIC ANTIBODIES THAT HAVE COMMON AND MULTIMERIC COMPONENTS. | |
US11535674B2 (en) | Bivalent bispecific antibody hybrid protein expression and preparation methods | |
WO2017143840A1 (en) | Method for expressing and preparing polyvalent multi-specific antibody and immune hybrid protein | |
SG193916A1 (en) | Dual variable region antibody-like binding proteins having cross-over binding region orientation | |
US20220227867A1 (en) | ICOS TARGETED HETERODIMERIC FUSION PROTEINS CONTAINING IL-15/IL-15RA Fc-FUSION PROTEINS AND ICOS ANTIGEN BINDING DOMAINS | |
US20240132584A1 (en) | Heterodimeric antibodies that bind cd3 and cldn6 | |
US20220144956A1 (en) | HETERODIMERIC ANTIBODIES THAT BIND TGFbetaRII | |
US20240059786A1 (en) | Anti-cd28 x anti-trop2 antibodies | |
US20190352429A1 (en) | Preferred pairing of antibody domains | |
Shukla et al. | Downstream Processing of fc Fusion Proteins, Bispecific Antibodies, and Antibody–Drug Conjugates | |
US20230116446A1 (en) | HETERODIMERIC Fc FOR MAKING FUSION PROTEINS AND BISPECIFIC ANTIBODIES | |
US20230340128A1 (en) | Anti-cd28 x anti-msln antibodies | |
CN118119642A (en) | Engineered Fc variants | |
WO2023073599A1 (en) | Engineered fc variants | |
TW202328179A (en) | Methods of controlling antibody heterogeneity | |
WO2017009419A1 (en) | Bispecific antibody-like molecules having bivalency vis-à-vis each antigen |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: MERCK PATENT GMBH, GERMANY Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:DAVIS, JONATHAN;HUSTON, JAMES;REEL/FRAME:042152/0023 Effective date: 20070808 |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO PAY ISSUE FEE |