US20160298133A1 - Crispr-based genome modification and regulation - Google Patents
Crispr-based genome modification and regulation Download PDFInfo
- Publication number
- US20160298133A1 US20160298133A1 US15/188,909 US201615188909A US2016298133A1 US 20160298133 A1 US20160298133 A1 US 20160298133A1 US 201615188909 A US201615188909 A US 201615188909A US 2016298133 A1 US2016298133 A1 US 2016298133A1
- Authority
- US
- United States
- Prior art keywords
- sequence
- protein
- domain
- cell
- fusion protein
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases RNAses, DNAses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0048—Eye, e.g. artificial tears
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/90—Stable introduction of foreign DNA into chromosome
- C12N15/902—Stable introduction of foreign DNA into chromosome using homologous recombination
- C12N15/907—Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
- A61P27/10—Ophthalmic agents for accommodation disorders, e.g. myopia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/463—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from amphibians
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/06—Linear peptides containing only normal peptide links having 5 to 11 amino acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/102—Mutagenizing nucleic acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/67—General methods for enhancing the expression
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/96—Stabilising an enzyme by forming an adduct or a composition; Forming enzyme conjugates
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y301/00—Hydrolases acting on ester bonds (3.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y301/00—Hydrolases acting on ester bonds (3.1)
- C12Y301/21—Endodeoxyribonucleases producing 5'-phosphomonoesters (3.1.21)
- C12Y301/21004—Type II site-specific deoxyribonuclease (3.1.21.4)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/09—Fusion polypeptide containing a localisation/targetting motif containing a nuclear localisation signal
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/10—Fusion polypeptide containing a localisation/targetting motif containing a tag for extracellular membrane crossing, e.g. TAT or VP22
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/80—Fusion polypeptide containing a DNA binding domain, e.g. Lacl or Tet-repressor
- C07K2319/81—Fusion polypeptide containing a DNA binding domain, e.g. Lacl or Tet-repressor containing a Zn-finger domain for DNA binding
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPRs]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/30—Chemical structure
- C12N2310/35—Nature of the modification
- C12N2310/351—Conjugate
- C12N2310/3513—Protein; Peptide
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
- C12N2750/00011—Details
- C12N2750/14011—Parvoviridae
- C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
- C12N2750/14141—Use of virus, viral particle or viral elements as a vector
- C12N2750/14143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/22—Vectors comprising a coding region that has been codon optimised for expression in a respective host
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/80—Vectors containing sites for inducing double-stranded breaks, e.g. meganuclease restriction sites
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the present disclosure relates targeted genome modification.
- the disclosure relates to RNA-guided endonucleases or fusion proteins comprising CRISPR/Cas-like protein and methods of using said proteins to modify or regulate targeted chromosomal sequences.
- Targeted genome modification is a powerful tool for genetic manipulation of eukaryotic cells, embryos, and animals.
- exogenous sequences can be integrated at targeted genomic locations and/or specific endogenous chromosomal sequences can be deleted, inactivated, or modified.
- Current methods rely on the use of engineered nuclease enzymes, such as, for example, zinc finger nucleases (ZFNs) or transcription activator-like effector nucleases (TALENs).
- ZFNs zinc finger nucleases
- TALENs transcription activator-like effector nucleases
- These chimeric nucleases contain programmable, sequence-specific DNA-binding modules linked to a nonspecific DNA cleavage domain.
- Each new genomic target however, requires the design of a new ZFN or TALEN comprising a novel sequence-specific DNA-binding module.
- these custom designed nucleases tend to be costly and time-consuming to prepare.
- the specificities of ZFNs and TALENS are such
- RNA-guided endonuclease wherein the endonuclease comprises at least one nuclear localization signal, at least one nuclease domain, and at least one domain that interacts with a guide RNA to target the endonuclease to a specific nucleotide sequence for cleavage.
- the endonuclease can be derived from a Cas9 protein.
- the endonuclease can be modified to lack at least one functional nuclease domain.
- the endonuclease can further comprise a cell-penetrating domain, a marker domain, or both.
- the endonuclease can be part of a protein-RNA complex comprising the guide RNA.
- the guide RNA can be a single molecule comprising a 5′ region that is complementary to a target site.
- an isolated nucleic acid encoding any of the RNA-guided endonucleases disclosed herein.
- the nucleic acid can be codon optimized for translation in mammalian cells, such as, for example, human cells.
- the nucleic acid sequence encoding the RNA-guided endonuclease can be operably linked to a promoter control sequence, and optionally, can be part of a vector.
- Another aspect of the present invention encompasses a method for modifying a chromosomal sequence in a eukaryotic cell or embryo.
- the method comprises introducing into a eukaryotic cell or embryo (i) at least one RNA-guided endonuclease comprising at least one nuclear localization signal or nucleic acid encoding at least one RNA-guided endonuclease as defined herein, (ii) at least one guide RNA or DNA encoding at least one guide RNA, and, optionally, (iii) at least one donor polynucleotide comprising a donor sequence.
- any of the fusion proteins disclosed herein can comprise at least one additional domain chosen from a nuclear localization signal, a cell-penetrating domain, and a marker domain. Also provided are isolated nucleic acids encoding any of the fusion proteins provided herein.
- fusion proteins wherein a fusion protein comprises a CRISPR/Cas-like protein or fragment thereof and an effector domain.
- Suitable effector domains include, without limit, cleavage domains, epigenetic modification domains, transcriptional activation domains, and transcriptional repressor domains.
- Each fusion protein is guided to a specific chromosomal sequence by a specific guide RNA, wherein the effector domain mediates targeted genome modification or gene regulation.
- the fusion proteins can function as dimers thereby increasing the length of the target site and increasing the likelihood of its uniqueness in the genome (thus, reducing off target effects).
- the RNA-guided endonuclease is derived from a type II CRISPR/Cas system.
- the RNA-guided endonuclease is derived from a Cas9 protein.
- the Cas9 protein can be from Streptococcus pyogenes, Streptococcus thermophilus, Streptococcus sp., Nocardiopsis rougevillei, Streptomyces pristinaespiralis, Streptomyces viridochromogenes, Streptomyces viridochromogenes, Streptosporangium roseum, Streptosporangium roseum, Alicyclobacillus acidocaldarius, Bacillus pseudomycoides, Bacillus selenitireducens, Exiguobacterium sibiricum, Lactobacillus delbrueckii, Lactobacillus salivarius, Microscilla marina, Burkholderiales bacterium, Polaro
- the CRISPR/Cas-like protein can be a wild type CRISPR/Cas protein, a modified CRISPR/Cas protein, or a fragment of a wild type or modified CRISPR/Cas protein.
- the CRISPR/Cas-like protein can be modified to increase nucleic acid binding affinity and/or specificity, alter an enzymatic activity, and/or change another property of the protein.
- nuclease i.e., DNase, RNase
- the CRISPR/Cas-like protein can be truncated to remove domains that are not essential for the function of the fusion protein.
- the CRISPR/Cas-like protein can also be truncated or modified to optimize the activity of the effector domain of the fusion protein.
- the RNA-guided endonuclease can further comprise at least one cell-penetrating domain.
- the cell-penetrating domain can be a cell-penetrating peptide sequence derived from the HIV-1 TAT protein.
- the TAT cell-penetrating sequence can be GRKKRRQRRRPPQPKKKRKV (SEQ ID NO:4).
- the cell-penetrating domain can be TLM (PLSSIFSRIGDPPKKKRKV; SEQ ID NO:5), a cell-penetrating peptide sequence derived from the human hepatitis B virus.
- the type II-S cleavage can be modified to facilitate dimerization of two different cleavage domains (each of which is attached to a CRISPR/Cas-like protein or fragment thereof).
- the cleavage domain of FokI can be modified by mutating certain amino acid residues.
- amino acid residues at positions 446, 447, 479, 483, 484, 486, 487, 490, 491, 496, 498, 499, 500, 531, 534, 537, and 538 of FokI cleavage domains are targets for modification.
- the combined length of the second and third regions (also called the universal or scaffold region) of the guide RNA can range from about 30 to about 120 nucleotides in length. In one aspect, the combined length of the second and third regions of the guide RNA range from about 70 to about 100 nucleotides in length.
- the guide RNA can be introduced into the cell or embryo as a DNA molecule.
- the DNA encoding the guide RNA can be operably linked to promoter control sequence for expression of the guide RNA in the cell or embryo of interest.
- the RNA coding sequence can be operably linked to a promoter sequence that is recognized by RNA polymerase III (Pol III).
- Pol III RNA polymerase III
- suitable Pol III promoters include, but are not limited to, mammalian U6 or H1 promoters.
- the RNA coding sequence is linked to a mouse or human U6 promoter.
- the RNA coding sequence is linked to a mouse or human H1 promoter.
- RNA-guided endonuclease in conjunction with a guide RNA is directed to a target site in the chromosomal sequence, wherein the RNA-guided endonuclease introduces a double-stranded break in the chromosomal sequence.
- the target site has no sequence limitation except that the sequence is immediately followed (downstream) by a consensus sequence.
- This consensus sequence is also known as a protospacer adjacent motif (PAM).
- PAM protospacer adjacent motif
- Examples of PAM include, but are not limited to, NGG, NGGNG, and NNAGAAW (wherein N is defined as any nucleotide and W is defined as either A or T).
- the first region (at the 5′ end) of the guide RNA is complementary to the protospacer of the target sequence.
- the first region of the guide RNA is about 19 to 21 nucleotides in length.
- the sequence of the target site in the chromosomal sequence is 5′-N 19-21 -NGG-3′.
- the PAM is in italics.
- the target site can be in the coding region of a gene, in an intron of a gene, in a control region of a gene, in a non-coding region between genes, etc.
- the gene can be a protein coding gene or an RNA coding gene.
- the gene can be any gene of interest.
- the method further comprises introducing at least one donor polynucleotide into the embryo.
- a donor polynucleotide comprises at least one donor sequence.
- a donor sequence of the donor polynucleotide corresponds to an endogenous or native chromosomal sequence.
- the donor sequence can be essentially identical to a portion of the chromosomal sequence at or near the targeted site, but which comprises at least one nucleotide change.
- the donor sequence can comprise a modified version of the wild type sequence at the targeted site such that, upon integration or exchange with the native sequence, the sequence at the targeted chromosomal location comprises at least one nucleotide change.
- the donor sequence of the donor polynucleotide corresponds to an exogenous sequence.
- an “exogenous” sequence refers to a sequence that is not native to the cell or embryo, or a sequence whose native location in the genome of the cell or embryo is in a different location.
- the exogenous sequence can comprise protein coding sequence, which can be operably linked to an exogenous promoter control sequence such that, upon integration into the genome, the cell or embryo/animal is able to express the protein coded by the integrated sequence.
- the exogenous sequence can be integrated into the chromosomal sequence such that its expression is regulated by an endogenous promoter control sequence.
- the exogenous sequence can be a transcriptional control sequence, another expression control sequence, an RNA coding sequence, and so forth. Integration of an exogenous sequence into a chromosomal sequence is termed a “knock in.”
- the length of the donor sequence can and will vary.
- the donor sequence can vary in length from several nucleotides to hundreds of nucleotides to hundreds of thousands of nucleotides.
- the upstream and downstream sequences in the donor polynucleotide can have about 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% A sequence identity with sequence upstream or downstream to the targeted site.
- the upstream and downstream sequences in the donor polynucleotide can have about 95% or 100% sequence identity with chromosomal sequences upstream or downstream to the targeted site.
- the upstream sequence shares substantial sequence identity with a chromosomal sequence located immediately upstream of the targeted site (i.e., adjacent to the targeted site). In other embodiments, the upstream sequence shares substantial sequence identity with a chromosomal sequence that is located within about one hundred (100) nucleotides upstream from the targeted site. Thus, for example, the upstream sequence can share substantial sequence identity with a chromosomal sequence that is located about 1 to about 20, about 21 to about 40, about 41 to about 60, about 61 to about 80, or about 81 to about 100 nucleotides upstream from the targeted site.
- the downstream sequence shares substantial sequence identity with a chromosomal sequence located immediately downstream of the targeted site (i.e., adjacent to the targeted site). In other embodiments, the downstream sequence shares substantial sequence identity with a chromosomal sequence that is located within about one hundred (100) nucleotides downstream from the targeted site. Thus, for example, the downstream sequence can share substantial sequence identity with a chromosomal sequence that is located about 1 to about 20, about 21 to about 40, about 41 to about 60, about 61 to about 80, or about 81 to about 100 nucleotides downstream from the targeted site.
- the donor polynucleotide can additionally comprise at least one targeted cleavage site that is recognized by the RNA-guided endonuclease.
- the targeted cleavage site added to the donor polynucleotide can be placed upstream or downstream or both upstream and downstream of the donor sequence.
- the donor sequence can be flanked by targeted cleavage sites such that, upon cleavage by the RNA-guided endonuclease, the donor sequence is flanked by overhangs that are compatible with those in the chromosomal sequence generated upon cleavage by the RNA-guided endonuclease.
- the double-stranded break can be repaired by a homology-directed repair (HDR) process such that the donor sequence is integrated into the chromosomal sequence.
- HDR homology-directed repair
- an exogenous sequence can be integrated into the genome of the cell or embryo, or the targeted chromosomal sequence can be modified by exchange of a modified sequence for the wild type chromosomal sequence.
- a single nucleotide change can give rise to an altered protein product, or a shift in the reading frame of a coding sequence can inactivate or “knock out” the sequence such that no protein product is made.
- the donor sequence in the donor polynucleotide can be exchanged with or integrated into the chromosomal sequence at the targeted site during repair of the double-stranded break.
- the donor sequence in embodiments in which the donor sequence is flanked by upstream and downstream sequences having substantial sequence identity with upstream and downstream sequences, respectively, of the targeted site in the chromosomal sequence, the donor sequence can be exchanged with or integrated into the chromosomal sequence at the targeted site during repair mediated by homology-directed repair process.
- the donor sequence in embodiments in which the donor sequence is flanked by compatible overhangs (or the compatible overhangs are generated in situ by the RNA-guided endonuclease) the donor sequence can be ligated directly with the cleaved chromosomal sequence by a non-homologous repair process during repair of the double-stranded break.
- Exchange or integration of the donor sequence into the chromosomal sequence modifies the targeted chromosomal sequence or introduces an exogenous sequence into the chromosomal sequence of the cell or embryo.
- the resultant double-stranded breaks can be repaired by a non-homologous repair process such that deletions of at least one nucleotide, insertions of at least one nucleotide, substitutions of at least one nucleotide, or combinations thereof can occur during the repair of the break.
- the method can comprise introducing into the cell or embryo one fusion protein (or nucleic acid encoding one fusion protein) and one guide RNA (or DNA encoding one guide RNA).
- the guide RNA directs the fusion protein to a specific chromosomal sequence, wherein the epigenetic modification domain modifies the structure of the targeted the chromosomal sequence. See FIG. 2B .
- Epigenetic modifications include acetylation, methylation of histone proteins and/or nucleotide methylation.
- structural modification of the chromosomal sequence leads to changes in expression of the chromosomal sequence.
- the present disclosure encompasses genetically modified cells, non-human embryos, and non-human animals comprising at least one chromosomal sequence that has been modified using an RNA-guided endonuclease-mediated or fusion protein-mediated process, for example, using the methods described herein.
- the disclosure provides cells comprising at least one DNA or RNA molecule encoding an RNA-guided endonuclease or fusion protein targeted to a chromosomal sequence of interest or a fusion protein, at least one guide RNA, and optionally one or more donor polynucleotide(s).
- the present disclosure provides genetically modified non-human animals, non-human embryos, or animal cells comprising at least one modified chromosomal sequence.
- the modified chromosomal sequence may be modified such that it is (1) inactivated, (2) has an altered expression or produces an altered protein product, or (3) comprises an integrated sequence.
- the chromosomal sequence is modified with an RNA guided endonuclease-mediated or fusion protein-mediated process, using the methods described herein.
- the modified chromosomal sequence can be altered such that it codes for a variant protein product.
- a genetically modified animal comprising a modified chromosomal sequence can comprise a targeted point mutation(s) or other modification such that an altered protein product is produced.
- the chromosomal sequence can be modified such that at least one nucleotide is changed and the expressed protein comprises one changed amino acid residue (missense mutation).
- the chromosomal sequence can be modified to comprise more than one missense mutation such that more than one amino acid is changed.
- the chromosomal sequence can be modified to have a three nucleotide deletion or insertion such that the expressed protein comprises a single amino acid deletion or insertion.
- the altered or variant protein can have altered properties or activities compared to the wild type protein, such as altered substrate specificity, altered enzyme activity, altered kinetic rates, etc.
- the chromosomally integrated sequence encoding a protein can encode the wild type form of a protein of interest or can encode a protein comprising at least one modification such that an altered version of the protein is produced.
- a chromosomally integrated sequence encoding a protein related to a disease or disorder can comprise at least one modification such that the altered version of the protein produced causes or potentiates the associated disorder.
- the chromosomally integrated sequence encoding a protein related to a disease or disorder can comprise at least one modification such that the altered version of the protein protects against the development of the associated disorder.
- the genetically modified animal can be a “humanized” animal comprising at least one chromosomally integrated sequence encoding a functional human protein.
- the functional human protein can have no corresponding ortholog in the genetically modified animal.
- the wild type animal from which the genetically modified animal is derived may comprise an ortholog corresponding to the functional human protein.
- the orthologous sequence in the “humanized” animal is inactivated such that no functional protein is made and the “humanized” animal comprises at least one chromosomally integrated sequence encoding the human protein.
- the genetically modified animal disclosed herein can be heterozygous for the modified chromosomal sequence.
- the genetically modified animal can be homozygous for the modified chromosomal sequence.
- a first animal comprising an inactivated chromosomal sequence gene “x” can be crossed with a second animal comprising a chromosomally integrated sequence encoding a human gene “X” protein to give rise to “humanized” gene “X” offspring comprising both the inactivated gene “x” chromosomal sequence and the chromosomally integrated human gene “X” sequence.
- a humanized gene “X” animal can be crossed with a humanized gene “Y” animal to create humanized gene X/gene Y offspring.
- a further aspect of the present disclosure provides genetically modified cells or cell lines comprising at least one modified chromosomal sequence.
- the genetically modified cell or cell line can be derived from any of the genetically modified animals disclosed herein.
- the chromosomal sequence can be modified in a cell as described herein above (in the paragraphs describing chromosomal sequence modifications in animals) using the methods descried herein.
- the disclosure also encompasses a lysate of said cells or cell lines.
- the cells are eukaryotic cells.
- Suitable host cells include fungi or yeast, such as Pichia, Saccharomyces , or Schizosaccharomyces ; insect cells, such as SF9 cells from Spodoptera frugiperda or S2 cells from Drosophila melanogaster ; and animal cells, such as mouse, rat, hamster, non-human primate, or human cells.
- Exemplary cells are mammalian.
- the mammalian cells can be primary cells. In general, any primary cell that is sensitive to double strand breaks may be used.
- the cells may be of a variety of cell types, e.g., fibroblast, myoblast, T or B cell, macrophage, epithelial cell, and so forth.
- heterologous refers to an entity that is not endogenous or native to the cell of interest.
- a heterologous protein refers to a protein that is derived from or was originally derived from an exogenous source, such as an exogenously introduced nucleic acid sequence. In some instances, the heterologous protein is not normally produced by the cell of interest.
- the percent identity of two sequences is the number of exact matches between two aligned sequences divided by the length of the shorter sequences and multiplied by 100.
- An approximate alignment for nucleic acid sequences is provided by the local homology algorithm of Smith and Waterman, Advances in Applied Mathematics 2:482-489 (1981). This algorithm can be applied to amino acid sequences by using the scoring matrix developed by Dayhoff, Atlas of Protein Sequences and Structure, M. O. Dayhoff ed., 5 suppl. 3:353-358, National Biomedical Research Foundation, Washington, D.C., USA, and normalized by Gribskov, Nucl. Acids Res. 14(6):6745-6763 (1986).
- the adeno-associated virus integration site 1 (AAVS1) locus was used as a target for Cas9-mediated human genome modification.
- the human AAVS1 locus is located in intron 1 (4427 bp) of protein phosphatase 1, regulatory subunit 12C (PPP1R12C).
- PPP1R12C protein phosphatase 1, regulatory subunit 12C
- Table 3 presents the first exon (shaded gray) and the first intron of PPP1R12C.
- the underlined sequence within the intron is the targeted modification site (i.e., AAVS1 locus).
- AAVS1-GFP DNA donor contained a 5′ (1185 bp) AAVS1 locus homologous arm, an RNA splicing receptor, a turbo GFP coding sequence, a 3′ transcription terminator, and a 3′ (1217 bp) AAVS1 locus homologous arm.
- Table 5 presents the sequences of the RNA splicing receptor and the GFP coding sequence followed by the 3′ transcription terminator.
- Plasmid DNA was prepared by using GenElute Endotoxin-Free Plasmid Maxiprep Kit (Sigma).
- Genomic DNA was extracted from transfected cells with GenElute Mammalian Genomic DNA Miniprep Kit (Sigma) 12 days after transfection. Genomic DNA was then PCR amplified with a forward primer located outside the 5′ homologous arm of the AAVS1-GFP plasmid donor and a reverse primer located at the 5′ region of the GFP.
- the forward primer was 5′-CCACTCTGTGCTGACCACTCT-3′ (SEQ ID NO:18) and reverse primer was 5′-GCGGCACTCGATCTCCA-3′ (SEQ ID NO:19).
- the expected fragment size from the junction PCR was 1388 bp.
- the amplification was carried out with JumpStart Taq ReadyMix (Sigma), using the following cycling conditions: 98° C.
- the crRNAs were chemically synthesized and pre-annealed to the tracrRNA (SEQ ID NO:13; see Example 2).
- Pre-annealed crRNA/tracrRNA and in vitro transcribed mRNA encoding modified Cas9 protein (SEQ ID NO. 9; see Example 1) can be microinjected into the pronuclei of fertilized mouse embryos.
- the Cas9 protein cleaves the target site, and the resultant double-stranded break can be repaired via a non-homologous end-joining (NHEJ) repair process.
- NHEJ non-homologous end-joining
- RNAs were designed to target each of the target sites in the rat Rosa26 locus.
- the sequences are shown in Table 11, each is 42 nucleotides in length and the 5′ region is complementary to the strand that is not presented in Table 10 (i.e., the strand that is complementary to the strand shown in Table 10).
- the injected embryos can be either incubated at 37° C., 5% CO 2 overnight or for up to 4 days, followed by genotyping analysis, or the injected embryos can be implanted into recipient female mice such that live born animals can be genotyped.
- the in vitro-incubated embryos or tissues from live born animals can be screened for the presence of Cas9-induced mutation at the Rosa locus using standard methods.
- the embryos or tissues from fetus or live-born animals can be harvested for DNA extraction and analysis. DNA can be isolated using standard procedures.
- the targeted region of the Rosa26 locus can be PCR amplified using appropriate primers.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Biophysics (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Medicinal Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Virology (AREA)
- Immunology (AREA)
- Crystallography & Structural Chemistry (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Mycology (AREA)
- Cell Biology (AREA)
- Epidemiology (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Ophthalmology & Optometry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Enzymes And Modification Thereof (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
The present invention provides RNA-guided endonucleases, which are engineered for expression in eukaryotic cells or embryos, and methods of using the RNA-guided endonuclease for targeted genome modification in in eukaryotic cells or embryos. Also provided are fusion proteins, wherein each fusion protein comprises a CRISPR/Cas-like protein or fragment thereof and an effector domain. The effector domain can be a cleavage domain, an epigenetic modification domain, a transcriptional activation domain, or a transcriptional repressor domain. Also provided are methods for using the fusion proteins to modify a chromosomal sequence or regulate expression of a chromosomal sequence.
Description
- This application is a divisional application of U.S. patent application Ser. No. 14/649,777, filed Jun. 4, 2015, which is a U.S. National Stage Application of PCT International Application No. PCT/US2013/073307, filed Dec. 5, 2013, which claims priority to U.S. Provisional Application Ser. No. 61/734,256, filed Dec. 6, 2012; U.S. Provisional Application Ser. No. 61/758,624, filed Jan. 30, 2013; U.S. Provisional Application Ser. No. 61/761,046, filed Feb. 5, 2013; and U.S. Provisional Application Ser. No. 61/794,422, filed Mar. 15, 2013, the disclosure of each is hereby incorporated by reference in its entirety.
- The present disclosure relates targeted genome modification. In particular, the disclosure relates to RNA-guided endonucleases or fusion proteins comprising CRISPR/Cas-like protein and methods of using said proteins to modify or regulate targeted chromosomal sequences.
- Targeted genome modification is a powerful tool for genetic manipulation of eukaryotic cells, embryos, and animals. For example, exogenous sequences can be integrated at targeted genomic locations and/or specific endogenous chromosomal sequences can be deleted, inactivated, or modified. Current methods rely on the use of engineered nuclease enzymes, such as, for example, zinc finger nucleases (ZFNs) or transcription activator-like effector nucleases (TALENs). These chimeric nucleases contain programmable, sequence-specific DNA-binding modules linked to a nonspecific DNA cleavage domain. Each new genomic target, however, requires the design of a new ZFN or TALEN comprising a novel sequence-specific DNA-binding module. Thus, these custom designed nucleases tend to be costly and time-consuming to prepare. Moreover, the specificities of ZFNs and TALENS are such that they can mediate off-target cleavages.
- Thus, there is a need for a targeted genome modification technology that does not require the design of a new nuclease for each new targeted genomic location. Additionally, there is a need for a technology with increased specificity with few or no off-target effects.
- Among the various aspects of the present disclosure is the provision of an isolated RNA-guided endonuclease, wherein the endonuclease comprises at least one nuclear localization signal, at least one nuclease domain, and at least one domain that interacts with a guide RNA to target the endonuclease to a specific nucleotide sequence for cleavage. In one embodiment, the endonuclease can be derived from a Cas9 protein. In another embodiment, the endonuclease can be modified to lack at least one functional nuclease domain. In other embodiments, the endonuclease can further comprise a cell-penetrating domain, a marker domain, or both. In a further embodiment, the endonuclease can be part of a protein-RNA complex comprising the guide RNA. In some instances, the guide RNA can be a single molecule comprising a 5′ region that is complementary to a target site. Also provided is an isolated nucleic acid encoding any of the RNA-guided endonucleases disclosed herein. In some embodiments, the nucleic acid can be codon optimized for translation in mammalian cells, such as, for example, human cells. In other embodiments, the nucleic acid sequence encoding the RNA-guided endonuclease can be operably linked to a promoter control sequence, and optionally, can be part of a vector. In other embodiments, a vector comprising sequence encoding the RNA-guided endonuclease, which can be operably linked to a promoter control sequence, can also comprise sequence encoding a guide RNA, which can be operably linked to a promoter control sequence.
- Another aspect of the present invention encompasses a method for modifying a chromosomal sequence in a eukaryotic cell or embryo. The method comprises introducing into a eukaryotic cell or embryo (i) at least one RNA-guided endonuclease comprising at least one nuclear localization signal or nucleic acid encoding at least one RNA-guided endonuclease as defined herein, (ii) at least one guide RNA or DNA encoding at least one guide RNA, and, optionally, (iii) at least one donor polynucleotide comprising a donor sequence. The method further comprises culturing the cell or embryo such that each guide RNA directs a RNA-guided endonuclease to a targeted site in the chromosomal sequence where the RNA-guided endonuclease introduces a double-stranded break in the targeted site, and the double-stranded break is repaired by a DNA repair process such that the chromosomal sequence is modified. In one embodiment, the RNA-guided endonuclease can be derived from a Cas9 protein. In another embodiment, the nucleic acid encoding the RNA-guided endonuclease introduced into the cell or embryo can be mRNA. In a further embodiment, wherein the nucleic acid encoding the RNA-guided endonuclease introduced into the cell or embryo can be DNA. In a further embodiment, the DNA encoding the RNA-guided endonuclease can be part of a vector that further comprises a sequence encoding the guide RNA. In certain embodiments, the eukaryotic cell can be a human cell, a non-human mammalian cell, a stem cell, a non-mammalian vertebrate cell, an invertebrate cell, a plant cell, or a single cell eukaryotic organism. In certain other embodiments, the embryo is a non-human one cell animal embryo.
- A further aspect of the disclosure provides a fusion protein comprising a CRISPR/Cas-like protein or fragment thereof and an effector domain. In general, the fusion protein comprises at least one nuclear localization signal. The effector domain of the fusion protein can be a cleavage domain, an epigenetic modification domain, a transcriptional activation domain, or a transcriptional repressor domain. In one embodiment, the CRISPR/Cas-like protein of the fusion protein can be derived from a Cas9 protein. In one iteration, the Cas9 protein can be modified to lack at least one functional nuclease domain. In an alternate iteration, the Cas9 protein can be modified to lack all nuclease activity. In one embodiment, the effector domain can be a cleavage domain, such as, for example, a FokI endonuclease domain or a modified FokI endonuclease domain. In another embodiment, one fusion protein can form a dimer with another fusion protein. The dimer can be a homodimer or a heterodimer. In another embodiment, the fusion protein can form a heterodimer with a zinc finger nuclease, wherein the cleavage domain of both the fusion protein and the zinc finger nucleases is a FokI endonuclease domain or a modified FokI endonuclease domain. In still another embodiment, the fusion protein comprises a CRISPR/Cas-like protein derived from a Cas9 protein modified to lack all nuclease activity, and the effector domain is a FokI endonuclease domain or a modified FokI endonuclease domain. In still another embodiment, the fusion protein comprises a CRISPR/Cas-like protein derived from a Cas9 protein modified to lack all nuclease activity, and the effector domain can be an epigenetic modification domain, a transcriptional activation domain, or a transcriptional repressor domain. In additional embodiments, any of the fusion proteins disclosed herein can comprise at least one additional domain chosen from a nuclear localization signal, a cell-penetrating domain, and a marker domain. Also provided are isolated nucleic acids encoding any of the fusion proteins provided herein.
- Still another aspect of the disclosure encompasses a method for modifying a chromosomal sequence or regulating expression of a chromosomal sequence in a cell or embryo. The method comprises introducing into the cell or embryo (a) at least one fusion protein or nucleic acid encoding at least one fusion protein, wherein the fusion protein comprises a CRISPR/Cas-like protein or a fragment thereof and an effector domain, and (b) at least one guide RNA or DNA encoding at least one guide RNA, wherein the guide RNA guides the CRISPR/Cas-like protein of the fusion protein to a targeted site in the chromosomal sequence and the effector domain of the fusion protein modifies the chromosomal sequence or regulates expression of the chromosomal sequence. In one embodiment, the CRISPR/Cas-like protein of the fusion protein can be derived from a Cas9 protein. In another embodiment, the CRISPR/Cas-like protein of the fusion protein can be modified to lack at least one functional nuclease domain. In still another embodiment, the CRISPR/Cas-like protein of the fusion protein can be modified to lack all nuclease activity. In one embodiment in which the fusion protein comprises a Cas9 protein modified to lack all nuclease activity and a FokI cleavage domain or a modified FokI cleavage domain, the method can comprise introducing into the cell or embryo one fusion protein or nucleic acid encoding one fusion protein and two guide RNAs or DNA encoding two guide RNAs, and wherein one double-stranded break is introduced in the chromosomal sequence. In another embodiment in which the fusion protein comprises a Cas9 protein modified to lack all nuclease activity and a FokI cleavage domain or a modified FokI cleavage domain, the method can comprise introducing into the cell or embryo two fusion proteins or nucleic acid encoding two fusion proteins and two guide RNAs or DNA encoding two guide RNAs, and wherein two double-stranded breaks are introduced in the chromosomal sequence. In still another one embodiment in which the fusion protein comprises a Cas9 protein modified to lack all nuclease activity and a FokI cleavage domain or a modified FokI cleavage domain, the method can comprise introducing into the cell or embryo one fusion protein or nucleic acid encoding one fusion protein, one guide RNA or nucleic acid encoding one guide RNA, and one zinc finger nuclease or nucleic acid encoding one zinc finger nuclease, wherein the zinc finger nuclease comprises a FokI cleavage domain or a modified a FokI cleavage domain, and wherein one double-stranded break is introduced into the chromosomal sequence. In certain embodiments in which the fusion protein comprises a cleavage domain, the method can further comprise introducing into the cell or embryo at least one donor polynucleotide. In embodiments in which the fusion protein comprises an effector domain chosen from an epigenetic modification domain, a transcriptional activation domain, or a transcriptional repressor domain, the fusion protein can comprise a Cas9 protein modified to lack all nuclease activity, and the method can comprise introducing into the cell or embryo one fusion protein or nucleic acid encoding one fusion protein, and one guide RNA or nucleic acid encoding one guide RNA, and wherein the structure or expression of the targeted chromosomal sequence is modified. In certain embodiments, the eukaryotic cell can be a human cell, a non-human mammalian cell, a stem cell, a non-mammalian vertebrate cell, an invertebrate cell, a plant cell, or a single cell eukaryotic organism. In certain other embodiments, the embryo is a non-human one cell animal embryo.
- Other aspects and iterations of the disclosure are detailed below.
