US20160017366A1 - Crispr-based genome modification and regulation - Google Patents
Crispr-based genome modification and regulation Download PDFInfo
- Publication number
- US20160017366A1 US20160017366A1 US14/649,777 US201314649777A US2016017366A1 US 20160017366 A1 US20160017366 A1 US 20160017366A1 US 201314649777 A US201314649777 A US 201314649777A US 2016017366 A1 US2016017366 A1 US 2016017366A1
- Authority
- US
- United States
- Prior art keywords
- cell
- sequence
- protein
- domain
- rna
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 108091033409 CRISPR Proteins 0.000 title claims abstract description 108
- 230000004048 modification Effects 0.000 title abstract description 27
- 238000012986 modification Methods 0.000 title abstract description 27
- 230000033228 biological regulation Effects 0.000 title description 2
- 230000002759 chromosomal effect Effects 0.000 claims abstract description 181
- 108020001507 fusion proteins Proteins 0.000 claims abstract description 180
- 102000037865 fusion proteins Human genes 0.000 claims abstract description 178
- 102000004533 Endonucleases Human genes 0.000 claims abstract description 142
- 108010042407 Endonucleases Proteins 0.000 claims abstract description 142
- 238000000034 method Methods 0.000 claims abstract description 93
- 239000012636 effector Substances 0.000 claims abstract description 49
- 102100021579 Enhancer of filamentation 1 Human genes 0.000 claims abstract description 46
- 101000898310 Homo sapiens Enhancer of filamentation 1 Proteins 0.000 claims abstract description 46
- 230000014509 gene expression Effects 0.000 claims abstract description 40
- 210000003527 eukaryotic cell Anatomy 0.000 claims abstract description 20
- 239000012634 fragment Substances 0.000 claims abstract description 20
- 230000029279 positive regulation of transcription, DNA-dependent Effects 0.000 claims abstract description 20
- 230000004049 epigenetic modification Effects 0.000 claims abstract description 19
- 102100025169 Max-binding protein MNT Human genes 0.000 claims abstract description 16
- 108091006107 transcriptional repressors Proteins 0.000 claims abstract description 16
- 238000010354 CRISPR gene editing Methods 0.000 claims abstract 6
- 210000004027 cell Anatomy 0.000 claims description 200
- 108020005004 Guide RNA Proteins 0.000 claims description 146
- 108020004414 DNA Proteins 0.000 claims description 104
- 210000001161 mammalian embryo Anatomy 0.000 claims description 104
- 150000007523 nucleic acids Chemical class 0.000 claims description 70
- 102000040430 polynucleotide Human genes 0.000 claims description 68
- 108091033319 polynucleotide Proteins 0.000 claims description 68
- 239000002157 polynucleotide Substances 0.000 claims description 68
- 241001465754 Metazoa Species 0.000 claims description 67
- 102000039446 nucleic acids Human genes 0.000 claims description 60
- 108020004707 nucleic acids Proteins 0.000 claims description 60
- 101710163270 Nuclease Proteins 0.000 claims description 57
- 241000282414 Homo sapiens Species 0.000 claims description 41
- 230000000694 effects Effects 0.000 claims description 33
- 108010077850 Nuclear Localization Signals Proteins 0.000 claims description 25
- 108020004999 messenger RNA Proteins 0.000 claims description 24
- 239000013598 vector Substances 0.000 claims description 20
- 210000004962 mammalian cell Anatomy 0.000 claims description 16
- 239000003550 marker Substances 0.000 claims description 15
- 230000001105 regulatory effect Effects 0.000 claims description 15
- 230000008569 process Effects 0.000 claims description 12
- 210000005260 human cell Anatomy 0.000 claims description 9
- 210000000130 stem cell Anatomy 0.000 claims description 9
- 238000012258 culturing Methods 0.000 claims description 7
- 241000251539 Vertebrata <Metazoa> Species 0.000 claims description 6
- 230000033616 DNA repair Effects 0.000 claims description 5
- 101150038500 cas9 gene Proteins 0.000 claims description 3
- 238000003776 cleavage reaction Methods 0.000 abstract description 87
- 230000007017 scission Effects 0.000 abstract description 87
- 210000002257 embryonic structure Anatomy 0.000 abstract description 38
- 108090000623 proteins and genes Proteins 0.000 description 135
- 102000004169 proteins and genes Human genes 0.000 description 101
- 125000003729 nucleotide group Chemical group 0.000 description 98
- 235000018102 proteins Nutrition 0.000 description 98
- 239000002773 nucleotide Substances 0.000 description 95
- 230000008439 repair process Effects 0.000 description 41
- 238000011144 upstream manufacturing Methods 0.000 description 35
- 241000699666 Mus <mouse, genus> Species 0.000 description 33
- 239000013612 plasmid Substances 0.000 description 26
- 108010017070 Zinc Finger Nucleases Proteins 0.000 description 24
- 241000700159 Rattus Species 0.000 description 23
- 108091028043 Nucleic acid sequence Proteins 0.000 description 19
- 238000012217 deletion Methods 0.000 description 18
- 230000037430 deletion Effects 0.000 description 18
- 230000010354 integration Effects 0.000 description 18
- 230000006780 non-homologous end joining Effects 0.000 description 17
- 238000003780 insertion Methods 0.000 description 16
- 230000037431 insertion Effects 0.000 description 16
- 230000035772 mutation Effects 0.000 description 16
- 238000001890 transfection Methods 0.000 description 16
- 108091026890 Coding region Proteins 0.000 description 15
- 230000004568 DNA-binding Effects 0.000 description 14
- 238000006467 substitution reaction Methods 0.000 description 14
- 239000000539 dimer Substances 0.000 description 13
- 239000000833 heterodimer Substances 0.000 description 13
- 239000000047 product Substances 0.000 description 13
- 230000001404 mediated effect Effects 0.000 description 12
- 238000013518 transcription Methods 0.000 description 12
- 125000003275 alpha amino acid group Chemical group 0.000 description 11
- 239000013600 plasmid vector Substances 0.000 description 11
- 238000010453 CRISPR/Cas method Methods 0.000 description 10
- 108091028113 Trans-activating crRNA Proteins 0.000 description 10
- 230000000295 complement effect Effects 0.000 description 10
- 238000000338 in vitro Methods 0.000 description 10
- 210000001519 tissue Anatomy 0.000 description 10
- 108091092236 Chimeric RNA Proteins 0.000 description 9
- 108020004705 Codon Proteins 0.000 description 9
- 235000001014 amino acid Nutrition 0.000 description 9
- 230000035897 transcription Effects 0.000 description 9
- 108010008532 Deoxyribonuclease I Proteins 0.000 description 8
- 102000007260 Deoxyribonuclease I Human genes 0.000 description 8
- 101001000998 Homo sapiens Protein phosphatase 1 regulatory subunit 12C Proteins 0.000 description 8
- 102100035620 Protein phosphatase 1 regulatory subunit 12C Human genes 0.000 description 8
- 229940024606 amino acid Drugs 0.000 description 8
- -1 for example Proteins 0.000 description 8
- 102000053602 DNA Human genes 0.000 description 7
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 7
- 238000006243 chemical reaction Methods 0.000 description 7
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 7
- 230000002068 genetic effect Effects 0.000 description 7
- 239000000178 monomer Substances 0.000 description 7
- 229910052725 zinc Inorganic materials 0.000 description 7
- 239000011701 zinc Substances 0.000 description 7
- 241000699800 Cricetinae Species 0.000 description 6
- 208000009869 Neu-Laxova syndrome Diseases 0.000 description 6
- 230000004913 activation Effects 0.000 description 6
- 150000001413 amino acids Chemical class 0.000 description 6
- 230000015572 biosynthetic process Effects 0.000 description 6
- 230000008859 change Effects 0.000 description 6
- 108010026638 endodeoxyribonuclease FokI Proteins 0.000 description 6
- 238000003205 genotyping method Methods 0.000 description 6
- 239000000710 homodimer Substances 0.000 description 6
- 241000894007 species Species 0.000 description 6
- 241000701022 Cytomegalovirus Species 0.000 description 5
- 102000004190 Enzymes Human genes 0.000 description 5
- 108090000790 Enzymes Proteins 0.000 description 5
- 241000238631 Hexapoda Species 0.000 description 5
- 125000000539 amino acid group Chemical group 0.000 description 5
- 230000001580 bacterial effect Effects 0.000 description 5
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 5
- 108091006047 fluorescent proteins Proteins 0.000 description 5
- 102000034287 fluorescent proteins Human genes 0.000 description 5
- 238000010561 standard procedure Methods 0.000 description 5
- 238000003786 synthesis reaction Methods 0.000 description 5
- 241000283690 Bos taurus Species 0.000 description 4
- 241000282465 Canis Species 0.000 description 4
- 108010051219 Cre recombinase Proteins 0.000 description 4
- 238000001712 DNA sequencing Methods 0.000 description 4
- 241000196324 Embryophyta Species 0.000 description 4
- 108010033040 Histones Proteins 0.000 description 4
- 108090000144 Human Proteins Proteins 0.000 description 4
- 102000003839 Human Proteins Human genes 0.000 description 4
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 4
- 241000699670 Mus sp. Species 0.000 description 4
- 241000288906 Primates Species 0.000 description 4
- 241000283984 Rodentia Species 0.000 description 4
- 230000001464 adherent effect Effects 0.000 description 4
- 235000004279 alanine Nutrition 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 4
- 238000003556 assay Methods 0.000 description 4
- 208000035475 disorder Diseases 0.000 description 4
- 230000034431 double-strand break repair via homologous recombination Effects 0.000 description 4
- 230000001965 increasing effect Effects 0.000 description 4
- 210000003734 kidney Anatomy 0.000 description 4
- 230000011987 methylation Effects 0.000 description 4
- 238000007069 methylation reaction Methods 0.000 description 4
- 231100000350 mutagenesis Toxicity 0.000 description 4
- 230000009437 off-target effect Effects 0.000 description 4
- 238000005457 optimization Methods 0.000 description 4
- 102000005962 receptors Human genes 0.000 description 4
- 108020003175 receptors Proteins 0.000 description 4
- 230000006798 recombination Effects 0.000 description 4
- 238000005215 recombination Methods 0.000 description 4
- 108010054624 red fluorescent protein Proteins 0.000 description 4
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 4
- 230000008685 targeting Effects 0.000 description 4
- 238000013519 translation Methods 0.000 description 4
- 230000014616 translation Effects 0.000 description 4
- 238000011282 treatment Methods 0.000 description 4
- 239000013603 viral vector Substances 0.000 description 4
- 108010051109 Cell-Penetrating Peptides Proteins 0.000 description 3
- 102000020313 Cell-Penetrating Peptides Human genes 0.000 description 3
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 3
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 3
- 102000016911 Deoxyribonucleases Human genes 0.000 description 3
- 108010053770 Deoxyribonucleases Proteins 0.000 description 3
- 108010068250 Herpes Simplex Virus Protein Vmw65 Proteins 0.000 description 3
- 102100022846 Histone acetyltransferase KAT2B Human genes 0.000 description 3
- 102100022893 Histone acetyltransferase KAT5 Human genes 0.000 description 3
- 102100038885 Histone acetyltransferase p300 Human genes 0.000 description 3
- 101000882390 Homo sapiens Histone acetyltransferase p300 Proteins 0.000 description 3
- 206010025323 Lymphomas Diseases 0.000 description 3
- 241000283973 Oryctolagus cuniculus Species 0.000 description 3
- 206010035226 Plasma cell myeloma Diseases 0.000 description 3
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 3
- 101710137500 T7 RNA polymerase Proteins 0.000 description 3
- 238000010459 TALEN Methods 0.000 description 3
- 108010043645 Transcription Activator-Like Effector Nucleases Proteins 0.000 description 3
- 102000040945 Transcription factor Human genes 0.000 description 3
- 108091023040 Transcription factor Proteins 0.000 description 3
- 230000027455 binding Effects 0.000 description 3
- 238000013461 design Methods 0.000 description 3
- 238000010586 diagram Methods 0.000 description 3
- 201000010099 disease Diseases 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 210000002950 fibroblast Anatomy 0.000 description 3
- 238000001727 in vivo Methods 0.000 description 3
- 238000001638 lipofection Methods 0.000 description 3
- 239000011159 matrix material Substances 0.000 description 3
- 201000000050 myeloid neoplasm Diseases 0.000 description 3
- 230000008488 polyadenylation Effects 0.000 description 3
- 229920000642 polymer Polymers 0.000 description 3
- 230000010076 replication Effects 0.000 description 3
- 230000002103 transcriptional effect Effects 0.000 description 3
- 230000005945 translocation Effects 0.000 description 3
- 241000251468 Actinopterygii Species 0.000 description 2
- 241000272517 Anseriformes Species 0.000 description 2
- 241000271566 Aves Species 0.000 description 2
- 101710201279 Biotin carboxyl carrier protein Proteins 0.000 description 2
- 102100021975 CREB-binding protein Human genes 0.000 description 2
- 241000282472 Canis lupus familiaris Species 0.000 description 2
- 241000282693 Cercopithecidae Species 0.000 description 2
- 101000709520 Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) Atypical response regulator protein ChxR Proteins 0.000 description 2
- 108700010070 Codon Usage Proteins 0.000 description 2
- 108091035707 Consensus sequence Proteins 0.000 description 2
- 102000005636 Cyclic AMP Response Element-Binding Protein Human genes 0.000 description 2
- 108010045171 Cyclic AMP Response Element-Binding Protein Proteins 0.000 description 2
- 238000007400 DNA extraction Methods 0.000 description 2
- 241000702421 Dependoparvovirus Species 0.000 description 2
- 102220518659 Enhancer of filamentation 1_D10A_mutation Human genes 0.000 description 2
- 241000283073 Equus caballus Species 0.000 description 2
- 108700024394 Exon Proteins 0.000 description 2
- 241000282324 Felis Species 0.000 description 2
- 241000282326 Felis catus Species 0.000 description 2
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 2
- 102000005720 Glutathione transferase Human genes 0.000 description 2
- 108010070675 Glutathione transferase Proteins 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- NYHBQMYGNKIUIF-UUOKFMHZSA-N Guanosine Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O NYHBQMYGNKIUIF-UUOKFMHZSA-N 0.000 description 2
- 102100039869 Histone H2B type F-S Human genes 0.000 description 2
- 101001035372 Homo sapiens Histone H2B type F-S Proteins 0.000 description 2
- 101001046967 Homo sapiens Histone acetyltransferase KAT2A Proteins 0.000 description 2
- 101001047006 Homo sapiens Histone acetyltransferase KAT2B Proteins 0.000 description 2
- 101001046996 Homo sapiens Histone acetyltransferase KAT5 Proteins 0.000 description 2
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 2
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 108060004795 Methyltransferase Proteins 0.000 description 2
- 108091093037 Peptide nucleic acid Proteins 0.000 description 2