-
FIG. 1A diagrams genome modification using protein dimers in which a double stranded break created by a dimer composed of two fusion proteins, each of which comprises a Cas-like protein for DNA binding and a FokI cleavage domain.FIG. 1B depicts a double stranded break created by a dimer composed of a fusion protein comprising a Cas-like protein and a FokI cleavage domain and a zinc finger nuclease comprising a zinc finger (ZF) DNA-binding domain and a FokI cleavage domain. -
FIG. 2A illustrates regulation of gene expression using RNA-guided fusion proteins comprising a Cas-like protein used for DNA binding and an “A/R” domain that activates or represses gene expression.FIG. 2B diagrams a fusion protein comprising a Cas-like protein for DNA binding and a epigenetic modification domain (“Epi-mod”) that affects epigenetic states by covalent modification of proximal DNA or proteins. -
FIG. 3A diagrams a double stranded break created by two RNA-guided endonuclease that have been converted into nickases.FIG. 3B depicts two double stranded breaks created by two RNA-guided endonuclease having endonuclease activity. -
FIG. 4A-F present fluorescence-activated cell sorting (FACS) of human K562 cells transfected with Cas9 nucleic acid, Cas9 guiding RNA, and AAVS1-GFP DNA donor. The Y axis represents the auto fluorescence intensity at a red channel, and the X axis represents the green fluorescence intensity.FIG. 4A presents K562 cells transfected with 10 μg of Cas9 mRNA transcribed with an Anti-Reverse Cap Analog, 0.3 nmol of pre-annealed crRNA-tracrRNA duplex, and 10 μg of AAVS1-GFP plasmid DNA;FIG. 4B depicts K562 cells transfected 10 μg of Cas9 mRNA transcribed with an Anti-Reverse Cap Analog, 0.3 nmol of chimeric RNA, and 10 μg of AAVS1-GFP plasmid DNA;FIG. 4C shows K562 cells transfected 10 μg of Cas9 mRNA that was capped by post-transcription capping reaction, 0.3 nmol of chimeric RNA, and 10 μg of AAVS1-GFP plasmid DNA;FIG. 4D presents K562 cells transfected with 10 μg of Cas9 plasmid DNA, 5 μg of U6-chimeric RNA plasmid DNA, and 10 μg of AAVS1-GFP plasmid DNA;FIG. 4E shows K562 cells transfected with 10 μg of AAVS1-GFP plasmid DNA; andFIG. 4F presents K562 cells transfected with transfection reagents only. -
FIG. 5 presents a junction PCR analysis documenting the targeted integration of GFP into the AAVS1 locus in human cells. Lane M: 1 kb DNA molecular markers; Lane A: K562 cells transfected with 10 μg of Cas9 mRNA transcribed with an Anti-Reverse Cap Analog, 0.3 nmol of pre-annealed crRNA-tracrRNA duplex, and 10 μg of AAVS1-GFP plasmid DNA; Lane B: K562 cells transfected 10 μg of Cas9 mRNA transcribed with an Anti-Reverse Cap Analog, 0.3 nmol of chimeric RNA, and 10 μg of AAVS1-GFP plasmid DNA; Lane C: K562 cells transfected 10 μg of Cas9 mRNA that was capped by post-transcription capping reaction, 0.3 nmol of chimeric RNA, and 10 μg of AAVS1-GFP plasmid DNA; Lane D: K562 cells transfected with 10 μg of Cas9 plasmid DNA, 5 μg of U6-chimeric RNA plasmid DNA, and 10 μg of AAVS1-GFP plasmid DNA; Lane E: K562 cells transfected with 10 μg of AAVS1-GFP plasmid DNA; Lane F: K562 cells transfected with transfection reagents only. - Provided herein are RNA-guided endonucleases, which comprise at least one nuclear localization signal, at least one nuclease domain, and at least one domain that interacts with a guide RNA to target the endonuclease to a specific nucleotide sequence for cleavage. Also provided are nucleic acids encoding the RNA-guided endonucleases, as well as methods of using the RNA-guided endonucleases to modify chromosomal sequences of eukaryotic cells or embryos. The RNA-guided endonuclease interacts with specific guide RNAs, each of which directs the endonuclease to a specific targeted site, at which site the RNA-guided endonuclease introduces a double-stranded break that can be repaired by a DNA repair process such that the chromosomal sequence is modified. Since the specificity is provided by the guide RNA, the RNA-based endonuclease is universal and can be used with different guide RNAs to target different genomic sequences. The methods disclosed herein can be used to target and modify specific chromosomal sequences and/or introduce exogenous sequences at targeted locations in the genome of cells or embryos. Furthermore, the targeting is specific with limited off target effects.
- The present disclosure provides fusion proteins, wherein a fusion protein comprises a CRISPR/Cas-like protein or fragment thereof and an effector domain. Suitable effector domains include, without limit, cleavage domains, epigenetic modification domains, transcriptional activation domains, and transcriptional repressor domains. Each fusion protein is guided to a specific chromosomal sequence by a specific guide RNA, wherein the effector domain mediates targeted genome modification or gene regulation. In one aspect, the fusion proteins can function as dimers thereby increasing the length of the target site and increasing the likelihood of its uniqueness in the genome (thus, reducing off target effects). For example, endogenous CRISPR systems modify genomic locations based on DNA binding word lengths of approximately 13-20 bp (Cong et al., Science, 339:819-823). At this word size, only 5-7% of the target sites are unique within the genome (Iseli et al, PLos One 2(6):e579). In contrast, DNA binding word sizes for zinc finger nucleases typically range from 30-36 bp, resulting in target sites that are approximately 85-87% unique within the human genome. The smaller sized DNA binding sites utilized by CRISPR-based systems limits and complicates design of targeted CRISP-based nucleases near desired locations, such as disease SNPs, small exons, start codons, and stop codons, as well as other locations within complex genomes. The present disclosure not only provides means for expanding the CRISPR DNA binding word length (i.e., so as to limit off-target activity), but further provides CRISPR fusion proteins having modified functionality. According, the disclosed CRISPR fusion proteins have increased target specificity and unique functionality(ies). Also provided herein are methods of using the fusion proteins to modify or regulate expression of targeted chromosomal sequences.
- One aspect of the present disclosure provides RNA-guided endonucleases comprising at least one nuclear localization signal, which permits entry of the endonuclease into the nuclei of eukaryotic cells and embryos such as, for example, non-human one cell embryos. RNA-guided endonucleases also comprise at least one nuclease domain and at least one domain that interacts with a guide RNA. An RNA-guided endonuclease is directed to a specific nucleic acid sequence (or target site) by a guide RNA. The guide RNA interacts with the RNA-guided endonuclease as well as the target site such that, once directed to the target site, the RNA-guided endonuclease is able to introduce a double-stranded break into the target site nucleic acid sequence. Since the guide RNA provides the specificity for the targeted cleavage, the endonuclease of the RNA-guided endonuclease is universal and can be used with different guide RNAs to cleave different target nucleic acid sequences. Provided herein are isolated RNA-guided endonucleases, isolated nucleic acids (i.e., RNA or DNA) encoding the RNA-guided endonucleases, vectors comprising nucleic acids encoding the RNA-guided endonucleases, and protein-RNA complexes comprising the RNA-guided endonuclease plus a guide RNA.
- The RNA-guided endonuclease can be derived from a clustered regularly interspersed short palindromic repeats (CRISPR)/CRISPR-associated (Cas) system. The CRISPR/Cas system can be a type I, a type II, or a type III system. Non-limiting examples of suitable CRISPR/Cas proteins include Cas3, Cas4, Cas5, Cas5e (or CasD), Cas6, Cas6e, Cas6f, Cas7, Cas8a1, Cas8a2, Cas8b, Cas8c, Cas9, Cas10, Cas10d, CasF, CasG, CasH, Csy1, Csy2, Csy3, Cse1 (or CasA), Cse2 (or CasB), Cse3 (or CasE), Cse4 (or CasC), Csc1, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmr1, Cmr3, Cmr4, Cmr5, Cmr6, Csb1, Csb2, Csb3, Csx17, Csx14, Csx10, Csx16, CsaX, Csx3, Csz1, Csx15, Csf1, Csf2, Csf3, Csf4, and Cu1966.
- In one embodiment, the RNA-guided endonuclease is derived from a type II CRISPR/Cas system. In specific embodiments, the RNA-guided endonuclease is derived from a Cas9 protein. The Cas9 protein can be from Streptococcus pyogenes, Streptococcus thermophilus, Streptococcus sp., Nocardiopsis dassonvillei, Streptomyces pristinaespiralis, Streptomyces viridochromogenes, Streptomyces viridochromogenes, Streptosporangium roseum, Streptosporangium roseum, Alicyclobacillus acidocaldarius, Bacillus pseudomycoides, Bacillus selenitireducens, Exiguobacterium sibiricum, Lactobacillus delbrueckii, Lactobacillus salivarius, Microscilla marina, Burkholderiales bacterium, Polaromonas naphthalenivorans, Polaromonas sp., Crocosphaera watsonii, Cyanothece sp., Microcystis aeruginosa, Synechococcus sp., Acetohalobium arabaticum, Ammonifex degensii, Caldicelulosiruptor becscii, Candidatus Desulforudis, Clostridium botulinum, Clostridium difficile, Finegoldia magna, Natranaerobius thermophilus, Pelotomaculum the rmopropionicum, Acidithiobacillus caldus, Acidithiobacillus ferrooxidans, Allochromatium vinosum, Marinobacter sp., Nitrosococcus halophilus, Nitrosococcus watsoni, Pseudoalteromonas haloplanktis, Ktedonobacter racemifer, Methanohalobium evestigatum, Anabaena variabilis, Nodularia spumigena, Nostoc sp., Arthrospira maxima, Arthrospira platensis, Arthrospira sp., Lyngbya sp., Microcoleus chthonoplastes, Oscillatoria sp., Petrotoga mobilis, Thermosipho africanus, or Acaryochloris marina.
- In general, CRISPR/Cas proteins comprise at least one RNA recognition and/or RNA binding domain. RNA recognition and/or RNA binding domains interact with guide RNAs. CRISPR/Cas proteins can also comprise nuclease domains (i.e., DNase or RNase domains), DNA binding domains, helicase domains, RNAse domains, protein-protein interaction domains, dimerization domains, as well as other domains.
- The CRISPR/Cas-like protein can be a wild type CRISPR/Cas protein, a modified CRISPR/Cas protein, or a fragment of a wild type or modified CRISPR/Cas protein. The CRISPR/Cas-like protein can be modified to increase nucleic acid binding affinity and/or specificity, alter an enzymatic activity, and/or change another property of the protein. For example, nuclease (i.e., DNase, RNase) domains of the CRISPR/Cas-like protein can be modified, deleted, or inactivated. Alternatively, the CRISPR/Cas-like protein can be truncated to remove domains that are not essential for the function of the fusion protein. The CRISPR/Cas-like protein can also be truncated or modified to optimize the activity of the effector domain of the fusion protein.
- In some embodiments, the CRISPR/Cas-like protein can be derived from a wild type Cas9 protein or fragment thereof. In other embodiments, the CRISPR/Cas-like protein can be derived from modified Cas9 protein. For example, the amino acid sequence of the Cas9 protein can be modified to alter one or more properties (e.g., nuclease activity, affinity, stability, etc.) of the protein. Alternatively, domains of the Cas9 protein not involved in RNA-guided cleavage can be eliminated from the protein such that the modified Cas9 protein is smaller than the wild type Cas9 protein.
- In general, a Cas9 protein comprises at least two nuclease (i.e., DNase) domains. For example, a Cas9 protein can comprise a RuvC-like nuclease domain and a HNH-like nuclease domain. The RuvC and HNH domains work together to cut single strands to make a double-stranded break in DNA. (Jinek et al., Science, 337: 816-821). In some embodiments, the Cas9-derived protein can be modified to contain only one functional nuclease domain (either a RuvC-like or a HNH-like nuclease domain). For example, the Cas9-derived protein can be modified such that one of the nuclease domains is deleted or mutated such that it is no longer functional (i.e., the nuclease activity is absent). In some embodiments in which one of the nuclease domains is inactive, the Cas9-derived protein is able to introduce a nick into a double-stranded nucleic acid (such protein is termed a “nickase”), but not cleave the double-stranded DNA. For example, an aspartate to alanine (D10A) conversion in a RuvC-like domain converts the Cas9-derived protein into a nickase. Likewise, a histidine to alanine (H840A or H839A) conversion in a HNH domain converts the Cas9-derived protein into a nickase. Each nuclease domain can be modified using well-known methods, such as site-directed mutagenesis, PCR-mediated mutagenesis, and total gene synthesis, as well as other methods known in the art.
- The RNA-guided endonuclease disclosed herein comprises at least one nuclear localization signal. In general, an NLS comprises a stretch of basic amino acids. Nuclear localization signals are known in the art (see, e.g., Lange et al., J. Biol. Chem., 2007, 282:5101-5105). For example, in one embodiment, the NLS can be a monopartite sequence, such as PKKKRKV (SEQ ID NO:1) or PKKKRRV (SEQ ID NO:2). In another embodiment, the NLS can be a bipartite sequence. In still another embodiment, the NLS can be KRPAATKKAGQAKKKK (SEQ ID NO:3). The NLS can be located at the N-terminus, the C-terminal, or in an internal location of the RNA-guided endonuclease.
- In some embodiments, the RNA-guided endonuclease can further comprise at least one cell-penetrating domain. In one embodiment, the cell-penetrating domain can be a cell-penetrating peptide sequence derived from the HIV-1 TAT protein. As an example, the TAT cell-penetrating sequence can be GRKKRRQRRRPPQPKKKRKV (SEQ ID NO:4). In another embodiment, the cell-penetrating domain can be TLM (PLSSIFSRIGDPPKKKRKV; SEQ ID NO:5), a cell-penetrating peptide sequence derived from the human hepatitis B virus. In still another embodiment, the cell-penetrating domain can be MPG (GALFLGWLGAAGSTMGAPKKKRKV; SEQ ID NO:6 or GALFLGFLGAAGSTMGAWSQPKKKRKV; SEQ ID NO:7). In an additional embodiment, the cell-penetrating domain can be Pep-1 (KETWWETWWTEWSQPKKKRKV; SEQ ID NO:8), VP22, a cell penetrating peptide from Herpes simplex virus, or a polyarginine peptide sequence. The cell-penetrating domain can be located at the N-terminus, the C-terminus, or in an internal location of the protein.
- In still other embodiments, the RNA-guided endonuclease can also comprise at least one marker domain. Non-limiting examples of marker domains include fluorescent proteins, purification tags, and epitope tags. In some embodiments, the marker domain can be a fluorescent protein. Non limiting examples of suitable fluorescent proteins include green fluorescent proteins (e.g., GFP, GFP-2, tagGFP, turboGFP, EGFP, Emerald, Azami Green, Monomeric Azami Green, CopGFP, AceGFP, ZsGreen1), yellow fluorescent proteins (e.g. YFP, EYFP, Citrine, Venus, YPet, PhiYFP, ZsYellow1,), blue fluorescent proteins (e.g. EBFP, EBFP2, Azurite, mKalama1, GFPuv, Sapphire, T-sapphire,), cyan fluorescent proteins (e.g. ECFP, Cerulean, CyPet, AmCyan1, Midoriishi-Cyan), red fluorescent proteins (mKate, mKate2, mPlum, DsRed monomer, mCherry, mRFP1, DsRed-Express, DsRed2, DsRed-Monomer, HcRed-Tandem, HcRed1, AsRed2, eqFP611, mRasberry, mStrawberry, Jred), and orange fluorescent proteins (mOrange, mKO, Kusabira-Orange, Monomeric Kusabira-Orange, mTangerine, tdTomato) or any other suitable fluorescent protein. In other embodiments, the marker domain can be a purification tag and/or an epitope tag. Exemplary tags include, but are not limited to, glutathione-S-transferase (GST), chitin binding protein (CBP), maltose binding protein, thioredoxin (TRX), poly(NANP), tandem affinity purification (TAP) tag, myc, AcV5, AU1, AU5, E, ECS, E2, FLAG, HA, nus, Softag 1,
Softag 3, Strep, SBP, Glu-Glu, HSV, KT3, S, 51, T7, V5, VSV-G, 6×His, biotin carboxyl carrier protein (BCCP), and calmodulin. - In certain embodiments, the RNA-guided endonuclease may be part of a protein-RNA complex comprising a guide RNA. The guide RNA interacts with the RNA-guided endonuclease to direct the endonuclease to a specific target site, wherein the 5′ end of the guide RNA base pairs with a specific protospacer sequence.
- Another aspect of the present disclosure provides a fusion protein comprising a CRISPR/Cas-like protein or fragment thereof and an effector domain. The CRISPR/Cas-like protein is directed to a target site by a guide RNA, at which site the effector domain can modify or effect the targeted nucleic acid sequence. The effector domain can be a cleavage domain, an epigenetic modification domain, a transcriptional activation domain, or a transcriptional repressor domain. The fusion protein can further comprise at least one additional domain chosen from a nuclear localization signal, a cell-penetrating domain, or a marker domain.
- (a) CRISPR/Cas-Like Protein
- The fusion protein comprises a CRISPR/Cas-like protein or a fragment thereof. CRISPR/Cas-like proteins are detailed above in section (I). The CRISPR/Cas-like protein can be located at the N-terminus, the C-terminus, or in an internal location of the fusion protein
- In some embodiments, the CRISPR/Cas-like protein of the fusion protein can be derived from a Cas9 protein. The Cas9-derived protein can be wild type, modified, or a fragment thereof. In some embodiments, the Cas9-derived protein can be modified to contain only one functional nuclease domain (either a RuvC-like or a HNH-like nuclease domain). For example, the Cas9-derived protein can be modified such that one of the nuclease domains is deleted or mutated such that it is no longer functional (i.e., the nuclease activity is absent). In some embodiments in which one of the nuclease domains is inactive, the Cas9-derived protein is able to introduce a nick into a double-stranded nucleic acid (such protein is termed a “nickase”), but not cleave the double-stranded DNA. For example, an aspartate to alanine (D10A) conversion in a RuvC-like domain converts the Cas9-derived protein into a nickase. Likewise, a histidine to alanine (H840A or H839A) conversion in a HNH domain converts the Cas9-derived protein into a nickase. In other embodiments, both of the RuvC-like nuclease domain and the HNH-like nuclease domain can be modified or eliminated such that the Cas9-derived protein is unable to nick or cleave double stranded nucleic acid. In still other embodiments, all nuclease domains of the Cas9-derived protein can be modified or eliminated such that the Cas9-derived protein lacks all nuclease activity.
- In any of the above-described embodiments, any or all of the nuclease domains can be inactivated by one or more deletion mutations, insertion mutations, and/or substitution mutations using well-known methods, such as site-directed mutagenesis, PCR-mediated mutagenesis, and total gene synthesis, as well as other methods known in the art. In an exemplary embodiment, the CRISPR/Cas-like protein of the fusion protein is derived from a Cas9 protein in which all the nuclease domains have been inactivated or deleted.
- (b) Effector Domain
- The fusion protein also comprises an effector domain. The effector domain can be a cleavage domain, an epigenetic modification domain, a transcriptional activation domain, or a transcriptional repressor domain. The effector domain can be located at the N-terminus, the C-terminus, or in an internal location of the fusion protein.
- (i) Cleavage Domain
- In some embodiments, the effector domain is a cleavage domain. As used herein, a “cleavage domain” refers to a domain that cleaves DNA. The cleavage domain can be obtained from any endonuclease or exonuclease. Non-limiting examples of endonucleases from which a cleavage domain can be derived include, but are not limited to, restriction endonucleases and homing endonucleases. See, for example, New England Biolabs Catalog or Belfort et al. (1997) Nucleic Acids Res. 25:3379-3388. Additional enzymes that cleave DNA are known (e.g., 51 Nuclease; mung bean nuclease; pancreatic DNase I; micrococcal nuclease; yeast HO endonuclease). See also Linn et al. (eds.) Nucleases, Cold Spring Harbor Laboratory Press, 1993. One or more of these enzymes (or functional fragments thereof) can be used as a source of cleavage domains.
- In some embodiments, the cleavage domain can be derived from a type II-S endonuclease. Type II-S endonucleases cleave DNA at sites that are typically several base pairs away the recognition site and, as such, have separable recognition and cleavage domains. These enzymes generally are monomers that transiently associate to form dimers to cleave each strand of DNA at staggered locations. Non-limiting examples of suitable type II-S endonucleases include BfiI, BpmI, BsaI, BsgI, BsmBI, BsmI, BspMI, FokI, MboII, and SapI. In exemplary embodiments, the cleavage domain of the fusion protein is a FokI cleavage domain or a derivative thereof.
- In certain embodiments, the type II-S cleavage can be modified to facilitate dimerization of two different cleavage domains (each of which is attached to a CRISPR/Cas-like protein or fragment thereof). For example, the cleavage domain of FokI can be modified by mutating certain amino acid residues. By way of non-limiting example, amino acid residues at positions 446, 447, 479, 483, 484, 486, 487, 490, 491, 496, 498, 499, 500, 531, 534, 537, and 538 of FokI cleavage domains are targets for modification. For example, modified cleavage domains of FokI that form obligate heterodimers include a pair in which a first modified cleavage domain includes mutations at amino acid positions 490 and 538 and a second modified cleavage domain that includes mutations at amino acid positions 486 and 499 (Miller et al., 2007, Nat. Biotechnol, 25:778-785; Szczpek et al., 2007, Nat. Biotechnol, 25:786-793). For example, the Glu (E) at position 490 can be changed to Lys (K) and the Ile (I) at position 538 can be changed to K in one domain (E490K, I538K), and the Gln (Q) at position 486 can be changed to E and the I at position 499 can be changed to Leu (L) in another cleavage domain (Q486E, I499L). In other embodiments, modified FokI cleavage domains can include three amino acid changes (Doyon et al. 2011, Nat. Methods, 8:74-81). For example, one modified FokI domain (which is termed ELD) can comprise Q486E, I499L, N496D mutations and the other modified FokI domain (which is termed KKR) can comprise E490K, I538K, H537R mutations.
- In exemplary embodiments, the effector domain of the fusion protein is a FokI cleavage domain or a modified FokI cleavage domain.
- In embodiments wherein the effector domain is a cleavage domain and the CRISPR/Cas-like protein is derived from a Cas9 protein, the Cas9-derived can be modified as discussed herein such that its endonuclease activity is eliminated. For example, the Cas9-derived can be modified by mutating the RuvC and HNH domains such that they no longer possess nuclease activity.
- (ii) Epigenetic Modification Domain
- In other embodiments, the effector domain of the fusion protein can be an epigenetic modification domain. In general, epigenetic modification domains alter histone structure and/or chromosomal structure without altering the DNA sequence. Changes histone and/or chromatin structure can lead to changes in gene expression. Examples of epigenetic modification include, without limit, acetylation or methylation of lysine residues in histone proteins, and methylation of cytosine residues in DNA. Non-limiting examples of suitable epigenetic modification domains include histone acetyltansferase domains, histone deacetylase domains, histone methyltransferase domains, histone demethylase domains, DNA methyltransferase domains, and DNA demethylase domains.
- In embodiments in which the effector domain is a histone acetyltansferase (HAT) domain, the HAT domain can be derived from EP300 (i.e., E1A binding protein p300), CREBBP (i.e., CREB-binding protein), CDY1, CDY2, CDYL1, CLOCK, ELP3, ESA1, GCN5 (KAT2A), HAT1, KAT2B, KAT5, MYST1, MYST2, MYST3, MYST4, NCOA1, NCOA2, NCOA3, NCOAT, P/CAF, Tip60, TAFII250, or TF3C4. In one such embodiment, the HAT domain is p300
- In embodiments wherein the effector domain is an epigenetic modification domain and the CRISPR/Cas-like protein is derived from a Cas9 protein, the Cas9-derived can be modified as discussed herein such that its endonuclease activity is eliminated. For example, the Cas9-derived can be modified by mutating the RuvC and HNH domains such that they no longer possess nuclease activity.
- (iii) Transcriptional Activation Domain
- In other embodiments, the effector domain of the fusion protein can be a transcriptional activation domain. In general, a transcriptional activation domain interacts with transcriptional control elements and/or transcriptional regulatory proteins (i.e., transcription factors, RNA polymerases, etc.) to increase and/or activate transcription of a gene. In some embodiments, the transcriptional activation domain can be, without limit, a herpes simplex virus VP16 activation domain, VP64 (which is a tetrameric derivative of VP16), a NFκB p65 activation domain,
p53 activation domains 1 and 2, a CREB (cAMP response element binding protein) activation domain, an E2A activation domain, and an NFAT (nuclear factor of activated T-cells) activation domain. In other embodiments, the transcriptional activation domain can be Gal4, Gcn4, MLL, Rtg3, Gln3, Oaf1, Pip2, Pdr1, Pdr3, Pho4, and Leu3. The transcriptional activation domain may be wild type, or it may be a modified version of the original transcriptional activation domain. In some embodiments, the effector domain of the fusion protein is a VP16 or VP64 transcriptional activation domain. - In embodiments wherein the effector domain is a transcriptional activation domain and the CRISPR/Cas-like protein is derived from a Cas9 protein, the Cas9-derived protein can be modified as discussed herein such that its endonuclease activity is eliminated. For example, the Cas9-derived can be modified by mutating the RuvC and HNH domains such that they no longer possess nuclease activity.
- (iv) Transcriptional Repressor Domain
- In still other embodiments, the effector domain of the fusion protein can be a transcriptional repressor domain. In general, a transcriptional repressor domain interacts with transcriptional control elements and/or transcriptional regulatory proteins (i.e., transcription factors, RNA polymerases, etc.) to decrease and/or terminate transcription of a gene. Non-limiting examples of suitable transcriptional repressor domains include inducible cAMP early repressor (ICER) domains, Kruppel-associated box A (KRAB-A) repressor domains, YY1 glycine rich repressor domains, Sp1-like repressors, E(spl) repressors, IκB repressor, and MeCP2.
- In embodiments wherein the effector domain is a transcriptional repressor domain and the CRISPR/Cas-like protein is derived from a Cas9 protein, the Cas9-derived protein can be modified as discussed herein such that its endonuclease activity is eliminated. For example, the cas9 can be modified by mutating the RuvC and HNH domains such that they no longer possess nuclease activity.
- (c) Additional Domains
- In some embodiments, the fusion protein further comprises at least one additional domain. Non-limiting examples of suitable additional domains include nuclear localization signals, cell-penetrating or translocation domains, and marker domains. Non-limiting examples of suitable nuclear localization signals, cell-penetrating domains, and marker domains are presented above in section (I).
- (d) Fusion Protein Dimers
- In embodiments in which the effector domain of the fusion protein is a cleavage domain, a dimer comprising at least one fusion protein can form. The dimer can be a homodimer or a heterodimer. In some embodiments, the heterodimer comprises two different fusion proteins. In other embodiments, the heterodimer comprises one fusion protein and an additional protein.
- In some embodiments, the dimer is a homodimer in which the two fusion protein monomers are identical with respect to the primary amino acid sequence. In one embodiment where the dimer is a homodimer, the Cas9-derived proteins are modified such that their endonuclease activity is eliminated, i.e., such that they have no functional nuclease domains. In certain embodiments wherein the Cas9-derived proteins are modified such that their endonuclease activity is eliminated, each fusion protein monomer comprises an identical Cas9 like protein and an identical cleavage domain. The cleavage domain can be any cleavage domain, such as any of the exemplary cleavage domains provided herein. In one specific embodiment, the cleavage domain is a FokI cleavage domain or a modified FokI cleavage domain. In such embodiments, specific guide RNAs would direct the fusion protein monomers to different but closely adjacent sites such that, upon dimer formation, the nuclease domains of the two monomers would create a double stranded break in the target DNA.
- In other embodiments, the dimer is a heterodimer of two different fusion proteins. For example, the CRISPR/Cas-like protein of each fusion protein can be derived from a different CRISPR/Cas protein or from an orthologous CRISPR/Cas protein from a different bacterial species. For example, each fusion protein can comprise a Cas9-like protein, which Cas9-like protein is derived from a different bacterial species. In these embodiments, each fusion protein would recognize a different target site (i.e., specified by the protospacer and/or PAM sequence). For example, the guide RNAs could position the heterodimer to different but closely adjacent sites such that their nuclease domains results in an effective double stranded break in the target DNA. The heterodimer can also have modified Cas9 proteins with nicking activity such that the nicking locations are different.
- Alternatively, two fusion proteins of a heterodimer can have different effector domains. In embodiments in which the effector domain is a cleavage domain, each fusion protein can contain a different modified cleavage domain. For example, each fusion protein can contain a different modified FokI cleavage domain, as detailed above in section (II)(b)(i). In these embodiments, the Cas-9 proteins can be modified such that their endonuclease activities are eliminated.
- As will be appreciated by those skilled in the art, the two fusion proteins forming a heterodimer can differ in both the CRISPR/Cas-like protein domain and the effector domain.
- In any of the above-described embodiments, the homodimer or heterodimer can comprise at least one additional domain chosen from nuclear localization signals (NLSs), cell-penetrating, translocation domains and marker domains, as detailed above.
- In any of the above-described embodiments, one or both of the Cas9-derived proteins can be modified such that its endonuclease activity is eliminated or modified.
- In still alternate embodiments, the heterodimer comprises one fusion protein and an additional protein. For example, the additional protein can be a nuclease. In one embodiment, the nuclease is a zinc finger nuclease. A zinc finger nuclease comprises a zinc finger DNA binding domain and a cleavage domain. A zinc finger recognizes and binds three (3) nucleotides. A zinc finger DNA binding domain can comprise from about three zinc fingers to about seven zinc fingers. The zinc finger DNA binding domain can be derived from a naturally occurring protein or it can be engineered. See, for example, Beerli et al. (2002) Nat. Biotechnol. 20:135-141; Pabo et al. (2001) Ann. Rev. Biochem. 70:313-340; Isalan et al. (2001) Nat. Biotechnol. 19:656-660; Segal et al. (2001) Curr. Opin. Biotechnol. 12:632-637; Choo et al. (2000) Curr. Opin. Struct. Biol. 10:411-416; Zhang et al. (2000) J. Biol. Chem. 275(43):33850-33860; Doyon et al. (2008) Nat. Biotechnol. 26:702-708; and Santiago et al. (2008) Proc. Natl. Acad. Sci. USA 105:5809-5814. The cleavage domain of the zinc finger nuclease can be any cleavage domain detailed above in section (II)(b)(i). In exemplary embodiments, the cleavage domain of the zinc finger nuclease is a FokI cleavage domain or a modified FokI cleavage domain. Such a zinc finger nuclease will dimerize with a fusion protein comprising a FokI cleavage domain or a modified FokI cleavage domain.
- In some embodiments, the zinc finger nuclease can comprise at least one additional domain chosen from nuclear localization signals, cell-penetrating or translocation domains, which are detailed above.
- In certain embodiments, any of the fusion protein detailed above or a dimer comprising at least one fusion protein may be part of a protein-RNA complex comprising at least one guide RNA. A guide RNA interacts with the CRISPR-Cas0 like protein of the fusion protein to direct the fusion protein to a specific target site, wherein the 5′ end of the guide RNA base pairs with a specific protospacer sequence.
- Another aspect of the present disclosure provides nucleic acids encoding any of the RNA-guided endonucleases or fusion proteins described above in sections (I) and (II), respectively. The nucleic acid can be RNA or DNA. In one embodiment, the nucleic acid encoding the RNA-guided endonuclease or fusion protein is mRNA. The mRNA can be 5′ capped and/or 3′ polyadenylated. In another embodiment, the nucleic acid encoding the RNA-guided endonuclease or fusion protein is DNA. The DNA can be present in a vector (see below).
- The nucleic acid encoding the RNA-guided endonuclease or fusion protein can be codon optimized for efficient translation into protein in the eukaryotic cell or animal of interest. For example, codons can be optimized for expression in humans, mice, rats, hamsters, cows, pigs, cats, dogs, fish, amphibians, plants, yeast, insects, and so forth. Programs for codon optimization are available as freeware. Commercial codon optimization programs are also available.
- In some embodiments, DNA encoding the RNA-guided endonuclease or fusion protein can be operably linked to at least one promoter control sequence. In some iterations, the DNA coding sequence can be operably linked to a promoter control sequence for expression in the eukaryotic cell or animal of interest. The promoter control sequence can be constitutive, regulated, or tissue-specific. Suitable constitutive promoter control sequences include, but are not limited to, cytomegalovirus immediate early promoter (CMV), simian virus (SV40) promoter, adenovirus major late promoter, Rous sarcoma virus (RSV) promoter, mouse mammary tumor virus (MMTV) promoter, phosphoglycerate kinase (PGK) promoter, elongation factor (ED1)-alpha promoter, ubiquitin promoters, actin promoters, tubulin promoters, immunoglobulin promoters, fragments thereof, or combinations of any of the foregoing. Examples of suitable regulated promoter control sequences include without limit those regulated by heat shock, metals, steroids, antibiotics, or alcohol. Non-limiting examples of tissue-specific promoters include B29 promoter, CD14 promoter, CD43 promoter, CD45 promoter, CD68 promoter, desmin promoter, elastase-1 promoter, endoglin promoter, fibronectin promoter, Flt-1 promoter, GFAP promoter, GPIIb promoter, ICAM-2 promoter, INF-β promoter, Mb promoter, Nphsl promoter, OG-2 promoter, SP-B promoter, SYN1 promoter, and WASP promoter. The promoter sequence can be wild type or it can be modified for more efficient or efficacious expression. In one exemplary embodiment, the encoding DNA can be operably linked to a CMV promoter for constitutive expression in mammalian cells.
- In certain embodiments, the sequence encoding the RNA-guided endonuclease or fusion protein can be operably linked to a promoter sequence that is recognized by a phage RNA polymerase for in vitro mRNA synthesis. In such embodiments, the in vitro-transcribed RNA can be purified for use in the methods detailed below in sections (IV) and (V). For example, the promoter sequence can be a T7, T3, or SP6 promoter sequence or a variation of a T7, T3, or SP6 promoter sequence. In an exemplary embodiment, the DNA encoding the fusion protein is operably linked to a T7 promoter for in vitro mRNA synthesis using T7 RNA polymerase.
- In alternate embodiments, the sequence encoding the RNA-guided endonuclease or fusion protein can be operably linked to a promoter sequence for in vitro expression of the RNA-guided endonuclease or fusion protein in bacterial or eukaryotic cells. In such embodiments, the expressed protein can be purified for use in the methods detailed below in sections (IV) and (V). Suitable bacterial promoters include, without limit, T7 promoters, lac operon promoters, trp promoters, variations thereof, and combinations thereof. An exemplary bacterial promoter is tac which is a hybrid of trp and lac promoters. Non-limiting examples of suitable eukaryotic promoters are listed above.
- In additional aspects, the DNA encoding the RNA-guided endonuclease or fusion protein also can be linked to a polyadenylation signal (e.g., SV40 polyA signal, bovine growth hormone (BGH) polyA signal, etc.) and/or at least one transcriptional termination sequence. Additionally, the sequence encoding the RNA-guided endonuclease or fusion protein also can be linked to sequence encoding at least one nuclear localization signal, at least one cell-penetrating domain, and/or at least one marker domain, which are detailed above in section (I).
- In various embodiments, the DNA encoding the RNA-guided endonuclease or fusion protein can be present in a vector. Suitable vectors include plasmid vectors, phagemids, cosmids, artificial/mini-chromosomes, transposons, and viral vectors (e.g., lentiviral vectors, adeno-associated viral vectors, etc.). In one embodiment, the DNA encoding the RNA-guided endonuclease or fusion protein is present in a plasmid vector. Non-limiting examples of suitable plasmid vectors include pUC, pBR322, pET, pBluescript, and variants thereof. The vector can comprise additional expression control sequences (e.g., enhancer sequences, Kozak sequences, polyadenylation sequences, transcriptional termination sequences, etc.), selectable marker sequences (e.g., antibiotic resistance genes), origins of replication, and the like. Additional information can be found in “Current Protocols in Molecular Biology” Ausubel et al., John Wiley & Sons, New York, 2003 or “Molecular Cloning: A Laboratory Manual” Sambrook & Russell, Cold Spring Harbor Press, Cold Spring Harbor, N.Y., 3rd edition, 2001.
- In some embodiments, the expression vector comprising the sequence encoding the RNA-guided endonuclease or fusion protein can further comprise sequence encoding a guide RNA. The sequence encoding the guide RNA generally is operably linked to at least one transcriptional control sequence for expression of the guide RNA in the cell or embryo of interest. For example, DNA encoding the guide RNA can be operably linked to a promoter sequence that is recognized by RNA polymerase III (Pol III). Examples of suitable Pol III promoters include, but are not limited to, mammalian U6, U3, H1, and 7SL RNA promoters.
- Another aspect of the present disclosure encompasses a method for modifying a chromosomal sequence in a eukaryotic cell or embryo. The method comprises introducing into a eukaryotic cell or embryo (i) at least one RNA-guided endonuclease comprising at least one nuclear localization signal or nucleic acid encoding at least one RNA-guided endonuclease comprising at least one nuclear localization signal, (ii) at least one guide RNA or DNA encoding at least one guide RNA, and, optionally, (iii) at least one donor polynucleotide comprising a donor sequence. The method further comprises culturing the cell or embryo such that each guide RNA directs an RNA-guided endonuclease to a targeted site in the chromosomal sequence where the RNA-guided endonuclease introduces a double-stranded break in the targeted site, and the double-stranded break is repaired by a DNA repair process such that the chromosomal sequence is modified.
- In some embodiments, the method can comprise introducing one RNA-guided endonuclease (or encoding nucleic acid) and one guide RNA (or encoding DNA) into a cell or embryo, wherein the RNA-guided endonuclease introduces one double-stranded break in the targeted chromosomal sequence. In embodiments in which the optional donor polynucleotide is not present, the double-stranded break in the chromosomal sequence can be repaired by a non-homologous end-joining (NHEJ) repair process. Because NHEJ is error-prone, deletions of at least one nucleotide, insertions of at least one nucleotide, substitutions of at least one nucleotide, or combinations thereof can occur during the repair of the break. Accordingly, the targeted chromosomal sequence can be modified or inactivated. For example, a single nucleotide change (SNP) can give rise to an altered protein product, or a shift in the reading frame of a coding sequence can inactivate or “knock out” the sequence such that no protein product is made. In embodiments in which the optional donor polynucleotide is present, the donor sequence in the donor polynucleotide can be exchanged with or integrated into the chromosomal sequence at the targeted site during repair of the double-stranded break. For example, in embodiments in which the donor sequence is flanked by upstream and downstream sequences having substantial sequence identity with upstream and downstream sequences, respectively, of the targeted site in the chromosomal sequence, the donor sequence can be exchanged with or integrated into the chromosomal sequence at the targeted site during repair mediated by homology-directed repair process. Alternatively, in embodiments in which the donor sequence is flanked by compatible overhangs (or the compatible overhangs are generated in situ by the RNA-guided endonuclease) the donor sequence can be ligated directly with the cleaved chromosomal sequence by a non-homologous repair process during repair of the double-stranded break. Exchange or integration of the donor sequence into the chromosomal sequence modifies the targeted chromosomal sequence or introduces an exogenous sequence into the chromosomal sequence of the cell or embryo.
- In other embodiments, the method can comprise introducing two RNA-guided endonucleases (or encoding nucleic acid) and two guide RNAs (or encoding DNA) into a cell or embryo, wherein the RNA-guided endonucleases introduce two double-stranded breaks in the chromosomal sequence. See
FIG. 3B . The two breaks can be within several base pairs, within tens of base pairs, or can be separated by many thousands of base pairs. In embodiments in which the optional donor polynucleotide is not present, the resultant double-stranded breaks can be repaired by a non-homologous repair process such that the sequence between the two cleavage sites is lost and/or deletions of at least one nucleotide, insertions of at least one nucleotide, substitutions of at least one nucleotide, or combinations thereof can occur during the repair of the break(s). In embodiments in which the optional donor polynucleotide is present, the donor sequence in the donor polynucleotide can be exchanged with or integrated into the chromosomal sequence during repair of the double-stranded breaks by either a homology-based repair process (e.g., in embodiments in which the donor sequence is flanked by upstream and downstream sequences having substantial sequence identity with upstream and downstream sequences, respectively, of the targeted sites in the chromosomal sequence) or a non-homologous repair process (e.g., in embodiments in which the donor sequence is flanked by compatible overhangs). - In still other embodiments, the method can comprise introducing one RNA-guided endonuclease modified to cleave one strand of a double-stranded sequence (or encoding nucleic acid) and two guide RNAs (or encoding DNA) into a cell or embryo, wherein each guide RNA directs the RNA-guided endonuclease to a specific target site, at which site the modified endonuclease cleaves one strand (i.e., nicks) of the double-stranded chromosomal sequence, and wherein the two nicks are in opposite stands and in close enough proximity to constitute a double-stranded break. See
FIG. 3A . In embodiments in which the optional donor polynucleotide is not present, the resultant double-stranded break can be repaired by a non-homologous repair process such that deletions of at least one nucleotide, insertions of at least one nucleotide, substitutions of at least one nucleotide, or combinations thereof can occur during the repair of the break. In embodiments in which the optional donor polynucleotide is present, the donor sequence in the donor polynucleotide can be exchanged with or integrated into the chromosomal sequence during repair of the double-stranded break by either a homology-based repair process (e.g., in embodiments in which the donor sequence is flanked by upstream and downstream sequences having substantial sequence identity with upstream and downstream sequences, respectively, of the targeted sites in the chromosomal sequence) or a non-homologous repair process (e.g., in embodiments in which the donor sequence is flanked by compatible overhangs). - (a) RNA-Guided Endonuclease
- The method comprises introducing into a cell or embryo at least one RNA-guided endonuclease comprising at least one nuclear localization signal or nucleic acid encoding at least one RNA-guided endonuclease comprising at least one nuclear localization signal. Such RNA-guided endonucleases and nucleic acids encoding RNA-guided endonucleases are described above in sections (I) and (III), respectively.
- In some embodiments, the RNA-guided endonuclease can be introduced into the cell or embryo as an isolated protein. In such embodiments, the RNA-guided endonuclease can further comprise at least one cell-penetrating domain, which facilitates cellular uptake of the protein. In other embodiments, the RNA-guided endonuclease can be introduced into the cell or embryo as an mRNA molecule. In still other embodiments, the RNA-guided endonuclease can be introduced into the cell or embryo as a DNA molecule. In general, DNA sequence encoding the fusion protein is operably linked to a promoter sequence that will function in the cell or embryo of interest. The DNA sequence can be linear, or the DNA sequence can be part of a vector. In still other embodiments, the fusion protein can be introduced into the cell or embryo as an RNA-protein complex comprising the fusion protein and the guide RNA.
- In alternate embodiments, DNA encoding the RNA-guided endonuclease can further comprise sequence encoding a guide RNA. In general, each of the sequences encoding the RNA-guided endonuclease and the guide RNA is operably linked to appropriate promoter control sequence that allows expression of the RNA-guided endonuclease and the guide RNA, respectively, in the cell or embryo. The DNA sequence encoding the RNA-guided endonuclease and the guide RNA can further comprise additional expression control, regulatory, and/or processing sequence(s). The DNA sequence encoding the RNA-guided endonuclease and the guide RNA can be linear or can be part of a vector
- (b) Guide RNA
- The method also comprises introducing into a cell or embryo at least one guide RNA or DNA encoding at least one guide RNA. A guide RNA interacts with the RNA-guided endonuclease to direct the endonuclease to a specific target site, at which site the 5′ end of the guide RNA base pairs with a specific protospacer sequence in the chromosomal sequence.
- Each guide RNA comprises three regions: a first region at the 5′ end that is complementary to the target site in the chromosomal sequence, a second internal region that forms a stem loop structure, and a third 3′ region that remains essentially single-stranded. The first region of each guide RNA is different such that each guide RNA guides a fusion protein to a specific target site. The second and third regions of each guide RNA can be the same in all guide RNAs.
- The first region of the guide RNA is complementary to sequence (i.e., protospacer sequence) at the target site in the chromosomal sequence such that the first region of the guide RNA can base pair with the target site. In various embodiments, the first region of the guide RNA can comprise from about 10 nucleotides to more than about 25 nucleotides. For example, the region of base pairing between the first region of the guide RNA and the target site in the chromosomal sequence can be about 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 22, 23, 24, 25, or more than 25 nucleotides in length. In an exemplary embodiment, the first region of the guide RNA is about 19, 20, or 21 nucleotides in length.
- The guide RNA also comprises a second region that forms a secondary structure. In some embodiments, the secondary structure comprises a stem (or hairpin) and a loop. The length of the loop and the stem can vary. For example, the loop can range from about 3 to about 10 nucleotides in length, and the stem can range from about 6 to about 20 base pairs in length. The stem can comprise one or more bulges of 1 to about 10 nucleotides. Thus, the overall length of the second region can range from about 16 to about 60 nucleotides in length. In an exemplary embodiment, the loop is about 4 nucleotides in length and the stem comprises about 12 base pairs.
- The guide RNA also comprises a third region at the 3′ end that remains essentially single-stranded. Thus, the third region has no complementarity to any chromosomal sequence in the cell of interest and has no complementarity to the rest of the guide RNA. The length of the third region can vary. In general, the third region is more than about 4 nucleotides in length. For example, the length of the third region can range from about 5 to about 60 nucleotides in length.
- The combined length of the second and third regions (also called the universal or scaffold region) of the guide RNA can range from about 30 to about 120 nucleotides in length. In one aspect, the combined length of the second and third regions of the guide RNA range from about 70 to about 100 nucleotides in length.
- In some embodiments, the guide RNA comprises a single molecule comprising all three regions. In other embodiments, the guide RNA can comprise two separate molecules. The first RNA molecule can comprise the first region of the guide RNA and one half of the “stem” of the second region of the guide RNA. The second RNA molecule can comprise the other half of the “stem” of the second region of the guide RNA and the third region of the guide RNA. Thus, in this embodiment, the first and second RNA molecules each contain a sequence of nucleotides that are complementary to one another. For example, in one embodiment, the first and second RNA molecules each comprise a sequence (of about 6 to about 20 nucleotides) that base pairs to the other sequence to form a functional guide RNA.
- In some embodiments, the guide RNA can be introduced into the cell or embryo as a RNA molecule. The RNA molecule can be transcribed in vitro. Alternatively, the RNA molecule can be chemically synthesized.
- In other embodiments, the guide RNA can be introduced into the cell or embryo as a DNA molecule. In such cases, the DNA encoding the guide RNA can be operably linked to promoter control sequence for expression of the guide RNA in the cell or embryo of interest. For example, the RNA coding sequence can be operably linked to a promoter sequence that is recognized by RNA polymerase III (Pol III). Examples of suitable Pol III promoters include, but are not limited to, mammalian U6 or H1 promoters. In exemplary embodiments, the RNA coding sequence is linked to a mouse or human U6 promoter. In other exemplary embodiments, the RNA coding sequence is linked to a mouse or human H1 promoter.
- The DNA molecule encoding the guide RNA can be linear or circular. In some embodiments, the DNA sequence encoding the guide RNA can be part of a vector. Suitable vectors include plasmid vectors, phagemids, cosmids, artificial/mini-chromosomes, transposons, and viral vectors. In an exemplary embodiment, the DNA encoding the RNA-guided endonuclease is present in a plasmid vector. Non-limiting examples of suitable plasmid vectors include pUC, pBR322, pET, pBluescript, and variants thereof. The vector can comprise additional expression control sequences (e.g., enhancer sequences, Kozak sequences, polyadenylation sequences, transcriptional termination sequences, etc.), selectable marker sequences (e.g., antibiotic resistance genes), origins of replication, and the like.
- In embodiments in which both the RNA-guided endonuclease and the guide RNA are introduced into the cell as DNA molecules, each can be part of a separate molecule (e.g., one vector containing fusion protein coding sequence and a second vector containing guide RNA coding sequence) or both can be part of the same molecule (e.g., one vector containing coding (and regulatory) sequence for both the fusion protein and the guide RNA).
- (c) Target Site
- An RNA-guided endonuclease in conjunction with a guide RNA is directed to a target site in the chromosomal sequence, wherein the RNA-guided endonuclease introduces a double-stranded break in the chromosomal sequence. The target site has no sequence limitation except that the sequence is immediately followed (downstream) by a consensus sequence. This consensus sequence is also known as a protospacer adjacent motif (PAM). Examples of PAM include, but are not limited to, NGG, NGGNG, and NNAGAAW (wherein N is defined as any nucleotide and W is defined as either A or T). As detailed above in section (IV)(b), the first region (at the 5′ end) of the guide RNA is complementary to the protospacer of the target sequence. Typically, the first region of the guide RNA is about 19 to 21 nucleotides in length. Thus, in certain aspects, the sequence of the target site in the chromosomal sequence is 5′-N19-21-NGG-3′. The PAM is in italics.
- The target site can be in the coding region of a gene, in an intron of a gene, in a control region of a gene, in a non-coding region between genes, etc. The gene can be a protein coding gene or an RNA coding gene. The gene can be any gene of interest.
- (d) Optional Donor Polynucleotide
- In some embodiments, the method further comprises introducing at least one donor polynucleotide into the embryo. A donor polynucleotide comprises at least one donor sequence. In some aspects, a donor sequence of the donor polynucleotide corresponds to an endogenous or native chromosomal sequence. For example, the donor sequence can be essentially identical to a portion of the chromosomal sequence at or near the targeted site, but which comprises at least one nucleotide change. Thus, the donor sequence can comprise a modified version of the wild type sequence at the targeted site such that, upon integration or exchange with the native sequence, the sequence at the targeted chromosomal location comprises at least one nucleotide change. For example, the change can be an insertion of one or more nucleotides, a deletion of one or more nucleotides, a substitution of one or more nucleotides, or combinations thereof. As a consequence of the integration of the modified sequence, the cell or embryo/animal can produce a modified gene product from the targeted chromosomal sequence.
- In other aspects, the donor sequence of the donor polynucleotide corresponds to an exogenous sequence. As used herein, an “exogenous” sequence refers to a sequence that is not native to the cell or embryo, or a sequence whose native location in the genome of the cell or embryo is in a different location. For example, the exogenous sequence can comprise protein coding sequence, which can be operably linked to an exogenous promoter control sequence such that, upon integration into the genome, the cell or embryo/animal is able to express the protein coded by the integrated sequence. Alternatively, the exogenous sequence can be integrated into the chromosomal sequence such that its expression is regulated by an endogenous promoter control sequence. In other iterations, the exogenous sequence can be a transcriptional control sequence, another expression control sequence, an RNA coding sequence, and so forth. Integration of an exogenous sequence into a chromosomal sequence is termed a “knock in.”
- As can be appreciated by those skilled in the art, the length of the donor sequence can and will vary. For example, the donor sequence can vary in length from several nucleotides to hundreds of nucleotides to hundreds of thousands of nucleotides.
- Donor Polynucleotide Comprising Upstream and Downstream Sequences.
- In some embodiments, the donor sequence in the donor polynucleotide is flanked by an upstream sequence and a downstream sequence, which have substantial sequence identity to sequences located upstream and downstream, respectively, of the targeted site in the chromosomal sequence. Because of these sequence similarities, the upstream and downstream sequences of the donor polynucleotide permit homologous recombination between the donor polynucleotide and the targeted chromosomal sequence such that the donor sequence can be integrated into (or exchanged with) the chromosomal sequence.
- The upstream sequence, as used herein, refers to a nucleic acid sequence that shares substantial sequence identity with a chromosomal sequence upstream of the targeted site. Similarly, the downstream sequence refers to a nucleic acid sequence that shares substantial sequence identity with a chromosomal sequence downstream of the targeted site. As used herein, the phrase “substantial sequence identity” refers to sequences having at least about 75% sequence identity. Thus, the upstream and downstream sequences in the donor polynucleotide can have about 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% A sequence identity with sequence upstream or downstream to the targeted site. In an exemplary embodiment, the upstream and downstream sequences in the donor polynucleotide can have about 95% or 100% sequence identity with chromosomal sequences upstream or downstream to the targeted site. In one embodiment, the upstream sequence shares substantial sequence identity with a chromosomal sequence located immediately upstream of the targeted site (i.e., adjacent to the targeted site). In other embodiments, the upstream sequence shares substantial sequence identity with a chromosomal sequence that is located within about one hundred (100) nucleotides upstream from the targeted site. Thus, for example, the upstream sequence can share substantial sequence identity with a chromosomal sequence that is located about 1 to about 20, about 21 to about 40, about 41 to about 60, about 61 to about 80, or about 81 to about 100 nucleotides upstream from the targeted site. In one embodiment, the downstream sequence shares substantial sequence identity with a chromosomal sequence located immediately downstream of the targeted site (i.e., adjacent to the targeted site). In other embodiments, the downstream sequence shares substantial sequence identity with a chromosomal sequence that is located within about one hundred (100) nucleotides downstream from the targeted site. Thus, for example, the downstream sequence can share substantial sequence identity with a chromosomal sequence that is located about 1 to about 20, about 21 to about 40, about 41 to about 60, about 61 to about 80, or about 81 to about 100 nucleotides downstream from the targeted site.
- Each upstream or downstream sequence can range in length from about 20 nucleotides to about 5000 nucleotides. In some embodiments, upstream and downstream sequences can comprise about 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2100, 2200, 2300, 2400, 2500, 2600, 2800, 3000, 3200, 3400, 3600, 3800, 4000, 4200, 4400, 4600, 4800, or 5000 nucleotides. In exemplary embodiments, upstream and downstream sequences can range in length from about 50 to about 1500 nucleotides.
- Donor polynucleotides comprising the upstream and downstream sequences with sequence similarity to the targeted chromosomal sequence can be linear or circular. In embodiments in which the donor polynucleotide is circular, it can be part of a vector. For example, the vector can be a plasmid vector.
- Donor Polynucleotide Comprising Targeted Cleavage Site(s).
- In other embodiments, the donor polynucleotide can additionally comprise at least one targeted cleavage site that is recognized by the RNA-guided endonuclease. The targeted cleavage site added to the donor polynucleotide can be placed upstream or downstream or both upstream and downstream of the donor sequence. For example, the donor sequence can be flanked by targeted cleavage sites such that, upon cleavage by the RNA-guided endonuclease, the donor sequence is flanked by overhangs that are compatible with those in the chromosomal sequence generated upon cleavage by the RNA-guided endonuclease. Accordingly, the donor sequence can be ligated with the cleaved chromosomal sequence during repair of the double stranded break by a non-homologous repair process. Generally, donor polynucleotides comprising the targeted cleavage site(s) will be circular (e.g., can be part of a plasmid vector).
- Donor Polynucleotide Comprising a Short Donor Sequence with Optional Overhangs.
- In still alternate embodiments, the donor polynucleotide can be a linear molecule comprising a short donor sequence with optional short overhangs that are compatible with the overhangs generated by the RNA-guided endonuclease. In such embodiments, the donor sequence can be ligated directly with the cleaved chromosomal sequence during repair of the double-stranded break. In some instances, the donor sequence can be less than about 1,000, less than about 500, less than about 250, or less than about 100 nucleotides. In certain cases, the donor polynucleotide can be a linear molecule comprising a short donor sequence with blunt ends. In other iterations, the donor polynucleotide can be a linear molecule comprising a short donor sequence with 5′ and/or 3′ overhangs. The overhangs can comprise 1, 2, 3, 4, or 5 nucleotides.
- Typically, the donor polynucleotide will be DNA. The DNA may be single-stranded or double-stranded and/or linear or circular. The donor polynucleotide may be a DNA plasmid, a bacterial artificial chromosome (BAC), a yeast artificial chromosome (YAC), a viral vector, a linear piece of DNA, a PCR fragment, a naked nucleic acid, or a nucleic acid complexed with a delivery vehicle such as a liposome or poloxamer. In certain embodiments, the donor polynucleotide comprising the donor sequence can be part of a plasmid vector. In any of these situations, the donor polynucleotide comprising the donor sequence can further comprise at least one additional sequence.
- (e) Introducing into the Cell or Embryo
- The RNA-targeted endonuclease(s) (or encoding nucleic acid), the guide RNA(s) (or encoding DNA), and the optional donor polynucleotide(s) can be introduced into a cell or embryo by a variety of means. In some embodiments, the cell or embryo is transfected. Suitable transfection methods include calcium phosphate-mediated transfection, nucleofection (or electroporation), cationic polymer transfection (e.g., DEAE-dextran or polyethylenimine), viral transduction, virosome transfection, virion transfection, liposome transfection, cationic liposome transfection, immunoliposome transfection, nonliposomal lipid transfection, dendrimer transfection, heat shock transfection, magnetofection, lipofection, gene gun delivery, impalefection, sonoporation, optical transfection, and proprietary agent-enhanced uptake of nucleic acids. Transfection methods are well known in the art (see, e.g., “Current Protocols in Molecular Biology” Ausubel et al., John Wiley & Sons, New York, 2003 or “Molecular Cloning: A Laboratory Manual” Sambrook & Russell, Cold Spring Harbor Press, Cold Spring Harbor, N.Y., 3rd edition, 2001). In other embodiments, the molecules are introduced into the cell or embryo by microinjection. Typically, the embryo is a fertilized one-cell stage embryo of the species of interest. For example, the molecules can be injected into the pronuclei of one cell embryos.
- The RNA-targeted endonuclease(s) (or encoding nucleic acid), the guide RNA(s) (or DNAs encoding the guide RNA), and the optional donor polynucleotide(s) can be introduced into the cell or embryo simultaneously or sequentially. The ratio of the RNA-targeted endonuclease(s) (or encoding nucleic acid) to the guide RNA(s) (or encoding DNA) generally will be about stoichiometric such that they can form an RNA-protein complex. In one embodiment, DNA encoding an RNA-targeted endonuclease and DNA encoding a guide RNA are delivered together within the plasmid vector.
- (f) Culturing the Cell or Embryo
- The method further comprises maintaining the cell or embryo under appropriate conditions such that the guide RNA(s) directs the RNA-guided endonuclease(s) to the targeted site(s) in the chromosomal sequence, and the RNA-guided endonuclease(s) introduce at least one double-stranded break in the chromosomal sequence. A double-stranded break can be repaired by a DNA repair process such that the chromosomal sequence is modified by a deletion of at least one nucleotide, an insertion of at least one nucleotide, a substitution of at least one nucleotide, or a combination thereof.
- In embodiments in which no donor polynucleotide is introduced into the cell or embryo, the double-stranded break can be repaired via a non-homologous end-joining (NHEJ) repair process. Because NHEJ is error-prone, deletions of at least one nucleotide, insertions of at least one nucleotide, substitutions of at least one nucleotide, or combinations thereof can occur during the repair of the break. Accordingly, the sequence at the chromosomal sequence can be modified such that the reading frame of a coding region can be shifted and that the chromosomal sequence is inactivated or “knocked out.” An inactivated protein-coding chromosomal sequence does not give rise to the protein coded by the wild type chromosomal sequence.
- In embodiments in which a donor polynucleotide comprising upstream and downstream sequences is introduced into the cell or embryo, the double-stranded break can be repaired by a homology-directed repair (HDR) process such that the donor sequence is integrated into the chromosomal sequence. Accordingly, an exogenous sequence can be integrated into the genome of the cell or embryo, or the targeted chromosomal sequence can be modified by exchange of a modified sequence for the wild type chromosomal sequence.
- In embodiments in which a donor polynucleotide comprising the targeted cleave site is introduced into the cell or embryo, the RNA-guided endonuclease can cleave both the targeted chromosomal sequence and the donor polynucleotide. The linearized donor polynucleotide can be integrated into the chromosomal sequence at the site of the double-stranded break by ligation between the donor polynucleotide and the cleaved chromosomal sequence via a NHEJ process.
- In embodiments in which a linear donor polynucleotide comprising a short donor sequence is introduced into the cell or embryo, the short donor sequence can be integrated into the chromosomal sequence at the site of the double-stranded break via a NHEJ process. The integration can proceed via the ligation of blunt ends between the short donor sequence and the chromosomal sequence at the site of the double stranded break. Alternatively, the integration can proceed via the ligation of sticky ends (i.e., having 5′ or 3′ overhangs) between a short donor sequence that is flanked by overhangs that are compatible with those generated by the RNA-targeting endonuclease in the cleaved chromosomal sequence.
- In general, the cell is maintained under conditions appropriate for cell growth and/or maintenance. Suitable cell culture conditions are well known in the art and are described, for example, in Santiago et al. (2008) PNAS 105:5809-5814; Moehle et al. (2007) PNAS 104:3055-3060; Urnov et al. (2005) Nature 435:646-651; and Lombardo et al (2007) Nat. Biotechnology 25:1298-1306. Those of skill in the art appreciate that methods for culturing cells are known in the art and can and will vary depending on the cell type. Routine optimization may be used, in all cases, to determine the best techniques for a particular cell type.
- An embryo can be cultured in vitro (e.g., in cell culture). Typically, the embryo is cultured at an appropriate temperature and in appropriate media with the necessary O2/CO2 ratio to allow the expression of the RNA endonuclease and guide RNA, if necessary. Suitable non-limiting examples of media include M2, M16, KSOM, BMOC, and HTF media. A skilled artisan will appreciate that culture conditions can and will vary depending on the species of embryo. Routine optimization may be used, in all cases, to determine the best culture conditions for a particular species of embryo. In some cases, a cell line may be derived from an in vitro-cultured embryo (e.g., an embryonic stem cell line).
- Alternatively, an embryo may be cultured in vivo by transferring the embryo into the uterus of a female host. Generally speaking the female host is from the same or similar species as the embryo. Preferably, the female host is pseudo-pregnant. Methods of preparing pseudo-pregnant female hosts are known in the art. Additionally, methods of transferring an embryo into a female host are known. Culturing an embryo in vivo permits the embryo to develop and can result in a live birth of an animal derived from the embryo. Such an animal would comprise the modified chromosomal sequence in every cell of the body.
- (g) Cell and Embryo Types
- A variety of eukaryotic cells and embryos are suitable for use in the method. For example, the cell can be a human cell, a non-human mammalian cell, a non-mammalian vertebrate cell, an invertebrate cell, an insect cell, a plant cell, a yeast cell, or a single cell eukaryotic organism. In general, the embryo is non-human mammalian embryo. In specific embodiments, the embryos can be a one cell non-human mammalian embryo. Exemplary mammalian embryos, including one cell embryos, include without limit mouse, rat, hamster, rodent, rabbit, feline, canine, ovine, porcine, bovine, equine, and primate embryos. In still other embodiments, the cell can be a stem cell. Suitable stem cells include without limit embryonic stem cells, ES-like stem cells, fetal stem cells, adult stem cells, pluripotent stem cells, induced pluripotent stem cells, multipotent stem cells, oligopotent stem cells, unipotent stem cells and others. In exemplary embodiments, the cell is a mammalian cell.
- Non-limiting examples of suitable mammalian cells include Chinese hamster ovary (CHO) cells, baby hamster kidney (BHK) cells; mouse myeloma NS0 cells, mouse embryonic fibroblast 3T3 cells (NIH3T3), mouse B lymphoma A20 cells; mouse melanoma B16 cells; mouse myoblast C2C12 cells; mouse myeloma SP2/0 cells; mouse embryonic mesenchymal C3H-10T1/2 cells; mouse carcinoma CT26 cells, mouse prostate DuCuP cells; mouse breast EMT6 cells; mouse hepatoma Hepa1c1c7 cells; mouse myeloma J5582 cells; mouse epithelial MTD-1A cells; mouse myocardial MyEnd cells; mouse renal RenCa cells; mouse pancreatic RIN-5F cells; mouse melanoma X64 cells; mouse lymphoma YAC-1 cells; rat glioblastoma 9L cells; rat B lymphoma RBL cells; rat neuroblastoma B35 cells; rat hepatoma cells (HTC); buffalo rat liver BRL 3A cells; canine kidney cells (MDCK); canine mammary (CMT) cells; rat osteosarcoma D17 cells; rat monocyte/macrophage DH82 cells; monkey kidney SV-40 transformed fibroblast (COS7) cells; monkey kidney CVI-76 cells; African green monkey kidney (VERO-76) cells; human embryonic kidney cells (HEK293, HEK293T); human cervical carcinoma cells (HELA); human lung cells (W138); human liver cells (Hep G2); human U2-OS osteosarcoma cells, human A549 cells, human A-431 cells, and human K562 cells. An extensive list of mammalian cell lines may be found in the American Type Culture Collection catalog (ATCC, Mamassas, Va.).
- Another aspect of the present disclosure encompasses a method for modifying a chromosomal sequence or regulating expression of a chromosomal sequence in a cell or embryo. The method comprises introducing into the cell or embryo (a) at least one fusion protein or nucleic acid encoding at least one fusion protein, wherein the fusion protein comprises a CRISPR/Cas-like protein or a fragment thereof and an effector domain, and (b) at least one guide RNA or DNA encoding the guide RNA, wherein the guide RNA guides the CRISPR/Cas-like protein of the fusion protein to a targeted site in the chromosomal sequence and the effector domain of the fusion protein modifies the chromosomal sequence or regulates expression of the chromosomal sequence.
- Fusion proteins comprising a CRISPR/Cas-like protein or a fragment thereof and an effector domain are detailed above in section (II). In general, the fusion proteins disclosed herein further comprise at least one nuclear localization signal. Nucleic acids encoding fusion proteins are described above in section (III). In some embodiments, the fusion protein can be introduced into the cell or embryo as an isolated protein (which can further comprise a cell-penetrating domain). Furthermore, the isolated fusion protein can be part of a protein-RNA complex comprising the guide RNA. In other embodiments, the fusion protein can be introduced into the cell or embryo as a RNA molecule (which can be capped and/or polyadenylated). In still other embodiments, the fusion protein can be introduced into the cell or embryo as a DNA molecule. For example, the fusion protein and the guide RNA can be introduced into the cell or embryo as discrete DNA molecules or as part of the same DNA molecule. Such DNA molecules can be plasmid vectors.
- In some embodiments, the method further comprises introducing into the cell or embryo at least one zinc finger nuclease. Zinc finger nucleases are described above in section (II)(d). In still other embodiments, the method further comprises introducing into the cell or embryo at least one donor polynucleotide. Donor polynucleotides are detailed above in section (IV)(d). Means for introducing molecules into cells or embryos, as well as means for culturing cell or embryos are described above in sections (IV)(e) and (IV)(f), respectively. Suitable cells and embryos are described above in section (IV)(g).
- In certain embodiments in which the effector domain of the fusion protein is a cleavage domain (e.g., a FokI cleavage domain or a modified FokI cleavage domain), the method can comprise introducing into the cell or embryo one fusion protein (or nucleic acid encoding one fusion protein) and two guide RNAs (or DNA encoding two guide RNAs). The two guide RNAs direct the fusion protein to two different target sites in the chromosomal sequence, wherein the fusion protein dimerizes (e.g., form a homodimer) such that the two cleavage domains can introduce a double stranded break into the chromosomal sequence. See
FIG. 1A . In embodiments in which the optional donor polynucleotide is not present, the double-stranded break in the chromosomal sequence can be repaired by a non-homologous end-joining (NHEJ) repair process. Because NHEJ is error-prone, deletions of at least one nucleotide, insertions of at least one nucleotide, substitutions of at least one nucleotide, or combinations thereof can occur during the repair of the break. Accordingly, the targeted chromosomal sequence can be modified or inactivated. For example, a single nucleotide change (SNP) can give rise to an altered protein product, or a shift in the reading frame of a coding sequence can inactivate or “knock out” the sequence such that no protein product is made. In embodiments in which the optional donor polynucleotide is present, the donor sequence in the donor polynucleotide can be exchanged with or integrated into the chromosomal sequence at the targeted site during repair of the double-stranded break. For example, in embodiments in which the donor sequence is flanked by upstream and downstream sequences having substantial sequence identity with upstream and downstream sequences, respectively, of the targeted site in the chromosomal sequence, the donor sequence can be exchanged with or integrated into the chromosomal sequence at the targeted site during repair mediated by homology-directed repair process. Alternatively, in embodiments in which the donor sequence is flanked by compatible overhangs (or the compatible overhangs are generated in situ by the RNA-guided endonuclease) the donor sequence can be ligated directly with the cleaved chromosomal sequence by a non-homologous repair process during repair of the double-stranded break. Exchange or integration of the donor sequence into the chromosomal sequence modifies the targeted chromosomal sequence or introduces an exogenous sequence into the chromosomal sequence of the cell or embryo. - In other embodiments in which the effector domain of the fusion protein is a cleavage domain (e.g., a FokI cleavage domain or a modified FokI cleavage domain), the method can comprise introducing into the cell or embryo two different fusion proteins (or nucleic acid encoding two different fusion proteins) and two guide RNAs (or DNA encoding two guide RNAs). The fusion proteins can differ as detailed above in section (II). Each guide RNA directs a fusion protein to a specific target site in the chromosomal sequence, wherein the fusion proteins dimerize (e.g., form a heterodimer) such that the two cleavage domains can introduce a double stranded break into the chromosomal sequence. In embodiments in which the optional donor polynucleotide is not present, the resultant double-stranded breaks can be repaired by a non-homologous repair process such that deletions of at least one nucleotide, insertions of at least one nucleotide, substitutions of at least one nucleotide, or combinations thereof can occur during the repair of the break. In embodiments in which the optional donor polynucleotide is present, the donor sequence in the donor polynucleotide can be exchanged with or integrated into the chromosomal sequence during repair of the double-stranded break by either a homology-based repair process (e.g., in embodiments in which the donor sequence is flanked by upstream and downstream sequences having substantial sequence identity with upstream and downstream sequences, respectively, of the targeted sites in the chromosomal sequence) or a non-homologous repair process (e.g., in embodiments in which the donor sequence is flanked by compatible overhangs).