- 102000011755 Phosphoglycerate Kinase Human genes 0.000 description 2
- 102000014450 RNA Polymerase III Human genes 0.000 description 2
- 108010078067 RNA Polymerase III Proteins 0.000 description 2
- 230000004570 RNA-binding Effects 0.000 description 2
- 108010083644 Ribonucleases Proteins 0.000 description 2
- 102000006382 Ribonucleases Human genes 0.000 description 2
- 108091028664 Ribonucleotide Proteins 0.000 description 2
- 241000714474 Rous sarcoma virus Species 0.000 description 2
- 241000700584 Simplexvirus Species 0.000 description 2
- 241000187191 Streptomyces viridochromogenes Species 0.000 description 2
- 241000203587 Streptosporangium roseum Species 0.000 description 2
- 210000001744 T-lymphocyte Anatomy 0.000 description 2
- 101001099217 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) Triosephosphate isomerase Proteins 0.000 description 2
- 102000002933 Thioredoxin Human genes 0.000 description 2
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 2
- DRTQHJPVMGBUCF-XVFCMESISA-N Uridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-XVFCMESISA-N 0.000 description 2
- 230000021736 acetylation Effects 0.000 description 2
- 238000006640 acetylation reaction Methods 0.000 description 2
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 2
- 210000004102 animal cell Anatomy 0.000 description 2
- 210000004436 artificial bacterial chromosome Anatomy 0.000 description 2
- 210000001106 artificial yeast chromosome Anatomy 0.000 description 2
- 229940009098 aspartate Drugs 0.000 description 2
- 230000003115 biocidal effect Effects 0.000 description 2
- 108010006025 bovine growth hormone Proteins 0.000 description 2
- 102100029387 cAMP-responsive element modulator Human genes 0.000 description 2
- 101710152311 cAMP-responsive element modulator Proteins 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 102000021178 chitin binding proteins Human genes 0.000 description 2
- 108091011157 chitin binding proteins Proteins 0.000 description 2
- 239000005547 deoxyribonucleotide Substances 0.000 description 2
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 2
- 238000006471 dimerization reaction Methods 0.000 description 2
- 210000001671 embryonic stem cell Anatomy 0.000 description 2
- 210000003754 fetus Anatomy 0.000 description 2
- 108010021843 fluorescent protein 583 Proteins 0.000 description 2
- 238000010362 genome editing Methods 0.000 description 2
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- 238000002744 homologous recombination Methods 0.000 description 2
- 230000006801 homologous recombination Effects 0.000 description 2
- 238000011065 in-situ storage Methods 0.000 description 2
- 210000003292 kidney cell Anatomy 0.000 description 2
- 244000144972 livestock Species 0.000 description 2
- 210000002540 macrophage Anatomy 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 201000001441 melanoma Diseases 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 238000002703 mutagenesis Methods 0.000 description 2
- 210000003098 myoblast Anatomy 0.000 description 2
- 210000004940 nucleus Anatomy 0.000 description 2
- 201000008968 osteosarcoma Diseases 0.000 description 2
- 229920001184 polypeptide Polymers 0.000 description 2
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 2
- 108090000765 processed proteins & peptides Proteins 0.000 description 2
- 102000004196 processed proteins & peptides Human genes 0.000 description 2
- 239000013636 protein dimer Substances 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 150000003212 purines Chemical class 0.000 description 2
- 238000007894 restriction fragment length polymorphism technique Methods 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 239000002336 ribonucleotide Substances 0.000 description 2
- 125000002652 ribonucleotide group Chemical group 0.000 description 2
- 229910052594 sapphire Inorganic materials 0.000 description 2
- 239000010980 sapphire Substances 0.000 description 2
- 230000035939 shock Effects 0.000 description 2
- 238000002741 site-directed mutagenesis Methods 0.000 description 2
- 238000010381 tandem affinity purification Methods 0.000 description 2
- 230000002123 temporal effect Effects 0.000 description 2
- 108060008226 thioredoxin Proteins 0.000 description 2
- 229940094937 thioredoxin Drugs 0.000 description 2
- 238000003151 transfection method Methods 0.000 description 2
- 239000012096 transfection reagent Substances 0.000 description 2
- 108091005957 yellow fluorescent proteins Proteins 0.000 description 2
- UHDGCWIWMRVCDJ-UHFFFAOYSA-N 1-beta-D-Xylofuranosyl-NH-Cytosine Natural products O=C1N=C(N)C=CN1C1C(O)C(O)C(CO)O1 UHDGCWIWMRVCDJ-UHFFFAOYSA-N 0.000 description 1
- YMHOBZXQZVXHBM-UHFFFAOYSA-N 2,5-dimethoxy-4-bromophenethylamine Chemical compound COC1=CC(CCN)=C(OC)C=C1Br YMHOBZXQZVXHBM-UHFFFAOYSA-N 0.000 description 1
- 241000007910 Acaryochloris marina Species 0.000 description 1
- 241001135192 Acetohalobium arabaticum Species 0.000 description 1
- 241001464929 Acidithiobacillus caldus Species 0.000 description 1
- 241000605222 Acidithiobacillus ferrooxidans Species 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 241000640374 Alicyclobacillus acidocaldarius Species 0.000 description 1
- 241000190857 Allochromatium vinosum Species 0.000 description 1
- 102100021954 Alpha-tubulin N-acetyltransferase 1 Human genes 0.000 description 1
- 241000147155 Ammonifex degensii Species 0.000 description 1
- 235000002198 Annona diversifolia Nutrition 0.000 description 1
- 241000620196 Arthrospira maxima Species 0.000 description 1
- 240000002900 Arthrospira platensis Species 0.000 description 1
- 235000016425 Arthrospira platensis Nutrition 0.000 description 1
- 241001495183 Arthrospira sp. Species 0.000 description 1
- 241000282672 Ateles sp. Species 0.000 description 1
- 108091005950 Azurite Proteins 0.000 description 1
- 241000906059 Bacillus pseudomycoides Species 0.000 description 1
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 1
- 241000823281 Burkholderiales bacterium Species 0.000 description 1
- 239000002126 C01EB10 - Adenosine Substances 0.000 description 1
- 108010040163 CREB-Binding Protein Proteins 0.000 description 1
- 101150018129 CSF2 gene Proteins 0.000 description 1
- 101150069031 CSN2 gene Proteins 0.000 description 1
- 101100381481 Caenorhabditis elegans baz-2 gene Proteins 0.000 description 1
- 102000000584 Calmodulin Human genes 0.000 description 1
- 108010041952 Calmodulin Proteins 0.000 description 1
- 241001496650 Candidatus Desulforudis Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- 241000700198 Cavia Species 0.000 description 1
- 241001515796 Cebinae Species 0.000 description 1
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 description 1
- 108091005944 Cerulean Proteins 0.000 description 1
- 241000862448 Chlorocebus Species 0.000 description 1
- 241000282552 Chlorocebus aethiops Species 0.000 description 1
- 241000579895 Chlorostilbon Species 0.000 description 1
- 108010077544 Chromatin Proteins 0.000 description 1
- 102100031668 Chromodomain Y-like protein Human genes 0.000 description 1
- 102100035371 Chymotrypsin-like elastase family member 1 Human genes 0.000 description 1
- 101710138848 Chymotrypsin-like elastase family member 1 Proteins 0.000 description 1
- 108091005960 Citrine Proteins 0.000 description 1
- 241000193163 Clostridioides difficile Species 0.000 description 1
- 241000193155 Clostridium botulinum Species 0.000 description 1
- 108091033380 Coding strand Proteins 0.000 description 1
- 241000907165 Coleofasciculus chthonoplastes Species 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 241000938605 Crocodylia Species 0.000 description 1
- 241000065716 Crocosphaera watsonii Species 0.000 description 1
- MIKUYHXYGGJMLM-GIMIYPNGSA-N Crotonoside Natural products C1=NC2=C(N)NC(=O)N=C2N1[C@H]1O[C@@H](CO)[C@H](O)[C@@H]1O MIKUYHXYGGJMLM-GIMIYPNGSA-N 0.000 description 1
- 101150074775 Csf1 gene Proteins 0.000 description 1
- 108091005943 CyPet Proteins 0.000 description 1
- 241000159506 Cyanothece Species 0.000 description 1
- UHDGCWIWMRVCDJ-PSQAKQOGSA-N Cytidine Natural products O=C1N=C(N)C=CN1[C@@H]1[C@@H](O)[C@@H](O)[C@H](CO)O1 UHDGCWIWMRVCDJ-PSQAKQOGSA-N 0.000 description 1
- NYHBQMYGNKIUIF-UHFFFAOYSA-N D-guanosine Natural products C1=2NC(N)=NC(=O)C=2N=CN1C1OC(CO)C(O)C1O NYHBQMYGNKIUIF-UHFFFAOYSA-N 0.000 description 1
- 230000007018 DNA scission Effects 0.000 description 1
- 102100036912 Desmin Human genes 0.000 description 1
- 108010044052 Desmin Proteins 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 241000255925 Diptera Species 0.000 description 1
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 1
- 241000255601 Drosophila melanogaster Species 0.000 description 1
- 108091005941 EBFP Proteins 0.000 description 1
- 108091005947 EBFP2 Proteins 0.000 description 1
- 108091005942 ECFP Proteins 0.000 description 1
- 101710099240 Elastase-1 Proteins 0.000 description 1
- 102100035074 Elongator complex protein 3 Human genes 0.000 description 1
- 102100037241 Endoglin Human genes 0.000 description 1
- 108010036395 Endoglin Proteins 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 241000289659 Erinaceidae Species 0.000 description 1
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 1
- 241000326311 Exiguobacterium sibiricum Species 0.000 description 1
- 108060002716 Exonuclease Proteins 0.000 description 1
- 102000016359 Fibronectins Human genes 0.000 description 1
- 108010067306 Fibronectins Proteins 0.000 description 1
- 241000192016 Finegoldia magna Species 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 108010001515 Galectin 4 Proteins 0.000 description 1
- 102100039556 Galectin-4 Human genes 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 241000699694 Gerbillinae Species 0.000 description 1
- 102100039289 Glial fibrillary acidic protein Human genes 0.000 description 1
- 101710193519 Glial fibrillary acidic protein Proteins 0.000 description 1
- KOSRFJWDECSPRO-WDSKDSINSA-N Glu-Glu Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(O)=O KOSRFJWDECSPRO-WDSKDSINSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 1
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 1
- 241000700721 Hepatitis B virus Species 0.000 description 1
- 102000008157 Histone Demethylases Human genes 0.000 description 1
- 108010074870 Histone Demethylases Proteins 0.000 description 1
- 102000011787 Histone Methyltransferases Human genes 0.000 description 1
- 108010036115 Histone Methyltransferases Proteins 0.000 description 1
- 102100022901 Histone acetyltransferase KAT2A Human genes 0.000 description 1
- 101710083341 Histone acetyltransferase KAT2B Proteins 0.000 description 1
- 101710116149 Histone acetyltransferase KAT5 Proteins 0.000 description 1
- 102100033071 Histone acetyltransferase KAT6A Human genes 0.000 description 1
- 102100033070 Histone acetyltransferase KAT6B Human genes 0.000 description 1
- 102100033068 Histone acetyltransferase KAT7 Human genes 0.000 description 1
- 102100033069 Histone acetyltransferase KAT8 Human genes 0.000 description 1
- 102100021467 Histone acetyltransferase type B catalytic subunit Human genes 0.000 description 1
- 102000043851 Histone deacetylase domains Human genes 0.000 description 1
- 108700038236 Histone deacetylase domains Proteins 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000896987 Homo sapiens CREB-binding protein Proteins 0.000 description 1
- 101000721661 Homo sapiens Cellular tumor antigen p53 Proteins 0.000 description 1
- 101000777795 Homo sapiens Chromodomain Y-like protein Proteins 0.000 description 1
- 101000877382 Homo sapiens Elongator complex protein 3 Proteins 0.000 description 1
- 101000828609 Homo sapiens Flotillin-2 Proteins 0.000 description 1
- 101000944179 Homo sapiens Histone acetyltransferase KAT6A Proteins 0.000 description 1
- 101000944174 Homo sapiens Histone acetyltransferase KAT6B Proteins 0.000 description 1
- 101000944166 Homo sapiens Histone acetyltransferase KAT7 Proteins 0.000 description 1
- 101000944170 Homo sapiens Histone acetyltransferase KAT8 Proteins 0.000 description 1
- 101000898976 Homo sapiens Histone acetyltransferase type B catalytic subunit Proteins 0.000 description 1
- 101000608935 Homo sapiens Leukosialin Proteins 0.000 description 1
- 101000934372 Homo sapiens Macrosialin Proteins 0.000 description 1
- 101000615488 Homo sapiens Methyl-CpG-binding domain protein 2 Proteins 0.000 description 1
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 1
- 101000602926 Homo sapiens Nuclear receptor coactivator 1 Proteins 0.000 description 1
- 101000602930 Homo sapiens Nuclear receptor coactivator 2 Proteins 0.000 description 1
- 101000974356 Homo sapiens Nuclear receptor coactivator 3 Proteins 0.000 description 1
- 101000585728 Homo sapiens Protein O-GlcNAcase Proteins 0.000 description 1
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 1
- 101000821100 Homo sapiens Synapsin-1 Proteins 0.000 description 1
- 101000777789 Homo sapiens Testis-specific chromodomain protein Y 1 Proteins 0.000 description 1
- 101000777786 Homo sapiens Testis-specific chromodomain protein Y 2 Proteins 0.000 description 1
- 101000666382 Homo sapiens Transcription factor E2-alpha Proteins 0.000 description 1
- 101000801209 Homo sapiens Transducin-like enhancer protein 4 Proteins 0.000 description 1
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 1
- 108010091358 Hypoxanthine Phosphoribosyltransferase Proteins 0.000 description 1
- 102100029098 Hypoxanthine-guanine phosphoribosyltransferase Human genes 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 229930010555 Inosine Natural products 0.000 description 1
- UGQMRVRMYYASKQ-KQYNXXCUSA-N Inosine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(O)=C2N=C1 UGQMRVRMYYASKQ-KQYNXXCUSA-N 0.000 description 1
- 102100025306 Integrin alpha-IIb Human genes 0.000 description 1
- 101710149643 Integrin alpha-IIb Proteins 0.000 description 1
- 102100037872 Intercellular adhesion molecule 2 Human genes 0.000 description 1
- 101710148794 Intercellular adhesion molecule 2 Proteins 0.000 description 1
- 108020004684 Internal Ribosome Entry Sites Proteins 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- 239000007760 Iscove's Modified Dulbecco's Medium Substances 0.000 description 1
- 241001430080 Ktedonobacter racemifer Species 0.000 description 1
- 229930182816 L-glutamine Natural products 0.000 description 1
- 241000186673 Lactobacillus delbrueckii Species 0.000 description 1
- 241000186869 Lactobacillus salivarius Species 0.000 description 1
- 241000282838 Lama Species 0.000 description 1
- 241000288903 Lemuridae Species 0.000 description 1
- 102100039564 Leukosialin Human genes 0.000 description 1
- 208000035752 Live birth Diseases 0.000 description 1
- 241001134698 Lyngbya Species 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 241000282553 Macaca Species 0.000 description 1
- 102100025136 Macrosialin Human genes 0.000 description 1
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 description 1
- 241000501784 Marinobacter sp. Species 0.000 description 1