- In still other embodiments in which the effector domain of the fusion protein is a cleavage domain (e.g., a FokI cleavage domain or a modified FokI cleavage domain), the method can comprise introducing into the cell or embryo one fusion protein (or nucleic acid encoding one fusion protein), one guide RNA (or DNA encoding one guide RNA), and one zinc finger nuclease (or nucleic acid encoding the zinc finger nuclease), wherein the zinc finger nuclease comprises a FokI cleavage domain or a modified FokI cleavage domain. The guide RNA directs the fusion protein to a specific chromosomal sequence, and the zinc finger nuclease is directed to another chromosomal sequence, wherein the fusion protein and the zinc finger nuclease dimerize such that the cleavage domain of the fusion protein and the cleavage domain of the zinc finger nuclease can introduce a double stranded break into the chromosomal sequence. See
FIG. 1B . In embodiments in which the optional donor polynucleotide is not present, the resultant double-stranded breaks can be repaired by a non-homologous repair process such that deletions of at least one nucleotide, insertions of at least one nucleotide, substitutions of at least one nucleotide, or combinations thereof can occur during the repair of the break. In embodiments in which the optional donor polynucleotide is present, the donor sequence in the donor polynucleotide can be exchanged with or integrated into the chromosomal sequence during repair of the double-stranded break by either a homology-based repair process (e.g., in embodiments in which the donor sequence is flanked by upstream and downstream sequences having substantial sequence identity with upstream and downstream sequences, respectively, of the targeted sites in the chromosomal sequence) or a non-homologous repair process (e.g., in embodiments in which the donor sequence is flanked by compatible overhangs). - In still other embodiments in which the effector domain of the fusion protein is a transcriptional activation domain or a transcriptional repressor domain, the method can comprise introducing into the cell or embryo one fusion protein (or nucleic acid encoding one fusion protein) and one guide RNA (or DNA encoding one guide RNA). The guide RNA directs the fusion protein to a specific chromosomal sequence, wherein the transcriptional activation domain or a transcriptional repressor domain activates or represses expression, respectively, of the targeted chromosomal sequence. See
FIG. 2A . - In alternate embodiments in which the effector domain of the fusion protein is an epigenetic modification domain, the method can comprise introducing into the cell or embryo one fusion protein (or nucleic acid encoding one fusion protein) and one guide RNA (or DNA encoding one guide RNA). The guide RNA directs the fusion protein to a specific chromosomal sequence, wherein the epigenetic modification domain modifies the structure of the targeted the chromosomal sequence. See
FIG. 2B . Epigenetic modifications include acetylation, methylation of histone proteins and/or nucleotide methylation. In some instances, structural modification of the chromosomal sequence leads to changes in expression of the chromosomal sequence. - The present disclosure encompasses genetically modified cells, non-human embryos, and non-human animals comprising at least one chromosomal sequence that has been modified using an RNA-guided endonuclease-mediated or fusion protein-mediated process, for example, using the methods described herein. The disclosure provides cells comprising at least one DNA or RNA molecule encoding an RNA-guided endonuclease or fusion protein targeted to a chromosomal sequence of interest or a fusion protein, at least one guide RNA, and optionally one or more donor polynucleotide(s). The disclosure also provides non-human embryos comprising at least one DNA or RNA molecule encoding an RNA-guided endonuclease or fusion protein targeted to a chromosomal sequence of interest, at least one guide RNA, and optionally one or more donor polynucleotide(s).
- The present disclosure provides genetically modified non-human animals, non-human embryos, or animal cells comprising at least one modified chromosomal sequence. The modified chromosomal sequence may be modified such that it is (1) inactivated, (2) has an altered expression or produces an altered protein product, or (3) comprises an integrated sequence. The chromosomal sequence is modified with an RNA guided endonuclease-mediated or fusion protein-mediated process, using the methods described herein.
- As discussed, one aspect of the present disclosure provides a genetically modified animal in which at least one chromosomal sequence has been modified. In one embodiment, the genetically modified animal comprises at least one inactivated chromosomal sequence. The modified chromosomal sequence may be inactivated such that the sequence is not transcribed and/or a functional protein product is not produced. Thus, a genetically modified animal comprising an inactivated chromosomal sequence may be termed a “knock out” or a “conditional knock out.” The inactivated chromosomal sequence can include a deletion mutation (i.e., deletion of one or more nucleotides), an insertion mutation (i.e., insertion of one or more nucleotides), or a nonsense mutation (i.e., substitution of a single nucleotide for another nucleotide such that a stop codon is introduced). As a consequence of the mutation, the targeted chromosomal sequence is inactivated and a functional protein is not produced. The inactivated chromosomal sequence comprises no exogenously introduced sequence. Also included herein are genetically modified animals in which two, three, four, five, six, seven, eight, nine, or ten or more chromosomal sequences are inactivated.
- In another embodiment, the modified chromosomal sequence can be altered such that it codes for a variant protein product. For example, a genetically modified animal comprising a modified chromosomal sequence can comprise a targeted point mutation(s) or other modification such that an altered protein product is produced. In one embodiment, the chromosomal sequence can be modified such that at least one nucleotide is changed and the expressed protein comprises one changed amino acid residue (missense mutation). In another embodiment, the chromosomal sequence can be modified to comprise more than one missense mutation such that more than one amino acid is changed. Additionally, the chromosomal sequence can be modified to have a three nucleotide deletion or insertion such that the expressed protein comprises a single amino acid deletion or insertion. The altered or variant protein can have altered properties or activities compared to the wild type protein, such as altered substrate specificity, altered enzyme activity, altered kinetic rates, etc.
- In another embodiment, the genetically modified animal can comprise at least one chromosomally integrated sequence. A genetically modified animal comprising an integrated sequence may be termed a “knock in” or a “conditional knock in.” The chromosomally integrated sequence can, for example, encode an orthologous protein, an endogenous protein, or combinations of both. In one embodiment, a sequence encoding an orthologous protein or an endogenous protein can be integrated into a chromosomal sequence encoding a protein such that the chromosomal sequence is inactivated, but the exogenous sequence is expressed. In such a case, the sequence encoding the orthologous protein or endogenous protein may be operably linked to a promoter control sequence. Alternatively, a sequence encoding an orthologous protein or an endogenous protein may be integrated into a chromosomal sequence without affecting expression of a chromosomal sequence. For example, a sequence encoding a protein can be integrated into a “safe harbor” locus, such as the Rosa26 locus, HPRT locus, or AAV locus. The present disclosure also encompasses genetically modified animals in which two, three, four, five, six, seven, eight, nine, or ten or more sequences, including sequences encoding protein(s), are integrated into the genome.
- The chromosomally integrated sequence encoding a protein can encode the wild type form of a protein of interest or can encode a protein comprising at least one modification such that an altered version of the protein is produced. For example, a chromosomally integrated sequence encoding a protein related to a disease or disorder can comprise at least one modification such that the altered version of the protein produced causes or potentiates the associated disorder. Alternatively, the chromosomally integrated sequence encoding a protein related to a disease or disorder can comprise at least one modification such that the altered version of the protein protects against the development of the associated disorder.
- In an additional embodiment, the genetically modified animal can be a “humanized” animal comprising at least one chromosomally integrated sequence encoding a functional human protein. The functional human protein can have no corresponding ortholog in the genetically modified animal. Alternatively, the wild type animal from which the genetically modified animal is derived may comprise an ortholog corresponding to the functional human protein. In this case, the orthologous sequence in the “humanized” animal is inactivated such that no functional protein is made and the “humanized” animal comprises at least one chromosomally integrated sequence encoding the human protein.
- In yet another embodiment, the genetically modified animal can comprise at least one modified chromosomal sequence encoding a protein such that the expression pattern of the protein is altered. For example, regulatory regions controlling the expression of the protein, such as a promoter or a transcription factor binding site, can be altered such that the protein is over-produced, or the tissue-specific or temporal expression of the protein is altered, or a combination thereof. Alternatively, the expression pattern of the protein can be altered using a conditional knockout system. A non-limiting example of a conditional knockout system includes a Cre-lox recombination system. A Cre-lox recombination system comprises a Cre recombinase enzyme, a site-specific DNA recombinase that can catalyze the recombination of a nucleic acid sequence between specific sites (lox sites) in a nucleic acid molecule. Methods of using this system to produce temporal and tissue specific expression are known in the art. In general, a genetically modified animal is generated with lox sites flanking a chromosomal sequence. The genetically modified animal comprising the lox-flanked chromosomal sequence can then be crossed with another genetically modified animal expressing Cre recombinase. Progeny animals comprising the lox-flanked chromosomal sequence and the Cre recombinase are then produced, and the lox-flanked chromosomal sequence is recombined, leading to deletion or inversion of the chromosomal sequence encoding the protein. Expression of Cre recombinase can be temporally and conditionally regulated to effect temporally and conditionally regulated recombination of the chromosomal sequence.
- In any of these embodiments, the genetically modified animal disclosed herein can be heterozygous for the modified chromosomal sequence. Alternatively, the genetically modified animal can be homozygous for the modified chromosomal sequence.
- The genetically modified animals disclosed herein can be crossbred to create animals comprising more than one modified chromosomal sequence or to create animals that are homozygous for one or more modified chromosomal sequences. For example, two animals comprising the same modified chromosomal sequence can be crossbred to create an animal homozygous for the modified chromosomal sequence. Alternatively, animals with different modified chromosomal sequences can be crossbred to create an animal comprising both modified chromosomal sequences.
- For example, a first animal comprising an inactivated chromosomal sequence gene “x” can be crossed with a second animal comprising a chromosomally integrated sequence encoding a human gene “X” protein to give rise to “humanized” gene “X” offspring comprising both the inactivated gene “x” chromosomal sequence and the chromosomally integrated human gene “X” sequence. Also, a humanized gene “X” animal can be crossed with a humanized gene “Y” animal to create humanized gene X/gene Y offspring. Those of skill in the art will appreciate that many combinations are possible.
- In other embodiments, an animal comprising a modified chromosomal sequence can be crossbred to combine the modified chromosomal sequence with other genetic backgrounds. By way of non-limiting example, other genetic backgrounds may include wild-type genetic backgrounds, genetic backgrounds with deletion mutations, genetic backgrounds with another targeted integration, and genetic backgrounds with non-targeted integrations.
- The term “animal,” as used herein, refers to a non-human animal. The animal may be an embryo, a juvenile, or an adult. Suitable animals include vertebrates such as mammals, birds, reptiles, amphibians, shellfish, and fish. Examples of suitable mammals include without limit rodents, companion animals, livestock, and primates. Non-limiting examples of rodents include mice, rats, hamsters, gerbils, and guinea pigs. Suitable companion animals include but are not limited to cats, dogs, rabbits, hedgehogs, and ferrets. Non-limiting examples of livestock include horses, goats, sheep, swine, cattle, llamas, and alpacas. Suitable primates include but are not limited to capuchin monkeys, chimpanzees, lemurs, macaques, marmosets, tamarins, spider monkeys, squirrel monkeys, and vervet monkeys. Non-limiting examples of birds include chickens, turkeys, ducks, and geese. Alternatively, the animal may be an invertebrate such as an insect, a nematode, and the like. Non-limiting examples of insects include Drosophila and mosquitoes. An exemplary animal is a rat. Non-limiting examples of suitable rat strains include Dahl Salt-Sensitive, Fischer 344, Lewis, Long Evans Hooded, Sprague-Dawley, and Wistar. In one embodiment, the animal is not a genetically modified mouse. In each of the foregoing iterations of suitable animals for the invention, the animal does not include exogenously introduced, randomly integrated transposon sequences.
- A further aspect of the present disclosure provides genetically modified cells or cell lines comprising at least one modified chromosomal sequence. The genetically modified cell or cell line can be derived from any of the genetically modified animals disclosed herein. Alternatively, the chromosomal sequence can be modified in a cell as described herein above (in the paragraphs describing chromosomal sequence modifications in animals) using the methods descried herein. The disclosure also encompasses a lysate of said cells or cell lines.
- In general, the cells are eukaryotic cells. Suitable host cells include fungi or yeast, such as Pichia, Saccharomyces, or Schizosaccharomyces; insect cells, such as SF9 cells from Spodoptera frugiperda or S2 cells from Drosophila melanogaster; and animal cells, such as mouse, rat, hamster, non-human primate, or human cells. Exemplary cells are mammalian. The mammalian cells can be primary cells. In general, any primary cell that is sensitive to double strand breaks may be used. The cells may be of a variety of cell types, e.g., fibroblast, myoblast, T or B cell, macrophage, epithelial cell, and so forth.
- When mammalian cell lines are used, the cell line can be any established cell line or a primary cell line that is not yet described. The cell line can be adherent or non-adherent, or the cell line can be grown under conditions that encourage adherent, non-adherent or organotypic growth using standard techniques known to individuals skilled in the art. Non-limiting examples of suitable mammalian cells and cell lines are provided herein in section (IV)(g). In still other embodiments, the cell can be a stem cell. Non-limiting examples of suitable stem cells are provided in section (IV)(g).
- The present disclosure also provides a genetically modified non-human embryo comprising at least one modified chromosomal sequence. The chromosomal sequence can be modified in an embryo as described herein above (in the paragraphs describing chromosomal sequence modifications in animals) using the methods descried herein. In one embodiment, the embryo is a non-human fertilized one-cell stage embryo of the animal species of interest. Exemplary mammalian embryos, including one cell embryos, include without limit, mouse, rat, hamster, rodent, rabbit, feline, canine, ovine, porcine, bovine, equine, and primate embryos.
- Unless defined otherwise, all technical and scientific terms used herein have the meaning commonly understood by a person skilled in the art to which this invention belongs. The following references provide one of skill with a general definition of many of the terms used in this invention: Singleton et al., Dictionary of Microbiology and Molecular Biology (2nd ed. 1994); The Cambridge Dictionary of Science and Technology (Walker ed., 1988); The Glossary of Genetics, 5th Ed., R. Rieger et al. (eds.), Springer Verlag (1991); and Hale & Marham, The Harper Collins Dictionary of Biology (1991). As used herein, the following terms have the meanings ascribed to them unless specified otherwise.
- When introducing elements of the present disclosure or the preferred embodiments(s) thereof, the articles “a”, “an”, “the” and “said” are intended to mean that there are one or more of the elements. The terms “comprising”, “including” and “having” are intended to be inclusive and mean that there may be additional elements other than the listed elements.
- As used herein, the term “endogenous sequence” refers to a chromosomal sequence that is native to the cell.
- The term “exogenous,” as used herein, refers to a sequence that is not native to the cell, or a chromosomal sequence whose native location in the genome of the cell is in a different chromosomal location.
- A “gene,” as used herein, refers to a DNA region (including exons and introns) encoding a gene product, as well as all DNA regions which regulate the production of the gene product, whether or not such regulatory sequences are adjacent to coding and/or transcribed sequences. Accordingly, a gene includes, but is not necessarily limited to, promoter sequences, terminators, translational regulatory sequences such as ribosome binding sites and internal ribosome entry sites, enhancers, silencers, insulators, boundary elements, replication origins, matrix attachment sites, and locus control regions.
- The term “heterologous” refers to an entity that is not endogenous or native to the cell of interest. For example, a heterologous protein refers to a protein that is derived from or was originally derived from an exogenous source, such as an exogenously introduced nucleic acid sequence. In some instances, the heterologous protein is not normally produced by the cell of interest.
- The terms “nucleic acid” and “polynucleotide” refer to a deoxyribonucleotide or ribonucleotide polymer, in linear or circular conformation, and in either single- or double-stranded form. For the purposes of the present disclosure, these terms are not to be construed as limiting with respect to the length of a polymer. The terms can encompass known analogs of natural nucleotides, as well as nucleotides that are modified in the base, sugar and/or phosphate moieties (e.g., phosphorothioate backbones). In general, an analog of a particular nucleotide has the same base-pairing specificity; i.e., an analog of A will base-pair with T.
- The term “nucleotide” refers to deoxyribonucleotides or ribonucleotides. The nucleotides may be standard nucleotides (i.e., adenosine, guanosine, cytidine, thymidine, and uridine) or nucleotide analogs. A nucleotide analog refers to a nucleotide having a modified purine or pyrimidine base or a modified ribose moiety. A nucleotide analog may be a naturally occurring nucleotide (e.g., inosine) or a non-naturally occurring nucleotide. Non-limiting examples of modifications on the sugar or base moieties of a nucleotide include the addition (or removal) of acetyl groups, amino groups, carboxyl groups, carboxymethyl groups, hydroxyl groups, methyl groups, phosphoryl groups, and thiol groups, as well as the substitution of the carbon and nitrogen atoms of the bases with other atoms (e.g., 7-deaza purines). Nucleotide analogs also include dideoxy nucleotides, 2′-O-methyl nucleotides, locked nucleic acids (LNA), peptide nucleic acids (PNA), and morpholinos.
- The terms “polypeptide” and “protein” are used interchangeably to refer to a polymer of amino acid residues.
- Techniques for determining nucleic acid and amino acid sequence identity are known in the art. Typically, such techniques include determining the nucleotide sequence of the mRNA for a gene and/or determining the amino acid sequence encoded thereby, and comparing these sequences to a second nucleotide or amino acid sequence. Genomic sequences can also be determined and compared in this fashion. In general, identity refers to an exact nucleotide-to-nucleotide or amino acid-to-amino acid correspondence of two polynucleotides or polypeptide sequences, respectively. Two or more sequences (polynucleotide or amino acid) can be compared by determining their percent identity. The percent identity of two sequences, whether nucleic acid or amino acid sequences, is the number of exact matches between two aligned sequences divided by the length of the shorter sequences and multiplied by 100. An approximate alignment for nucleic acid sequences is provided by the local homology algorithm of Smith and Waterman, Advances in Applied Mathematics 2:482-489 (1981). This algorithm can be applied to amino acid sequences by using the scoring matrix developed by Dayhoff, Atlas of Protein Sequences and Structure, M. O. Dayhoff ed., 5 suppl. 3:353-358, National Biomedical Research Foundation, Washington, D.C., USA, and normalized by Gribskov, Nucl. Acids Res. 14(6):6745-6763 (1986). An exemplary implementation of this algorithm to determine percent identity of a sequence is provided by the Genetics Computer Group (Madison, Wis.) in the “BestFit” utility application. Other suitable programs for calculating the percent identity or similarity between sequences are generally known in the art, for example, another alignment program is BLAST, used with default parameters. For example, BLASTN and BLASTP can be used using the following default parameters: genetic code=standard; filter=none; strand=both; cutoff=60; expect=10; Matrix=BLOSUM62; Descriptions=50 sequences; sort by=HIGH SCORE; Databases=non-redundant, GenBank+EMBL+DDBJ+PDB+GenBank CDS translations+Swiss protein+Spupdate+PIR. Details of these programs can be found on the GenBank website.
- As various changes could be made in the above-described cells and methods without departing from the scope of the invention, it is intended that all matter contained in the above description and in the examples given below, shall be interpreted as illustrative and not in a limiting sense.
- The following examples illustrate certain aspects of the invention.
- A Cas9 gene from Streptococcus pyogenes strain MGAS15252 (Accession number YP_005388840.1) was optimized with Homo sapiens codon preference to enhance its translation in mammalian cells. The Cas9 gene also was modified by adding a nuclear localization signal PKKKRKV (SEQ ID NO:1) at the C terminus for targeting the protein into the nuclei of mammalian cells. Table 1 presents the modified Cas9 amino acid sequence, with the nuclear localization sequence underlined. Table 2 presents the codon optimized, modified Cas9 DNA sequence.
-
TABLE 1 Modified Cas9 Amino Acid Sequence (SEQ ID NO: 9) MDKKYSIGLDIGTNSVGWAVITDDYKVPSKKFKVLGNTDRHSIKK NLIGALLFGSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEM AKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTI YHLRKKLADSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSD VDKLFIQLVQIYNQLFEENPINASRVDAKAILSARLSKSRRLENL IAQLPGEKRNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDT YDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRVNSEITKA PLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYA GYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTF DNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPY YVGPLARGNSRFAWMTRKSEETITPWNFEEWDKGASAQSFIERMT NFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLS GEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDR FNASLGAYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDRGM IEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSG KTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGHSLH EQIANLAGSPAIKKGILQTVKIVDELVKVMGHKPENIVIEMAREN QTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLY LYYLQNGRDMYVDQELDINRLSDYDVDHIVPQSFIKDDSIDNKVL TRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLTK AERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDEND KLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHANDAYLNAV VGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYF FYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFAT VRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWD PKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIMERS SFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASA GELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQH KHYLDEIIEQISEFSKRVILADANLDKVLSAYNKHRDKPIREQAE NIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQSI TGLYETRIDLSQLGGDPKKKRKV -
TABLE 2 Optimized Cas9 DNA Sequence (5′-3′) (SEQ ID NO: 10) ATGGACAAGAAGTACAGCATCGGCCTGGACATCGGCACCAACTCTGTG GGCTGGGCCGTGATCACCGACGACTACAAGGTGCCCAGCAAGAAATTC AAGGTGCTGGGCAACACCGACCGGCACAGCATCAAGAAGAACCTGATC GGCGCCCTGCTGTTCGGCTCTGGCGAAACAGCCGAGGCCACCCGGCTG AAGAGAACCGCCAGAAGAAGATACACCAGACGGAAGAACCGGATCTGC TATCTGCAAGAGATCTTCAGCAACGAGATGGCCAAGGTGGACGACAGC TTCTTCCACAGACTGGAAGAGTCCTTCCTGGTGGAAGAGGATAAGAAG CACGAGCGGCACCCCATCTTCGGCAACATCGTGGACGAGGTGGCCTAC CACGAGAAGTACCCCACCATCTACCACCTGAGAAAGAAGCTGGCCGAC AGCACCGACAAGGCCGACCTGAGACTGATCTACCTGGCCCTGGCCCAC ATGATCAAGTTCCGGGGCCACTTCCTGATCGAGGGCGACCTGAACCCC GACAACAGCGACGTGGACAAGCTGTTCATCCAGCTGGTGCAGATCTAC AATCAGCTGTTCGAGGAAAACCCCATCAACGCCAGCAGAGTGGACGCC AAGGCCATCCTGAGCGCCAGACTGAGCAAGAGCAGACGGCTGGAAAAT CTGATCGCCCAGCTGCCCGGCGAGAAGCGGAATGGCCTGTTCGGCAAC CTGATTGCCCTGAGCCTGGGCCTGACCCCCAACTTCAAGAGCAACTTC GACCTGGCCGAGGATGCCAAACTGCAGCTGAGCAAGGACACCTACGAC GACGACCTGGACAACCTGCTGGCCCAGATCGGCGACCAGTACGCCGAC CTGTTTCTGGCCGCCAAGAACCTGTCCGACGCCATCCTGCTGAGCGAC ATCCTGAGAGTGAACAGCGAGATCACCAAGGCCCCCCTGTCCGCCTCT ATGATCAAGAGATACGACGAGCACCACCAGGACCTGACCCTGCTGAAA GCTCTCGTGCGGCAGCAGCTGCCTGAGAAGTACAAAGAGATTTTCTTC GACCAGAGCAAGAACGGCTACGCCGGCTACATCGATGGCGGAGCCAGC CAGGAAGAGTTCTACAAGTTCATCAAGCCCATCCTGGAAAAGATGGAC GGCACCGAGGAACTGCTCGTGAAGCTGAACAGAGAGGACCTGCTGCGG AAGCAGCGGACCTTCGACAACGGCAGCATCCCCCACCAGATCCACCTG GGAGAGCTGCACGCCATTCTGCGGCGGCAGGAAGATTTTTACCCATTC CTGAAGGACAACCGGGAAAAGATCGAGAAGATCCTGACCTTCAGAATC CCCTACTACGTGGGCCCTCTGGCCAGGGGAAACAGCAGATTCGCCTGG ATGACCAGAAAGAGCGAGGAAACCATCACCCCCTGGAACTTCGAGGAA GTGGTGGACAAGGGCGCCAGCGCCCAGAGCTTCATCGAGCGGATGACC AACTTCGATAAGAACCTGCCCAACGAGAAGGTGCTGCCCAAGCACAGC CTGCTGTACGAGTACTTCACCGTGTACAACGAGCTGACCAAAGTGAAA TACGTGACCGAGGGAATGCGGAAGCCCGCCTTTCTGAGCGGCGAGCAG AAAAAGGCCATCGTGGACCTGCTGTTCAAGACCAACCGGAAAGTGACC GTGAAGCAGCTGAAAGAGGACTACTTCAAGAAAATCGAGTGCTTCGAC AGCGTGGAAATCAGCGGCGTGGAAGATCGGTTCAACGCCTCCCTGGGC GCCTATCACGATCTGCTGAAAATTATCAAGGACAAGGACTTCCTGGAC AATGAGGAAAACGAGGACATTCTGGAAGATATCGTGCTGACCCTGACA CTGTTTGAGGACCGGGGCATGATCGAGGAACGGCTGAAAACCTATGCC CACCTGTTCGACGACAAAGTGATGAAGCAGCTGAAGCGGCGGAGATAC ACCGGCTGGGGCAGGCTGAGCCGGAAGCTGATCAACGGCATCCGGGAC AAGCAGTCCGGCAAGACAATCCTGGATTTCCTGAAGTCCGACGGCTTC GCCAACAGAAACTTCATGCAGCTGATCCACGACGACAGCCTGACCTTT AAAGAGGACATCCAGAAAGCCCAGGTGTCCGGCCAGGGACACTCTCTG CACGAGCAGATCGCCAATCTGGCCGGATCCCCCGCCATTAAGAAGGGC ATCCTGCAGACAGTGAAGATTGTGGACGAGCTCGTGAAAGTGATGGGC CACAAGCCCGAGAACATCGTGATCGAAATGGCCAGAGAGAACCAGACC ACCCAGAAGGGACAGAAGAACAGCCGCGAGAGAATGAAGCGGATCGAA GAGGGCATCAAAGAGCTGGGCAGCCAGATCCTGAAAGAACACCCCGTG GAAAACACCCAGCTGCAGAACGAGAAGCTGTACCTGTACTACCTGCAG AATGGGCGGGATATGTACGTGGACCAGGAACTGGACATCAACCGGCTG TCCGACTACGATGTGGACCACATTGTGCCCCAGTCCTTCATCAAGGAC GACTCCATCGATAACAAAGTGCTGACTCGGAGCGACAAGAACCGGGGC AAGAGCGACAACGTGCCCTCCGAAGAGGTCGTGAAGAAGATGAAGAAC TACTGGCGCCAGCTGCTGAATGCCAAGCTGATTACCCAGAGGAAGTTC GACAATCTGACCAAGGCCGAGAGAGGCGGCCTGAGCGAACTGGATAAG GCCGGCTTCATTAAGCGGCAGCTGGTGGAAACCCGGCAGATCACAAAG CACGTGGCACAGATCCTGGACTCCCGGATGAACACTAAGTACGACGAG AACGACAAACTGATCCGGGAAGTGAAAGTGATCACCCTGAAGTCCAAG CTGGTGTCCGACTTCAGAAAGGATTTCCAGTTTTACAAAGTGCGCGAG ATCAACAACTACCACCACGCCCACGACGCCTACCTGAACGCCGTCGTG GGAACCGCCCTGATCAAAAAGTACCCTAAGCTGGAAAGCGAGTTCGTG TACGGCGATTACAAGGTGTACGACGTGCGGAAGATGATCGCCAAGAGC GAGCAGGAAATCGGCAAGGCTACCGCCAAGTACTTCTTCTACAGCAAC ATCATGAACTTTTTCAAGACCGAGATCACACTGGCCAACGGCGAGATC AGAAAGCGGCCTCTGATCGAGACAAACGGCGAAACCGGGGAGATCGTG TGGGATAAGGGCCGGGATTTTGCCACAGTGCGGAAAGTGCTGTCCATG CCCCAAGTGAATATCGTGAAAAAGACCGAGGTGCAGACCGGCGGCTTC AGCAAAGAGTCTATCCTGCCCAAGAGGAACTCCGACAAGCTGATCGCC AGAAAGAAGGATTGGGACCCTAAGAAGTACGGCGGCTTTGACAGCCCC ACCGTGGCCTACTCTGTGCTGGTGGTGGCCAAAGTGGAAAAGGGCAAG TCCAAGAAACTGAAGAGTGTGAAAGAGCTGCTGGGGATCACCATCATG GAAAGAAGCAGCTTCGAGAAGAATCCCATCGACTTTCTGGAAGCCAAG GGCTACAAAGAAGTGAAAAAGGACCTGATCATCAAGCTGCCTAAGTAC TCCCTGTTCGAGCTGGAAAACGGCCGGAAGCGGATGCTGGCTTCTGCC GGCGAACTGCAGAAGGGAAACGAGCTGGCCCTGCCCTCCAAATATGTG AACTTCCTGTACCTGGCCAGCCACTATGAGAAGCTGAAGGGCTCCCCC GAGGATAATGAGCAGAAACAGCTGTTTGTGGAACAGCACAAGCACTAC CTGGACGAGATCATCGAGCAGATTAGCGAGTTCTCCAAGCGCGTGATC CTGGCCGATGCCAACCTGGACAAGGTGCTGAGCGCCTACAACAAGCAC CGGGATAAGCCCATCAGAGAGCAGGCCGAGAATATCATCCACCTGTTT ACCCTGACCAACCTGGGAGCCCCTGCCGCCTTCAAGTACTTTGACACC ACCATCGACCGGAAGAGGTACACCAGCACCAAAGAGGTGCTGGACGCC ACCCTGATCCACCAGAGCATCACCGGCCTGTACGAGACACGGATCGAC CTGTCTCAGCTGGGAGGCGACCCCAAGAAAAAGCGCAAAGTG - The modified Cas9 DNA sequence was placed under the control of cytomegalovirus (CMV) promoter for constituent expression in mammalian cells. The modified Cas9 DNA sequence was also placed under the control T7 promoter for in vitro mRNA synthesis with T7 RNA polymerase. In vitro RNA transcription was performed by using MessageMAX T7 ARCA-Capped Message Transcription Kit and T7 mScript Standard mRNA Production System (Cellscript).
- The adeno-associated virus integration site 1 (AAVS1) locus was used as a target for Cas9-mediated human genome modification. The human AAVS1 locus is located in intron 1 (4427 bp) of protein phosphatase 1, regulatory subunit 12C (PPP1R12C). Table 3 presents the first exon (shaded gray) and the first intron of PPP1R12C. The underlined sequence within the intron is the targeted modification site (i.e., AAVS1 locus).