- 241000204637 Methanohalobium evestigatum Species 0.000 description 1
- 102000006890 Methyl-CpG-Binding Protein 2 Human genes 0.000 description 1
- 108010072388 Methyl-CpG-Binding Protein 2 Proteins 0.000 description 1
- 102100021299 Methyl-CpG-binding domain protein 2 Human genes 0.000 description 1
- 102000016397 Methyltransferase Human genes 0.000 description 1
- 108010059724 Micrococcal Nuclease Proteins 0.000 description 1
- 241000192710 Microcystis aeruginosa Species 0.000 description 1
- 241000190928 Microscilla marina Species 0.000 description 1
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 1
- 241000713333 Mouse mammary tumor virus Species 0.000 description 1
- 108010086093 Mung Bean Nuclease Proteins 0.000 description 1
- 101000981253 Mus musculus GPI-linked NAD(P)(+)-arginine ADP-ribosyltransferase 1 Proteins 0.000 description 1
- 241000282339 Mustela Species 0.000 description 1
- 241000167285 Natranaerobius thermophilus Species 0.000 description 1
- 241000244206 Nematoda Species 0.000 description 1
- 206010029260 Neuroblastoma Diseases 0.000 description 1
- 101100385413 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) csm-3 gene Proteins 0.000 description 1
- 101100083259 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) pho-4 gene Proteins 0.000 description 1
- 241000919925 Nitrosococcus halophilus Species 0.000 description 1
- 241001515112 Nitrosococcus watsonii Species 0.000 description 1
- 241000203619 Nocardiopsis dassonvillei Species 0.000 description 1
- 241001223105 Nodularia spumigena Species 0.000 description 1
- 108091092724 Noncoding DNA Proteins 0.000 description 1
- 108020004485 Nonsense Codon Proteins 0.000 description 1
- 241000192673 Nostoc sp. Species 0.000 description 1
- 102100037223 Nuclear receptor coactivator 1 Human genes 0.000 description 1
- 102100037226 Nuclear receptor coactivator 2 Human genes 0.000 description 1
- 102100022883 Nuclear receptor coactivator 3 Human genes 0.000 description 1
- 241000192520 Oscillatoria sp. Species 0.000 description 1
- 238000010222 PCR analysis Methods 0.000 description 1
- 241000282579 Pan Species 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 241000142651 Pelotomaculum thermopropionicum Species 0.000 description 1
- 108010088535 Pep-1 peptide Proteins 0.000 description 1
- 102000002508 Peptide Elongation Factors Human genes 0.000 description 1
- 108010068204 Peptide Elongation Factors Proteins 0.000 description 1
- 241000983938 Petrotoga mobilis Species 0.000 description 1
- 241000286209 Phasianidae Species 0.000 description 1
- 241000235648 Pichia Species 0.000 description 1
- 241001599925 Polaromonas naphthalenivorans Species 0.000 description 1
- 241001472610 Polaromonas sp. Species 0.000 description 1
- RVGRUAULSDPKGF-UHFFFAOYSA-N Poloxamer Chemical compound C1CO1.CC1CO1 RVGRUAULSDPKGF-UHFFFAOYSA-N 0.000 description 1
- 229920002873 Polyethylenimine Polymers 0.000 description 1
- 102100030122 Protein O-GlcNAcase Human genes 0.000 description 1
- 101710149951 Protein Tat Proteins 0.000 description 1
- 241000590028 Pseudoalteromonas haloplanktis Species 0.000 description 1
- CZPWVGJYEJSRLH-UHFFFAOYSA-N Pyrimidine Chemical compound C1=CN=CN=C1 CZPWVGJYEJSRLH-UHFFFAOYSA-N 0.000 description 1
- 241000700157 Rattus norvegicus Species 0.000 description 1
- 101100372762 Rattus norvegicus Flt1 gene Proteins 0.000 description 1
- 101100047461 Rattus norvegicus Trpm8 gene Proteins 0.000 description 1
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 1
- 108010091086 Recombinases Proteins 0.000 description 1
- 102000018120 Recombinases Human genes 0.000 description 1
- 241000235070 Saccharomyces Species 0.000 description 1
- 101001025539 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) Homothallic switching endonuclease Proteins 0.000 description 1
- 241000288961 Saguinus imperator Species 0.000 description 1
- 241000282695 Saimiri Species 0.000 description 1
- 241000235346 Schizosaccharomyces Species 0.000 description 1
- 108091061750 Signal recognition particle RNA Proteins 0.000 description 1
- 241000256251 Spodoptera frugiperda Species 0.000 description 1
- 108091081024 Start codon Proteins 0.000 description 1
- 241000193996 Streptococcus pyogenes Species 0.000 description 1
- 241001431998 Streptococcus pyogenes MGAS15252 Species 0.000 description 1
- 241000194022 Streptococcus sp. Species 0.000 description 1
- 241000194020 Streptococcus thermophilus Species 0.000 description 1
- 241001518258 Streptomyces pristinaespiralis Species 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- 241000282898 Sus scrofa Species 0.000 description 1
- 102100021905 Synapsin-1 Human genes 0.000 description 1
- 241000192560 Synechococcus sp. Species 0.000 description 1
- 101710192266 Tegument protein VP22 Proteins 0.000 description 1
- 102100031664 Testis-specific chromodomain protein Y 1 Human genes 0.000 description 1
- 102100031666 Testis-specific chromodomain protein Y 2 Human genes 0.000 description 1
- 241000206213 Thermosipho africanus Species 0.000 description 1
- 102000005747 Transcription Factor RelA Human genes 0.000 description 1
- 108010031154 Transcription Factor RelA Proteins 0.000 description 1
- 102100038313 Transcription factor E2-alpha Human genes 0.000 description 1
- 108050004072 Transcription initiation factor TFIID subunit 1 Proteins 0.000 description 1
- 102100035222 Transcription initiation factor TFIID subunit 1 Human genes 0.000 description 1
- 102100033763 Transducin-like enhancer protein 4 Human genes 0.000 description 1
- 241000078013 Trichormus variabilis Species 0.000 description 1
- 102000044159 Ubiquitin Human genes 0.000 description 1
- 108090000848 Ubiquitin Proteins 0.000 description 1
- 241000545067 Venus Species 0.000 description 1
- 241001416177 Vicugna pacos Species 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 241001673106 [Bacillus] selenitireducens Species 0.000 description 1
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 229960005305 adenosine Drugs 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- KOSRFJWDECSPRO-UHFFFAOYSA-N alpha-L-glutamyl-L-glutamic acid Natural products OC(=O)CCC(N)C(=O)NC(CCC(O)=O)C(O)=O KOSRFJWDECSPRO-UHFFFAOYSA-N 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 229940011019 arthrospira platensis Drugs 0.000 description 1
- 125000004429 atom Chemical group 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 1
- DRTQHJPVMGBUCF-PSQAKQOGSA-N beta-L-uridine Natural products O[C@H]1[C@@H](O)[C@H](CO)O[C@@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-PSQAKQOGSA-N 0.000 description 1
- 108091005948 blue fluorescent proteins Proteins 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 125000004432 carbon atom Chemical group C* 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 125000002057 carboxymethyl group Chemical group [H]OC(=O)C([H])([H])[*] 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 229920006317 cationic polymer Polymers 0.000 description 1
- 230000033077 cellular process Effects 0.000 description 1
- 230000004700 cellular uptake Effects 0.000 description 1
- 208000019065 cervical carcinoma Diseases 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 235000013330 chicken meat Nutrition 0.000 description 1
- 210000003483 chromatin Anatomy 0.000 description 1
- 239000011035 citrine Substances 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 101150055601 cops2 gene Proteins 0.000 description 1
- 108010082025 cyan fluorescent protein Proteins 0.000 description 1
- 230000001351 cycling effect Effects 0.000 description 1
- UHDGCWIWMRVCDJ-ZAKLUEHWSA-N cytidine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O1 UHDGCWIWMRVCDJ-ZAKLUEHWSA-N 0.000 description 1
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical group NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 1
- 238000004925 denaturation Methods 0.000 description 1
- 230000036425 denaturation Effects 0.000 description 1
- 239000000412 dendrimer Substances 0.000 description 1
- 229920000736 dendritic polymer Polymers 0.000 description 1
- 210000005045 desmin Anatomy 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 239000005546 dideoxynucleotide Substances 0.000 description 1
- 230000005782 double-strand break Effects 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 239000010976 emerald Substances 0.000 description 1
- 229910052876 emerald Inorganic materials 0.000 description 1
- 108010048367 enhanced green fluorescent protein Proteins 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 230000001973 epigenetic effect Effects 0.000 description 1
- 210000002919 epithelial cell Anatomy 0.000 description 1
- 102000013165 exonuclease Human genes 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 210000000604 fetal stem cell Anatomy 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 210000005046 glial fibrillary acidic protein Anatomy 0.000 description 1
- 208000005017 glioblastoma Diseases 0.000 description 1
- 108010055341 glutamyl-glutamic acid Proteins 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 229940029575 guanosine Drugs 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 238000000530 impalefection Methods 0.000 description 1
- 210000004263 induced pluripotent stem cell Anatomy 0.000 description 1
- 229960003786 inosine Drugs 0.000 description 1
- 239000012212 insulator Substances 0.000 description 1
- 230000000366 juvenile effect Effects 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 210000005229 liver cell Anatomy 0.000 description 1
- 210000005265 lung cell Anatomy 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 108091005949 mKalama1 Proteins 0.000 description 1
- 241001515942 marmosets Species 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 150000002739 metals Chemical class 0.000 description 1
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- 125000004573 morpholin-4-yl group Chemical group N1(CCOCC1)* 0.000 description 1
- 210000002894 multi-fate stem cell Anatomy 0.000 description 1
- 230000002107 myocardial effect Effects 0.000 description 1
- 125000004433 nitrogen atom Chemical group N* 0.000 description 1
- 230000037434 nonsense mutation Effects 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 230000030648 nucleus localization Effects 0.000 description 1
- 230000009438 off-target cleavage Effects 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 1
- 210000001778 pluripotent stem cell Anatomy 0.000 description 1
- 229960000502 poloxamer Drugs 0.000 description 1
- 229920001983 poloxamer Polymers 0.000 description 1
- 108010011110 polyarginine Proteins 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 210000002307 prostate Anatomy 0.000 description 1
- 108020001580 protein domains Proteins 0.000 description 1
- 230000004850 protein–protein interaction Effects 0.000 description 1
- 230000014493 regulation of gene expression Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 125000000548 ribosyl group Chemical group C1([C@H](O)[C@H](O)[C@H](O1)CO)* 0.000 description 1
- 235000015170 shellfish Nutrition 0.000 description 1
- 238000012453 sprague-dawley rat model Methods 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 125000003396 thiol group Chemical group [H]S* 0.000 description 1
- RYYWUUFWQRZTIU-UHFFFAOYSA-K thiophosphate Chemical group [O-]P([O-])([O-])=S RYYWUUFWQRZTIU-UHFFFAOYSA-K 0.000 description 1
- 229940104230 thymidine Drugs 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- GWBUNZLLLLDXMD-UHFFFAOYSA-H tricopper;dicarbonate;dihydroxide Chemical compound [OH-].[OH-].[Cu+2].[Cu+2].[Cu+2].[O-]C([O-])=O.[O-]C([O-])=O GWBUNZLLLLDXMD-UHFFFAOYSA-H 0.000 description 1
- 239000003744 tubulin modulator Substances 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 210000002444 unipotent stem cell Anatomy 0.000 description 1
- DRTQHJPVMGBUCF-UHFFFAOYSA-N uracil arabinoside Natural products OC1C(O)C(CO)OC1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-UHFFFAOYSA-N 0.000 description 1
- 229940045145 uridine Drugs 0.000 description 1
- 210000004291 uterus Anatomy 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 210000002845 virion Anatomy 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 239000000277 virosome Substances 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0048—Eye, e.g. artificial tears
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/90—Stable introduction of foreign DNA into chromosome
- C12N15/902—Stable introduction of foreign DNA into chromosome using homologous recombination
- C12N15/907—Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
- A61P27/10—Ophthalmic agents for accommodation disorders, e.g. myopia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/463—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from amphibians
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/06—Linear peptides containing only normal peptide links having 5 to 11 amino acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/102—Mutagenizing nucleic acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/67—General methods for enhancing the expression
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/96—Stabilising an enzyme by forming an adduct or a composition; Forming enzyme conjugates
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y301/00—Hydrolases acting on ester bonds (3.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y301/00—Hydrolases acting on ester bonds (3.1)
- C12Y301/21—Endodeoxyribonucleases producing 5'-phosphomonoesters (3.1.21)
- C12Y301/21004—Type II site-specific deoxyribonuclease (3.1.21.4)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/09—Fusion polypeptide containing a localisation/targetting motif containing a nuclear localisation signal
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/10—Fusion polypeptide containing a localisation/targetting motif containing a tag for extracellular membrane crossing, e.g. TAT or VP22
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/80—Fusion polypeptide containing a DNA binding domain, e.g. Lacl or Tet-repressor
- C07K2319/81—Fusion polypeptide containing a DNA binding domain, e.g. Lacl or Tet-repressor containing a Zn-finger domain for DNA binding
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/30—Chemical structure
- C12N2310/35—Nature of the modification
- C12N2310/351—Conjugate
- C12N2310/3513—Protein; Peptide
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
- C12N2750/00011—Details
- C12N2750/14011—Parvoviridae
- C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
- C12N2750/14141—Use of virus, viral particle or viral elements as a vector
- C12N2750/14143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/22—Vectors comprising a coding region that has been codon optimised for expression in a respective host
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/80—Vectors containing sites for inducing double-stranded breaks, e.g. meganuclease restriction sites
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the present disclosure relates targeted genome modification.
- the disclosure relates to RNA-guided endonucleases or fusion proteins comprising CRISPR/Cas-like protein and methods of using said proteins to modify or regulate targeted chromosomal sequences.
- Targeted genome modification is a powerful tool for genetic manipulation of eukaryotic cells, embryos, and animals.
- exogenous sequences can be integrated at targeted genomic locations and/or specific endogenous chromosomal sequences can be deleted, inactivated, or modified.
- Current methods rely on the use of engineered nuclease enzymes, such as, for example, zinc finger nucleases (ZFNs) or transcription activator-like effector nucleases (TALENs).
- ZFNs zinc finger nucleases
- TALENs transcription activator-like effector nucleases
- These chimeric nucleases contain programmable, sequence-specific DNA-binding modules linked to a nonspecific DNA cleavage domain.
- Each new genomic target however, requires the design of a new ZFN or TALEN comprising a novel sequence-specific DNA-binding module.
- these custom designed nucleases tend to be costly and time-consuming to prepare.
- the specificities of ZFNs and TALENS are such
- RNA-guided endonuclease wherein the endonuclease comprises at least one nuclear localization signal, at least one nuclease domain, and at least one domain that interacts with a guide RNA to target the endonuclease to a specific nucleotide sequence for cleavage.
- the endonuclease can be derived from a Cas9 protein.
- the endonuclease can be modified to lack at least one functional nuclease domain.
- the endonuclease can further comprise a cell-penetrating domain, a marker domain, or both.
- the endonuclease can be part of a protein-RNA complex comprising the guide RNA.
- the guide RNA can be a single molecule comprising a 5′ region that is complementary to a target site.
- an isolated nucleic acid encoding any of the RNA-guided endonucleases disclosed herein.
- the nucleic acid can be codon optimized for translation in mammalian cells, such as, for example, human cells.
- the nucleic acid sequence encoding the RNA-guided endonuclease can be operably linked to a promoter control sequence, and optionally, can be part of a vector.
- a vector comprising sequence encoding the RNA-guided endonuclease, which can be operably linked to a promoter control sequence can also comprise sequence encoding a guide RNA, which can be operably linked to a promoter control sequence.
- Another aspect of the present invention encompasses a method for modifying a chromosomal sequence in a eukaryotic cell or embryo.
- the method comprises introducing into a eukaryotic cell or embryo (i) at least one RNA-guided endonuclease comprising at least one nuclear localization signal or nucleic acid encoding at least one RNA-guided endonuclease as defined herein, (ii) at least one guide RNA or DNA encoding at least one guide RNA, and, optionally, (iii) at least one donor polynucleotide comprising a donor sequence.
- the method further comprises culturing the cell or embryo such that each guide RNA directs a RNA-guided endonuclease to a targeted site in the chromosomal sequence where the RNA-guided endonuclease introduces a double-stranded break in the targeted site, and the double-stranded break is repaired by a DNA repair process such that the chromosomal sequence is modified.
- the RNA-guided endonuclease can be derived from a Cas9 protein.
- the nucleic acid encoding the RNA-guided endonuclease introduced into the cell or embryo can be mRNA.
- the nucleic acid encoding the RNA-guided endonuclease introduced into the cell or embryo can be DNA.
- the DNA encoding the RNA-guided endonuclease can be part of a vector that further comprises a sequence encoding the guide RNA.
- the eukaryotic cell can be a human cell, a non-human mammalian cell, a stem cell, a non-mammalian vertebrate cell, an invertebrate cell, a plant cell, or a single cell eukaryotic organism.
- the embryo is a non-human one cell animal embryo.
- a further aspect of the disclosure provides a fusion protein comprising a CRISPR/Cas-like protein or fragment thereof and an effector domain.
- the fusion protein comprises at least one nuclear localization signal.
- the effector domain of the fusion protein can be a cleavage domain, an epigenetic modification domain, a transcriptional activation domain, or a transcriptional repressor domain.
- the CRISPR/Cas-like protein of the fusion protein can be derived from a Cas9 protein.
- the Cas9 protein can be modified to lack at least one functional nuclease domain.
- the Cas9 protein can be modified to lack all nuclease activity.
- the effector domain can be a cleavage domain, such as, for example, a FokI endonuclease domain or a modified FokI endonuclease domain.
- one fusion protein can form a dimer with another fusion protein.
- the dimer can be a homodimer or a heterodimer.
- the fusion protein can form a heterodimer with a zinc finger nuclease, wherein the cleavage domain of both the fusion protein and the zinc finger nucleases is a FokI endonuclease domain or a modified FokI endonuclease domain.
- the fusion protein comprises a CRISPR/Cas-like protein derived from a Cas9 protein modified to lack all nuclease activity, and the effector domain is a FokI endonuclease domain or a modified FokI endonuclease domain.
- the fusion protein comprises a CRISPR/Cas-like protein derived from a Cas9 protein modified to lack all nuclease activity, and the effector domain can be an epigenetic modification domain, a transcriptional activation domain, or a transcriptional repressor domain.
- any of the fusion proteins disclosed herein can comprise at least one additional domain chosen from a nuclear localization signal, a cell-penetrating domain, and a marker domain. Also provided are isolated nucleic acids encoding any of the fusion proteins provided herein.
- Still another aspect of the disclosure encompasses a method for modifying a chromosomal sequence or regulating expression of a chromosomal sequence in a cell or embryo.
- the method comprises introducing into the cell or embryo (a) at least one fusion protein or nucleic acid encoding at least one fusion protein, wherein the fusion protein comprises a CRISPR/Cas-like protein or a fragment thereof and an effector domain, and (b) at least one guide RNA or DNA encoding at least one guide RNA, wherein the guide RNA guides the CRISPR/Cas-like protein of the fusion protein to a targeted site in the chromosomal sequence and the effector domain of the fusion protein modifies the chromosomal sequence or regulates expression of the chromosomal sequence.
- the CRISPR/Cas-like protein of the fusion protein can be derived from a Cas9 protein.
- the CRISPR/Cas-like protein of the fusion protein can be modified to lack at least one functional nuclease domain.
- the CRISPR/Cas-like protein of the fusion protein can be modified to lack all nuclease activity.
- the method can comprise introducing into the cell or embryo one fusion protein or nucleic acid encoding one fusion protein and two guide RNAs or DNA encoding two guide RNAs, and wherein one double-stranded break is introduced in the chromosomal sequence.
- the method can comprise introducing into the cell or embryo two fusion proteins or nucleic acid encoding two fusion proteins and two guide RNAs or DNA encoding two guide RNAs, and wherein two double-stranded breaks are introduced in the chromosomal sequence.
- the method can comprise introducing into the cell or embryo one fusion protein or nucleic acid encoding one fusion protein, one guide RNA or nucleic acid encoding one guide RNA, and one zinc finger nuclease or nucleic acid encoding one zinc finger nuclease, wherein the zinc finger nuclease comprises a FokI cleavage domain or a modified a FokI cleavage domain, and wherein one double-stranded break is introduced into the chromosomal sequence.
- the method can further comprise introducing into the cell or embryo at least one donor polynucleotide.
- the fusion protein comprises an effector domain chosen from an epigenetic modification domain, a transcriptional activation domain, or a transcriptional repressor domain
- the fusion protein can comprise a Cas9 protein modified to lack all nuclease activity
- the method can comprise introducing into the cell or embryo one fusion protein or nucleic acid encoding one fusion protein, and one guide RNA or nucleic acid encoding one guide RNA, and wherein the structure or expression of the targeted chromosomal sequence is modified.
- the eukaryotic cell can be a human cell, a non-human mammalian cell, a stem cell, a non-mammalian vertebrate cell, an invertebrate cell, a plant cell, or a single cell eukaryotic organism.
- the embryo is a non-human one cell animal embryo.
- FIG. 1 diagrams genome modification using protein dimers.
- A depicts a double stranded break created by a dimer composed of two fusion proteins, each of which comprises a Cas-like protein for DNA binding and a FokI cleavage domain.
- B depicts a double stranded break created by a dimer composed of a fusion protein comprising a Cas-like protein and a FokI cleavage domain and a zinc finger nuclease comprising a zinc finger (ZF) DNA-binding domain and a FokI cleavage domain.
- ZF zinc finger
- FIG. 2 illustrates regulation of gene expression using RNA-guided fusion proteins comprising gene regulatory domains.
- A depicts a fusion protein comprising a Cas-like protein used for DNA binding and an “AIR” domain that activates or represses gene expression.
- B diagrams a fusion protein comprising a Cas-like protein for DNA binding and a epigenetic modification domain (“Epi-mod”) that affects epigenetic states by covalent modification of proximal DNA or proteins.
- Epi-mod epigenetic modification domain
- FIG. 3 diagrams genome modification using two RNA-guided endonuclease.
- A depicts a double stranded break created by two RNA-guided endonuclease that have been converted into nickases.
- B depicts two double stranded breaks created by two RNA-guided endonuclease having endonuclease activity.
- FIG. 4 presents fluorescence-activated cell sorting (FACS) of human K562 cells transfected with Cas9 nucleic acid, Cas9 guiding RNA, and AAVS1-GFP DNA donor.
- the Y axis represents the auto fluorescence intensity at a red channel, and the X axis represents the green fluorescence intensity.
- A K562 cells transfected with 10 ⁇ g of Cas9 mRNA transcribed with an Anti-Reverse Cap Analog, 0.3 nmol of pre-annealed crRNA-tracrRNA duplex, and 10 ⁇ g of AAVS1-GFP plasmid DNA
- B K562 cells transfected 10 ⁇ g of Cas9 mRNA transcribed with an Anti-Reverse Cap Analog, 0.3 nmol of chimeric RNA, and 10 ⁇ g of AAVS1-GFP plasmid DNA
- C K562 cells transfected 10 ⁇ g of Cas9 mRNA that was capped by post-transcription capping reaction, 0.3 nmol of chimeric RNA, and 10 ⁇ g of AAVS1-GFP plasmid DNA
- D K562 cells transfected with 10 ⁇ g of Cas9 plasmid DNA, 5 ⁇ g of U6-chimeric RNA plasmid DNA, and 10 ⁇ g of AA
- FIG. 5 presents a junction PCR analysis documenting the targeted integration of GFP into the AAVS1 locus in human cells.
- Lane M 1 kb DNA molecular markers
- Lane A K562 cells transfected with 10 ⁇ g of Cas9 mRNA transcribed with an Anti-Reverse Cap Analog, 0.3 nmol of pre-annealed crRNA-tracrRNA duplex, and 10 ⁇ g of AAVS1-GFP plasmid DNA
- Lane B K562 cells transfected 10 ⁇ g of Cas9 mRNA transcribed with an Anti-Reverse Cap Analog, 0.3 nmol of chimeric RNA, and 10 ⁇ g of AAVS1-GFP plasmid DNA
- Lane C K562 cells transfected 10 ⁇ g of Cas9 mRNA that was capped by post-transcription capping reaction, 0.3 nmol of chimeric RNA, and 10 ⁇ g of AAVS1-GFP plasmid DNA
- Lane D K562
- RNA-guided endonucleases which comprise at least one nuclear localization signal, at least one nuclease domain, and at least one domain that interacts with a guide RNA to target the endonuclease to a specific nucleotide sequence for cleavage.
- nucleic acids encoding the RNA-guided endonucleases as well as methods of using the RNA-guided endonucleases to modify chromosomal sequences of eukaryotic cells or embryos.
- the RNA-guided endonuclease interacts with specific guide RNAs, each of which directs the endonuclease to a specific targeted site, at which site the RNA-guided endonuclease introduces a double-stranded break that can be repaired by a DNA repair process such that the chromosomal sequence is modified. Since the specificity is provided by the guide RNA, the RNA-based endonuclease is universal and can be used with different guide RNAs to target different genomic sequences. The methods disclosed herein can be used to target and modify specific chromosomal sequences and/or introduce exogenous sequences at targeted locations in the genome of cells or embryos. Furthermore, the targeting is specific with limited off target effects.
- fusion proteins wherein a fusion protein comprises a CRISPR/Cas-like protein or fragment thereof and an effector domain.
- Suitable effector domains include, without limit, cleavage domains, epigenetic modification domains, transcriptional activation domains, and transcriptional repressor domains.
- Each fusion protein is guided to a specific chromosomal sequence by a specific guide RNA, wherein the effector domain mediates targeted genome modification or gene regulation.
- the fusion proteins can function as dimers thereby increasing the length of the target site and increasing the likelihood of its uniqueness in the genome (thus, reducing off target effects).
- endogenous CRISPR systems modify genomic locations based on DNA binding word lengths of approximately 13-20 bp (Cong et al., Science, 339:819-823). At this word size, only 5-7% of the target sites are unique within the genome (Iseli et al, PLos One 2 (6):e579). In contrast, DNA binding word sizes for zinc finger nucleases typically range from 30-36 bp, resulting in target sites that are approximately 85-87% unique within the human genome.
- the smaller sized DNA binding sites utilized by CRISPR-based systems limits and complicates design of targeted CRISP-based nucleases near desired locations, such as disease SNPs, small exons, start codons, and stop codons, as well as other locations within complex genomes.
- the present disclosure not only provides means for expanding the CRISPR DNA binding word length (i.e., so as to limit off-target activity), but further provides CRISPR fusion proteins having modified functionality. According, the disclosed CRISPR fusion proteins have increased target specificity and unique functionality(ies). Also provided herein are methods of using the fusion proteins to modify or regulate expression of targeted chromosomal sequences.
- RNA-guided endonucleases comprising at least one nuclear localization signal, which permits entry of the endonuclease into the nuclei of eukaryotic cells and embryos such as, for example, non-human one cell embryos.
- RNA-guided endonucleases also comprise at least one nuclease domain and at least one domain that interacts with a guide RNA.
- An RNA-guided endonuclease is directed to a specific nucleic acid sequence (or target site) by a guide RNA.
- the guide RNA interacts with the RNA-guided endonuclease as well as the target site such that, once directed to the target site, the RNA-guided endonuclease is able to introduce a double-stranded break into the target site nucleic acid sequence. Since the guide RNA provides the specificity for the targeted cleavage, the endonuclease of the RNA-guided endonuclease is universal and can be used with different guide RNAs to cleave different target nucleic acid sequences.
- RNA-guided endonucleases isolated nucleic acids (i.e., RNA or DNA) encoding the RNA-guided endonucleases, vectors comprising nucleic acids encoding the RNA-guided endonucleases, and protein-RNA complexes comprising the RNA-guided endonuclease plus a guide RNA.