-
TABLE 3 First Exon and Intron of PPP1R12C (5′-3′) CAGGTCCACCCTCTGCTGCGCCACCTGGGGCATCCTCCTTCCCCGTTGCCAGTCT CGATCCGCCCCGTCGTTCCTGGCCCTGGGCTTTGCCACCCTATGCTGACACCCCG TCCCAGTCCCCCTTACCATTCCCCTTCGACCACCCCACTTCCGAATTGGAGCCGCT TCAACTGGCCCTGGGCTTAGCCACTCTGTGCTGACCACTCTGCCCCAGGCCTCCT TACCATTCCCCTTCGACCTACTCTCTTCCGCATTGGAGTCGCTTTAACTGGCCCTG GCTTTGGCAGCCTGTGCTGACCCATGCAGTCCTCCTTACCATCCCTCCCTCGACTT CCCCTCTTCCGATGTTGAGCCCCTCCAGCCGGTCCTGGACTTTGTCTCCTTCCCTG CCCTGCCCTCTCCTGAACCTGAGCCAGCTCCCATAGCTCAGTCTGGTCTATCTGCC TGGCCCTGGCCATTGTCACTTTGCGCTGCCCTCCTCTCGCCCCCGAGTGCCCTTG CTGTGCCGCCGGAACTCTGCCCTCTAACGCTGCCGTCTCTCTCCTGAGTCCGGAC CACTTTGAGCTCTACTGGCTTCTGCGCCGCCTCTGGCCCACTGTTTCCCCTTCCCA GGCAGGTCCTGCTTTCTCTGACCTGCATTCTCTCCCCTGGGCCTGTGCCGCTTTCT GTCTGCAGCTTGTGGCCTGGGTCACCTCTACGGCTGGCCCAGATCCTTCCCTGCC GCCTCCTTCAGGTTCCGTCTTCCTCCACTCCCTCTTCCCCTTGCTCTCTGCTGTGT TGCTGCCCAAGGATGCTCTTTCCGGAGCACTTCCTTCTCGGCGCTGCACCACGTG ATGTCCTCTGAGCGGATCCTCCCCGTGTCTGGGTCCTCTCCGGGCATCTCTCCTC CCTCACCCAACCCCATGCCGTCTTCACTCGCTGGGTTCCCTTTTCCTTCTCCTTCT GGGGCCTGTGCCATCTCTCGTTTCTTAGGATGGCCTTCTCCGACGGATGTCTCCCT TGCGTCCCGCCTCCCCTTCTTGTAGGCCTGCATCATCACCGTTTTTCTGGACAACC CCAAAGTACCCCGTCTCCCTGGCTTTAGCCACCTCTCCATCCTCTTGCTTTCTTTG CCTGGACACCCCGTTCTCCTGTGGATTCGGGTCACCTCTCACTCCTTTCATTTGGG CAGCTCCCCTACCCCCCTTACCTCTCTAGTCTGTGCTAGCTCTTCCAGCCCCCTGT CATGGCATCTTCCAGGGGTCCGAGAGCTCAGCTAGTCTTCTTCCTCCAACCCGGG CCCCTATGTCCACTTCAGGACAGCATGTTTGCTGCCTCCAGGGATCCTGTGTCCCC GAGCTGGGACCACCTTATATTCCCAGGGCCGGTTAATGTGGCTCTGGTTCTGGGT ACTTTTATCTGTCCCCTCCACCCCACAGTGGGGCCACTAGGGACAGGATTGGTGA CAGAAAAGCCCCATCCTTAGGCCTCCTCCTTCCTAGTCTCCTGATATTGGGTCTAA CCCCCACCTCCTGTTAGGCAGATTCCTTATCTGGTGACACACCCCCATTTCCTGGA GCCATCTCTCTCCTTGCCAGAACCTCTAAGGTTTGCTTACGATGGAGCCAGAGAGG ATCCTGGGAGGGAGAGCTTGGCAGGGGGTGGGAGGGAAGGGGGGGATGCGTGA CCTGCCCGGTTCTCAGTGGCCACCCTGCGCTACCCTCTCCCAGAACCTGAGCTGC TCTGACGCGGCCGTCTGGTGCGTTTCACTGATCCTGGTGCTGCAGCTTCCTTACA CTTCCCAAGAGGAGAAGCAGTTTGGAAAAACAAAATCAGAATAAGTTGGTCCTGAG TTCTAACTTTGGCTCTTCACCTTTCTAGTCCCCAATTTATATTGTTCCTCCGTGCGT CAGTTTTACCTGTGAGATAAGGCCAGTAGCCAGCCCCGTCCTGGCAGGGCTGTGG TGAGGAGGGGGGTGTCCGTGTGGAAAACTCCCTTTGTGAGAATGGTGCGTCCTAG GTGTTCACCAGGTCGTGGCCGCCTCTACTCCCTTTCTCTTTCTCCATCCTTCTTTCC TTAAAGAGTCCCCAGTGCTATCTGGGACATATTCCTCCGCCCAGAGCAGGGTCCC GCTTCCCTAAGGCCCTGCTCTGGGCTTCTGGGTTTGAGTCCTTGGCAAGCCCAGG AGAGGCGCTCAGGCTTCCCTGTCCCCCTTCCTCGTCCACCATCTCATGCCCCTGG CTCTCCTGCCCCTTCCCTACAGGGGTTCCTGGCTCTGCTCTTCAGACTGAGCCCC GTTCCCCTGCATCCCCGTTCCCCTGCATCCCCTTCCCCTGCATCCCCCAGAGGC CCCAGGCCACCTACTTGGCCTGGACCCCACGAGAGGCCACCCCAGCCCTGTCTA CCAGGCTGCCTTTTGGGTGGATTCTCCTCCAACTGTGGGGTGACTGCTTGGCAAA CTCACTCTTCGGGGTATCCCAGGAGGCCTGGAGCATTGGGGTGGGCTGGGGTTC AGAGAGGAGGGATTCCCTTCTCAGGTTACGTGGCCAAGAAGCAGGGGAGCTGGG TTTGGGTCAGGTCTGGGTGTGGGGTGACCAGCTTATGCTGTTTGCCCAGGACAGC CTAGTTTTAGCACTGAAACCCTCAGTCCTAGGAAAACAGGGATGGTTGGTCACTGT CTCTGGGTGACTCTTGATTCCCGGCCAGTTTCTCCACCTGGGGCTGTGTTTCTCGT CCTGCATCCTTCTCCAGGCAGGTCCCCAAGCATCGCCCCCTGCTGTGGCTGTTC CCAAGTTCTTAGGGTACCCCACGTGGGTTTATCAACCACTTGGTGAGGCTGGTACC CTGCCCCCATTCCTGCACCCCAATTGCCTTAGTGGCTAGGGGGTTGGGGGCTAGA GTAGGAGGGGCTGGAGCCAGGATTCTTAGGGCTGAACAGAGAAGAGCTGGGGGC CTGGGCTCCTGGGTTTGAGAGAGGAGGGGCTGGGGCCTGGACTCCTGGGTCCGA GGGAGGAGGGGCTGGGGCCTGGACTCCTGGGTCTGAGGGTGGAGGGACTGGGG GCCTGGACTCCTGGGTCCGAGGGAGGAGGGGCTGGGGCCTGGACTCGTGGGTC TGAGGGAGGAGGGGCTGGGGGCCTGGACTTCTGGGTCTTAGGGAGGCGGGGCT GGGCCTGGACCCCTGGGTCTGAATGGGGAGAGGCTGGGGGCCTGGACTCCTTCA TCTGAGGGCGGAAGGGCTGGGGCCTGGCCTCCTGGGTTGAATGGGGAGGGGTTG GGCCTGGACTCTGGAGTCCCTGGTGCCCAGGCCTCAGGCATCTTTCACAGGGATG CCTGTACTGGGCAGGTCCTTGAAAGGGAAAGGCCCATTGCTCTCCTTGCCCCCCT CCCCTATCGCCATGACAACTGGGTGGAAATAAACGAGCGAGTTCATCCCGTTCC CAGGGCACGTGCGGCCCCTTCACAGCCCGAGTTTCCATGACCTCATGCTCTTGGC CCTCGTAGCTCCCTCCCGCCTCCTCCAGATGGGCAGCTTTGGAGAGGTGAGGGAC TTGGGGGGTAATTTATCCCGTGGATCTAGGAGTTTAGCTTCACTCCTTCCTCAGCT CCAGTTCAGGTCCCGGAGCCCACCCAGTGTCCACAAGGCCTGGGGCAAGTCCCT CCTCCGACCCCCTGGACTTCGGCTTTTGTCCCCCCAAGTTTTGGACCCCTAAGGG AAGAATGAGAAACGGTGGCCCGTGTCAGCCCCTGGCTGCAGGGCCCCGTGCAGA GGGGGCCTCAGTGAACTGGAGTGTGACAGCCTGGGGCCCAGGCACACAGGTGTG CAGCTGTCTCACCCCTCTGGGAGTCCCGCCCAGGCCCCTGAGTCTGTCCCAGCAC AGGGTGGCCTTCCTCCACCCTGCATAGCCCTGGGCCCACGGCTTCGTTCCTGCAG AGTATCTGCTGGGGTGGTTTCCGAGCTTGACCCTTGGAAGGACCTGGCTGGGTTT AAGGCAGGAGGGGCTGGGGGCCAGGACTCCTGGCTCTGAAGGAGGAGGGGCTG GAACCTCTTCCCTAGTCTGAGCACTGGAAGCGCCACCTGTGGGTGGTGACGGGG GTTTTGCCGTGTCTAACAGGTACCATGTGGGGTTCCCGCACCCAGATGAGAAGCC CCCTCCCTTCCCCGTTCACTTCCTGTTTGCAGATAGCCAGGAGTCCTTTCGTGGTT TCCACTGAGCACTGAAGGCCTGGCCGGCCTGACCACTGGGCAACCAGGCGTATC TTAAACAGCCAGTGGCCAGAGGCTGTTGGGTCATTTTCCCCACTGTCCTAGCACC GTGTCCCTGGATCTGTTTTCGTGGCTCCCTCTGGAGTCCCGACTTGCTGGGACAC CGTGGCTGGGGTAGGTGCGGCTGACGGCTGTTTCCCACCCCCAG (SEQ ID NO: 11) - Cas9 guide RNAs were designed for targeting the human AAVS1 locus. A 42 nucleotide RNA (referred to herein as a “crRNA” sequence) comprising (5′ to 3′) a target recognition sequence (i.e., sequence complementary to the non-coding strand of the target sequence) and protospacer sequence; a 85 nucleotide RNA (referred to herein as a “tracrRNA” sequence) comprising 5′ sequence with complementarity to the 3′ sequence of the crRNA and additional hairpin sequence; and a chimeric RNA comprising nucleotides 1-32 of the crRNA, a GAAA loop, and nucleotides 19-45 of the tracrRNA were prepared. The crRNA was chemically synthesized by Sigma-Aldrich. The tracrRNA and chimeric RNA were synthesized by in vitro transcription with T7 RNA polymerase using T7-Scribe Standard RNA IVT Kit (Cellscript). The chimeric RNA coding sequence was also placed under the control of human U6 promoter for in vivo transcription in human cells. Table 4 presents the sequences of the guide RNAs.
-
TABLE 4 Guide RNAs SEQ ID RNA 5′-3′ Sequence NO: AAVS1- ACCCCACAGUGGGGCCACUAG 12 crRNA UUUUAGAGCUAUGCUGUUUUG tracrRNA GGAACCAUUCAAAACAGCAUA 13 GCAAGUUAAAAUAAGGCUAGU CCGUUAUCAACUUGAAAAAGU GGCACCGAGUCGGUGCUUUUU UU chimeric ACCCCACAGUGGGGCCACUAG 14 RNA UUUUAGAGCUAGAAAUAGCAA GUUAAAAUAAGGCUAGUCCG - Targeted integration of a GFP protein into the N terminus of PPP1R12C was used to monitor Cas9-mediated genome modification. To mediate integration by homologous recombination a donor polynucleotide was prepared. The AAVS1-GFP DNA donor contained a 5′ (1185 bp) AAVS1 locus homologous arm, an RNA splicing receptor, a turbo GFP coding sequence, a 3′ transcription terminator, and a 3′ (1217 bp) AAVS1 locus homologous arm. Table 5 presents the sequences of the RNA splicing receptor and the GFP coding sequence followed by the 3′ transcription terminator. Plasmid DNA was prepared by using GenElute Endotoxin-Free Plasmid Maxiprep Kit (Sigma).
-
TABLE 5 Sequences in the AAVS1-GFP DNA donor sequence SEQ ID 5′-3′ Sequence NO: RNA splicing CTGACCTCTTCTCTTCCTCCCACAG 15 receptor GFP coding GCCACCATGGACTACAAAGACGATG 16 sequence and ACGACAAGGTCGACTCTAGAGCTGC transcription AGAGAGCGACGAGAGCGGCCTGCCC terminator GCCATGGAGATCGAGTGCCGCATCA CCGGCACCCTGAACGGCGTGGAGTT CGAGCTGGTGGGCGGCGGAGAGGGC ACCCCCGAGCAGGGCCGCATGACCA ACAAGATGAAGAGCACCAAAGGCGC CCTGACCTTCAGCCCCTACCTGCTG AGCCACGTGATGGGCTACGGCTTCT ACCACTTCGGCACCTACCCCAGCGG CTACGAGAACCCCTTCCTGCACGCC ATCAACAACGGCGGCTACACCAACA CCCGCATCGAGAAGTACGAGGACGG CGGCGTGCTGCACGTGAGCTTCAGC TACCGCTACGAGGCCGGCCGCGTGA TCGGCGACTTCAAGGTGATGGGCAC CGGCTTCCCCGAGGACAGCGTGATC TTCACCGACAAGATCGTCCGCAGCA ACGCCACCGTGGAGCACCTGCACCC CATGGGCGATAACGATCTGGATGGC AGCTTCACCCGCACCTTCAGCCTGC GCGACGGCGGCTACTACAGCTCCGT GGTGGACAGCCACATGCACTTCAAG AGCGCCATCCACCCCAGCATCCTGC AGAACGGGGGCCCCATGTTCGCCTT CCGCCGCGTGGAGGAGGATCACAGC AACACCGAGCTGGGCATCGTGGAGT ACCAGCACGCCTTCAAGACCCCGGA TGCAGATGCCGGTGAAGAATGAAGA TCTCTGTGCCTTCTAGTTGCCAGCC ATCTGTTGTTTGCCCCTCCCCCGTG CCTTCCTTGACCCTGGAAGGTGCCA CTCCCACTGTCCTTTCCTAATAAAA TGAGGAAATTGCATCGCATTGTCTG AGTAGGTGTCATTCTATTCTGGGGG GTGGGGTGGGGCAGGACAGCAAGGG GGAGGATTGGGAAGACAATAGCAGG CATGCTGGGGATGCGGTGGGCTCTA TGGACTCGAGGTTTAAACGTCGACG CGGCCGCGT - Targeted gene integration will result in a fusion protein between the first 107 amino acids of the PPP1R12C and the turbo GFP. The expected fusion protein contains the first 107 amino acid residues of PPP1R12C (highlighted in grey) from RNA splicing between the first exon of PPP1R12C and the engineered splice receptor (see Table 6).
-
TABLE 6 Predicted amino acid sequence of the PPP1R12C-GFP fusion protein. KDDDDKVDSRAAESDESGLPAMEIECRITGTLNGVEFELVGGGEGTPEQGRMTNKMK STKGALTFSPYLLSHVMGYGFYHFGTYPSGYENPFLHAINNGGYTNTRIEKYEDGGVL HVSFSYRYEAGRVIGDFKVMGTGFPEDSVIFTDKIVRSNATVEHLHPMGDNDLDGSFT RTFSLRDGGYYSSVVDSHMHFKSAIHPSILQNGGPMFAFRRVEEDHSNTELGIVEYQH AFKTPDADAGEE (SEQ ID NO: 17) - Transfection was performed on human K562 cells. The K562 cell line was obtained from American Type Culture Collection (ATCC) and grown in Iscove's Modified Dulbecco's Medium, supplemented with 10% FBS and 2 mM L-glutamine. All media and supplements were obtained from Sigma-Aldrich. Cultures were split one day before transfection (at approximately 0.5 million cells per mL before transfection). Cells were transfected with Nucleofector Solution V (Lonza) on a Nucleofector (Lonza) with the T-016 program. Each nucleofection contained approximately 0.6 million cells. Transfection treatments are detailed in Table 7. Cells were grown at 37° C. and 5% CO2 immediately after nucleofection.
-
TABLE 7 Transfection Treatments. Treat- Donor ment Modified Cas9 Guide RNA sequence A Cas9 mRNA transcribed pre-annealed AAVS1-GFP with an Anti-Reverse Cap crRNA-tracrRNA plasmid DNA Analog (10 μg) duplex (0.3 nmol) (10 μg) B Cas9 mRNA transcribed chimeric RNA AAVS1-GFP with an Anti-Reverse Cap (0.3 nmol) plasmid DNA Analog (10 μg) (10 μg) C Cas9 mRNA capped via chimeric RNA AAVS1-GFP post-transcription capping (0.3 nmol) plasmid DNA reaction (10 μg) (10 μg) D Cas9 plasmid DNA (10 μg) U6-chimeric AAVS1-GFP RNA plasmid plasmid DNA DNA (5 μg) (10 μg) E None None AAVS1-GFP plasmid DNA (10 μg) F None None None - Fluorescence-activated cell sorting (FACS) was performed 4 days after transfection. FACS data are presented in
FIGS. 4A-F . The percent GFP detected in each of the four experimental treatments (FIGS. 4A-D ) was greater than in the control treatments (FIGS. 4E and 4F ), confirming integration of the donor sequence and expression of the fusion protein. - Genomic DNA was extracted from transfected cells with GenElute Mammalian Genomic DNA Miniprep Kit (Sigma) 12 days after transfection. Genomic DNA was then PCR amplified with a forward primer located outside the 5′ homologous arm of the AAVS1-GFP plasmid donor and a reverse primer located at the 5′ region of the GFP. The forward primer was 5′-CCACTCTGTGCTGACCACTCT-3′ (SEQ ID NO:18) and reverse primer was 5′-GCGGCACTCGATCTCCA-3′ (SEQ ID NO:19). The expected fragment size from the junction PCR was 1388 bp. The amplification was carried out with JumpStart Taq ReadyMix (Sigma), using the following cycling conditions: 98° C. for 2 minutes for initial denaturation; 35 cycles of 98° C. for 15 seconds, 62° C. for 30 seconds, and 72° C. for 1 minutes and 30 seconds; and a final extension at 72° C. for 5 minutes. PCR products were resolved on 1% agarose gel.
- Cells transfected with 10 μg of Cas9 mRNA transcribed with an Anti-Reverse Cap Analog, 0.3 nmol of pre-annealed crRNA-tracrRNA duplex, and 10 μg of AAVS1-GFP plasmid DNA displayed a PCR product of the expected size (see lane A in
FIG. 5 ). - The mouse Rosa26 locus can be targeted for genome modifications. Table 8 presents a portion of the mouse Rosa26 sequence in which potential target sites are shown in bold. Each target site comprises a protospacer.
-
TABLE 8 Mouse Rosa26 Sequence (SEQ ID NO: 20) GAGCGGCTGCGGGGCGGGTGCAAGCACGTTTCCGACTTGAGTTGCCT CAAGAGGGGCGTGCTGAGCCAGACCTCCATCGCGCACTCCGGGGAGT GGAGGGAAGGAGCGAGGGCTCAGTTGGGCTGTTTTGGAGGCAGGAAG CACTTGCTCTCCCAAAGTCGCTCTGAGTTGTTATCAGTAAGGGAGCT GCAGTGGAGTAGGCGGGGAGAAGGCCGCACCCTTCTCCGGAGGGGGG AGGGGAGTGTTGCAATACCTTTCTGGGAGTTCTCTGCTGCCTCCTGG CTTCTGAGGACCGCCCTGGGCCTGGGAGAATCCCTTCCCCCTCTTCC CTCGTGATCTGCAACTCCAGTCTTTCTAGAAGATGGGCGGGAGTCTT CTGGGCAGGCTTAAAGGCTAACCTGGTGTGTGGGCGTTGTCCTGCAG GGGAATTGAACAGGTGTAAAATTGGAGGGACAAGACTTCCCACAGAT TTTCGGTTTTGTCGGGAAGTTTTTTAATAGGGGCAAATAAGGAAAAT GGGAGGATAGGTAGTCATCTGGGGTTTTATGCAGCAAAACTACAGGT TATTATTGCTTGTGATCCGCCTCGGAGTATTTTCCATCGAGGTAGAT TAAAGACATGCTCACCCGAGTTTTATACTCTCCTGCTTGAGATCCTT ACTACAGTATGAAATTACAGTGTCGCGAGTTAGACTATGTAAGCAGA ATTTTA - Guide RNAs were designed to target each of the target sites in the mouse Rosa26 locus. The sequences are shown in Table 9, each is 42 nucleotides in length and the 5′ region is complementary to the strand that is not presented in Table 8 (i.e., the strand that is complementary to the strand shown in Table 8).
-
TABLE 9 Mouse Rosa26 Guide RNAs SEQ ID RNA 5′-3′ Sequence NO: mRosa26-crRNA-1 CUCCAGUCUUUCUAGAAGAUG 21 UUUUAGAGCUAUGCUGUUUUG mRosa26-crRNA-2 UGAACAGGUGUAAAAUUGGAG 22 UUUUAGAGCUAUGCUGUUUUG mRosa26-crRNA-3 UGUCGGGAAGUUUUUUAAUAG 23 UUUUAGAGCUAUGCUGUUUUG - The crRNAs were chemically synthesized and pre-annealed to the tracrRNA (SEQ ID NO:13; see Example 2). Pre-annealed crRNA/tracrRNA and in vitro transcribed mRNA encoding modified Cas9 protein (SEQ ID NO. 9; see Example 1) can be microinjected into the pronuclei of fertilized mouse embryos. Upon guidance to the target set by the crRNA, the Cas9 protein cleaves the target site, and the resultant double-stranded break can be repaired via a non-homologous end-joining (NHEJ) repair process. The injected embryos can be either incubated at 37° C., 5% CO2 overnight or for up to 4 days, followed by genotyping analysis, or the injected embryos can be implanted into recipient female mice such that live born animals can be genotyped. The in vitro-incubated embryos or tissues from live born animals can be screened for the presence of Cas9-induced mutation at the Rosa locus using standard methods. For example, the embryos or tissues from fetus or live-born animals can be harvested for DNA extraction and analysis. DNA can be isolated using standard procedures. The targeted region of the Rosa26 locus can be PCR amplified using appropriate primers. Because NHEJ is error-prone, deletions of at least one nucleotide, insertions of at least one nucleotide, substitutions of at least one nucleotide, or combinations thereof can occur during the repair of the break. Mutations can be detected using PCR-based genotyping methods, such as Cel-I mismatch assays and DNA sequencing.
- The Rosa26 locus can be modified in mouse embryos by co-injecting a donor polynucleotide, as detailed above in section (IV)(d), along with the pre-annealed crRNA/tracrRNA and mRNA encoding modified Cas9 as described above in Example 6. In vitro-incubated embryos or tissues from live born animals (as described in Example 6) can be screened for a modified Rosa26 locus using PCR-based genotyping methods, such as RFLP assays, junction PCR, and DNA sequencing.
- The rat Rosa26 locus can be targeted for genome modifications. Table 10 presents a portion of the rat sequence in which potential target sites are shown in bold. Each target site comprises a protospacer.
-
TABLE 10 Rat Rosa26 Sequence (SEQ ID NO: 24) GGGATTCCTCCTTGAGTTGTGGCACTGAGGAACGTGCTGAACAAGAC CTACATTGCACTCCAGGGAGTGGATGAAGGAGTTGGGGCTCAGTCGG GTTGTATTGGAGACAAGAAGCACTTGCTCTCCAAAAGTCGGTTTGAG TTATCATTAAGGGAGCTGCAGTGGAGTAGGCGGAGAAAAGGCCGCAC CCTTCTCAGGACGGGGGAGGGGAGTGTTGCAATACCTTTCTGGGAGT TCTCTGCTGCCTCCTGTCTTCTGAGGACCGCCCTGGGCCTGGAAGAT TCCCTTCCCCCTTCTTCCCTCGTGATCTGCAACTGGAGTCTTTCTGG AAGATAGGCGGGAGTCTTCTGGGCAGGCTTAAAGGCTAACCTGGTGC GTGGGGCGTTGTCCTGCAGAGGAATTGAACAGGTGTAAAATTGGAGG GGCAAGACTTCCCACAGATTTTCGATTGTGTTGTTAAGTATTGTAAT AGGGGCAAATAAGGGAAATAGACTAGGCACTCACCTGGGGTTTTATG CAGCAAAACTACAGGTTATTATTGCTTGTGATCCGCCCTGGAGAATT TTTCACCGAGGTAGATTGAAGACATGCCCACCCAAATTTTAATATTC TTCCACTTGCGATCCTTGCTACAGTATGAAA - Guide RNAs were designed to target each of the target sites in the rat Rosa26 locus. The sequences are shown in Table 11, each is 42 nucleotides in length and the 5′ region is complementary to the strand that is not presented in Table 10 (i.e., the strand that is complementary to the strand shown in Table 10).
-
TABLE 11 Rat Rosa26 Guide RNAs SEQ ID RNA 5′-3′ Sequence NO: rRosa26-crRNA-1 AGGGGGAAGGGAAUCUUCCAG 25 UUUUAGAGCUAUGCUGUUUUG rRosa26-crRNA-2 UCUGCAACUGGAGUCUUUCUG 26 UUUUAGAGCUAUGCUGUUUUG rRosa26-crRNA-3 AGGCGGGAGUCUUCUGGGCAG 27 UUUUAGAGCUAUGCUGUUUUG - The crRNAs were chemically synthesized and pre-annealed to the tracrRNA (SEQ ID NO:13; see Example 2). Pre-annealed crRNA/tracrRNA and in vitro transcribed mRNA encoding modified Cas9 protein (SEQ ID NO. 9; see Example 1) can be microinjected into the pronuclei of fertilized rat embryos. Upon guidance to the target site by the crRNA, the Cas9 protein cleaves the target site, and the resultant double-stranded break can be repaired via a non-homologous end-joining (NHEJ) repair process. The injected embryos can be either incubated at 37° C., 5% CO2 overnight or for up to 4 days, followed by genotyping analysis, or the injected embryos can be implanted into recipient female mice such that live born animals can be genotyped. The in vitro-incubated embryos or tissues from live born animals can be screened for the presence of Cas9-induced mutation at the Rosa locus using standard methods. For example, the embryos or tissues from fetus or live-born animals can be harvested for DNA extraction and analysis. DNA can be isolated using standard procedures. The targeted region of the Rosa26 locus can be PCR amplified using appropriate primers. Because NHEJ is error-prone, deletions of at least one nucleotide, insertions of at least one nucleotide, substitutions of at least one nucleotide, or combinations thereof can occur during the repair of the break. Mutations can be detected using PCR-based genotyping methods, such as Cel-I mismatch assays and DNA sequencing.
- The Rosa26 locus can be modified in rat embryos by co-injecting a donor polynucleotide, as detailed above in section (IV)(d), along with the pre-annealed crRNA/tracrRNA and mRNA encoding modified Cas9 as described above in Example 8. In vitro-incubated embryos or tissues from live born rats (as described in Example 8) can be screened for a modified Rosa26 locus using PCR-based genotyping methods, such as RFLP assays, junction PCR, and DNA sequencing.
Claims (30)
1. A method for cleaving a chromosomal sequence in a cell or embryo, the method comprising introducing into the cell or embryo (a) at least one fusion protein or nucleic acid encoding at least one fusion protein, wherein the fusion protein comprises a Cas9 protein mutated in the RuvC and HNH domains so that it no longer possesses nuclease activity or a fragment thereof and a cleavage domain, and (b) at least one guide RNA or DNA encoding at least one guide RNA, wherein the at least one guide RNA guides the mutated Cas9 protein of the fusion protein to a target site in the chromosomal sequence and the cleavage domain of the fusion protein cleaves the chromosomal sequence.
2. The method of claim 1 , wherein the mutation in the RuvC domain of the mutated Cas9 protein is D10A.
3. The method of claim 1 , wherein the mutation in the HNH domain of the mutated Cas9 is H840A or H839A.
4. The method of claim 1 , wherein fusion protein further comprises at least one additional domain chosen from a nuclear localization signal, a cell-penetrating domain, and a marker domain.
5. The method of claim 1 , wherein one fusion protein or nucleic acid encoding one fusion protein and two guide RNAs or DNA encoding two guide RNAs are introduced into the cell or embryo.
6. The method of claim 1 , wherein two fusion proteins or nucleic acid encoding two fusion proteins and two guide RNAs or DNA encoding two guide RNAs are introduced into the cell or embryo.
7. The method of claim 6 , wherein each fusion protein comprises a different Cas9 protein or fragment thereof.
8. The method of claim 6 , wherein each fusion protein comprises a different cleavage domain.
9. The method of claim 1 , further comprising introducing into the cell or embryo at least one donor polynucleotide.
10. The method of claim 1 , wherein the cell is a human cell, a non-human mammalian cell, a stem cell, a non-mammalian vertebrate cell, an invertebrate cell, a plant cell, or a single cell eukaryotic organism.
11. The method of claim 1 , wherein the embryo is a non-human one cell animal embryo.
12. The method of claim 1 , wherein the cleavage domain is derived from a type II-S endonuclease.
13. The method of claim 12 , wherein the type II-S endonuclease is FokI or a derivative thereof.
14. The method of claim 1 , wherein the at least one guide RNA is at least partially chemically synthesized.
15. A fusion protein comprising a CRISPR/Cas-like protein or fragment thereof and a cleavage domain, wherein the CRISPR/Cas-like protein is a Cas9 protein mutated in the RuvC and HNH domains so that it no longer possesses nuclease activity.
16. The fusion protein of claim 15 , wherein the mutation in the RuvC domain of the mutated Cas9 protein is D10A.
17. The fusion protein of claim 15 , wherein the mutation in the HNH domain of the mutated Cas9 is H840A or H839A.
18. The fusion protein of claim 15 , wherein the fusion protein further comprises at least one additional domain chosen from a nuclear localization signal, a cell-penetrating domain, and a marker domain.
19. The fusion protein of claim 15 , wherein the cleavage domain is derived from a type II-S endonuclease.
20. The fusion protein of claim 19 , wherein the type II-S endonuclease is FokI or a derivative thereof.
21. A nucleic acid encoding a fusion protein, the fusion protein comprising a CRISPR/Cas-like protein or fragment thereof and a cleavage domain, wherein the CRISPR/Cas-like protein is a Cas9 protein mutated in the RuvC and HNH domains so that it no longer possesses nuclease activity.
22. The nucleic acid of claim 21 , wherein the fusion protein further comprises at least one additional domain chosen from a nuclear localization signal, a cell-penetrating domain, and a marker domain.
23. The nucleic acid of claim 21 , wherein the nucleic acid is operably linked to at least one promoter control sequence.
24. The nucleic acid of claim 21 , wherein the nucleic acid is codon-optimized for expression in a eukaryotic cell and the fusion protein further comprises a nuclear localization signal.
25. The nucleic acid of claim 24 , wherein the nucleic acid is operably linked to at least one promoter control sequence.