- isolated nucleic acids i.e., RNA or DNA
- vectors comprising nucleic acids encoding the RNA-guided endonucleases
- protein-RNA complexes comprising the RNA-guided endonuclease plus a guide RNA.
- the RNA-guided endonuclease can be derived from a clustered regularly interspersed short palindromic repeats (CRISPR)/CRISPR-associated (Cas) system.
- CRISPR/Cas system can be a type I, a type II, or a type III system.
- Non-limiting examples of suitable CRISPR/Cas proteins include Cas3, Cas4, Cas5, Cas5e (or CasD), Cas6, Cas6e, Cas6f, Cas7, Cas8a1, Cas8a2, Cas8b, Cas8c, Cas9, Cas10, Cas10d, CasF, CasG, CasH, Csy1, Csy2, Csy3, Cse1 (or CasA), Cse2 (or CasB), Cse3 (or CasE), Cse4 (or CasC), Csc1, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmr1, Cmr3, Cmr4, Cmr5, Cmr6, Csb1, Csb2, Csb3, Csx17, Csx14, Csx10, Csx16, CsaX, Csx3, Csz1, Csx15,
- the RNA-guided endonuclease is derived from a type II CRISPR/Cas system.
- the RNA-guided endonuclease is derived from a Cas9 protein.
- the Cas9 protein can be from Streptococcus pyogenes, Streptococcus thermophilus, Streptococcus sp., Nocardiopsis rougevillei, Streptomyces pristinaespiralis, Streptomyces viridochromogenes, Streptomyces viridochromogenes, Streptosporangium roseum, Streptosporangium roseum, Alicyclobacillus acidocaldarius, Bacillus pseudomycoides, Bacillus selenitireducens, Exiguobacterium sibiricum, Lactobacillus delbrueckii, Lactobacillus salivarius, Microscilla marina, Burkholderiales bacterium, Polaro
- CRISPR/Cas proteins comprise at least one RNA recognition and/or RNA binding domain.
- RNA recognition and/or RNA binding domains interact with guide RNAs.
- CRISPR/Cas proteins can also comprise nuclease domains (i.e., DNase or RNase domains), DNA binding domains, helicase domains, RNAse domains, protein-protein interaction domains, dimerization domains, as well as other domains.
- the CRISPR/Cas-like protein can be a wild type CRISPR/Cas protein, a modified CRISPR/Cas protein, or a fragment of a wild type or modified CRISPR/Cas protein.
- the CRISPR/Cas-like protein can be modified to increase nucleic acid binding affinity and/or specificity, alter an enzymatic activity, and/or change another property of the protein.
- nuclease i.e., DNase, RNase
- the CRISPR/Cas-like protein can be truncated to remove domains that are not essential for the function of the fusion protein.
- the CRISPR/Cas-like protein can also be truncated or modified to optimize the activity of the effector domain of the fusion protein.
- the CRISPR/Cas-like protein can be derived from a wild type Cas9 protein or fragment thereof.
- the CRISPR/Cas-like protein can be derived from modified Cas9 protein.
- the amino acid sequence of the Cas9 protein can be modified to alter one or more properties (e.g., nuclease activity, affinity, stability, etc.) of the protein.
- domains of the Cas9 protein not involved in RNA-guided cleavage can be eliminated from the protein such that the modified Cas9 protein is smaller than the wild type Cas9 protein.
- a Cas9 protein comprises at least two nuclease (i.e., DNase) domains.
- a Cas9 protein can comprise a RuvC-like nuclease domain and a HNH-like nuclease domain. The RuvC and HNH domains work together to cut single strands to make a double-stranded break in DNA. (Jinek et al., Science, 337: 816-821).
- the Cas9-derived protein can be modified to contain only one functional nuclease domain (either a RuvC-like or a HNH-like nuclease domain).
- the Cas9-derived protein can be modified such that one of the nuclease domains is deleted or mutated such that it is no longer functional (i.e., the nuclease activity is absent).
- the Cas9-derived protein is able to introduce a nick into a double-stranded nucleic acid (such protein is termed a “nickase”), but not cleave the double-stranded DNA.
- nickase such protein is termed a “nickase”
- an aspartate to alanine (D10A) conversion in a RuvC-like domain converts the Cas9-derived protein into a nickase.
- H840A or H839A a histidine to alanine (H840A or H839A) conversion in a HNH domain converts the Cas9-derived protein into a nickase.
- Each nuclease domain can be modified using well-known methods, such as site-directed mutagenesis, PCR-mediated mutagenesis, and total gene synthesis, as well as other methods known in the art.
- the RNA-guided endonuclease disclosed herein comprises at least one nuclear localization signal.
- an NLS comprises a stretch of basic amino acids. Nuclear localization signals are known in the art (see, e.g., Lange et al., J. Biol. Chem., 2007, 282:5101-5105).
- the NLS can be a monopartite sequence, such as PKKKRKV (SEQ ID NO:1) or PKKKRRV (SEQ ID NO:2).
- the NLS can be a bipartite sequence.
- the NLS can be KRPAATKKAGQAKKKK (SEQ ID NO:3).
- the NLS can be located at the N-terminus, the C-terminal, or in an internal location of the RNA-guided endonuclease.
- the RNA-guided endonuclease can further comprise at least one cell-penetrating domain.
- the cell-penetrating domain can be a cell-penetrating peptide sequence derived from the HIV-1 TAT protein.
- the TAT cell-penetrating sequence can be GRKKRRQRRRPPQPKKKRKV (SEQ ID NO:4).
- the cell-penetrating domain can be TLM (PLSSIFSRIGDPPKKKRKV; SEQ ID NO:5), a cell-penetrating peptide sequence derived from the human hepatitis B virus.
- the cell-penetrating domain can be MPG (GALFLGWLGAAGSTMGAPKKKRKV; SEQ ID NO:6 or GALFLGFLGAAGSTMGAWSQPKKKRKV; SEQ ID NO:7).
- the cell-penetrating domain can be Pep-1 (KETWWETWWTEWSQPKKKRKV; SEQ ID NO:8), VP22, a cell penetrating peptide from Herpes simplex virus, or a polyarginine peptide sequence.
- the cell-penetrating domain can be located at the N-terminus, the C-terminus, or in an internal location of the protein.
- the RNA-guided endonuclease can also comprise at least one marker domain.
- marker domains include fluorescent proteins, purification tags, and epitope tags.
- the marker domain can be a fluorescent protein.
- suitable fluorescent proteins include green fluorescent proteins (e.g., GFP, GFP-2, tagGFP, turboGFP, EGFP, Emerald, Azami Green, Monomeric Azami Green, CopGFP, AceGFP, ZsGreen1), yellow fluorescent proteins (e.g. YFP, EYFP, Citrine, Venus, YPet, PhiYFP, ZsYellow1), blue fluorescent proteins (e.g.
- EBFP EBFP2, Azurite, mKalama1, GFPuv, Sapphire, T-sapphire), cyan fluorescent proteins (e.g. ECFP, Cerulean, CyPet, AmCyan1, Midoriishi-Cyan), red fluorescent proteins (mKate, mKate2, mPlum, DsRed monomer, mCherry, mRFP1, DsRed-Express, DsRed2, DsRed-Monomer, HcRed-Tandem, HcRed1, AsRed2, eqFP611, mRasberry, mStrawberry, Jred), and orange fluorescent proteins (mOrange, mKO, Kusabira-Orange, Monomeric Kusabira-Orange, mTangerine, tdTomato) or any other suitable fluorescent protein.
- cyan fluorescent proteins e.g. ECFP, Cerulean, CyPet, AmCyan1, Midoriishi-C
- the marker domain can be a purification tag and/or an epitope tag.
- tags include, but are not limited to, glutathione-S-transferase (GST), chitin binding protein (CBP), maltose binding protein, thioredoxin (TRX), poly(NANP), tandem affinity purification (TAP) tag, myc, AcV5, AU1, AU5, E, ECS, E2, FLAG, HA, nus, Softag 1, Softag 3, Strep, SBP, Glu-Glu, HSV, KT3, S, S1, T7, V5, VSV-G, 6 ⁇ His, biotin carboxyl carrier protein (BCCP), and calmodulin.
- GST glutathione-S-transferase
- CBP chitin binding protein
- TRX thioredoxin
- poly(NANP) poly(NANP)
- TAP tandem affinity purification
- the RNA-guided endonuclease may be part of a protein-RNA complex comprising a guide RNA.
- the guide RNA interacts with the RNA-guided endonuclease to direct the endonuclease to a specific target site, wherein the 5′ end of the guide RNA base pairs with a specific protospacer sequence.
- a fusion protein comprising a CRISPR/Cas-like protein or fragment thereof and an effector domain.
- the CRISPR/Cas-like protein is directed to a target site by a guide RNA, at which site the effector domain can modify or effect the targeted nucleic acid sequence.
- the effector domain can be a cleavage domain, an epigenetic modification domain, a transcriptional activation domain, or a transcriptional repressor domain.
- the fusion protein can further comprise at least one additional domain chosen from a nuclear localization signal, a cell-penetrating domain, or a marker domain.
- the fusion protein comprises a CRISPR/Cas-like protein or a fragment thereof.
- CRISPR/Cas-like proteins are detailed above in section (I).
- the CRISPR/Cas-like protein can be located at the N-terminus, the C-terminus, or in an internal location of the fusion protein
- the CRISPR/Cas-like protein of the fusion protein can be derived from a Cas9 protein.
- the Cas9-derived protein can be wild type, modified, or a fragment thereof.
- the Cas9-derived protein can be modified to contain only one functional nuclease domain (either a RuvC-like or a HNH-like nuclease domain).
- the Cas9-derived protein can be modified such that one of the nuclease domains is deleted or mutated such that it is no longer functional (i.e., the nuclease activity is absent).
- the Cas9-derived protein is able to introduce a nick into a double-stranded nucleic acid (such protein is termed a “nickase”), but not cleave the double-stranded DNA.
- a nickase such protein is termed a “nickase”
- an aspartate to alanine (D10A) conversion in a RuvC-like domain converts the Cas9-derived protein into a nickase.
- a histidine to alanine (H840A or H839A) conversion in a HNH domain converts the Cas9-derived protein into a nickase.
- both of the RuvC-like nuclease domain and the HNH-like nuclease domain can be modified or eliminated such that the Cas9-derived protein is unable to nick or cleave double stranded nucleic acid.
- all nuclease domains of the Cas9-derived protein can be modified or eliminated such that the Cas9-derived protein lacks all nuclease activity.
- any or all of the nuclease domains can be inactivated by one or more deletion mutations, insertion mutations, and/or substitution mutations using well-known methods, such as site-directed mutagenesis, PCR-mediated mutagenesis, and total gene synthesis, as well as other methods known in the art.
- the CRISPR/Cas-like protein of the fusion protein is derived from a Cas9 protein in which all the nuclease domains have been inactivated or deleted.
- the fusion protein also comprises an effector domain.
- the effector domain can be a cleavage domain, an epigenetic modification domain, a transcriptional activation domain, or a transcriptional repressor domain.
- the effector domain can be located at the N-terminus, the C-terminus, or in an internal location of the fusion protein.
- the effector domain is a cleavage domain.
- a “cleavage domain” refers to a domain that cleaves DNA.
- the cleavage domain can be obtained from any endonuclease or exonuclease.
- Non-limiting examples of endonucleases from which a cleavage domain can be derived include, but are not limited to, restriction endonucleases and homing endonucleases. See, for example, New England Biolabs Catalog or Belfort et al. (1997) Nucleic Acids Res. 25:3379-3388.
- cleave DNA e.g., S1 Nuclease; mung bean nuclease; pancreatic DNase I; micrococcal nuclease; yeast HO endonuclease. See also Linn et al. (eds.) Nucleases, Cold Spring Harbor Laboratory Press, 1993. One or more of these enzymes (or functional fragments thereof) can be used as a source of cleavage domains.
- the cleavage domain can be derived from a type II-S endonuclease.
- Type II-S endonucleases cleave DNA at sites that are typically several base pairs away the recognition site and, as such, have separable recognition and cleavage domains. These enzymes generally are monomers that transiently associate to form dimers to cleave each strand of DNA at staggered locations.
- suitable type II-S endonucleases include BfiI, BpmI, BsaI, BsgI, BsmBI, BsmI, BspMI, FokI, MbolI, and SapI.
- the cleavage domain of the fusion protein is a FokI cleavage domain or a derivative thereof.
- the type II-S cleavage can be modified to facilitate dimerization of two different cleavage domains (each of which is attached to a CRISPR/Cas-like protein or fragment thereof).
- the cleavage domain of FokI can be modified by mutating certain amino acid residues.
- amino acid residues at positions 446, 447, 479, 483, 484, 486, 487, 490, 491, 496, 498, 499, 500, 531, 534, 537, and 538 of FokI cleavage domains are targets for modification.
- modified cleavage domains of FokI that form obligate heterodimers include a pair in which a first modified cleavage domain includes mutations at amino acid positions 490 and 538 and a second modified cleavage domain that includes mutations at amino acid positions 486 and 499 (Miller et al., 2007, Nat. Biotechnol, 25:778-785; Szczpek et al., 2007, Nat. Biotechnol, 25:786-793).
- modified FokI cleavage domains can include three amino acid changes (Doyon et al. 2011, Nat. Methods, 8:74-81).
- one modified FokI domain (which is termed ELD) can comprise Q486E, I499L, N496D mutations and the other modified FokI domain (which is termed KKR) can comprise E490K, I538K, H537R mutations.
- the effector domain of the fusion protein is a FokI cleavage domain or a modified FokI cleavage domain.
- the Cas9-derived can be modified as discussed herein such that its endonuclease activity is eliminated.
- the Cas9-derived can be modified by mutating the RuvC and HNH domains such that they no longer possess nuclease activity.
- the effector domain of the fusion protein can be an epigenetic modification domain.
- epigenetic modification domains alter histone structure and/or chromosomal structure without altering the DNA sequence. Changes histone and/or chromatin structure can lead to changes in gene expression. Examples of epigenetic modification include, without limit, acetylation or methylation of lysine residues in histone proteins, and methylation of cytosine residues in DNA.
- Non-limiting examples of suitable epigenetic modification domains include histone acetyltansferase domains, histone deacetylase domains, histone methyltransferase domains, histone demethylase domains, DNA methyltransferase domains, and DNA demethylase domains.
- the HAT domain can be derived from EP300 (i.e., E1A binding protein p300), CREBBP (i.e., CREB-binding protein), CDY1, CDY2, CDYL1, CLOCK, ELP3, ESA1, GCN5 (KAT2A), HAT1, KAT2B, KAT5, MYST1, MYST2, MYST3, MYST4, NCOA1, NCOA2, NCOA3, NCOAT, P/CAF, Tip60, TAFII250, or TF3C4.
- the HAT domain is p300
- the Cas9-derived can be modified as discussed herein such that its endonuclease activity is eliminated.
- the Cas9-derived can be modified by mutating the RuvC and HNH domains such that they no longer possess nuclease activity.
- the effector domain of the fusion protein can be a transcriptional activation domain.
- a transcriptional activation domain interacts with transcriptional control elements and/or transcriptional regulatory proteins (i.e., transcription factors, RNA polymerases, etc.) to increase and/or activate transcription of a gene.
- the transcriptional activation domain can be, without limit, a herpes simplex virus VP16 activation domain, VP64 (which is a tetrameric derivative of VP16), a NF ⁇ B p65 activation domain, p53 activation domains 1 and 2, a CREB (cAMP response element binding protein) activation domain, an E2A activation domain, and an NFAT (nuclear factor of activated T-cells) activation domain.
- the transcriptional activation domain can be Gal4, Gcn4, MLL, Rtg3, Gln3, Oaf1, Pip2, Pdr1, Pdr3, Pho4, and Leu3.
- the transcriptional activation domain may be wild type, or it may be a modified version of the original transcriptional activation domain.
- the effector domain of the fusion protein is a VP16 or VP64 transcriptional activation domain.
- the Cas9-derived protein can be modified as discussed herein such that its endonuclease activity is eliminated.
- the Cas9-derived can be modified by mutating the RuvC and HNH domains such that they no longer possess nuclease activity.
- the effector domain of the fusion protein can be a transcriptional repressor domain.
- a transcriptional repressor domain interacts with transcriptional control elements and/or transcriptional regulatory proteins (i.e., transcription factors, RNA polymerases, etc.) to decrease and/or terminate transcription of a gene.
- transcriptional repressor domains include inducible cAMP early repressor (ICER) domains, Kruppel-associated box A (KRAB-A) repressor domains, YY1 glycine rich repressor domains, Sp1-like repressors, E(spl) repressors, I ⁇ B repressor, and MeCP2.
- the Cas9-derived protein can be modified as discussed herein such that its endonuclease activity is eliminated.
- the cas9 can be modified by mutating the RuvC and HNH domains such that they no longer possess nuclease activity.
- the fusion protein further comprises at least one additional domain.
- suitable additional domains include nuclear localization signals, cell-penetrating or translocation domains, and marker domains.
- suitable nuclear localization signals, cell-penetrating domains, and marker domains are presented above in section (I).
- a dimer comprising at least one fusion protein can form.
- the dimer can be a homodimer or a heterodimer.
- the heterodimer comprises two different fusion proteins.
- the heterodimer comprises one fusion protein and an additional protein.
- the dimer is a homodimer in which the two fusion protein monomers are identical with respect to the primary amino acid sequence.
- the Cas9-derived proteins are modified such that their endonuclease activity is eliminated, i.e., such that they have no functional nuclease domains.
- each fusion protein monomer comprises an identical Cas9 like protein and an identical cleavage domain.
- the cleavage domain can be any cleavage domain, such as any of the exemplary cleavage domains provided herein.
- the cleavage domain is a FokI cleavage domain or a modified FokI cleavage domain.
- specific guide RNAs would direct the fusion protein monomers to different but closely adjacent sites such that, upon dimer formation, the nuclease domains of the two monomers would create a double stranded break in the target DNA.
- the dimer is a heterodimer of two different fusion proteins.
- the CRISPR/Cas-like protein of each fusion protein can be derived from a different CRISPR/Cas protein or from an orthologous CRISPR/Cas protein from a different bacterial species.
- each fusion protein can comprise a Cas9-like protein, which Cas9-like protein is derived from a different bacterial species.
- each fusion protein would recognize a different target site (i.e., specified by the protospacer and/or PAM sequence).
- the guide RNAs could position the heterodimer to different but closely adjacent sites such that their nuclease domains results in an effective double stranded break in the target DNA.
- the heterodimer can also have modified Cas9 proteins with nicking activity such that the nicking locations are different.
- two fusion proteins of a heterodimer can have different effector domains.
- each fusion protein can contain a different modified cleavage domain.
- each fusion protein can contain a different modified FokI cleavage domain, as detailed above in section (II)(b)(i).
- the Cas-9 proteins can be modified such that their endonuclease activities are eliminated.
- the two fusion proteins forming a heterodimer can differ in both the CRISPR/Cas-like protein domain and the effector domain.
- the homodimer or heterodimer can comprise at least one additional domain chosen from nuclear localization signals (NLSs), cell-penetrating, translocation domains and marker domains, as detailed above.
- NLSs nuclear localization signals
- cell-penetrating cell-penetrating
- translocation domains translocation domains
- marker domains marker domains
- one or both of the Cas9-derived proteins can be modified such that its endonuclease activity is eliminated or modified.
- the heterodimer comprises one fusion protein and an additional protein.
- the additional protein can be a nuclease.
- the nuclease is a zinc finger nuclease.
- a zinc finger nuclease comprises a zinc finger DNA binding domain and a cleavage domain.
- a zinc finger recognizes and binds three (3) nucleotides.
- a zinc finger DNA binding domain can comprise from about three zinc fingers to about seven zinc fingers.
- the zinc finger DNA binding domain can be derived from a naturally occurring protein or it can be engineered. See, for example, Beerli et al. (2002) Nat. Biotechnol. 20:135-141; Pabo et al. (2001) Ann. Rev. Biochem.
- the cleavage domain of the zinc finger nuclease can be any cleavage domain detailed above in section (II)(b)(i).
- the cleavage domain of the zinc finger nuclease is a FokI cleavage domain or a modified FokI cleavage domain.
- Such a zinc finger nuclease will dimerize with a fusion protein comprising a FokI cleavage domain or a modified FokI cleavage domain.
- the zinc finger nuclease can comprise at least one additional domain chosen from nuclear localization signals, cell-penetrating or translocation domains, which are detailed above.
- any of the fusion protein detailed above or a dimer comprising at least one fusion protein may be part of a protein-RNA complex comprising at least one guide RNA.
- a guide RNA interacts with the CRISPR-Cas0 like protein of the fusion protein to direct the fusion protein to a specific target site, wherein the 5′ end of the guide RNA base pairs with a specific protospacer sequence.
- nucleic acids encoding any of the RNA-guided endonucleases or fusion proteins described above in sections (I) and (II), respectively.
- the nucleic acid can be RNA or DNA.
- the nucleic acid encoding the RNA-guided endonuclease or fusion protein is mRNA.
- the mRNA can be 5′ capped and/or 3′ polyadenylated.
- the nucleic acid encoding the RNA-guided endonuclease or fusion protein is DNA.
- the DNA can be present in a vector (see below).
- the nucleic acid encoding the RNA-guided endonuclease or fusion protein can be codon optimized for efficient translation into protein in the eukaryotic cell or animal of interest.
- codons can be optimized for expression in humans, mice, rats, hamsters, cows, pigs, cats, dogs, fish, amphibians, plants, yeast, insects, and so forth (see Codon Usage Database at www.kazusa.or.jp/codon/).
- Programs for codon optimization are available as freeware (e.g., OPTIMIZER at genomes.urv.es/OPTIMIZER; OptimumGeneTM from GenScript at www.genscript.com/codon_opt.html).
- Commercial codon optimization programs are also available.
- DNA encoding the RNA-guided endonuclease or fusion protein can be operably linked to at least one promoter control sequence.
- the DNA coding sequence can be operably linked to a promoter control sequence for expression in the eukaryotic cell or animal of interest.
- the promoter control sequence can be constitutive, regulated, or tissue-specific.
- Suitable constitutive promoter control sequences include, but are not limited to, cytomegalovirus immediate early promoter (CMV), simian virus (SV40) promoter, adenovirus major late promoter, Rous sarcoma virus (RSV) promoter, mouse mammary tumor virus (MMTV) promoter, phosphoglycerate kinase (PGK) promoter, elongation factor (ED1)-alpha promoter, ubiquitin promoters, actin promoters, tubulin promoters, immunoglobulin promoters, fragments thereof, or combinations of any of the foregoing.
- suitable regulated promoter control sequences include without limit those regulated by heat shock, metals, steroids, antibiotics, or alcohol.
- tissue-specific promoters include B29 promoter, CD14 promoter, CD43 promoter, CD45 promoter, CD68 promoter, desmin promoter, elastase-1 promoter, endoglin promoter, fibronectin promoter, Flt-1 promoter, GFAP promoter, GPIIb promoter, ICAM-2 promoter, INF- ⁇ promoter, Mb promoter, NphsI promoter, 00-2 promoter, SP-B promoter, SYN1 promoter, and WASP promoter.
- the promoter sequence can be wild type or it can be modified for more efficient or efficacious expression.
- the encoding DNA can be operably linked to a CMV promoter for constitutive expression in mammalian cells.
- the sequence encoding the RNA-guided endonuclease or fusion protein can be operably linked to a promoter sequence that is recognized by a phage RNA polymerase for in vitro mRNA synthesis.
- the in vitro-transcribed RNA can be purified for use in the methods detailed below in sections (IV) and (V).
- the promoter sequence can be a T7, T3, or SP6 promoter sequence or a variation of a T7, T3, or SP6 promoter sequence.
- the DNA encoding the fusion protein is operably linked to a T7 promoter for in vitro mRNA synthesis using T7 RNA polymerase.
- the sequence encoding the RNA-guided endonuclease or fusion protein can be operably linked to a promoter sequence for in vitro expression of the RNA-guided endonuclease or fusion protein in bacterial or eukaryotic cells.
- the expressed protein can be purified for use in the methods detailed below in sections (IV) and (V).
- Suitable bacterial promoters include, without limit, T7 promoters, lac operon promoters, trp promoters, variations thereof, and combinations thereof.
- An exemplary bacterial promoter is tac which is a hybrid of trp and lac promoters.
- suitable eukaryotic promoters are listed above.
- the DNA encoding the RNA-guided endonuclease or fusion protein also can be linked to a polyadenylation signal (e.g., SV40 polyA signal, bovine growth hormone (BGH) polyA signal, etc.) and/or at least one transcriptional termination sequence.
- a polyadenylation signal e.g., SV40 polyA signal, bovine growth hormone (BGH) polyA signal, etc.
- BGH bovine growth hormone
- the sequence encoding the RNA-guided endonuclease or fusion protein also can be linked to sequence encoding at least one nuclear localization signal, at least one cell-penetrating domain, and/or at least one marker domain, which are detailed above in section (I).
- the DNA encoding the RNA-guided endonuclease or fusion protein can be present in a vector.
- Suitable vectors include plasmid vectors, phagemids, cosmids, artificial/mini-chromosomes, transposons, and viral vectors (e.g., lentiviral vectors, adeno-associated viral vectors, etc.).
- the DNA encoding the RNA-guided endonuclease or fusion protein is present in a plasmid vector.
- suitable plasmid vectors include pUC, pBR322, pET, pBluescript, and variants thereof.
- the vector can comprise additional expression control sequences (e.g., enhancer sequences, Kozak sequences, polyadenylation sequences, transcriptional termination sequences, etc.), selectable marker sequences (e.g., antibiotic resistance genes), origins of replication, and the like. Additional information can be found in “Current Protocols in Molecular Biology” Ausubel et al., John Wiley & Sons, New York, 2003 or “Molecular Cloning: A Laboratory Manual” Sambrook & Russell, Cold Spring Harbor Press, Cold Spring Harbor, N.Y., 3 rd edition, 2001.
- additional expression control sequences e.g., enhancer sequences, Kozak sequences, polyadenylation sequences, transcriptional termination sequences, etc.
- selectable marker sequences e.g., antibiotic resistance genes
- the expression vector comprising the sequence encoding the RNA-guided endonuclease or fusion protein can further comprise sequence encoding a guide RNA.
- the sequence encoding the guide RNA generally is operably linked to at least one transcriptional control sequence for expression of the guide RNA in the cell or embryo of interest.
- DNA encoding the guide RNA can be operably linked to a promoter sequence that is recognized by RNA polymerase III (Pol III).
- Pol III RNA polymerase III
- suitable Pol III promoters include, but are not limited to, mammalian U6, U3, H1, and 7SL RNA promoters.
- Another aspect of the present disclosure encompasses a method for modifying a chromosomal sequence in a eukaryotic cell or embryo.
- the method comprises introducing into a eukaryotic cell or embryo (i) at least one RNA-guided endonuclease comprising at least one nuclear localization signal or nucleic acid encoding at least one RNA-guided endonuclease comprising at least one nuclear localization signal, (ii) at least one guide RNA or DNA encoding at least one guide RNA, and, optionally, (iii) at least one donor polynucleotide comprising a donor sequence.
- the method further comprises culturing the cell or embryo such that each guide RNA directs an RNA-guided endonuclease to a targeted site in the chromosomal sequence where the RNA-guided endonuclease introduces a double-stranded break in the targeted site, and the double-stranded break is repaired by a DNA repair process such that the chromosomal sequence is modified.
- the method can comprise introducing one RNA-guided endonuclease (or encoding nucleic acid) and one guide RNA (or encoding DNA) into a cell or embryo, wherein the RNA-guided endonuclease introduces one double-stranded break in the targeted chromosomal sequence.
- the double-stranded break in the chromosomal sequence can be repaired by a non-homologous end-joining (NHEJ) repair process.
- NHEJ non-homologous end-joining
- the targeted chromosomal sequence can be modified or inactivated.
- a single nucleotide change can give rise to an altered protein product, or a shift in the reading frame of a coding sequence can inactivate or “knock out” the sequence such that no protein product is made.
- the donor sequence in the donor polynucleotide can be exchanged with or integrated into the chromosomal sequence at the targeted site during repair of the double-stranded break.
- the donor sequence in embodiments in which the donor sequence is flanked by upstream and downstream sequences having substantial sequence identity with upstream and downstream sequences, respectively, of the targeted site in the chromosomal sequence, the donor sequence can be exchanged with or integrated into the chromosomal sequence at the targeted site during repair mediated by homology-directed repair process.
- the donor sequence can be ligated directly with the cleaved chromosomal sequence by a non-homologous repair process during repair of the double-stranded break.
- Exchange or integration of the donor sequence into the chromosomal sequence modifies the targeted chromosomal sequence or introduces an exogenous sequence into the chromosomal sequence of the cell or embryo.
- the method can comprise introducing two RNA-guided endonucleases (or encoding nucleic acid) and two guide RNAs (or encoding DNA) into a cell or embryo, wherein the RNA-guided endonucleases introduce two double-stranded breaks in the chromosomal sequence. See FIG. 3B .