26. The nucleic acid of claim 25 , wherein the nucleic acid is present in a vector.
27. The nucleic acid of claim 26 , wherein the vector is a lentiviral vector or an adeno-associated viral vector.
28. The nucleic acid of claim 27 , wherein the vector further encodes a guide RNA.
29. The nucleic acid of claim 21 , wherein the cleavage domain is derived from a type II-S endonuclease.
30. The nucleic acid of claim 29 , wherein the type II-S endonuclease is FokI or a derivative thereof.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US15/188,909 US20160298133A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
Applications Claiming Priority (7)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201261734256P | 2012-12-06 | 2012-12-06 | |
US201361758624P | 2013-01-30 | 2013-01-30 | |
US201361761046P | 2013-02-05 | 2013-02-05 | |
US201361794422P | 2013-03-15 | 2013-03-15 | |
PCT/US2013/073307 WO2014089290A1 (en) | 2012-12-06 | 2013-12-05 | Crispr-based genome modification and regulation |
US201514649777A | 2015-06-04 | 2015-06-04 | |
US15/188,909 US20160298133A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
Related Parent Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/649,777 Division US20160017366A1 (en) | 2012-12-06 | 2013-12-05 | Crispr-based genome modification and regulation |
PCT/US2013/073307 Division WO2014089290A1 (en) | 2012-12-06 | 2013-12-05 | Crispr-based genome modification and regulation |
Publications (1)
Publication Number | Publication Date |
---|---|
US20160298133A1 true US20160298133A1 (en) | 2016-10-13 |
Family
ID=50883989
Family Applications (15)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/649,777 Abandoned US20160017366A1 (en) | 2012-12-06 | 2013-12-05 | Crispr-based genome modification and regulation |
US15/188,909 Abandoned US20160298133A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
US15/188,933 Abandoned US20160298138A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
US15/188,927 Abandoned US20160298136A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
US15/188,924 Active US10745716B2 (en) | 2012-12-06 | 2016-06-21 | CRISPR-based genome modification and regulation |
US15/188,899 Abandoned US20160298125A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
US15/188,931 Abandoned US20160298137A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
US15/188,911 Active US10731181B2 (en) | 2012-12-06 | 2016-06-21 | CRISPR-based genome modification and regulation |
US15/188,902 Abandoned US20160298132A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
US15/342,976 Abandoned US20170073705A1 (en) | 2012-12-06 | 2016-11-03 | Crispr-based genome modification and regulation |
US15/456,204 Pending US20170191082A1 (en) | 2012-12-06 | 2017-03-10 | Crispr-based genome modification and regulation |
US16/654,613 Abandoned US20200140897A1 (en) | 2012-12-06 | 2019-10-16 | Crispr-based genome modification and regulation |
US16/943,792 Abandoned US20210079427A1 (en) | 2012-12-06 | 2020-07-30 | Crispr-based genome modification and regulation |
US16/943,767 Pending US20210207173A1 (en) | 2012-12-06 | 2020-07-30 | Crispr-based genome modification and regulation |
US17/398,648 Pending US20210388396A1 (en) | 2012-12-06 | 2021-08-10 | Crispr-based genome modification and regulation |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/649,777 Abandoned US20160017366A1 (en) | 2012-12-06 | 2013-12-05 | Crispr-based genome modification and regulation |
Family Applications After (13)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/188,933 Abandoned US20160298138A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
US15/188,927 Abandoned US20160298136A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
US15/188,924 Active US10745716B2 (en) | 2012-12-06 | 2016-06-21 | CRISPR-based genome modification and regulation |
US15/188,899 Abandoned US20160298125A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
US15/188,931 Abandoned US20160298137A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
US15/188,911 Active US10731181B2 (en) | 2012-12-06 | 2016-06-21 | CRISPR-based genome modification and regulation |
US15/188,902 Abandoned US20160298132A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
US15/342,976 Abandoned US20170073705A1 (en) | 2012-12-06 | 2016-11-03 | Crispr-based genome modification and regulation |
US15/456,204 Pending US20170191082A1 (en) | 2012-12-06 | 2017-03-10 | Crispr-based genome modification and regulation |
US16/654,613 Abandoned US20200140897A1 (en) | 2012-12-06 | 2019-10-16 | Crispr-based genome modification and regulation |
US16/943,792 Abandoned US20210079427A1 (en) | 2012-12-06 | 2020-07-30 | Crispr-based genome modification and regulation |
US16/943,767 Pending US20210207173A1 (en) | 2012-12-06 | 2020-07-30 | Crispr-based genome modification and regulation |
US17/398,648 Pending US20210388396A1 (en) | 2012-12-06 | 2021-08-10 | Crispr-based genome modification and regulation |
Country Status (17)
Country | Link |
---|---|
US (15) | US20160017366A1 (en) |
EP (11) | EP3617309A3 (en) |
JP (6) | JP6620018B2 (en) |
KR (6) | KR101844123B1 (en) |
CN (3) | CN108715602A (en) |
AU (9) | AU2013355214B2 (en) |
BR (1) | BR112015012375A2 (en) |
CA (3) | CA2977152C (en) |
DK (6) | DK3363902T3 (en) |
ES (6) | ES2713243T3 (en) |
HK (1) | HK1218389A1 (en) |
IL (5) | IL300199A (en) |
LT (4) | LT3138912T (en) |
PL (6) | PL2928496T3 (en) |
PT (6) | PT3138912T (en) |
SG (4) | SG10201800585VA (en) |
WO (1) | WO2014089290A1 (en) |
Cited By (13)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10190137B2 (en) | 2013-11-07 | 2019-01-29 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAS |
US10227611B2 (en) | 2012-05-25 | 2019-03-12 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10428319B2 (en) | 2017-06-09 | 2019-10-01 | Editas Medicine, Inc. | Engineered Cas9 nucleases |
US10731181B2 (en) | 2012-12-06 | 2020-08-04 | Sigma, Aldrich Co. LLC | CRISPR-based genome modification and regulation |
US20200385753A1 (en) * | 2016-12-23 | 2020-12-10 | Institute For Basic Science | Composition for base editing for animal embryo and base editing method |
US11236313B2 (en) | 2016-04-13 | 2022-02-01 | Editas Medicine, Inc. | Cas9 fusion molecules, gene editing systems, and methods of use thereof |
US11390884B2 (en) | 2015-05-11 | 2022-07-19 | Editas Medicine, Inc. | Optimized CRISPR/cas9 systems and methods for gene editing in stem cells |
US11499151B2 (en) | 2017-04-28 | 2022-11-15 | Editas Medicine, Inc. | Methods and systems for analyzing guide RNA molecules |
US11597924B2 (en) | 2016-03-25 | 2023-03-07 | Editas Medicine, Inc. | Genome editing systems comprising repair-modulating enzyme molecules and methods of their use |
US11667911B2 (en) | 2015-09-24 | 2023-06-06 | Editas Medicine, Inc. | Use of exonucleases to improve CRISPR/CAS-mediated genome editing |
US11680268B2 (en) | 2014-11-07 | 2023-06-20 | Editas Medicine, Inc. | Methods for improving CRISPR/Cas-mediated genome-editing |
US11866726B2 (en) | 2017-07-14 | 2024-01-09 | Editas Medicine, Inc. | Systems and methods for targeted integration and genome editing and detection thereof using integrated priming sites |
US11911415B2 (en) | 2015-06-09 | 2024-02-27 | Editas Medicine, Inc. | CRISPR/Cas-related methods and compositions for improving transplantation |
Families Citing this family (352)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2008027558A2 (en) | 2006-08-31 | 2008-03-06 | Codon Devices, Inc. | Iterative nucleic acid assembly using activation of vector-encoded traits |
EP2638157B1 (en) | 2010-11-12 | 2015-07-22 | Gen9, Inc. | Methods and devices for nucleic acids synthesis |
EP4039363A1 (en) | 2010-11-12 | 2022-08-10 | Gen9, Inc. | Protein arrays and methods of using and making the same |
EP3613852A3 (en) | 2011-07-22 | 2020-04-22 | President and Fellows of Harvard College | Evaluation and improvement of nuclease cleavage specificity |
EP3594340B1 (en) | 2011-08-26 | 2021-06-30 | Gen9, Inc. | Compositions and methods for high fidelity assembly of nucleic acids |
US11021737B2 (en) | 2011-12-22 | 2021-06-01 | President And Fellows Of Harvard College | Compositions and methods for analyte detection |
GB201122458D0 (en) | 2011-12-30 | 2012-02-08 | Univ Wageningen | Modified cascade ribonucleoproteins and uses thereof |
US9637739B2 (en) | 2012-03-20 | 2017-05-02 | Vilnius University | RNA-directed DNA cleavage by the Cas9-crRNA complex |
US9150853B2 (en) | 2012-03-21 | 2015-10-06 | Gen9, Inc. | Methods for screening proteins using DNA encoded chemical libraries as templates for enzyme catalysis |
EP3543350B1 (en) | 2012-04-24 | 2021-11-10 | Gen9, Inc. | Methods for sorting nucleic acids and multiplexed preparative in vitro cloning |
IN2014DN09261A (en) | 2012-04-25 | 2015-07-10 | Regeneron Pharma | |
EP3597741A1 (en) | 2012-04-27 | 2020-01-22 | Duke University | Genetic correction of mutated genes |
EP2861737B1 (en) | 2012-06-19 | 2019-04-17 | Regents Of The University Of Minnesota | Gene targeting in plants using dna viruses |
WO2014004393A1 (en) | 2012-06-25 | 2014-01-03 | Gen9, Inc. | Methods for nucleic acid assembly and high throughput sequencing |
CN116622704A (en) * | 2012-07-25 | 2023-08-22 | 布罗德研究所有限公司 | Inducible DNA binding proteins and genomic disruption tools and uses thereof |
KR102182847B1 (en) * | 2012-10-23 | 2020-11-27 | 주식회사 툴젠 | Composition for cleaving a target DNA comprising a guide RNA specific for the target DNA and Cas protein-encoding nucleic acid or Cas protein, and use thereof |
CN105051204B (en) | 2012-11-16 | 2023-07-21 | 波赛伊达治疗学股份有限公司 | Site-specific enzymes and methods of use |
KR20150105634A (en) * | 2012-12-12 | 2015-09-17 | 더 브로드 인스티튜트, 인코퍼레이티드 | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
US8697359B1 (en) * | 2012-12-12 | 2014-04-15 | The Broad Institute, Inc. | CRISPR-Cas systems and methods for altering expression of gene products |
IL293526A (en) * | 2012-12-12 | 2022-08-01 | Harvard College | C delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
WO2014093595A1 (en) * | 2012-12-12 | 2014-06-19 | The Broad Institute, Inc. | Crispr-cas component systems, methods and compositions for sequence manipulation |
EP3064585B1 (en) | 2012-12-12 | 2020-02-05 | The Broad Institute, Inc. | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
PT2771468E (en) * | 2012-12-12 | 2015-06-02 | Harvard College | Engineering of systems, methods and optimized guide compositions for sequence manipulation |
WO2014093709A1 (en) | 2012-12-12 | 2014-06-19 | The Broad Institute, Inc. | Methods, models, systems, and apparatus for identifying target sequences for cas enzymes or crispr-cas systems for target sequences and conveying results thereof |
US20140310830A1 (en) | 2012-12-12 | 2014-10-16 | Feng Zhang | CRISPR-Cas Nickase Systems, Methods And Compositions For Sequence Manipulation in Eukaryotes |
DK2931898T3 (en) | 2012-12-12 | 2016-06-20 | Massachusetts Inst Technology | CONSTRUCTION AND OPTIMIZATION OF SYSTEMS, PROCEDURES AND COMPOSITIONS FOR SEQUENCE MANIPULATION WITH FUNCTIONAL DOMAINS |
ES2741951T3 (en) | 2012-12-17 | 2020-02-12 | Harvard College | Genetic engineering modification of the human genome guided by RNA |
JP2016507244A (en) | 2013-02-27 | 2016-03-10 | ヘルムホルツ・ツェントルム・ミュンヒェン・ドイチェス・フォルシュンクスツェントルム・フューア・ゲズントハイト・ウント・ウムベルト(ゲーエムベーハー)Helmholtz Zentrum MuenchenDeutsches Forschungszentrum fuer Gesundheit und Umwelt (GmbH) | Gene editing in oocytes by Cas9 nuclease |
EP2971184B1 (en) | 2013-03-12 | 2019-04-17 | President and Fellows of Harvard College | Method of generating a three-dimensional nucleic acid containing matrix |
RU2018122288A (en) | 2013-03-14 | 2019-03-06 | Карибо Биосайенсиз, Инк. | COMPOSITIONS AND METHODS WITH PARTICIPATION OF NUCLEIC ACIDS AIMED AT NUCLEIC ACIDS |
AU2014227653B2 (en) | 2013-03-15 | 2017-04-20 | The General Hospital Corporation | Using RNA-guided foki nucleases (RFNs) to increase specificity for RNA-guided genome editing |
US20140273230A1 (en) * | 2013-03-15 | 2014-09-18 | Sigma-Aldrich Co., Llc | Crispr-based genome modification and regulation |
US10760064B2 (en) | 2013-03-15 | 2020-09-01 | The General Hospital Corporation | RNA-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci |
US20140273235A1 (en) * | 2013-03-15 | 2014-09-18 | Regents Of The University Of Minnesota | ENGINEERING PLANT GENOMES USING CRISPR/Cas SYSTEMS |
SI2986729T1 (en) | 2013-04-16 | 2019-02-28 | Regeneron Pharmaceuticals, Inc. | Targeted modification of rat genome |
WO2014172470A2 (en) * | 2013-04-16 | 2014-10-23 | Whitehead Institute For Biomedical Research | Methods of mutating, modifying or modulating nucleic acid in a cell or nonhuman mammal |
CA2910489A1 (en) | 2013-05-15 | 2014-11-20 | Sangamo Biosciences, Inc. | Methods and compositions for treatment of a genetic condition |
US20160122774A1 (en) * | 2013-05-29 | 2016-05-05 | Cellectis | A method for producing precise dna cleavage using cas9 nickase activity |
US20140356956A1 (en) | 2013-06-04 | 2014-12-04 | President And Fellows Of Harvard College | RNA-Guided Transcriptional Regulation |
MY197877A (en) * | 2013-06-04 | 2023-07-22 | Harvard College | Rna-guided transcriptional regulation |
JP7085716B2 (en) * | 2013-06-05 | 2022-06-17 | デューク ユニバーシティ | RNA Guide Gene Editing and Gene Regulation |
US20160145631A1 (en) | 2013-06-14 | 2016-05-26 | Cellectis | Methods for non-transgenic genome editing in plants |
EP3725885A1 (en) | 2013-06-17 | 2020-10-21 | The Broad Institute, Inc. | Functional genomics using crispr-cas systems, compositions methods, screens and applications thereof |
SG11201510284XA (en) | 2013-06-17 | 2016-01-28 | Broad Inst Inc | Delivery and use of the crispr-cas systems, vectors and compositions for hepatic targeting and therapy |
ES2767318T3 (en) * | 2013-06-17 | 2020-06-17 | Broad Inst Inc | Supply, modification and optimization of systems, methods and compositions to generate models and act on postmitotic cell diseases and disorders |
CN106062197A (en) * | 2013-06-17 | 2016-10-26 | 布罗德研究所有限公司 | Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation |
AU2014281027A1 (en) * | 2013-06-17 | 2016-01-28 | Massachusetts Institute Of Technology | Optimized CRISPR-Cas double nickase systems, methods and compositions for sequence manipulation |
EP3011034B1 (en) * | 2013-06-17 | 2019-08-07 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using viral components |
US10011850B2 (en) | 2013-06-21 | 2018-07-03 | The General Hospital Corporation | Using RNA-guided FokI Nucleases (RFNs) to increase specificity for RNA-Guided Genome Editing |
US11306328B2 (en) * | 2013-07-26 | 2022-04-19 | President And Fellows Of Harvard College | Genome engineering |
US20150044192A1 (en) | 2013-08-09 | 2015-02-12 | President And Fellows Of Harvard College | Methods for identifying a target site of a cas9 nuclease |
US9359599B2 (en) | 2013-08-22 | 2016-06-07 | President And Fellows Of Harvard College | Engineered transcription activator-like effector (TALE) domains and uses thereof |
CA3221516A1 (en) | 2013-08-22 | 2015-02-26 | E. I. Du Pont De Nemours And Company | Plant genome modification using guide rna/cas endonuclease systems and methods of use |
US9322037B2 (en) | 2013-09-06 | 2016-04-26 | President And Fellows Of Harvard College | Cas9-FokI fusion proteins and uses thereof |
US9340800B2 (en) | 2013-09-06 | 2016-05-17 | President And Fellows Of Harvard College | Extended DNA-sensing GRNAS |
US9526784B2 (en) | 2013-09-06 | 2016-12-27 | President And Fellows Of Harvard College | Delivery system for functional nucleases |
ES2844174T3 (en) * | 2013-09-18 | 2021-07-21 | Kymab Ltd | Methods, cells and organisms |
WO2015065964A1 (en) | 2013-10-28 | 2015-05-07 | The Broad Institute Inc. | Functional genomics using crispr-cas systems, compositions, methods, screens and applications thereof |
WO2015066119A1 (en) | 2013-10-30 | 2015-05-07 | North Carolina State University | Compositions and methods related to a type-ii crispr-cas system in lactobacillus buchneri |
MX2016007654A (en) | 2013-12-11 | 2017-08-15 | Regeneron Pharma | Methods and compositions for the targeted modification of a genome. |
SI3080279T1 (en) | 2013-12-11 | 2019-01-31 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for the targeted modification of a genome |
BR112016013520A2 (en) | 2013-12-12 | 2017-10-03 | Broad Inst Inc | COMPOSITIONS AND METHODS OF USE OF CRISPR-CAS SYSTEMS IN NUCLEOTIDE REPEAT DISORDERS |
JP6793547B2 (en) | 2013-12-12 | 2020-12-02 | ザ・ブロード・インスティテュート・インコーポレイテッド | Optimization Function Systems, methods and compositions for sequence manipulation with the CRISPR-Cas system |
KR20160089527A (en) | 2013-12-12 | 2016-07-27 | 더 브로드 인스티튜트, 인코퍼레이티드 | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for genome editing |
WO2015089427A1 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Crispr-cas systems and methods for altering expression of gene products, structural information and inducible modular cas enzymes |
WO2015089364A1 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Crystal structure of a crispr-cas system, and uses thereof |
US20150166985A1 (en) | 2013-12-12 | 2015-06-18 | President And Fellows Of Harvard College | Methods for correcting von willebrand factor point mutations |
US10787654B2 (en) * | 2014-01-24 | 2020-09-29 | North Carolina State University | Methods and compositions for sequence guiding Cas9 targeting |
WO2015123339A1 (en) | 2014-02-11 | 2015-08-20 | The Regents Of The University Of Colorado, A Body Corporate | Crispr enabled multiplexed genome engineering |
AU2015219167A1 (en) | 2014-02-18 | 2016-09-08 | Duke University | Compositions for the inactivation of virus replication and methods of making and using the same |
US11028388B2 (en) | 2014-03-05 | 2021-06-08 | Editas Medicine, Inc. | CRISPR/Cas-related methods and compositions for treating Usher syndrome and retinitis pigmentosa |
DK3116997T3 (en) | 2014-03-10 | 2019-08-19 | Editas Medicine Inc | CRISPR / CAS-RELATED PROCEDURES AND COMPOSITIONS TO TREAT LEVER'S CONGENITAL AMAUROSIS 10 (LCA10) |
US11339437B2 (en) | 2014-03-10 | 2022-05-24 | Editas Medicine, Inc. | Compositions and methods for treating CEP290-associated disease |
US11141493B2 (en) | 2014-03-10 | 2021-10-12 | Editas Medicine, Inc. | Compositions and methods for treating CEP290-associated disease |
WO2015148670A1 (en) * | 2014-03-25 | 2015-10-01 | Editas Medicine Inc. | Crispr/cas-related methods and compositions for treating hiv infection and aids |
EP3122880B1 (en) | 2014-03-26 | 2021-05-05 | Editas Medicine, Inc. | Crispr/cas-related methods and compositions for treating sickle cell disease |
CN106460003A (en) | 2014-04-08 | 2017-02-22 | 北卡罗来纳州立大学 | Methods and compositions for RNA-directed repression of transcription using CRISPR-associated genes |
WO2015188056A1 (en) * | 2014-06-05 | 2015-12-10 | Sangamo Biosciences, Inc. | Methods and compositions for nuclease design |
CN106795521B (en) | 2014-06-06 | 2021-06-04 | 瑞泽恩制药公司 | Methods and compositions for modifying targeted loci |
CA2952697A1 (en) * | 2014-06-16 | 2015-12-23 | The Johns Hopkins University | Compositions and methods for the expression of crispr guide rnas using the h1 promoter |
US20170107541A1 (en) * | 2014-06-17 | 2017-04-20 | Poseida Therapeutics, Inc. | A method for directing proteins to specific loci in the genome and uses thereof |
EP3354732B1 (en) * | 2014-06-23 | 2020-01-08 | Regeneron Pharmaceuticals, Inc. | Nuclease-mediated dna assembly |
AU2015279642B2 (en) | 2014-06-26 | 2021-03-25 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for targeted genetic modifications and methods of use |
US20170198268A1 (en) * | 2014-07-09 | 2017-07-13 | Gen9, Inc. | Compositions and Methods for Site-Directed DNA Nicking and Cleaving |
CA2954791A1 (en) * | 2014-07-14 | 2016-01-21 | The Regents Of The University Of California | Crispr/cas transcriptional modulation |
EP4079847A1 (en) | 2014-07-30 | 2022-10-26 | President And Fellows Of Harvard College | Cas9 proteins including ligand-dependent inteins |
CN106922154B (en) * | 2014-08-06 | 2022-01-07 | 基因工具股份有限公司 | Gene editing using Campylobacter jejuni CRISPR/CAS system-derived RNA-guided engineered nucleases |
US10450584B2 (en) | 2014-08-28 | 2019-10-22 | North Carolina State University | Cas9 proteins and guiding features for DNA targeting and genome editing |
EP3188763B1 (en) | 2014-09-02 | 2020-05-13 | The Regents of The University of California | Methods and compositions for rna-directed target dna modification |
WO2016040030A1 (en) | 2014-09-12 | 2016-03-17 | E. I. Du Pont De Nemours And Company | Generation of site-specific-integration sites for complex trait loci in corn and soybean, and methods of use |
CA2963840A1 (en) | 2014-10-09 | 2016-04-14 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Long poly(a) plasmids and methods for introduction of long poly(a) sequences into the plasmid |
CN107002078A (en) * | 2014-10-09 | 2017-08-01 | 生命技术公司 | CRISPR oligonucleotides and gene editing |
WO2016061374A1 (en) | 2014-10-15 | 2016-04-21 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for generating or maintaining pluripotent cells |
WO2016065364A1 (en) * | 2014-10-24 | 2016-04-28 | Life Technologies Corporation | Compositions and methods for enhancing homologous recombination |
CN107429246B (en) * | 2014-10-31 | 2021-06-01 | 麻省理工学院 | Massively parallel combinatorial genetics for CRISPR |
DK3215611T3 (en) * | 2014-11-06 | 2019-11-25 | Du Pont | Peptide-Mediated Administration of RNA-Guided ENDONUCLEASE IN CELLS |
WO2016077273A1 (en) * | 2014-11-11 | 2016-05-19 | Q Therapeutics, Inc. | Engineering mesenchymal stem cells using homologous recombination |
JP2017534294A (en) | 2014-11-19 | 2017-11-24 | インスティチュート フォー ベーシック サイエンスInstitute For Basic Science | Method for regulating gene expression using CAS9 protein expressed from two vectors |
ES2731437T3 (en) | 2014-11-21 | 2019-11-15 | Regeneron Pharma | Methods and compositions for directed genetic modification through the use of guide RNA pairs |
GB201421096D0 (en) | 2014-11-27 | 2015-01-14 | Imp Innovations Ltd | Genome editing methods |
CA2969619A1 (en) | 2014-12-03 | 2016-06-09 | Agilent Technologies, Inc. | Guide rna with chemical modifications |
CN116059378A (en) | 2014-12-10 | 2023-05-05 | 明尼苏达大学董事会 | Genetically modified cells, tissues and organs for the treatment of diseases |
EP3230451B1 (en) | 2014-12-12 | 2021-04-07 | The Broad Institute, Inc. | Protected guide rnas (pgrnas) |
WO2016100857A1 (en) | 2014-12-19 | 2016-06-23 | Regeneron Pharmaceuticals, Inc. | Stem cells for modeling type 2 diabetes |
EP3232774B1 (en) | 2014-12-19 | 2019-10-09 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for targeted genetic modification through single-step multiple targeting |
US11248240B2 (en) | 2015-01-29 | 2022-02-15 | Meiogenix | Method for inducing targeted meiotic recombinations |
EP3280803B1 (en) | 2015-04-06 | 2021-05-26 | The Board of Trustees of the Leland Stanford Junior University | Chemically modified guide rnas for crispr/cas-mediated gene regulation |
EP3286571B1 (en) | 2015-04-24 | 2021-08-18 | Editas Medicine, Inc. | Evaluation of cas9 molecule/guide rna molecule complexes |
WO2016176617A2 (en) | 2015-04-29 | 2016-11-03 | New York University | Method for treating high-grade gliomas |
EP3292219B9 (en) | 2015-05-04 | 2022-05-18 | Ramot at Tel-Aviv University Ltd. | Methods and kits for fragmenting dna |
AU2016270649B2 (en) | 2015-05-29 | 2022-04-21 | North Carolina State University | Methods for screening bacteria, archaea, algae, and yeast using crispr nucleic acids |
EP3303585A4 (en) | 2015-06-03 | 2018-10-31 | Board of Regents of the University of Nebraska | Dna editing using single-stranded dna |
FI3307872T3 (en) | 2015-06-15 | 2023-10-16 | Univ North Carolina State | Methods and compositions for efficient delivery of nucleic acids and rna-based antimicrobials |
AU2016278226B2 (en) * | 2015-06-17 | 2021-08-12 | Poseida Therapeutics, Inc. | Compositions and methods for directing proteins to specific loci in the genome |
EP3129393B1 (en) | 2015-06-18 | 2021-08-04 | The Broad Institute Inc. | Crispr enzyme mutations reducing off-target effects |
WO2016205759A1 (en) | 2015-06-18 | 2016-12-22 | The Broad Institute Inc. | Engineering and optimization of systems, methods, enzymes and guide scaffolds of cas9 orthologs and variants for sequence manipulation |
CN107949400A (en) * | 2015-06-24 | 2018-04-20 | 西格马-奥尔德里奇有限责任公司 | Cell cycle dependant genome regulates and controls and modification |
US20170119820A1 (en) | 2015-07-31 | 2017-05-04 | Regents Of The University Of Minnesota | Modified cells and methods of therapy |
US10709726B2 (en) | 2015-08-14 | 2020-07-14 | The University Of Sydney | Connexin 45 inhibition for therapy |
IL288662B2 (en) | 2015-08-25 | 2023-09-01 | Univ Duke | Compositions and methods of improving specificity in genomic engineering using rna-guided endonucleases |
WO2017040348A1 (en) | 2015-08-28 | 2017-03-09 | The General Hospital Corporation | Engineered crispr-cas9 nucleases |
US9512446B1 (en) | 2015-08-28 | 2016-12-06 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
US9926546B2 (en) | 2015-08-28 | 2018-03-27 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
KR101745863B1 (en) | 2015-09-25 | 2017-06-12 | 전남대학교산학협력단 | Primer for prohibitin2 gene remove using CRISPR/CAS9 system |
KR101795999B1 (en) | 2015-09-25 | 2017-11-09 | 전남대학교산학협력단 | Primer for Beta2-Microglobulin gene remove using CRISPR/CAS9 system |
US11286480B2 (en) | 2015-09-28 | 2022-03-29 | North Carolina State University | Methods and compositions for sequence specific antimicrobials |
EP3362571A4 (en) * | 2015-10-13 | 2019-07-10 | Duke University | Genome engineering with type i crispr systems in eukaryotic cells |
CN108370303B (en) | 2015-10-22 | 2022-03-08 | 瑞典爱立信有限公司 | Method and arrangement relating to selective enhancement of radio signals |
JP7067793B2 (en) * | 2015-10-23 | 2022-05-16 | プレジデント アンド フェローズ オブ ハーバード カレッジ | Nucleobase editing factors and their use |
US20180230489A1 (en) | 2015-10-28 | 2018-08-16 | Voyager Therapeutics, Inc. | Regulatable expression using adeno-associated virus (aav) |
GB2559526B (en) | 2015-11-03 | 2021-02-17 | Harvard College | Method and apparatus for volumetric imaging of a three-dimensional nucleic acid containing matrix |
US11905521B2 (en) | 2015-11-17 | 2024-02-20 | The Chinese University Of Hong Kong | Methods and systems for targeted gene manipulation |
US10240145B2 (en) * | 2015-11-25 | 2019-03-26 | The Board Of Trustees Of The Leland Stanford Junior University | CRISPR/Cas-mediated genome editing to treat EGFR-mutant lung cancer |
US11542466B2 (en) | 2015-12-22 | 2023-01-03 | North Carolina State University | Methods and compositions for delivery of CRISPR based antimicrobials |
IL260532B2 (en) | 2016-01-11 | 2023-12-01 | Univ Leland Stanford Junior | Chimeric proteins- containing systems and uses thereof in regulating gene expression |
EA201891614A1 (en) | 2016-01-11 | 2019-02-28 | Те Борд Оф Трастиз Оф Те Лилэнд Стэнфорд Джуниор Юниверсити | CHEMICAL PROTEINS AND METHODS OF IMMUNOTHERAPY |
EP3219799A1 (en) | 2016-03-17 | 2017-09-20 | IMBA-Institut für Molekulare Biotechnologie GmbH | Conditional crispr sgrna expression |
US11512311B2 (en) | 2016-03-25 | 2022-11-29 | Editas Medicine, Inc. | Systems and methods for treating alpha 1-antitrypsin (A1AT) deficiency |
WO2017180926A1 (en) * | 2016-04-14 | 2017-10-19 | Boco Silicon Valley. Inc. | Genome editing of human neural stem cells using nucleases |
EP3449016A4 (en) | 2016-04-25 | 2019-10-02 | President and Fellows of Harvard College | Hybridization chain reaction methods for in situ molecular detection |
WO2017186718A1 (en) * | 2016-04-25 | 2017-11-02 | Universität Basel | Allele editing and applications thereof |
KR102661748B1 (en) | 2016-05-20 | 2024-05-31 | 리제너론 파마슈티칼스 인코포레이티드 | Methods for breaking immunological tolerance using multiple guide rnas |
KR102458395B1 (en) * | 2016-06-02 | 2022-10-25 | 시그마-알드리치 컴퍼니., 엘엘씨 | Improvement of Targeted Genomic Modifications Using Programmable DNA Binding Proteins |
AU2017277810A1 (en) * | 2016-06-03 | 2018-12-06 | Temple University - Of The Commonwealth System Of Higher Education | Negative feedback regulation of HIV-1 by gene editing strategy |
CA3025591A1 (en) * | 2016-06-03 | 2017-12-07 | Philippe Ravassard | Diet controlled expression of a nucleic acid encoding cas9 nuclease and uses thereof |
US10767175B2 (en) | 2016-06-08 | 2020-09-08 | Agilent Technologies, Inc. | High specificity genome editing using chemically modified guide RNAs |
US10337051B2 (en) | 2016-06-16 | 2019-07-02 | The Regents Of The University Of California | Methods and compositions for detecting a target RNA |
US11293021B1 (en) | 2016-06-23 | 2022-04-05 | Inscripta, Inc. | Automated cell processing methods, modules, instruments, and systems |
EP3474669B1 (en) | 2016-06-24 | 2022-04-06 | The Regents of The University of Colorado, A Body Corporate | Methods for generating barcoded combinatorial libraries |
US11603533B2 (en) | 2016-07-12 | 2023-03-14 | Washington University | Incorporation of internal polya-encoded poly-lysine sequence tags and their variations for the tunable control of protein synthesis in bacterial and eukaryotic cells |
AU2017302611B2 (en) | 2016-07-28 | 2021-12-09 | Regeneron Pharmaceuticals, Inc. | GPR156 variants and uses thereof |
BR112019001783A2 (en) | 2016-07-29 | 2019-05-07 | Regeneron Pharmaceuticals, Inc. | nonhuman mammal, and methods for producing the nonhuman mammal and screening a compound. |
CA3032822A1 (en) | 2016-08-02 | 2018-02-08 | Editas Medicine, Inc. | Compositions and methods for treating cep290 associated disease |
US11078481B1 (en) | 2016-08-03 | 2021-08-03 | KSQ Therapeutics, Inc. | Methods for screening for cancer targets |
KR102547316B1 (en) | 2016-08-03 | 2023-06-23 | 프레지던트 앤드 펠로우즈 오브 하바드 칼리지 | Adenosine nucleobase editing agents and uses thereof |
US11661590B2 (en) | 2016-08-09 | 2023-05-30 | President And Fellows Of Harvard College | Programmable CAS9-recombinase fusion proteins and uses thereof |
JP2019524149A (en) * | 2016-08-20 | 2019-09-05 | アベリノ ラボ ユーエスエー インコーポレイテッドAvellino Lab USA, Inc. | Single-stranded guide RNA, CRISPR / Cas9 system, and methods of use thereof |
US11542509B2 (en) | 2016-08-24 | 2023-01-03 | President And Fellows Of Harvard College | Incorporation of unnatural amino acids into proteins using base editing |
US11078483B1 (en) | 2016-09-02 | 2021-08-03 | KSQ Therapeutics, Inc. | Methods for measuring and improving CRISPR reagent function |
US20180105806A1 (en) * | 2016-09-07 | 2018-04-19 | Massachusetts Institute Of Technology | Method for rna-guided endonuclease-based dna assembly |
CN106636197B (en) * | 2016-09-22 | 2019-09-03 | 南京市妇幼保健院 | A method of orientation strikes multi-copy gene in drop zebra fish genome |
US20190225974A1 (en) | 2016-09-23 | 2019-07-25 | BASF Agricultural Solutions Seed US LLC | Targeted genome optimization in plants |
MX2019003674A (en) | 2016-09-30 | 2021-01-08 | Univ California | Rna-guided nucleic acid modifying enzymes and methods of use thereof. |
US20190233820A1 (en) * | 2016-10-11 | 2019-08-01 | Stemgenics, Inc. | Nanoparticles functionalized with gene editing tools and related methods |
US11306324B2 (en) | 2016-10-14 | 2022-04-19 | President And Fellows Of Harvard College | AAV delivery of nucleobase editors |
WO2018071892A1 (en) | 2016-10-14 | 2018-04-19 | Joung J Keith | Epigenetically regulated site-specific nucleases |
GB201617559D0 (en) | 2016-10-17 | 2016-11-30 | University Court Of The University Of Edinburgh The | Swine comprising modified cd163 and associated methods |
GB2573406B (en) | 2016-10-18 | 2021-11-10 | Univ Minnesota | Tumor infiltrating lymphocytes and methods of therapy |
KR20190072639A (en) * | 2016-11-02 | 2019-06-25 | 유니버시타트 바셀 | Immunologically identifiable cell surface variants for use in cell therapy |
US10745677B2 (en) | 2016-12-23 | 2020-08-18 | President And Fellows Of Harvard College | Editing of CCR5 receptor gene to protect against HIV infection |
US11859219B1 (en) | 2016-12-30 | 2024-01-02 | Flagship Pioneering Innovations V, Inc. | Methods of altering a target nucleotide sequence with an RNA-guided nuclease and a single guide RNA |
KR20190111067A (en) | 2017-01-23 | 2019-10-01 | 리제너론 파마슈티칼스 인코포레이티드 | Hydroxysteroid 17-beta Dehydrogenase 13 (HSD17B13) Variants and Uses thereof |
TW201839136A (en) | 2017-02-06 | 2018-11-01 | 瑞士商諾華公司 | Compositions and methods for the treatment of hemoglobinopathies |