- the two breaks can be within several base pairs, within tens of base pairs, or can be separated by many thousands of base pairs.
- the resultant double-stranded breaks can be repaired by a non-homologous repair process such that the sequence between the two cleavage sites is lost and/or deletions of at least one nucleotide, insertions of at least one nucleotide, substitutions of at least one nucleotide, or combinations thereof can occur during the repair of the break(s).
- the donor sequence in the donor polynucleotide can be exchanged with or integrated into the chromosomal sequence during repair of the double-stranded breaks by either a homology-based repair process (e.g., in embodiments in which the donor sequence is flanked by upstream and downstream sequences having substantial sequence identity with upstream and downstream sequences, respectively, of the targeted sites in the chromosomal sequence) or a non-homologous repair process (e.g., in embodiments in which the donor sequence is flanked by compatible overhangs).
- a homology-based repair process e.g., in embodiments in which the donor sequence is flanked by upstream and downstream sequences having substantial sequence identity with upstream and downstream sequences, respectively, of the targeted sites in the chromosomal sequence
- a non-homologous repair process e.g., in embodiments in which the donor sequence is flanked by compatible overhangs.
- the method can comprise introducing one RNA-guided endonuclease modified to cleave one strand of a double-stranded sequence (or encoding nucleic acid) and two guide RNAs (or encoding DNA) into a cell or embryo, wherein each guide RNA directs the RNA-guided endonuclease to a specific target site, at which site the modified endonuclease cleaves one strand (i.e., nicks) of the double-stranded chromosomal sequence, and wherein the two nicks are in opposite stands and in close enough proximity to constitute a double-stranded break. See FIG. 3A .
- the resultant double-stranded break can be repaired by a non-homologous repair process such that deletions of at least one nucleotide, insertions of at least one nucleotide, substitutions of at least one nucleotide, or combinations thereof can occur during the repair of the break.
- the donor sequence in the donor polynucleotide can be exchanged with or integrated into the chromosomal sequence during repair of the double-stranded break by either a homology-based repair process (e.g., in embodiments in which the donor sequence is flanked by upstream and downstream sequences having substantial sequence identity with upstream and downstream sequences, respectively, of the targeted sites in the chromosomal sequence) or a non-homologous repair process (e.g., in embodiments in which the donor sequence is flanked by compatible overhangs).
- a homology-based repair process e.g., in embodiments in which the donor sequence is flanked by upstream and downstream sequences having substantial sequence identity with upstream and downstream sequences, respectively, of the targeted sites in the chromosomal sequence
- a non-homologous repair process e.g., in embodiments in which the donor sequence is flanked by compatible overhangs.
- the method comprises introducing into a cell or embryo at least one RNA-guided endonuclease comprising at least one nuclear localization signal or nucleic acid encoding at least one RNA-guided endonuclease comprising at least one nuclear localization signal.
- RNA-guided endonucleases and nucleic acids encoding RNA-guided endonucleases are described above in sections (I) and (III), respectively.
- the RNA-guided endonuclease can be introduced into the cell or embryo as an isolated protein. In such embodiments, the RNA-guided endonuclease can further comprise at least one cell-penetrating domain, which facilitates cellular uptake of the protein. In other embodiments, the RNA-guided endonuclease can be introduced into the cell or embryo as an mRNA molecule. In still other embodiments, the RNA-guided endonuclease can be introduced into the cell or embryo as a DNA molecule. In general, DNA sequence encoding the fusion protein is operably linked to a promoter sequence that will function in the cell or embryo of interest. The DNA sequence can be linear, or the DNA sequence can be part of a vector. In still other embodiments, the fusion protein can be introduced into the cell or embryo as an RNA-protein complex comprising the fusion protein and the guide RNA.
- DNA encoding the RNA-guided endonuclease can further comprise sequence encoding a guide RNA.
- each of the sequences encoding the RNA-guided endonuclease and the guide RNA is operably linked to appropriate promoter control sequence that allows expression of the RNA-guided endonuclease and the guide RNA, respectively, in the cell or embryo.
- the DNA sequence encoding the RNA-guided endonuclease and the guide RNA can further comprise additional expression control, regulatory, and/or processing sequence(s).
- the DNA sequence encoding the RNA-guided endonuclease and the guide RNA can be linear or can be part of a vector
- the method also comprises introducing into a cell or embryo at least one guide RNA or DNA encoding at least one guide RNA.
- a guide RNA interacts with the RNA-guided endonuclease to direct the endonuclease to a specific target site, at which site the 5′ end of the guide RNA base pairs with a specific protospacer sequence in the chromosomal sequence.
- Each guide RNA comprises three regions: a first region at the 5′ end that is complementary to the target site in the chromosomal sequence, a second internal region that forms a stem loop structure, and a third 3′ region that remains essentially single-stranded.
- the first region of each guide RNA is different such that each guide RNA guides a fusion protein to a specific target site.
- the second and third regions of each guide RNA can be the same in all guide RNAs.
- the first region of the guide RNA is complementary to sequence (i.e., protospacer sequence) at the target site in the chromosomal sequence such that the first region of the guide RNA can base pair with the target site.
- the first region of the guide RNA can comprise from about 10 nucleotides to more than about 25 nucleotides.
- the region of base pairing between the first region of the guide RNA and the target site in the chromosomal sequence can be about 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 22, 23, 24, 25, or more than 25 nucleotides in length.
- the first region of the guide RNA is about 19, 20, or 21 nucleotides in length.
- the guide RNA also comprises a second region that forms a secondary structure.
- the secondary structure comprises a stem (or hairpin) and a loop.
- the length of the loop and the stem can vary.
- the loop can range from about 3 to about 10 nucleotides in length
- the stem can range from about 6 to about 20 base pairs in length.
- the stem can comprise one or more bulges of 1 to about 10 nucleotides.
- the overall length of the second region can range from about 16 to about 60 nucleotides in length.
- the loop is about 4 nucleotides in length and the stem comprises about 12 base pairs.
- the guide RNA also comprises a third region at the 3′ end that remains essentially single-stranded.
- the third region has no complementarity to any chromosomal sequence in the cell of interest and has no complementarity to the rest of the guide RNA.
- the length of the third region can vary. In general, the third region is more than about 4 nucleotides in length. For example, the length of the third region can range from about 5 to about 60 nucleotides in length.
- the combined length of the second and third regions (also called the universal or scaffold region) of the guide RNA can range from about 30 to about 120 nucleotides in length. In one aspect, the combined length of the second and third regions of the guide RNA range from about 70 to about 100 nucleotides in length.
- the guide RNA comprises a single molecule comprising all three regions.
- the guide RNA can comprise two separate molecules.
- the first RNA molecule can comprise the first region of the guide RNA and one half of the “stem” of the second region of the guide RNA.
- the second RNA molecule can comprise the other half of the “stem” of the second region of the guide RNA and the third region of the guide RNA.
- the first and second RNA molecules each contain a sequence of nucleotides that are complementary to one another.
- the first and second RNA molecules each comprise a sequence (of about 6 to about 20 nucleotides) that base pairs to the other sequence to form a functional guide RNA.
- the guide RNA can be introduced into the cell or embryo as a RNA molecule.
- the RNA molecule can be transcribed in vitro.
- the RNA molecule can be chemically synthesized.
- the guide RNA can be introduced into the cell or embryo as a DNA molecule.
- the DNA encoding the guide RNA can be operably linked to promoter control sequence for expression of the guide RNA in the cell or embryo of interest.
- the RNA coding sequence can be operably linked to a promoter sequence that is recognized by RNA polymerase III (Pol III).
- Pol III RNA polymerase III
- suitable Pol III promoters include, but are not limited to, mammalian U6 or H1 promoters.
- the RNA coding sequence is linked to a mouse or human U6 promoter.
- the RNA coding sequence is linked to a mouse or human H1 promoter.
- the DNA molecule encoding the guide RNA can be linear or circular.
- the DNA sequence encoding the guide RNA can be part of a vector.
- Suitable vectors include plasmid vectors, phagemids, cosmids, artificial/mini-chromosomes, transposons, and viral vectors.
- the DNA encoding the RNA-guided endonuclease is present in a plasmid vector.
- suitable plasmid vectors include pUC, pBR322, pET, pBluescript, and variants thereof.
- the vector can comprise additional expression control sequences (e.g., enhancer sequences, Kozak sequences, polyadenylation sequences, transcriptional termination sequences, etc.), selectable marker sequences (e.g., antibiotic resistance genes), origins of replication, and the like.
- additional expression control sequences e.g., enhancer sequences, Kozak sequences, polyadenylation sequences, transcriptional termination sequences, etc.
- selectable marker sequences e.g., antibiotic resistance genes
- each can be part of a separate molecule (e.g., one vector containing fusion protein coding sequence and a second vector containing guide RNA coding sequence) or both can be part of the same molecule (e.g., one vector containing coding (and regulatory) sequence for both the fusion protein and the guide RNA).
- RNA-guided endonuclease in conjunction with a guide RNA is directed to a target site in the chromosomal sequence, wherein the RNA-guided endonuclease introduces a double-stranded break in the chromosomal sequence.
- the target site has no sequence limitation except that the sequence is immediately followed (downstream) by a consensus sequence.
- This consensus sequence is also known as a protospacer adjacent motif (PAM).
- PAM protospacer adjacent motif
- Examples of PAM include, but are not limited to, NGG, NGGNG, and NNAGAAW (wherein N is defined as any nucleotide and W is defined as either A or T).
- the first region (at the 5′ end) of the guide RNA is complementary to the protospacer of the target sequence.
- the first region of the guide RNA is about 19 to 21 nucleotides in length.
- the sequence of the target site in the chromosomal sequence is 5′-N 19-21 -NGG-3′.
- the PAM is in italics.
- the target site can be in the coding region of a gene, in an intron of a gene, in a control region of a gene, in a non-coding region between genes, etc.
- the gene can be a protein coding gene or an RNA coding gene.
- the gene can be any gene of interest.
- the method further comprises introducing at least one donor polynucleotide into the embryo.
- a donor polynucleotide comprises at least one donor sequence.
- a donor sequence of the donor polynucleotide corresponds to an endogenous or native chromosomal sequence.
- the donor sequence can be essentially identical to a portion of the chromosomal sequence at or near the targeted site, but which comprises at least one nucleotide change.
- the donor sequence can comprise a modified version of the wild type sequence at the targeted site such that, upon integration or exchange with the native sequence, the sequence at the targeted chromosomal location comprises at least one nucleotide change.
- the change can be an insertion of one or more nucleotides, a deletion of one or more nucleotides, a substitution of one or more nucleotides, or combinations thereof.
- the cell or embryo/animal can produce a modified gene product from the targeted chromosomal sequence.
- the donor sequence of the donor polynucleotide corresponds to an exogenous sequence.
- an “exogenous” sequence refers to a sequence that is not native to the cell or embryo, or a sequence whose native location in the genome of the cell or embryo is in a different location.
- the exogenous sequence can comprise protein coding sequence, which can be operably linked to an exogenous promoter control sequence such that, upon integration into the genome, the cell or embryo/animal is able to express the protein coded by the integrated sequence.
- the exogenous sequence can be integrated into the chromosomal sequence such that its expression is regulated by an endogenous promoter control sequence.
- the exogenous sequence can be a transcriptional control sequence, another expression control sequence, an RNA coding sequence, and so forth. Integration of an exogenous sequence into a chromosomal sequence is termed a “knock in.”
- the length of the donor sequence can and will vary.
- the donor sequence can vary in length from several nucleotides to hundreds of nucleotides to hundreds of thousands of nucleotides.
- the donor sequence in the donor polynucleotide is flanked by an upstream sequence and a downstream sequence, which have substantial sequence identity to sequences located upstream and downstream, respectively, of the targeted site in the chromosomal sequence. Because of these sequence similarities, the upstream and downstream sequences of the donor polynucleotide permit homologous recombination between the donor polynucleotide and the targeted chromosomal sequence such that the donor sequence can be integrated into (or exchanged with) the chromosomal sequence.
- the upstream sequence refers to a nucleic acid sequence that shares substantial sequence identity with a chromosomal sequence upstream of the targeted site.
- the downstream sequence refers to a nucleic acid sequence that shares substantial sequence identity with a chromosomal sequence downstream of the targeted site.
- the phrase “substantial sequence identity” refers to sequences having at least about 75% sequence identity.
- the upstream and downstream sequences in the donor polynucleotide can have about 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity with sequence upstream or downstream to the targeted site.
- the upstream and downstream sequences in the donor polynucleotide can have about 95% or 100% sequence identity with chromosomal sequences upstream or downstream to the targeted site.
- the upstream sequence shares substantial sequence identity with a chromosomal sequence located immediately upstream of the targeted site (i.e., adjacent to the targeted site). In other embodiments, the upstream sequence shares substantial sequence identity with a chromosomal sequence that is located within about one hundred (100) nucleotides upstream from the targeted site. Thus, for example, the upstream sequence can share substantial sequence identity with a chromosomal sequence that is located about 1 to about 20, about 21 to about 40, about 41 to about 60, about 61 to about 80, or about 81 to about 100 nucleotides upstream from the targeted site.
- the downstream sequence shares substantial sequence identity with a chromosomal sequence located immediately downstream of the targeted site (i.e., adjacent to the targeted site). In other embodiments, the downstream sequence shares substantial sequence identity with a chromosomal sequence that is located within about one hundred (100) nucleotides downstream from the targeted site. Thus, for example, the downstream sequence can share substantial sequence identity with a chromosomal sequence that is located about 1 to about 20, about 21 to about 40, about 41 to about 60, about 61 to about 80, or about 81 to about 100 nucleotides downstream from the targeted site.
- Each upstream or downstream sequence can range in length from about 20 nucleotides to about 5000 nucleotides.
- upstream and downstream sequences can comprise about 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2100, 2200, 2300, 2400, 2500, 2600, 2800, 3000, 3200, 3400, 3600, 3800, 4000, 4200, 4400, 4600, 4800, or 5000 nucleotides.
- upstream and downstream sequences can range in length from about 50 to about 1500 nucleotides.
- Donor polynucleotides comprising the upstream and downstream sequences with sequence similarity to the targeted chromosomal sequence can be linear or circular.
- the donor polynucleotide can be part of a vector.
- the vector can be a plasmid vector.
- the donor polynucleotide can additionally comprise at least one targeted cleavage site that is recognized by the RNA-guided endonuclease.
- the targeted cleavage site added to the donor polynucleotide can be placed upstream or downstream or both upstream and downstream of the donor sequence.