CN106978438B (en) * | 2017-02-27 | 2020-08-28 | 北京大北农生物技术有限公司 | Method for improving homologous recombination efficiency |
WO2018165504A1 (en) | 2017-03-09 | 2018-09-13 | President And Fellows Of Harvard College | Suppression of pain by gene editing |
EP3592777A1 (en) | 2017-03-10 | 2020-01-15 | President and Fellows of Harvard College | Cytosine to guanine base editor |
EP3596217A1 (en) | 2017-03-14 | 2020-01-22 | Editas Medicine, Inc. | Systems and methods for the treatment of hemoglobinopathies |
IL306092A (en) | 2017-03-23 | 2023-11-01 | Harvard College | Nucleobase editors comprising nucleic acid programmable dna binding proteins |
WO2018195129A1 (en) | 2017-04-17 | 2018-10-25 | University Of Maryland, College Park | Embryonic cell cultures and methods of using the same |
US11834670B2 (en) | 2017-04-19 | 2023-12-05 | Global Life Sciences Solutions Usa Llc | Site-specific DNA modification using a donor DNA repair template having tandem repeat sequences |
CN110799525A (en) | 2017-04-21 | 2020-02-14 | 通用医疗公司 | Variants of CPF1(CAS12a) with altered PAM specificity |
EP3622070A2 (en) | 2017-05-10 | 2020-03-18 | Editas Medicine, Inc. | Crispr/rna-guided nuclease systems and methods |
WO2018209320A1 (en) | 2017-05-12 | 2018-11-15 | President And Fellows Of Harvard College | Aptazyme-embedded guide rnas for use with crispr-cas9 in genome editing and transcriptional activation |
CA3063449A1 (en) | 2017-05-25 | 2018-11-29 | The General Hospital Corporation | Using split deaminases to limit unwanted off-target base editor deamination |
CA3065938A1 (en) | 2017-06-05 | 2018-12-13 | Regeneron Pharmaceuticals, Inc. | B4galt1 variants and uses thereof |
CA3067382A1 (en) | 2017-06-15 | 2018-12-20 | The Regents Of The University Of California | Targeted non-viral dna insertions |
US10011849B1 (en) | 2017-06-23 | 2018-07-03 | Inscripta, Inc. | Nucleic acid-guided nucleases |
US9982279B1 (en) | 2017-06-23 | 2018-05-29 | Inscripta, Inc. | Nucleic acid-guided nucleases |
AU2018295358A1 (en) | 2017-06-27 | 2020-01-16 | Regeneron Pharmaceuticals, Inc. | Non-human animals comprising a humanized ASGR1 locus |
RU2755308C2 (en) | 2017-06-30 | 2021-09-15 | Инскрипта, Инк. | Automated multi-module tool for editing cells (options) |
EP3645021A4 (en) | 2017-06-30 | 2021-04-21 | Intima Bioscience, Inc. | Adeno-associated viral vectors for gene therapy |
CN111801345A (en) | 2017-07-28 | 2020-10-20 | 哈佛大学的校长及成员们 | Methods and compositions using an evolved base editor for Phage Assisted Continuous Evolution (PACE) |
RU2019143568A (en) | 2017-07-31 | 2021-09-02 | Регенерон Фармасьютикалс, Инк. | METHODS AND COMPOSITIONS FOR ASSESSING CRISPR / CAS-INDUCED RECOMBINATION WITH EXOGENIC DONORIC NUCLEIC ACID IN VIVO |
BR112020001996A2 (en) | 2017-07-31 | 2020-08-18 | Regeneron Pharmaceuticals, Inc. | non-human animal, and methods for testing and for optimizing the ability of a crispr / cas nuclease to excise a genomic nucleic acid in vivo, to test the crispr / cas-induced recombination of a genomic acid with an exogenous donor nucleic acid in vivo and to optimize the ability of crispr / cas to induce recombination of a genomic nucleic acid with an exogenous donor nucleic acid in vivo. |
AU2018311695A1 (en) * | 2017-07-31 | 2020-01-16 | Sigma-Aldrich Co. Llc | Synthetic guide RNA for CRISPR/Cas activator systems |
BR112020001364A2 (en) | 2017-07-31 | 2020-08-11 | Regeneron Pharmaceuticals, Inc. | methods to test and modify the capacity of a crispr / cas nuclease. |
WO2019030695A1 (en) * | 2017-08-09 | 2019-02-14 | Benson Hill Biosystems, Inc. | Compositions and methods for modifying genomes |
US10738327B2 (en) | 2017-08-28 | 2020-08-11 | Inscripta, Inc. | Electroporation cuvettes for automation |
US11319532B2 (en) | 2017-08-30 | 2022-05-03 | President And Fellows Of Harvard College | High efficiency base editors comprising Gam |
EP3678680A4 (en) * | 2017-09-05 | 2021-12-01 | Regeneron Pharmaceuticals, Inc. | Delivery of a gene-editing system with a single retroviral particle and methods of generation and use |
CN111373053A (en) | 2017-09-06 | 2020-07-03 | 雷杰纳荣制药公司 | Mono-immunoglobulin interleukin-1 receptor-associated molecule (SIGIRR) variants and uses thereof |
CN111278851A (en) | 2017-09-07 | 2020-06-12 | 雷杰纳荣制药公司 | Solute carrier family 14 member 1(SLC14a1) variants and uses thereof |
NZ761329A (en) | 2017-09-29 | 2023-04-28 | Regeneron Pharma | Non-human animals comprising a humanized ttr locus and methods of use |
WO2019068022A1 (en) | 2017-09-30 | 2019-04-04 | Inscripta, Inc. | Flow through electroporation instrumentation |
WO2019079195A1 (en) * | 2017-10-16 | 2019-04-25 | University Of Pittsburgh - Of The Commonwealth System Of Higher Education | Genetically modified mesenchymal stem cells for use in cardiovascular prosthetics |
JP2021500036A (en) | 2017-10-16 | 2021-01-07 | ザ ブロード インスティテュート, インコーポレーテッドThe Broad Institute, Inc. | Use of adenosine base editing factors |
SG11202002822XA (en) | 2017-10-16 | 2020-04-29 | Regeneron Pharma | Cornulin (crnn) variants and uses thereof |
CA3080415A1 (en) | 2017-10-27 | 2019-05-02 | The Regents Of The University Of California | Targeted replacement of endogenous t cell receptors |
WO2019089808A1 (en) | 2017-11-01 | 2019-05-09 | The Regents Of The University Of California | Class 2 crispr/cas compositions and methods of use |
CA3076371C (en) | 2017-11-10 | 2022-11-22 | Regeneron Pharmaceuticals, Inc. | Non-human animals comprising slc30a8 mutation and methods of use |
US20210180059A1 (en) * | 2017-11-16 | 2021-06-17 | Astrazeneca Ab | Compositions and methods for improving the efficacy of cas9-based knock-in strategies |
IL274740B2 (en) | 2017-11-30 | 2024-06-01 | Regeneron Pharma | Non-human animals comprising a humanized trkb locus |
WO2019126578A1 (en) * | 2017-12-20 | 2019-06-27 | Poseida Therapeutics, Inc. | Compositions and methods for directing proteins to specific loci in the genome |
KR102098915B1 (en) * | 2017-12-22 | 2020-04-09 | (주)지플러스 생명과학 | Chimeric genome engineering molecules and methods |
CN111566121A (en) | 2018-01-12 | 2020-08-21 | 巴斯夫欧洲公司 | Gene for determining number of spikelets per ear QTL on wheat 7a chromosome |
WO2019147302A1 (en) * | 2018-01-26 | 2019-08-01 | Bauer Daniel E | Targeting bcl11a distal regulatory elements with a cas9-cas9 fusion for fetal hemoglobin reinduction |
KR102494449B1 (en) | 2018-02-15 | 2023-01-31 | 시그마-알드리치 컴퍼니., 엘엘씨 | Engineered cas9 systems for eukaryotic genome modification |
KR20240038811A (en) | 2018-03-19 | 2024-03-25 | 리제너론 파마슈티칼스 인코포레이티드 | Transcription modulation in animals using crispr/cas systems |
CN112204131A (en) | 2018-03-29 | 2021-01-08 | 因思科瑞普特公司 | Automated control of cell growth rate for induction and transformation |
WO2019200004A1 (en) | 2018-04-13 | 2019-10-17 | Inscripta, Inc. | Automated cell processing instruments comprising reagent cartridges |
SG11202009783WA (en) | 2018-04-19 | 2020-11-27 | Univ California | Compositions and methods for gene editing |
US10858761B2 (en) | 2018-04-24 | 2020-12-08 | Inscripta, Inc. | Nucleic acid-guided editing of exogenous polynucleotides in heterologous cells |
US10526598B2 (en) | 2018-04-24 | 2020-01-07 | Inscripta, Inc. | Methods for identifying T-cell receptor antigens |
WO2019209926A1 (en) | 2018-04-24 | 2019-10-31 | Inscripta, Inc. | Automated instrumentation for production of peptide libraries |
KR20210005178A (en) * | 2018-04-27 | 2021-01-13 | 시애틀 칠드런즈 호스피탈 디/비/에이 시애틀 칠드런즈 리서치 인스티튜트 | Therapeutic genome editing in X-linked high IGM syndrome |
WO2019217803A1 (en) | 2018-05-10 | 2019-11-14 | Auxolytic Ltd. | Gene therapy methods and compositions using auxotrophic regulatable cells |
CN112105732A (en) * | 2018-05-10 | 2020-12-18 | 先正达参股股份有限公司 | Methods and compositions for targeted editing of polynucleotides |
CN108624622A (en) * | 2018-05-16 | 2018-10-09 | 湖南艾佳生物科技股份有限公司 | A kind of genetically engineered cell strain that can secrete mouse interleukin -6 based on CRISPR-Cas9 systems structure |
JP2021523745A (en) | 2018-05-16 | 2021-09-09 | シンテゴ コーポレイション | Methods and systems for guide RNA design and use |
EP3575402A1 (en) * | 2018-06-01 | 2019-12-04 | Algentech SAS | Gene targeting |
CA3102975A1 (en) | 2018-06-07 | 2019-12-12 | The State Of Israel, Ministry Of Agriculture & Rural Development, Agricultural Research Organization (Aro) (Volcani Center) | Methods of regenerating and transforming cannabis |
WO2019234754A1 (en) | 2018-06-07 | 2019-12-12 | The State Of Israel, Ministry Of Agriculture & Rural Development, Agricultural Research Organization (Aro) (Volcani Center) | Nucleic acid constructs and methods of using same |
CA3104649A1 (en) * | 2018-06-25 | 2020-12-21 | Bionano Genomics, Inc. | Labeling of dna |
EP3813974A4 (en) | 2018-06-30 | 2022-08-03 | Inscripta, Inc. | Instruments, modules, and methods for improved detection of edited sequences in live cells |
CN112805379A (en) * | 2018-08-03 | 2021-05-14 | 比姆医疗股份有限公司 | Multi-effect nucleobase editor and method of modifying nucleic acid target sequences using the same |
GB201813011D0 (en) | 2018-08-10 | 2018-09-26 | Vib Vzw | Means and methods for drought tolerance in crops |
US10752874B2 (en) | 2018-08-14 | 2020-08-25 | Inscripta, Inc. | Instruments, modules, and methods for improved detection of edited sequences in live cells |
US10532324B1 (en) | 2018-08-14 | 2020-01-14 | Inscripta, Inc. | Instruments, modules, and methods for improved detection of edited sequences in live cells |
US11142740B2 (en) | 2018-08-14 | 2021-10-12 | Inscripta, Inc. | Detection of nuclease edited sequences in automated modules and instruments |
KR102103103B1 (en) * | 2018-08-16 | 2020-04-21 | (주)라트바이오 | Transgenic animals and transgenic embryos producing an engineered nuclease |
SG11202101382VA (en) * | 2018-08-21 | 2021-03-30 | Sigma Aldrich Co Llc | Down-regulation of the cytosolic dna sensor pathway |
WO2020081149A2 (en) | 2018-08-30 | 2020-04-23 | Inscripta, Inc. | Improved detection of nuclease edited sequences in automated modules and instruments |
CN109055379B (en) * | 2018-09-10 | 2022-04-15 | 石铭 | Preparation method of transgenic chicken oviduct bioreactor |
KR102121817B1 (en) * | 2018-09-12 | 2020-06-26 | 한국화학연구원 | Vectors for expressing recombinant antigens using CRISPR and method for simultaneously multiplexing thereof |
US20220053741A1 (en) | 2018-09-13 | 2022-02-24 | Regeneron Pharmaceuticals, Inc. | Complement Factor H Gene Knockout Rat as a Model of C3 Glomerulopathy |
EP3861120A4 (en) | 2018-10-01 | 2023-08-16 | North Carolina State University | Recombinant type i crispr-cas system |
GB2611929B (en) | 2018-10-16 | 2023-11-22 | Blueallele Corp | Methods for targeted insertion of DNA in genes |
AU2019368215B2 (en) | 2018-10-22 | 2023-05-18 | Inscripta, Inc. | Engineered enzymes |
US11214781B2 (en) | 2018-10-22 | 2022-01-04 | Inscripta, Inc. | Engineered enzyme |
WO2020086908A1 (en) * | 2018-10-24 | 2020-04-30 | The Broad Institute, Inc. | Constructs for improved hdr-dependent genomic editing |
KR20200071198A (en) | 2018-12-10 | 2020-06-19 | 네오이뮨텍, 인코퍼레이티드 | Development of new adoptive T cell immunotherapy by modification of Nrf2 expression |
CA3117228A1 (en) | 2018-12-14 | 2020-06-18 | Pioneer Hi-Bred International, Inc. | Novel crispr-cas systems for genome editing |
CA3124039A1 (en) | 2018-12-19 | 2020-06-25 | King's College London | Immunotherapeutic methods and compositions |
IL301193A (en) | 2018-12-20 | 2023-05-01 | Regeneron Pharma | Nuclease-mediated repeat expansion |
MX2021008153A (en) * | 2019-01-04 | 2021-08-11 | Univ Chicago | Systems and methods for modulating rna. |
WO2020146899A1 (en) * | 2019-01-11 | 2020-07-16 | Chan Zuckerberg Biohub, Inc. | Targeted in vivo genome modification |
US11946040B2 (en) | 2019-02-04 | 2024-04-02 | The General Hospital Corporation | Adenine DNA base editor variants with reduced off-target RNA editing |
US20220298494A1 (en) * | 2019-02-14 | 2022-09-22 | Metagenomi Ip Technologies, Llc | Enzymes with ruvc domains |
JP2022520104A (en) * | 2019-02-15 | 2022-03-28 | シグマ-アルドリッチ・カンパニー・リミテッド・ライアビリティ・カンパニー | CRISPR / CAS fusion proteins and systems |
GB201902277D0 (en) | 2019-02-19 | 2019-04-03 | King S College London | Therapeutic agents |
MX2021010559A (en) | 2019-03-07 | 2021-12-15 | Univ California | Crispr-cas effector polypeptides and methods of use thereof. |
IL286357B1 (en) | 2019-03-18 | 2024-06-01 | Regeneron Pharma | Crispr/cas screening platform to identify genetic modifiers of tau seeding or aggregation |
SG11202108090XA (en) | 2019-03-18 | 2021-08-30 | Regeneron Pharma | Crispr/cas dropout screening platform to reveal genetic vulnerabilities associated with tau aggregation |
AU2020242032A1 (en) | 2019-03-19 | 2021-10-07 | Massachusetts Institute Of Technology | Methods and compositions for editing nucleotide sequences |
EP3947691A4 (en) | 2019-03-25 | 2022-12-14 | Inscripta, Inc. | Simultaneous multiplex genome editing in yeast |
US11001831B2 (en) | 2019-03-25 | 2021-05-11 | Inscripta, Inc. | Simultaneous multiplex genome editing in yeast |
BR112021019512A2 (en) | 2019-04-03 | 2022-02-15 | Regeneron Pharma | Methods for inserting an antigen-binding protein coding sequence and for treating or prophylaxis of a disease in an animal, animal, cell, genome, exogenous donor nucleic acid, safe harbor gene, and nuclease agent or a or more nucleic acids |
IL286917B (en) | 2019-04-04 | 2022-09-01 | Regeneron Pharma | Methods for scarless introduction of targeted modifications into targeting vectors |
ES2966625T3 (en) | 2019-04-04 | 2024-04-23 | Regeneron Pharma | Rodents comprising a humanized coagulation factor 12 locus |
GB201905360D0 (en) | 2019-04-16 | 2019-05-29 | Univ Nottingham | Fungal strains, production and uses thereof |
AU2020274594A1 (en) | 2019-05-10 | 2022-01-20 | Basf Se | Regulatory nucleic acid molecules for enhancing gene expression in plants |
AU2020286382A1 (en) | 2019-06-04 | 2021-11-04 | Regeneron Pharmaceuticals, Inc. | Non-human animals comprising a humanized TTR locus with a beta-slip mutation and methods of use |
CN113939593A (en) | 2019-06-06 | 2022-01-14 | 因思科瑞普特公司 | Treatment for recursive nucleic acid-guided cell editing |
EP3796776A1 (en) | 2019-06-07 | 2021-03-31 | Regeneron Pharmaceuticals, Inc. | Non-human animals comprising a humanized albumin locus |
US11845957B2 (en) | 2019-06-14 | 2023-12-19 | Regeneron Pharmaceuticals, Inc. | Models of tauopathy |
US10907125B2 (en) | 2019-06-20 | 2021-02-02 | Inscripta, Inc. | Flow through electroporation modules and instrumentation |
AU2020297499A1 (en) | 2019-06-21 | 2022-02-03 | Inscripta, Inc. | Genome-wide rationally-designed mutations leading to enhanced lysine production in E. coli |
US10927385B2 (en) | 2019-06-25 | 2021-02-23 | Inscripta, Inc. | Increased nucleic-acid guided cell editing in yeast |
WO2021050398A1 (en) * | 2019-09-10 | 2021-03-18 | The Regents Of The University Of California | Synthetic lethality screening platform for cells undergoing alt |
EP4028530A1 (en) | 2019-09-12 | 2022-07-20 | Basf Se | Regulatory nucleic acid molecules for enhancing gene expression in plants |
US20210079394A1 (en) | 2019-09-13 | 2021-03-18 | Regeneron Pharmaceuticals, Inc. | Transcription modulation in animals using crispr/cas systems delivered by lipid nanoparticles |
WO2021069387A1 (en) | 2019-10-07 | 2021-04-15 | Basf Se | Regulatory nucleic acid molecules for enhancing gene expression in plants |
CN110628825A (en) * | 2019-10-14 | 2019-12-31 | 上海捷易生物科技有限公司 | NHEJ-dependent reporter gene knock-in composition and using method thereof |
BR112022008861A2 (en) | 2019-11-08 | 2022-08-23 | Regeneron Pharma | NUCLEIC ACID CONSTRUCTION, VECTOR, LIPID NANO PARTICLE, CELL, COMPOSITION FOR USE IN EXPRESSING RETINOSCHISIN, METHOD FOR INTEGRATING A CODING SEQUENCE, AND, METHOD FOR MODIFYING AN RS1 GENE |
WO2021102059A1 (en) | 2019-11-19 | 2021-05-27 | Inscripta, Inc. | Methods for increasing observed editing in bacteria |
WO2021108363A1 (en) | 2019-11-25 | 2021-06-03 | Regeneron Pharmaceuticals, Inc. | Crispr/cas-mediated upregulation of humanized ttr allele |
AU2020396138A1 (en) | 2019-12-03 | 2022-06-16 | Basf Se | Regulatory nucleic acid molecules for enhancing gene expression in plants |
WO2021118626A1 (en) | 2019-12-10 | 2021-06-17 | Inscripta, Inc. | Novel mad nucleases |
US10704033B1 (en) | 2019-12-13 | 2020-07-07 | Inscripta, Inc. | Nucleic acid-guided nucleases |
KR20220116485A (en) | 2019-12-16 | 2022-08-23 | 바스프 아그리컬쳐럴 솔루션즈 시드 유에스 엘엘씨 | Improved genome editing using paired nickases |
EP4069851A4 (en) | 2019-12-18 | 2023-11-22 | Inscripta, Inc. | Cascade/dcas3 complementation assays for in vivo detection of nucleic acid-guided nuclease edited cells |
BR112022013772A2 (en) * | 2020-01-09 | 2022-10-11 | Pioneer Hi Bred Int | TWO-STEP GENE EXCHANGE |
US10689669B1 (en) | 2020-01-11 | 2020-06-23 | Inscripta, Inc. | Automated multi-module cell processing methods, instruments, and systems |
EP4096770A1 (en) | 2020-01-27 | 2022-12-07 | Inscripta, Inc. | Electroporation modules and instrumentation |
EP4096396A1 (en) | 2020-01-28 | 2022-12-07 | Regeneron Pharmaceuticals, Inc. | Non-human animals comprising a humanized pnpla3 locus and methods of use |
EP4099821A1 (en) | 2020-02-07 | 2022-12-14 | Regeneron Pharmaceuticals, Inc. | <smallcaps/>? ? ?klkb1? ? ? ? ?non-human animals comprising a humanizedlocus and methods of use |
AU2021232598A1 (en) | 2020-03-04 | 2022-09-08 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for sensitization of tumor cells to immune therapy |
US20230102342A1 (en) | 2020-03-23 | 2023-03-30 | Regeneron Pharmaceuticals, Inc. | Non-human animals comprising a humanized ttr locus comprising a v30m mutation and methods of use |
EP4127156A4 (en) | 2020-03-31 | 2024-03-27 | Metagenomi Inc | Class ii, type ii crispr systems |
WO2021202938A1 (en) | 2020-04-03 | 2021-10-07 | Creyon Bio, Inc. | Oligonucleotide-based machine learning |
US20210332388A1 (en) | 2020-04-24 | 2021-10-28 | Inscripta, Inc. | Compositions, methods, modules and instruments for automated nucleic acid-guided nuclease editing in mammalian cells |
BR112022022603A2 (en) | 2020-05-08 | 2023-01-17 | Broad Inst Inc | METHODS AND COMPOSITIONS FOR SIMULTANEOUS EDITING OF BOTH DUAL-STRANDED NUCLEOTIDE TARGET SEQUENCE STRAINS |
US11787841B2 (en) | 2020-05-19 | 2023-10-17 | Inscripta, Inc. | Rationally-designed mutations to the thrA gene for enhanced lysine production in E. coli |
WO2021263146A2 (en) | 2020-06-26 | 2021-12-30 | Regeneron Pharmaceuticals, Inc. | Non-human animals comprising a humanized ace2 locus |
CN111849986A (en) * | 2020-07-24 | 2020-10-30 | 江苏集萃药康生物科技有限公司 | Method for reducing tandem connection of double-stranded DNA (deoxyribonucleic acid) fragments in CRISPR-Cas9 gene editing and application thereof |
US11299731B1 (en) | 2020-09-15 | 2022-04-12 | Inscripta, Inc. | CRISPR editing to embed nucleic acid landing pads into genomes of live cells |
US11512297B2 (en) | 2020-11-09 | 2022-11-29 | Inscripta, Inc. | Affinity tag for recombination protein recruitment |
WO2022120022A1 (en) | 2020-12-02 | 2022-06-09 | Regeneron Pharmaceuticals, Inc. | Crispr sam biosensor cell lines and methods of use thereof |
WO2022133139A2 (en) * | 2020-12-16 | 2022-06-23 | Administrators Of The Tulane Educational Fund | Wnt+ adipocytes, exosomes from wnt+ adipocyte, and methods of making and using them |
US11306298B1 (en) | 2021-01-04 | 2022-04-19 | Inscripta, Inc. | Mad nucleases |
US11332742B1 (en) | 2021-01-07 | 2022-05-17 | Inscripta, Inc. | Mad nucleases |
US11884924B2 (en) | 2021-02-16 | 2024-01-30 | Inscripta, Inc. | Dual strand nucleic acid-guided nickase editing |
GB202103131D0 (en) | 2021-03-05 | 2021-04-21 | Biosystems Tech Limited | Method for preparation of research organisms |
EP4337769A1 (en) | 2021-05-10 | 2024-03-20 | SQZ Biotechnologies Company | Methods for delivering genome editing molecules to the nucleus or cytosol of a cell and uses thereof |
WO2022251644A1 (en) | 2021-05-28 | 2022-12-01 | Lyell Immunopharma, Inc. | Nr4a3-deficient immune cells and uses thereof |
AU2022286947A1 (en) | 2021-06-02 | 2023-12-14 | Lyell Immunopharma, Inc. | NR4A-deficient cells expressing c-Jun and uses thereof |
KR20240055811A (en) | 2021-09-10 | 2024-04-29 | 애질런트 테크놀로지스, 인크. | Guide RNA with chemical modifications for prime editing |
CN118119702A (en) | 2021-10-14 | 2024-05-31 | 隆萨销售股份有限公司 | Modified producer cells for extracellular vesicle production |
WO2023077053A2 (en) | 2021-10-28 | 2023-05-04 | Regeneron Pharmaceuticals, Inc. | Crispr/cas-related methods and compositions for knocking out c5 |
WO2023077148A1 (en) | 2021-11-01 | 2023-05-04 | Tome Biosciences, Inc. | Single construct platform for simultaneous delivery of gene editing machinery and nucleic acid cargo |
AU2022381205A1 (en) | 2021-11-04 | 2024-03-28 | Regeneron Pharmaceuticals, Inc. | Non-human animals comprising a modified cacng1 locus |
AU2022408167A1 (en) | 2021-12-08 | 2024-06-06 | Regeneron Pharmaceuticals, Inc. | Mutant myocilin disease model and uses thereof |
GB202118058D0 (en) | 2021-12-14 | 2022-01-26 | Univ Warwick | Methods to increase yields in crops |
US20230279442A1 (en) | 2021-12-15 | 2023-09-07 | Versitech Limited | Engineered cas9-nucleases and method of use thereof |
WO2023122506A1 (en) | 2021-12-20 | 2023-06-29 | Regeneron Pharmaceuticals, Inc. | Non-human animals comprising humanized ace2 and tmprss loci |
WO2023122764A1 (en) | 2021-12-22 | 2023-06-29 | Tome Biosciences, Inc. | Co-delivery of a gene editor construct and a donor template |
AU2022424002A1 (en) | 2021-12-29 | 2024-06-13 | Bristol-Myers Squibb Company | Generation of landing pad cell lines |
WO2023150181A1 (en) | 2022-02-01 | 2023-08-10 | President And Fellows Of Harvard College | Methods and compositions for treating cancer |
WO2023150620A1 (en) | 2022-02-02 | 2023-08-10 | Regeneron Pharmaceuticals, Inc. | Crispr-mediated transgene insertion in neonatal cells |
WO2023150798A1 (en) | 2022-02-07 | 2023-08-10 | Regeneron Pharmaceuticals, Inc. | Compositions and methods for defining optimal treatment timeframes in lysosomal disease |
WO2023205744A1 (en) | 2022-04-20 | 2023-10-26 | Tome Biosciences, Inc. | Programmable gene insertion compositions |
WO2023212677A2 (en) | 2022-04-29 | 2023-11-02 | Regeneron Pharmaceuticals, Inc. | Identification of tissue-specific extragenic safe harbors for gene therapy approaches |
WO2023215831A1 (en) | 2022-05-04 | 2023-11-09 | Tome Biosciences, Inc. | Guide rna compositions for programmable gene insertion |
WO2023220603A1 (en) | 2022-05-09 | 2023-11-16 | Regeneron Pharmaceuticals, Inc. | Vectors and methods for in vivo antibody production |
WO2023225665A1 (en) | 2022-05-19 | 2023-11-23 | Lyell Immunopharma, Inc. | Polynucleotides targeting nr4a3 and uses thereof |
WO2023225670A2 (en) | 2022-05-20 | 2023-11-23 | Tome Biosciences, Inc. | Ex vivo programmable gene insertion |
WO2023235726A2 (en) | 2022-05-31 | 2023-12-07 | Regeneron Pharmaceuticals, Inc. | Crispr interference therapeutics for c9orf72 repeat expansion disease |
WO2023235725A2 (en) | 2022-05-31 | 2023-12-07 | Regeneron Pharmaceuticals, Inc. | Crispr-based therapeutics for c9orf72 repeat expansion disease |
WO2023250384A2 (en) * | 2022-06-22 | 2023-12-28 | The Regents Of The University Of California | Crispr-cas effector polypeptides and methods of use thereof |
GB2621813A (en) | 2022-06-30 | 2024-02-28 | Univ Newcastle | Preventing disease recurrence in Mitochondrial replacement therapy |
WO2024020587A2 (en) | 2022-07-22 | 2024-01-25 | Tome Biosciences, Inc. | Pleiopluripotent stem cell programmable gene insertion |
WO2024026474A1 (en) | 2022-07-29 | 2024-02-01 | Regeneron Pharmaceuticals, Inc. | Compositions and methods for transferrin receptor (tfr)-mediated delivery to the brain and muscle |
WO2024026488A2 (en) | 2022-07-29 | 2024-02-01 | Regeneron Pharmaceuticals, Inc. | Non-human animals comprising a modified transferrin receptor locus |
WO2024031053A1 (en) | 2022-08-05 | 2024-02-08 | Regeneron Pharmaceuticals, Inc. | Aggregation-resistant variants of tdp-43 |
WO2024064958A1 (en) | 2022-09-23 | 2024-03-28 | Lyell Immunopharma, Inc. | Methods for culturing nr4a-deficient cells |
WO2024064952A1 (en) | 2022-09-23 | 2024-03-28 | Lyell Immunopharma, Inc. | Methods for culturing nr4a-deficient cells overexpressing c-jun |
WO2024073606A1 (en) | 2022-09-28 | 2024-04-04 | Regeneron Pharmaceuticals, Inc. | Antibody resistant modified receptors to enhance cell-based therapies |
WO2024077174A1 (en) | 2022-10-05 | 2024-04-11 | Lyell Immunopharma, Inc. | Methods for culturing nr4a-deficient cells |
WO2024083579A1 (en) | 2022-10-20 | 2024-04-25 | Basf Se | Regulatory nucleic acid molecules for enhancing gene expression in plants |
US20240182561A1 (en) | 2022-11-04 | 2024-06-06 | Regeneron Pharmaceuticals, Inc. | Calcium voltage-gated channel auxiliary subunit gamma 1 (cacng1) binding proteins and cacng1-mediated delivery to skeletal muscle |
US20240173426A1 (en) | 2022-11-14 | 2024-05-30 | Regeneron Pharmaceuticals, Inc. | Compositions and methods for fibroblast growth factor receptor 3-mediated delivery to astrocytes |
WO2024107670A1 (en) | 2022-11-16 | 2024-05-23 | Regeneron Pharmaceuticals, Inc. | Chimeric proteins comprising membrane bound il-12 with protease cleavable linkers |
Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20050220796A1 (en) * | 2004-03-31 | 2005-10-06 | Dynan William S | Compositions and methods for modulating DNA repair |
Family Cites Families (167)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4952496A (en) | 1984-03-30 | 1990-08-28 | Associated Universities, Inc. | Cloning and expression of the gene for bacteriophage T7 RNA polymerase |
WO1988008450A1 (en) | 1987-05-01 | 1988-11-03 | Birdwell Finlayson | Gene therapy for metabolite disorders |
US5350689A (en) | 1987-05-20 | 1994-09-27 | Ciba-Geigy Corporation | Zea mays plants and transgenic Zea mays plants regenerated from protoplasts or protoplast-derived cells |
US5767367A (en) | 1990-06-23 | 1998-06-16 | Hoechst Aktiengesellschaft | Zea mays (L.) with capability of long term, highly efficient plant regeneration including fertile transgenic maize plants having a heterologous gene, and their preparation |
US7150982B2 (en) | 1991-09-09 | 2006-12-19 | Third Wave Technologies, Inc. | RNA detection assays |
FR2763797B1 (en) * | 1997-05-30 | 1999-07-16 | Tabacs & Allumettes Ind | VERY LOW TAR RATE CIGARETTE WITH A TOBACCO TASTE COMPARABLE TO THAT OF A CLASSIC CIGARETTE WITH HIGHER TAR RATE |
US20040186071A1 (en) | 1998-04-13 | 2004-09-23 | Bennett C. Frank | Antisense modulation of CD40 expression |
US20020182673A1 (en) | 1998-05-15 | 2002-12-05 | Genentech, Inc. | IL-17 homologous polypedies and therapeutic uses thereof |
CA2361191A1 (en) | 1999-02-03 | 2000-08-10 | The Children's Medical Center Corporation | Gene repair involving the induction of double-stranded dna cleavage at a chromosomal target site |
US8183339B1 (en) * | 1999-10-12 | 2012-05-22 | Xigen S.A. | Cell-permeable peptide inhibitors of the JNK signal transduction pathway |
WO2002026967A2 (en) | 2000-09-25 | 2002-04-04 | Thomas Jefferson University | Targeted gene correction by single-stranded oligodeoxynucleotides |
JP4254931B1 (en) | 2000-10-27 | 2009-04-15 | カイロン ソチエタ ア レスポンサビリタ リミタータ | Nucleic acids and proteins from Group A Streptococcus and Group B Streptococcus |
US7033744B2 (en) * | 2001-03-16 | 2006-04-25 | Naoya Kobayashi | Method for proliferating a liver cell, a liver cell obtained thereby, and use thereof |
IL159756A0 (en) | 2001-07-12 | 2004-06-20 | Univ Massachusetts | IN VIVO PRODUCTION OF SMALL INTERFERING RNAs THAT MEDIATE GENE SILENCING |
US20060253913A1 (en) | 2001-12-21 | 2006-11-09 | Yue-Jin Huang | Production of hSA-linked butyrylcholinesterases in transgenic mammals |
BR0307383A (en) | 2002-01-23 | 2005-04-26 | Univ Utah Res Found | Target chromosomal mutagenesis using zinc branch nucleases |
WO2003080809A2 (en) | 2002-03-21 | 2003-10-02 | Sangamo Biosciences, Inc. | Methods and compositions for using zinc finger endonucleases to enhance homologous recombination |
AU2003224897A1 (en) | 2002-04-09 | 2003-10-27 | Kenneth L. Beattie | Oligonucleotide probes for genosensor chips |
AU2003233719A1 (en) * | 2002-06-06 | 2003-12-22 | Her Majesty The Queen In Right Of Canada As Represented By The Minister Of Agriculture And Agri-Food | Modifying the dna recombination potential in eukaryotes |
JP2006502748A (en) | 2002-09-05 | 2006-01-26 | カリフォルニア インスティテュート オブ テクノロジー | Methods of using chimeric nucleases to induce gene targeting |
DE10260805A1 (en) * | 2002-12-23 | 2004-07-22 | Geneart Gmbh | Method and device for optimizing a nucleotide sequence for expression of a protein |
EP1651660B1 (en) * | 2003-08-08 | 2018-01-24 | Sangamo Therapeutics, Inc. | Methods and compositions for targeted cleavage and recombination |
US8053232B2 (en) | 2004-01-23 | 2011-11-08 | Virxsys Corporation | Correction of alpha-1-antitrypsin genetic defects using spliceosome mediated RNA trans splicing |
US7972854B2 (en) | 2004-02-05 | 2011-07-05 | Sangamo Biosciences, Inc. | Methods and compositions for targeted cleavage and recombination |
US7919277B2 (en) | 2004-04-28 | 2011-04-05 | Danisco A/S | Detection and typing of bacterial strains |
AU2005319306B9 (en) * | 2004-12-22 | 2012-04-05 | Alnylam Pharmaceuticals, Inc. | Conserved HBV and HCV sequences useful for gene silencing |
US7892224B2 (en) | 2005-06-01 | 2011-02-22 | Brainlab Ag | Inverse catheter planning |
US7534819B2 (en) | 2005-06-10 | 2009-05-19 | University Of Washington | Compositions and methods for intracellular delivery of biotinylated cargo |
US20060282289A1 (en) | 2005-06-14 | 2006-12-14 | Healthmatch Solutions, Llc | System and method for health care financing |
US20100055793A1 (en) * | 2005-07-25 | 2010-03-04 | Johns Hopkins University | Site-specific modification of the human genome using custom-designed zinc finger nucleases |
KR20080033455A (en) | 2005-07-26 | 2008-04-16 | 상가모 바이오사이언스 인코포레이티드 | Targeted integration and expression of exogenous nucleic acid sequences |
US10022457B2 (en) | 2005-08-05 | 2018-07-17 | Gholam A. Peyman | Methods to regulate polarization and enhance function of cells |
NZ597299A (en) | 2005-08-26 | 2013-03-28 | Dupont Nutrition Biosci Aps | Use of a cas gene in combination with CRISPR repeats for modulating resistance in a cell |
KR100877824B1 (en) * | 2005-11-11 | 2009-01-12 | 한국생명공학연구원 | E2EPF ubiquitin carrier protein-von Hippel-Lindau interaction and uses of thereof |
EP2522749A1 (en) * | 2006-03-02 | 2012-11-14 | The Ohio State University | MicroRNA expression profile associated with pancreatic cancer |
US9677123B2 (en) | 2006-03-15 | 2017-06-13 | Siemens Healthcare Diagnostics Inc. | Degenerate nucleobase analogs |
WO2007126856A2 (en) * | 2006-03-28 | 2007-11-08 | Novartis Ag | Covalently-linked complexes of hiv tat and env proteins |
ATE513053T1 (en) | 2006-05-10 | 2011-07-15 | Deinove Sa | METHOD FOR CHROMOSOME MANIPULATION USING A NEW DNA REPAIR SYSTEM |
US9399801B2 (en) | 2006-05-19 | 2016-07-26 | Dupont Nutrition Biosciences Aps | Tagged microorganisms and methods of tagging |
EP2019839B1 (en) | 2006-05-25 | 2011-12-07 | Sangamo BioSciences, Inc. | Methods and compositions for gene inactivation |
ES2610811T3 (en) | 2006-06-16 | 2017-05-03 | Dupont Nutrition Biosciences Aps | Streptococcus thermophilus bacteria |
WO2008019123A2 (en) * | 2006-08-04 | 2008-02-14 | Georgia State University Research Foundation, Inc. | Enzyme sensors, methods for preparing and using such sensors, and methods of detecting protease activity |
MX2009009071A (en) | 2007-03-02 | 2009-09-24 | Danisco | Cultures with improved phage resistance. |
GB0806086D0 (en) | 2008-04-04 | 2008-05-14 | Ulive Entpr Ltd | Dendrimer polymer hybrids |
US8546553B2 (en) | 2008-07-25 | 2013-10-01 | University Of Georgia Research Foundation, Inc. | Prokaryotic RNAi-like system and methods of use |
AU2009283194B2 (en) | 2008-08-22 | 2014-10-16 | Sangamo Therapeutics, Inc. | Methods and compositions for targeted single-stranded cleavage and targeted integration |
DK2334794T3 (en) | 2008-09-15 | 2017-02-20 | Children's Medical Center Corp | MODULATION OF BCL11A FOR TREATMENT OF HEMOGLOBINOPATHIES |
US20100076057A1 (en) * | 2008-09-23 | 2010-03-25 | Northwestern University | TARGET DNA INTERFERENCE WITH crRNA |
US9404098B2 (en) | 2008-11-06 | 2016-08-02 | University Of Georgia Research Foundation, Inc. | Method for cleaving a target RNA using a Cas6 polypeptide |
DK2362915T3 (en) | 2008-11-07 | 2017-03-27 | Dupont Nutrition Biosci Aps | CRISPR SEQUENCES OF BIFIDOBACTERIA |
EP2789687A1 (en) | 2008-12-12 | 2014-10-15 | DuPont Nutrition Biosciences ApS | Genetic cluster of strains of Streptococcus thermophilus having unique rheological properties for dairy fermentation |
WO2010075424A2 (en) | 2008-12-22 | 2010-07-01 | The Regents Of University Of California | Compositions and methods for downregulating prokaryotic genes |
GB0823658D0 (en) | 2008-12-30 | 2009-02-04 | Angiomed Ag | Stent delivery device |
US8392349B2 (en) | 2009-02-23 | 2013-03-05 | Shalini Vajjhala | Global adaptation atlas and method of creating same |
AU2010235161B2 (en) | 2009-04-09 | 2015-01-22 | Sangamo Therapeutics, Inc. | Targeted integration into stem cells |
PT2424571T (en) | 2009-04-30 | 2020-05-06 | Ospedale San Raffaele Srl | Gene vector |
AU2010275432A1 (en) | 2009-07-24 | 2012-02-02 | Sigma-Aldrich Co. Llc. | Method for genome editing |
US20120192298A1 (en) * | 2009-07-24 | 2012-07-26 | Sigma Aldrich Co. Llc | Method for genome editing |
EP2727600B1 (en) | 2009-07-28 | 2019-03-27 | Sangamo Therapeutics, Inc. | Zinc finger fusion proteins for repressing a huntington gene |
KR101418355B1 (en) | 2009-10-23 | 2014-07-11 | (주)바이오니아 | High throughput oligonucleotide synthesizer |
DE102009052674B4 (en) | 2009-11-12 | 2012-10-18 | Karl Weinhold | Method and device for connecting double-walled pipes |
US20110294114A1 (en) | 2009-12-04 | 2011-12-01 | Cincinnati Children's Hospital Medical Center | Optimization of determinants for successful genetic correction of diseases, mediated by hematopoietic stem cells |
DK2816112T3 (en) | 2009-12-10 | 2018-11-19 | Univ Minnesota | TAL effector-mediated DNA modification |
EP2534163B1 (en) | 2010-02-09 | 2015-11-04 | Sangamo BioSciences, Inc. | Targeted genomic modification with partially single-stranded donor molecules |
US10087431B2 (en) | 2010-03-10 | 2018-10-02 | The Regents Of The University Of California | Methods of generating nucleic acid fragments |
JP5926242B2 (en) | 2010-05-10 | 2016-05-25 | ザ リージェンツ オブ ザ ユニバーシティ オブ カリフォルニア | Endoribonuclease composition and method of use thereof |
EP3156062A1 (en) | 2010-05-17 | 2017-04-19 | Sangamo BioSciences, Inc. | Novel dna-binding proteins and uses thereof |
US20140148361A1 (en) | 2010-06-07 | 2014-05-29 | Barry L. Stoddard | Generation and Expression of Engineered I-ONUI Endonuclease and Its Homologues and Uses Thereof |
EP2392208B1 (en) * | 2010-06-07 | 2016-05-04 | Helmholtz Zentrum München Deutsches Forschungszentrum für Gesundheit und Umwelt (GmbH) | Fusion proteins comprising a DNA-binding domain of a Tal effector protein and a non-specific cleavage domain of a restriction nuclease and their use |
AU2011265733B2 (en) | 2010-06-14 | 2014-04-17 | Iowa State University Research Foundation, Inc. | Nuclease activity of TAL effector and Foki fusion protein |
SG187075A1 (en) * | 2010-07-23 | 2013-03-28 | Sigma Aldrich Co Llc | Genome editing using targeting endonucleases and single-stranded nucleic acids |
US9081737B2 (en) | 2010-08-02 | 2015-07-14 | Integrated Dna Technologies, Inc. | Methods for predicting stability and melting temperatures of nucleic acid duplexes |
DK2630156T3 (en) | 2010-10-20 | 2018-12-17 | Dupont Nutrition Biosci Aps | CRISPR-CAS SEQUENCES OF LACTOCOCCUS |
WO2012069657A1 (en) * | 2010-11-26 | 2012-05-31 | Institut Pasteur | Identification of a human gyrovirus and applications. |
WO2012087756A1 (en) | 2010-12-22 | 2012-06-28 | Sangamo Biosciences, Inc. | Zinc finger nuclease modification of leucine rich repeat kinase 2 (lrrk2) mutant fibroblasts and ipscs |
KR20120096395A (en) | 2011-02-22 | 2012-08-30 | 주식회사 툴젠 | Methods for enriching cells containing nuclease-induced gene disruptions |
WO2012164565A1 (en) | 2011-06-01 | 2012-12-06 | Yeda Research And Development Co. Ltd. | Compositions and methods for downregulating prokaryotic genes |
IL277027B (en) | 2011-09-21 | 2022-07-01 | Sangamo Therapeutics Inc | Methods and compositions for regulation of transgene expression |
JP6144691B2 (en) * | 2011-11-16 | 2017-06-07 | サンガモ セラピューティクス, インコーポレイテッド | Modified DNA binding proteins and uses thereof |
US8450107B1 (en) | 2011-11-30 | 2013-05-28 | The Broad Institute Inc. | Nucleotide-specific recognition sequences for designer TAL effectors |
GB201122458D0 (en) | 2011-12-30 | 2012-02-08 | Univ Wageningen | Modified cascade ribonucleoproteins and uses thereof |
SG10201606959PA (en) | 2012-02-24 | 2016-09-29 | Hutchinson Fred Cancer Res | Compositions and methods for the treatment of hemoglobinopathies |
CA2865011C (en) | 2012-02-29 | 2021-06-15 | Sangamo Biosciences, Inc. | Methods and compositions for treating huntington's disease |
US9637739B2 (en) | 2012-03-20 | 2017-05-02 | Vilnius University | RNA-directed DNA cleavage by the Cas9-crRNA complex |
WO2013141680A1 (en) | 2012-03-20 | 2013-09-26 | Vilnius University | RNA-DIRECTED DNA CLEAVAGE BY THE Cas9-crRNA COMPLEX |
AU2013204327B2 (en) | 2012-04-20 | 2016-09-01 | Aviagen | Cell transfection method |
CN104245940A (en) | 2012-04-23 | 2014-12-24 | 拜尔作物科学公司 | Targeted genome engineering in plants |
IN2014DN09261A (en) | 2012-04-25 | 2015-07-10 | Regeneron Pharma | |
BR112014027227B1 (en) | 2012-05-02 | 2022-04-19 | Sangamo Biosciences, Inc. | Methods for producing a plant that has reduced expression of the endogenous malate dehydrogenase (mdh) gene, and for increasing crop yield |
CN104471067B (en) | 2012-05-07 | 2020-08-14 | 桑格摩生物治疗股份有限公司 | Methods and compositions for nuclease-mediated targeted integration of transgenes |
US11120889B2 (en) | 2012-05-09 | 2021-09-14 | Georgia Tech Research Corporation | Method for synthesizing a nuclease with reduced off-site cleavage |
MA37663B1 (en) * | 2012-05-25 | 2019-12-31 | Univ California | Methods and compositions for modifying rna-directed target DNA and modulating rna-directed transcription |
MX2014014650A (en) | 2012-05-30 | 2015-10-14 | Univ Washington | Supercoiled minivectors as a tool for dna repair, alteration and replacement. |
WO2013188037A2 (en) | 2012-06-11 | 2013-12-19 | Agilent Technologies, Inc | Method of adaptor-dimer subtraction using a crispr cas6 protein |
MX2014015204A (en) | 2012-06-12 | 2015-08-07 | Genentech Inc | Methods and compositions for generating conditional knock-out alleles. |
EP2674501A1 (en) | 2012-06-14 | 2013-12-18 | Agence nationale de sécurité sanitaire de l'alimentation,de l'environnement et du travail | Method for detecting and identifying enterohemorrhagic Escherichia coli |
US9688971B2 (en) | 2012-06-15 | 2017-06-27 | The Regents Of The University Of California | Endoribonuclease and methods of use thereof |
EP2861737B1 (en) | 2012-06-19 | 2019-04-17 | Regents Of The University Of Minnesota | Gene targeting in plants using dna viruses |
JP6329537B2 (en) | 2012-07-11 | 2018-05-23 | サンガモ セラピューティクス, インコーポレイテッド | Methods and compositions for delivery of biological agents |
ES2813080T3 (en) | 2012-07-11 | 2021-03-22 | Sangamo Therapeutics Inc | Methods and compositions for the treatment of lysosomal storage diseases |
CN116622704A (en) | 2012-07-25 | 2023-08-22 | 布罗德研究所有限公司 | Inducible DNA binding proteins and genomic disruption tools and uses thereof |
WO2014022702A2 (en) | 2012-08-03 | 2014-02-06 | The Regents Of The University Of California | Methods and compositions for controlling gene expression by rna processing |
EA039384B1 (en) | 2012-08-29 | 2022-01-20 | Сангамо Байосаенсез, Инк. | Zinc finger protein for modulating expression of bcl11a gene and method of modulating expression of globin gene |
UA119135C2 (en) | 2012-09-07 | 2019-05-10 | ДАУ АГРОСАЙЄНСІЗ ЕлЕлСі | Engineered transgene integration platform (etip) for gene targeting and trait stacking |
AU2013312538B2 (en) | 2012-09-07 | 2019-01-24 | Corteva Agriscience Llc | FAD3 performance loci and corresponding target site specific binding proteins capable of inducing targeted breaks |
UA118090C2 (en) | 2012-09-07 | 2018-11-26 | ДАУ АГРОСАЙЄНСІЗ ЕлЕлСі | Fad2 performance loci and corresponding target site specific binding proteins capable of inducing targeted breaks |
US20150267176A1 (en) | 2012-10-12 | 2015-09-24 | The General Hospital Corporation | Transcription activator-like effector (tale) - lysine-specific demethylase 1 (lsd1) fusion proteins |
KR102182847B1 (en) | 2012-10-23 | 2020-11-27 | 주식회사 툴젠 | Composition for cleaving a target DNA comprising a guide RNA specific for the target DNA and Cas protein-encoding nucleic acid or Cas protein, and use thereof |
WO2014070887A1 (en) | 2012-10-30 | 2014-05-08 | Recombinetics, Inc. | Control of sexual maturation in animals |
WO2014071006A1 (en) | 2012-10-31 | 2014-05-08 | Cellectis | Coupling herbicide resistance with targeted insertion of transgenes in plants |
US20140127752A1 (en) | 2012-11-07 | 2014-05-08 | Zhaohui Zhou | Method, composition, and reagent kit for targeted genomic enrichment |
EP3617309A3 (en) | 2012-12-06 | 2020-05-06 | Sigma Aldrich Co. LLC | Crispr-based genome modification and regulation |
WO2014093479A1 (en) | 2012-12-11 | 2014-06-19 | Montana State University | Crispr (clustered regularly interspaced short palindromic repeats) rna-guided control of gene regulation |
KR20150105634A (en) | 2012-12-12 | 2015-09-17 | 더 브로드 인스티튜트, 인코퍼레이티드 | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
US8697359B1 (en) | 2012-12-12 | 2014-04-15 | The Broad Institute, Inc. | CRISPR-Cas systems and methods for altering expression of gene products |
DK2931898T3 (en) * | 2012-12-12 | 2016-06-20 | Massachusetts Inst Technology | CONSTRUCTION AND OPTIMIZATION OF SYSTEMS, PROCEDURES AND COMPOSITIONS FOR SEQUENCE MANIPULATION WITH FUNCTIONAL DOMAINS |
WO2014093709A1 (en) | 2012-12-12 | 2014-06-19 | The Broad Institute, Inc. | Methods, models, systems, and apparatus for identifying target sequences for cas enzymes or crispr-cas systems for target sequences and conveying results thereof |
US20140310830A1 (en) | 2012-12-12 | 2014-10-16 | Feng Zhang | CRISPR-Cas Nickase Systems, Methods And Compositions For Sequence Manipulation in Eukaryotes |
IL293526A (en) | 2012-12-12 | 2022-08-01 | Harvard College | C delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
PT2771468E (en) | 2012-12-12 | 2015-06-02 | Harvard College | Engineering of systems, methods and optimized guide compositions for sequence manipulation |
WO2014093595A1 (en) | 2012-12-12 | 2014-06-19 | The Broad Institute, Inc. | Crispr-cas component systems, methods and compositions for sequence manipulation |
EP3064585B1 (en) | 2012-12-12 | 2020-02-05 | The Broad Institute, Inc. | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
EP2931899A1 (en) | 2012-12-12 | 2015-10-21 | The Broad Institute, Inc. | Functional genomics using crispr-cas systems, compositions, methods, knock out libraries and applications thereof |
AR093979A1 (en) | 2012-12-13 | 2015-07-01 | Dow Agrosciences Llc | DNA DETECTION METHODS FOR SITE SPECIFIC NUCLEASE ACTIVITY |
ES2741951T3 (en) | 2012-12-17 | 2020-02-12 | Harvard College | Genetic engineering modification of the human genome guided by RNA |
EP2938184B1 (en) | 2012-12-27 | 2018-10-31 | Keygene N.V. | Method for removing genetic linkage in a plant |
CN113005148A (en) | 2013-01-16 | 2021-06-22 | 爱默蕾大学 | CAS 9-nucleic acid complexes and uses related thereto |
CN103233028B (en) | 2013-01-25 | 2015-05-13 | 南京徇齐生物技术有限公司 | Specie limitation-free eucaryote gene targeting method having no bio-safety influence and helical-structure DNA sequence |
WO2014127287A1 (en) | 2013-02-14 | 2014-08-21 | Massachusetts Institute Of Technology | Method for in vivo tergated mutagenesis |
RU2690352C2 (en) | 2013-02-20 | 2019-05-31 | Регенерон Фармасютикалс, Инк. | Genetic modification of rats |
AU2014218621B2 (en) | 2013-02-25 | 2019-11-07 | Sangamo Therapeutics, Inc. | Methods and compositions for enhancing nuclease-mediated gene disruption |
RU2018122288A (en) | 2013-03-14 | 2019-03-06 | Карибо Биосайенсиз, Инк. | COMPOSITIONS AND METHODS WITH PARTICIPATION OF NUCLEIC ACIDS AIMED AT NUCLEIC ACIDS |
US9234213B2 (en) | 2013-03-15 | 2016-01-12 | System Biosciences, Llc | Compositions and methods directed to CRISPR/Cas genomic engineering systems |
US10760064B2 (en) | 2013-03-15 | 2020-09-01 | The General Hospital Corporation | RNA-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci |
AU2014227653B2 (en) | 2013-03-15 | 2017-04-20 | The General Hospital Corporation | Using RNA-guided foki nucleases (RFNs) to increase specificity for RNA-guided genome editing |
US11332719B2 (en) | 2013-03-15 | 2022-05-17 | The Broad Institute, Inc. | Recombinant virus and preparations thereof |
US20140364333A1 (en) | 2013-03-15 | 2014-12-11 | President And Fellows Of Harvard College | Methods for Live Imaging of Cells |
US20140273230A1 (en) | 2013-03-15 | 2014-09-18 | Sigma-Aldrich Co., Llc | Crispr-based genome modification and regulation |
US20140273235A1 (en) | 2013-03-15 | 2014-09-18 | Regents Of The University Of Minnesota | ENGINEERING PLANT GENOMES USING CRISPR/Cas SYSTEMS |
WO2014165825A2 (en) | 2013-04-04 | 2014-10-09 | President And Fellows Of Harvard College | Therapeutic uses of genome editing with crispr/cas systems |
CA2908512C (en) | 2013-04-05 | 2023-10-24 | Dow Agrosciences Llc | Methods and compositions for integration of an exogenous sequence within the genome of plants |
SI2986729T1 (en) | 2013-04-16 | 2019-02-28 | Regeneron Pharmaceuticals, Inc. | Targeted modification of rat genome |
CN103224947B (en) | 2013-04-28 | 2015-06-10 | 陕西师范大学 | Gene targeting system |
CA2910427C (en) | 2013-05-10 | 2024-02-20 | Sangamo Biosciences, Inc. | Delivery methods and compositions for nuclease-mediated genome engineering |
EP2999788B1 (en) | 2013-05-22 | 2020-07-08 | Northwestern University | Rna-directed dna cleavage and gene editing by cas9 enzyme from neisseria meningitidis |
US11414695B2 (en) | 2013-05-29 | 2022-08-16 | Agilent Technologies, Inc. | Nucleic acid enrichment using Cas9 |
US20140356956A1 (en) | 2013-06-04 | 2014-12-04 | President And Fellows Of Harvard College | RNA-Guided Transcriptional Regulation |
ES2767318T3 (en) | 2013-06-17 | 2020-06-17 | Broad Inst Inc | Supply, modification and optimization of systems, methods and compositions to generate models and act on postmitotic cell diseases and disorders |
AU2014281027A1 (en) | 2013-06-17 | 2016-01-28 | Massachusetts Institute Of Technology | Optimized CRISPR-Cas double nickase systems, methods and compositions for sequence manipulation |
SG11201510284XA (en) | 2013-06-17 | 2016-01-28 | Broad Inst Inc | Delivery and use of the crispr-cas systems, vectors and compositions for hepatic targeting and therapy |
EP3011034B1 (en) | 2013-06-17 | 2019-08-07 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using viral components |
EP3725885A1 (en) | 2013-06-17 | 2020-10-21 | The Broad Institute, Inc. | Functional genomics using crispr-cas systems, compositions methods, screens and applications thereof |
CN103343120B (en) | 2013-07-04 | 2015-03-04 | 中国科学院遗传与发育生物学研究所 | Wheat genome site-specific modification method |
CN103382468B (en) * | 2013-07-04 | 2015-04-29 | 中国科学院遗传与发育生物学研究所 | Site-directed modification method of rice genome |
IL282489B (en) | 2013-07-10 | 2022-07-01 | Harvard College | Orthogonal cas9 proteins for rna-guided gene regulation and editing |
CN103388006B (en) | 2013-07-26 | 2015-10-28 | 华东师范大学 | A kind of construction process of site-directed point mutation |
US10421957B2 (en) | 2013-07-29 | 2019-09-24 | Agilent Technologies, Inc. | DNA assembly using an RNA-programmable nickase |
EP3065540B1 (en) | 2013-11-04 | 2021-12-15 | Corteva Agriscience LLC | Optimal maize loci |
MX362066B (en) | 2013-11-04 | 2019-01-07 | Dow Agrosciences Llc | Optimal soybean loci. |
TWI672378B (en) | 2013-11-04 | 2019-09-21 | 陶氏農業科學公司 | Optimal soybean loci |
CN106459995B (en) | 2013-11-07 | 2020-02-21 | 爱迪塔斯医药有限公司 | CRISPR-associated methods and compositions using dominant grnas |
MX2016007654A (en) | 2013-12-11 | 2017-08-15 | Regeneron Pharma | Methods and compositions for the targeted modification of a genome. |
US9850525B2 (en) | 2014-01-29 | 2017-12-26 | Agilent Technologies, Inc. | CAS9-based isothermal method of detection of specific DNA sequence |
WO2015117041A1 (en) | 2014-01-30 | 2015-08-06 | Nair Ramesh B | Gene modification-mediated methods and compositions for generating dominant traits in eukaryotic systems |
US20150225801A1 (en) | 2014-02-11 | 2015-08-13 | California Institute Of Technology | Recording and mapping lineage information and molecular events in individual cells |
EP3110454B1 (en) | 2014-02-24 | 2020-11-18 | Sangamo Therapeutics, Inc. | Methods and compositions for nuclease-mediated targeted integration |
US9624498B2 (en) | 2014-03-18 | 2017-04-18 | Sangamo Biosciences, Inc. | Methods and compositions for regulation of zinc finger protein expression |
-
2013
- 2013-12-05 EP EP19189913.7A patent/EP3617309A3/en active Pending
- 2013-12-05 ES ES16183725T patent/ES2713243T3/en active Active
- 2013-12-05 SG SG10201800585VA patent/SG10201800585VA/en unknown
- 2013-12-05 EP EP16183720.8A patent/EP3141604A1/en not_active Withdrawn
- 2013-12-05 US US14/649,777 patent/US20160017366A1/en not_active Abandoned
- 2013-12-05 PT PT16183725T patent/PT3138912T/en unknown
- 2013-12-05 ES ES16183724T patent/ES2714154T3/en active Active
- 2013-12-05 EP EP13859964.2A patent/EP2928496B1/en not_active Revoked
- 2013-12-05 ES ES18160519T patent/ES2769310T3/en active Active
- 2013-12-05 CA CA2977152A patent/CA2977152C/en active Active
- 2013-12-05 ES ES18156734T patent/ES2757808T3/en active Active
- 2013-12-05 DK DK18160519.7T patent/DK3363902T3/en active
- 2013-12-05 LT LTEP16183725.7T patent/LT3138912T/en unknown
- 2013-12-05 BR BR112015012375A patent/BR112015012375A2/en active Search and Examination
- 2013-12-05 PL PL13859964T patent/PL2928496T3/en unknown
- 2013-12-05 DK DK16183724.0T patent/DK3138911T3/en active
- 2013-12-05 CA CA2891347A patent/CA2891347C/en active Active
- 2013-12-05 AU AU2013355214A patent/AU2013355214B2/en active Active
- 2013-12-05 PL PL16183723T patent/PL3138910T3/en unknown
- 2013-12-05 LT LTEP18160519.7T patent/LT3363902T/en unknown
- 2013-12-05 EP EP18156734.8A patent/EP3360964B1/en active Active
- 2013-12-05 CN CN201810540449.5A patent/CN108715602A/en active Pending
- 2013-12-05 LT LTEP16183723.2T patent/LT3138910T/en unknown
- 2013-12-05 EP EP16183725.7A patent/EP3138912B1/en not_active Revoked
- 2013-12-05 PL PL18156734T patent/PL3360964T3/en unknown
- 2013-12-05 WO PCT/US2013/073307 patent/WO2014089290A1/en active Application Filing
- 2013-12-05 DK DK13859964T patent/DK2928496T3/en active
- 2013-12-05 PT PT181605197T patent/PT3363902T/en unknown
- 2013-12-05 EP EP16183723.2A patent/EP3138910B1/en not_active Revoked
- 2013-12-05 EP EP16183717.4A patent/EP3138909A1/en not_active Withdrawn
- 2013-12-05 DK DK18156734T patent/DK3360964T3/en active
- 2013-12-05 PT PT138599642T patent/PT2928496T/en unknown
- 2013-12-05 EP EP19201769.7A patent/EP3611263A1/en active Pending
- 2013-12-05 KR KR1020157013843A patent/KR101844123B1/en active IP Right Review Request
- 2013-12-05 EP EP18160519.7A patent/EP3363902B1/en active Active
- 2013-12-05 KR KR1020187001934A patent/KR102006880B1/en active IP Right Grant
- 2013-12-05 PT PT181567348T patent/PT3360964T/en unknown
- 2013-12-05 IL IL300199A patent/IL300199A/en unknown
- 2013-12-05 ES ES13859964T patent/ES2757325T3/en active Active
- 2013-12-05 EP EP16183719.0A patent/EP3135765A1/en not_active Withdrawn
- 2013-12-05 DK DK16183725.7T patent/DK3138912T3/en active
- 2013-12-05 PL PL18160519T patent/PL3363902T3/en unknown
- 2013-12-05 CN CN201810574719.4A patent/CN108913676B/en active Active
- 2013-12-05 DK DK16183723.2T patent/DK3138910T3/en active
- 2013-12-05 PT PT16183724T patent/PT3138911T/en unknown
- 2013-12-05 SG SG10202107423UA patent/SG10202107423UA/en unknown
- 2013-12-05 ES ES16183723.2T patent/ES2653212T3/en active Active
- 2013-12-05 SG SG10201910987SA patent/SG10201910987SA/en unknown
- 2013-12-05 EP EP16183724.0A patent/EP3138911B1/en active Active
- 2013-12-05 JP JP2015545838A patent/JP6620018B2/en active Active
- 2013-12-05 CN CN201380072477.4A patent/CN105142669B/en active Active
- 2013-12-05 PL PL16183724T patent/PL3138911T3/en unknown
- 2013-12-05 LT LTEP16183724.0T patent/LT3138911T/en unknown
- 2013-12-05 KR KR1020217011309A patent/KR102479178B1/en active IP Right Grant
- 2013-12-05 PL PL16183725T patent/PL3138912T3/en unknown
- 2013-12-05 SG SG11201503824SA patent/SG11201503824SA/en unknown
- 2013-12-05 KR KR1020197022305A patent/KR102145760B1/en active IP Right Grant
- 2013-12-05 KR KR1020207023229A patent/KR102243092B1/en active IP Right Grant
- 2013-12-05 CA CA3034794A patent/CA3034794A1/en active Pending
- 2013-12-05 PT PT161837232T patent/PT3138910T/en unknown
- 2013-12-05 KR KR1020227043854A patent/KR102531576B1/en active IP Right Grant
-
2015
- 2015-05-17 IL IL238856A patent/IL238856B/en active IP Right Grant
-
2016
- 2016-06-06 HK HK16106396.9A patent/HK1218389A1/en unknown
- 2016-06-21 US US15/188,909 patent/US20160298133A1/en not_active Abandoned
- 2016-06-21 US US15/188,933 patent/US20160298138A1/en not_active Abandoned
- 2016-06-21 US US15/188,927 patent/US20160298136A1/en not_active Abandoned
- 2016-06-21 US US15/188,924 patent/US10745716B2/en active Active
- 2016-06-21 US US15/188,899 patent/US20160298125A1/en not_active Abandoned
- 2016-06-21 US US15/188,931 patent/US20160298137A1/en not_active Abandoned
- 2016-06-21 US US15/188,911 patent/US10731181B2/en active Active
- 2016-06-21 US US15/188,902 patent/US20160298132A1/en not_active Abandoned
- 2016-11-03 US US15/342,976 patent/US20170073705A1/en not_active Abandoned
-
2017
- 2017-03-10 US US15/456,204 patent/US20170191082A1/en active Pending
- 2017-06-13 JP JP2017115672A patent/JP2017192392A/en active Pending
- 2017-06-15 AU AU2017204031A patent/AU2017204031B2/en active Active
-
2018
- 2018-01-28 IL IL257178A patent/IL257178B/en active IP Right Grant
- 2018-09-13 AU AU2018229489A patent/AU2018229489B2/en active Active
- 2018-09-28 JP JP2018183815A patent/JP2019037231A/en active Pending
-
2019
- 2019-02-26 AU AU2019201344A patent/AU2019201344C1/en active Active
- 2019-06-24 IL IL267598A patent/IL267598B/en unknown
- 2019-10-16 US US16/654,613 patent/US20200140897A1/en not_active Abandoned
-
2020
- 2020-04-17 JP JP2020074283A patent/JP2020120674A/en active Pending
- 2020-07-30 US US16/943,792 patent/US20210079427A1/en not_active Abandoned
- 2020-07-30 US US16/943,767 patent/US20210207173A1/en active Pending
- 2020-09-08 AU AU2020230246A patent/AU2020230246B2/en active Active
- 2020-09-08 AU AU2020230243A patent/AU2020230243B2/en active Active
- 2020-11-19 AU AU2020273316A patent/AU2020273316B2/en active Active
-
2021
- 2021-03-03 JP JP2021033258A patent/JP2021101706A/en active Pending
- 2021-08-10 US US17/398,648 patent/US20210388396A1/en active Pending
-
2022
- 2022-01-19 AU AU2022200330A patent/AU2022200330B2/en active Active
- 2022-03-06 IL IL291129A patent/IL291129B2/en unknown
- 2022-05-06 JP JP2022076698A patent/JP7478772B2/en active Active
-
2023
- 2023-08-17 AU AU2023216829A patent/AU2023216829A1/en active Pending
Patent Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20050220796A1 (en) * | 2004-03-31 | 2005-10-06 | Dynan William S | Compositions and methods for modulating DNA repair |
Non-Patent Citations (7)
Title |
---|
Chen et al. Transfection and expression of plasmid DNA in plant cells by an arginine-rich intracellular delivery peptide without protoplast preparation. FEBS Letters, Vol. 581, pages 1891-1897, 2007. * |
Gustafsson et al. codon bias and heterologous protein expression. TRENDS in Biotechnology, Vol. 22, No. 7, pages 346-353, July 2004. * |
Han et al. Efficient intracellular delivery of GFP by homeodomains of Drosophila Fushi-Tarazu and Engrailed proteins. Molecules and Cells, Vol. 10, No. 6, pages 728-732, 2000. * |
Järver et al. The use of cell-penetratingpeptides as a tool for gene regulation. Drug Discovery Today, Vol. 9, No. 9, pages 395-402, May 2004. * |
Matsui et al. Protein therapy: In vivo protein transduction by polyarginine (11R) PTD and subcellular targeting delivery. Current Protein and Peptide Science, Vol. 4, pages 151-157, 2003. * |
Noguchi et al. Recent advances in protein transduction technology. Cell Transplantation, Vol. 19, pages 649-654, June 2010. * |
Zhang et al. MDV-1 VP22: a transporter that can selectively deliver proteins into cells. Archives of Virology, Vol. 154, No. 7, pages 1027-1034, June 2009. * |
Cited By (71)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11274318B2 (en) | 2012-05-25 | 2022-03-15 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10337029B2 (en) | 2012-05-25 | 2019-07-02 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10266850B2 (en) | 2012-05-25 | 2019-04-23 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US11970711B2 (en) | 2012-05-25 | 2024-04-30 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10308961B2 (en) | 2012-05-25 | 2019-06-04 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10752920B2 (en) | 2012-05-25 | 2020-08-25 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10351878B2 (en) | 2012-05-25 | 2019-07-16 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10358658B2 (en) | 2012-05-25 | 2019-07-23 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10358659B2 (en) | 2012-05-25 | 2019-07-23 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10385360B2 (en) | 2012-05-25 | 2019-08-20 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10400253B2 (en) | 2012-05-25 | 2019-09-03 | The Regents Of The University Of California | Methods and compositions or RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10407697B2 (en) | 2012-05-25 | 2019-09-10 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10415061B2 (en) | 2012-05-25 | 2019-09-17 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10421980B2 (en) | 2012-05-25 | 2019-09-24 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10428352B2 (en) | 2012-05-25 | 2019-10-01 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US11814645B2 (en) | 2012-05-25 | 2023-11-14 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10443076B2 (en) | 2012-05-25 | 2019-10-15 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10487341B2 (en) | 2012-05-25 | 2019-11-26 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10513712B2 (en) | 2012-05-25 | 2019-12-24 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10519467B2 (en) | 2012-05-25 | 2019-12-31 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10526619B2 (en) | 2012-05-25 | 2020-01-07 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10533190B2 (en) | 2012-05-25 | 2020-01-14 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10550407B2 (en) | 2012-05-25 | 2020-02-04 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10563227B2 (en) | 2012-05-25 | 2020-02-18 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10570419B2 (en) | 2012-05-25 | 2020-02-25 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10577631B2 (en) | 2012-05-25 | 2020-03-03 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10597680B2 (en) | 2012-05-25 | 2020-03-24 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10612045B2 (en) | 2012-05-25 | 2020-04-07 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10626419B2 (en) | 2012-05-25 | 2020-04-21 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US11674159B2 (en) | 2012-05-25 | 2023-06-13 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10640791B2 (en) | 2012-05-25 | 2020-05-05 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10669560B2 (en) | 2012-05-25 | 2020-06-02 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10676759B2 (en) | 2012-05-25 | 2020-06-09 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US11634730B2 (en) | 2012-05-25 | 2023-04-25 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10301651B2 (en) | 2012-05-25 | 2019-05-28 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10774344B1 (en) | 2012-05-25 | 2020-09-15 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10227611B2 (en) | 2012-05-25 | 2019-03-12 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10793878B1 (en) | 2012-05-25 | 2020-10-06 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US11549127B2 (en) | 2012-05-25 | 2023-01-10 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10900054B2 (en) | 2012-05-25 | 2021-01-26 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10982230B2 (en) | 2012-05-25 | 2021-04-20 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10982231B2 (en) | 2012-05-25 | 2021-04-20 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10988780B2 (en) | 2012-05-25 | 2021-04-27 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10988782B2 (en) | 2012-05-25 | 2021-04-27 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US11001863B2 (en) | 2012-05-25 | 2021-05-11 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US11008590B2 (en) | 2012-05-25 | 2021-05-18 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US11008589B2 (en) | 2012-05-25 | 2021-05-18 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US11028412B2 (en) | 2012-05-25 | 2021-06-08 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US11479794B2 (en) | 2012-05-25 | 2022-10-25 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US11186849B2 (en) | 2012-05-25 | 2021-11-30 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US11473108B2 (en) | 2012-05-25 | 2022-10-18 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US11242543B2 (en) | 2012-05-25 | 2022-02-08 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US11401532B2 (en) | 2012-05-25 | 2022-08-02 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US11293034B2 (en) | 2012-05-25 | 2022-04-05 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US11332761B2 (en) | 2012-05-25 | 2022-05-17 | The Regenis of Wie University of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
US10745716B2 (en) | 2012-12-06 | 2020-08-18 | Sigma-Aldrich Co. Llc | CRISPR-based genome modification and regulation |
US10731181B2 (en) | 2012-12-06 | 2020-08-04 | Sigma, Aldrich Co. LLC | CRISPR-based genome modification and regulation |
US10640788B2 (en) | 2013-11-07 | 2020-05-05 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAs |
US10190137B2 (en) | 2013-11-07 | 2019-01-29 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAS |
US11390887B2 (en) | 2013-11-07 | 2022-07-19 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAS |
US11680268B2 (en) | 2014-11-07 | 2023-06-20 | Editas Medicine, Inc. | Methods for improving CRISPR/Cas-mediated genome-editing |
US11390884B2 (en) | 2015-05-11 | 2022-07-19 | Editas Medicine, Inc. | Optimized CRISPR/cas9 systems and methods for gene editing in stem cells |
US11911415B2 (en) | 2015-06-09 | 2024-02-27 | Editas Medicine, Inc. | CRISPR/Cas-related methods and compositions for improving transplantation |
US11667911B2 (en) | 2015-09-24 | 2023-06-06 | Editas Medicine, Inc. | Use of exonucleases to improve CRISPR/CAS-mediated genome editing |
US11597924B2 (en) | 2016-03-25 | 2023-03-07 | Editas Medicine, Inc. | Genome editing systems comprising repair-modulating enzyme molecules and methods of their use |
US11236313B2 (en) | 2016-04-13 | 2022-02-01 | Editas Medicine, Inc. | Cas9 fusion molecules, gene editing systems, and methods of use thereof |
US20200385753A1 (en) * | 2016-12-23 | 2020-12-10 | Institute For Basic Science | Composition for base editing for animal embryo and base editing method |
US11499151B2 (en) | 2017-04-28 | 2022-11-15 | Editas Medicine, Inc. | Methods and systems for analyzing guide RNA molecules |
US11098297B2 (en) | 2017-06-09 | 2021-08-24 | Editas Medicine, Inc. | Engineered Cas9 nucleases |
US10428319B2 (en) | 2017-06-09 | 2019-10-01 | Editas Medicine, Inc. | Engineered Cas9 nucleases |
US11866726B2 (en) | 2017-07-14 | 2024-01-09 | Editas Medicine, Inc. | Systems and methods for targeted integration and genome editing and detection thereof using integrated priming sites |
Also Published As
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20210388396A1 (en) | Crispr-based genome modification and regulation |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |
|
AS | Assignment |
Owner name: MIDCAP FINANCIAL TRUST, MARYLAND Free format text: SECURITY INTEREST;ASSIGNORS:ANALOGIC CORPORATION;SOUND TECHNOLOGY, INC.;REEL/FRAME:046414/0277 Effective date: 20180622 |