- the donor sequence can be flanked by targeted cleavage sites such that, upon cleavage by the RNA-guided endonuclease, the donor sequence is flanked by overhangs that are compatible with those in the chromosomal sequence generated upon cleavage by the RNA-guided endonuclease.
- the donor sequence can be ligated with the cleaved chromosomal sequence during repair of the double stranded break by a non-homologous repair process.
- donor polynucleotides comprising the targeted cleavage site(s) will be circular (e.g., can be part of a plasmid vector).
- Donor Polynucleotide Comprising a Short Donor Sequence with Optional Overhangs.
- the donor polynucleotide can be a linear molecule comprising a short donor sequence with optional short overhangs that are compatible with the overhangs generated by the RNA-guided endonuclease.
- the donor sequence can be ligated directly with the cleaved chromosomal sequence during repair of the double-stranded break.
- the donor sequence can be less than about 1,000, less than about 500, less than about 250, or less than about 100 nucleotides.
- the donor polynucleotide can be a linear molecule comprising a short donor sequence with blunt ends.
- the donor polynucleotide can be a linear molecule comprising a short donor sequence with 5′ and/or 3′ overhangs.
- the overhangs can comprise 1, 2, 3, 4, or 5 nucleotides.
- the donor polynucleotide will be DNA.
- the DNA may be single-stranded or double-stranded and/or linear or circular.
- the donor polynucleotide may be a DNA plasmid, a bacterial artificial chromosome (BAC), a yeast artificial chromosome (YAC), a viral vector, a linear piece of DNA, a PCR fragment, a naked nucleic acid, or a nucleic acid complexed with a delivery vehicle such as a liposome or poloxamer.
- the donor polynucleotide comprising the donor sequence can be part of a plasmid vector. In any of these situations, the donor polynucleotide comprising the donor sequence can further comprise at least one additional sequence.
- RNA-targeted endonuclease(s) (or encoding nucleic acid), the guide RNA(s) (or encoding DNA), and the optional donor polynucleotide(s) can be introduced into a cell or embryo by a variety of means. In some embodiments, the cell or embryo is transfected.
- Suitable transfection methods include calcium phosphate-mediated transfection, nucleofection (or electroporation), cationic polymer transfection (e.g., DEAE-dextran or polyethylenimine), viral transduction, virosome transfection, virion transfection, liposome transfection, cationic liposome transfection, immunoliposome transfection, nonliposomal lipid transfection, dendrimer transfection, heat shock transfection, magnetofection, lipofection, gene gun delivery, impalefection, sonoporation, optical transfection, and proprietary agent-enhanced uptake of nucleic acids.
- nucleofection or electroporation
- cationic polymer transfection e.g., DEAE-dextran or polyethylenimine
- viral transduction virosome transfection, virion transfection, liposome transfection, cationic liposome transfection, immunoliposome transfection, nonliposomal lipid transfection, dendrimer transfection, heat shock trans
- the molecules are introduced into the cell or embryo by microinjection.
- the embryo is a fertilized one-cell stage embryo of the species of interest.
- the molecules can be injected into the pronuclei of one cell embryos.
- RNA-targeted endonuclease(s) (or encoding nucleic acid), the guide RNA(s) (or DNAs encoding the guide RNA), and the optional donor polynucleotide(s) can be introduced into the cell or embryo simultaneously or sequentially.
- the ratio of the RNA-targeted endonuclease(s) (or encoding nucleic acid) to the guide RNA(s) (or encoding DNA) generally will be about stoichiometric such that they can form an RNA-protein complex.
- DNA encoding an RNA-targeted endonuclease and DNA encoding a guide RNA are delivered together within the plasmid vector.
- the method further comprises maintaining the cell or embryo under appropriate conditions such that the guide RNA(s) directs the RNA-guided endonuclease(s) to the targeted site(s) in the chromosomal sequence, and the RNA-guided endonuclease(s) introduce at least one double-stranded break in the chromosomal sequence.
- a double-stranded break can be repaired by a DNA repair process such that the chromosomal sequence is modified by a deletion of at least one nucleotide, an insertion of at least one nucleotide, a substitution of at least one nucleotide, or a combination thereof.
- the double-stranded break can be repaired via a non-homologous end-joining (NHEJ) repair process.
- NHEJ non-homologous end-joining
- sequence at the chromosomal sequence can be modified such that the reading frame of a coding region can be shifted and that the chromosomal sequence is inactivated or “knocked out.”
- An inactivated protein-coding chromosomal sequence does not give rise to the protein coded by the wild type chromosomal sequence.
- the double-stranded break can be repaired by a homology-directed repair (HDR) process such that the donor sequence is integrated into the chromosomal sequence.
- HDR homology-directed repair
- an exogenous sequence can be integrated into the genome of the cell or embryo, or the targeted chromosomal sequence can be modified by exchange of a modified sequence for the wild type chromosomal sequence.
- the RNA-guided endonuclease can cleave both the targeted chromosomal sequence and the donor polynucleotide.
- the linearized donor polynucleotide can be integrated into the chromosomal sequence at the site of the double-stranded break by ligation between the donor polynucleotide and the cleaved chromosomal sequence via a NHEJ process.
- the short donor sequence can be integrated into the chromosomal sequence at the site of the double-stranded break via a NHEJ process.
- the integration can proceed via the ligation of blunt ends between the short donor sequence and the chromosomal sequence at the site of the double stranded break.
- the integration can proceed via the ligation of sticky ends (i.e., having 5′ or 3′ overhangs) between a short donor sequence that is flanked by overhangs that are compatible with those generated by the RNA-targeting endonuclease in the cleaved chromosomal sequence.
- the cell is maintained under conditions appropriate for cell growth and/or maintenance. Suitable cell culture conditions are well known in the art and are described, for example, in Santiago et al. (2008) PNAS 105:5809-5814; Moehle et al. (2007) PNAS 104:3055-3060; Urnov et al. (2005) Nature 435:646-651; and Lombardo et al (2007) Nat. Biotechnology 25:1298-1306. Those of skill in the art appreciate that methods for culturing cells are known in the art and can and will vary depending on the cell type. Routine optimization may be used, in all cases, to determine the best techniques for a particular cell type.
- An embryo can be cultured in vitro (e.g., in cell culture). Typically, the embryo is cultured at an appropriate temperature and in appropriate media with the necessary O 2 /CO 2 ratio to allow the expression of the RNA endonuclease and guide RNA, if necessary. Suitable non-limiting examples of media include M2, M16, KSOM, BMOC, and HTF media. A skilled artisan will appreciate that culture conditions can and will vary depending on the species of embryo. Routine optimization may be used, in all cases, to determine the best culture conditions for a particular species of embryo. In some cases, a cell line may be derived from an in vitro-cultured embryo (e.g., an embryonic stem cell line).
- an embryo may be cultured in vivo by transferring the embryo into the uterus of a female host.
- the female host is from the same or similar species as the embryo.
- the female host is pseudo-pregnant.
- Methods of preparing pseudo-pregnant female hosts are known in the art.
- methods of transferring an embryo into a female host are known. Culturing an embryo in vivo permits the embryo to develop and can result in a live birth of an animal derived from the embryo. Such an animal would comprise the modified chromosomal sequence in every cell of the body.
- the cell can be a human cell, a non-human mammalian cell, a non-mammalian vertebrate cell, an invertebrate cell, an insect cell, a plant cell, a yeast cell, or a single cell eukaryotic organism.
- the embryo is non-human mammalian embryo.
- the embryos can be a one cell non-human mammalian embryo.
- Exemplary mammalian embryos, including one cell embryos include without limit mouse, rat, hamster, rodent, rabbit, feline, canine, ovine, porcine, bovine, equine, and primate embryos.
- the cell can be a stem cell.
- Suitable stem cells include without limit embryonic stem cells, ES-like stem cells, fetal stem cells, adult stem cells, pluripotent stem cells, induced pluripotent stem cells, multipotent stem cells, oligopotent stem cells, unipotent stem cells and others.
- the cell is a mammalian cell.
- Non-limiting examples of suitable mammalian cells include Chinese hamster ovary (CHO) cells, baby hamster kidney (BHK) cells; mouse myeloma NS0 cells, mouse embryonic fibroblast 3T3 cells (NIH3T3), mouse B lymphoma A20 cells; mouse melanoma B16 cells; mouse myoblast C2C12 cells; mouse myeloma SP2/0 cells; mouse embryonic mesenchymal C3H-10T1/2 cells; mouse carcinoma CT26 cells, mouse prostate DuCuP cells; mouse breast EMT6 cells; mouse hepatoma Hepa1c1c7 cells; mouse myeloma J5582 cells; mouse epithelial MTD-1A cells; mouse myocardial MyEnd cells; mouse renal RenCa cells; mouse pancreatic RIN-5F cells; mouse melanoma X64 cells; mouse lymphoma YAC-1 cells; rat glioblastoma 9 L cells; rat B lymphoma RBL cells;
- Another aspect of the present disclosure encompasses a method for modifying a chromosomal sequence or regulating expression of a chromosomal sequence in a cell or embryo.
- the method comprises introducing into the cell or embryo (a) at least one fusion protein or nucleic acid encoding at least one fusion protein, wherein the fusion protein comprises a CRISPR/Cas-like protein or a fragment thereof and an effector domain, and (b) at least one guide RNA or DNA encoding the guide RNA, wherein the guide RNA guides the CRISPR/Cas-like protein of the fusion protein to a targeted site in the chromosomal sequence and the effector domain of the fusion protein modifies the chromosomal sequence or regulates expression of the chromosomal sequence.
- Fusion proteins comprising a CRISPR/Cas-like protein or a fragment thereof and an effector domain are detailed above in section (II).
- the fusion proteins disclosed herein further comprise at least one nuclear localization signal.
- Nucleic acids encoding fusion proteins are described above in section (III).
- the fusion protein can be introduced into the cell or embryo as an isolated protein (which can further comprise a cell-penetrating domain).
- the isolated fusion protein can be part of a protein-RNA complex comprising the guide RNA.
- the fusion protein can be introduced into the cell or embryo as a RNA molecule (which can be capped and/or polyadenylated).
- the fusion protein can be introduced into the cell or embryo as a DNA molecule.
- the fusion protein and the guide RNA can be introduced into the cell or embryo as discrete DNA molecules or as part of the same DNA molecule.
- DNA molecules can be plasmid vectors.
- the method further comprises introducing into the cell or embryo at least one zinc finger nuclease.
- Zinc finger nucleases are described above in section (II)(d).
- the method further comprises introducing into the cell or embryo at least one donor polynucleotide. Donor polynucleotides are detailed above in section (IV)(d). Means for introducing molecules into cells or embryos, as well as means for culturing cell or embryos are described above in sections (IV)(e) and (IV)(f), respectively. Suitable cells and embryos are described above in section (IV)(g).
- the method can comprise introducing into the cell or embryo one fusion protein (or nucleic acid encoding one fusion protein) and two guide RNAs (or DNA encoding two guide RNAs).
- the two guide RNAs direct the fusion protein to two different target sites in the chromosomal sequence, wherein the fusion protein dimerizes (e.g., form a homodimer) such that the two cleavage domains can introduce a double stranded break into the chromosomal sequence. See FIG. 1A .
- the double-stranded break in the chromosomal sequence can be repaired by a non-homologous end-joining (NHEJ) repair process.
- NHEJ non-homologous end-joining
- a single nucleotide change can give rise to an altered protein product, or a shift in the reading frame of a coding sequence can inactivate or “knock out” the sequence such that no protein product is made.
- the donor sequence in the donor polynucleotide can be exchanged with or integrated into the chromosomal sequence at the targeted site during repair of the double-stranded break.
- the donor sequence in embodiments in which the donor sequence is flanked by upstream and downstream sequences having substantial sequence identity with upstream and downstream sequences, respectively, of the targeted site in the chromosomal sequence, the donor sequence can be exchanged with or integrated into the chromosomal sequence at the targeted site during repair mediated by homology-directed repair process.
- the donor sequence in embodiments in which the donor sequence is flanked by compatible overhangs (or the compatible overhangs are generated in situ by the RNA-guided endonuclease) the donor sequence can be ligated directly with the cleaved chromosomal sequence by a non-homologous repair process during repair of the double-stranded break.
- Exchange or integration of the donor sequence into the chromosomal sequence modifies the targeted chromosomal sequence or introduces an exogenous sequence into the chromosomal sequence of the cell or embryo.
- the method can comprise introducing into the cell or embryo two different fusion proteins (or nucleic acid encoding two different fusion proteins) and two guide RNAs (or DNA encoding two guide RNAs).
- the fusion proteins can differ as detailed above in section (II).
- Each guide RNA directs a fusion protein to a specific target site in the chromosomal sequence, wherein the fusion proteins dimerize (e.g., form a heterodimer) such that the two cleavage domains can introduce a double stranded break into the chromosomal sequence.
- the resultant double-stranded breaks can be repaired by a non-homologous repair process such that deletions of at least one nucleotide, insertions of at least one nucleotide, substitutions of at least one nucleotide, or combinations thereof can occur during the repair of the break.
- the donor sequence in the donor polynucleotide can be exchanged with or integrated into the chromosomal sequence during repair of the double-stranded break by either a homology-based repair process (e.g., in embodiments in which the donor sequence is flanked by upstream and downstream sequences having substantial sequence identity with upstream and downstream sequences, respectively, of the targeted sites in the chromosomal sequence) or a non-homologous repair process (e.g., in embodiments in which the donor sequence is flanked by compatible overhangs).
- a homology-based repair process e.g., in embodiments in which the donor sequence is flanked by upstream and downstream sequences having substantial sequence identity with upstream and downstream sequences, respectively, of the targeted sites in the chromosomal sequence
- a non-homologous repair process e.g., in embodiments in which the donor sequence is flanked by compatible overhangs.
- the method can comprise introducing into the cell or embryo one fusion protein (or nucleic acid encoding one fusion protein), one guide RNA (or DNA encoding one guide RNA), and one zinc finger nuclease (or nucleic acid encoding the zinc finger nuclease), wherein the zinc finger nuclease comprises a FokI cleavage domain or a modified FokI cleavage domain.
- one fusion protein or nucleic acid encoding one fusion protein
- one guide RNA or DNA encoding one guide RNA
- zinc finger nuclease or nucleic acid encoding the zinc finger nuclease
- the guide RNA directs the fusion protein to a specific chromosomal sequence, and the zinc finger nuclease is directed to another chromosomal sequence, wherein the fusion protein and the zinc finger nuclease dimerize such that the cleavage domain of the fusion protein and the cleavage domain of the zinc finger nuclease can introduce a double stranded break into the chromosomal sequence. See FIG. 1B .
- the resultant double-stranded breaks can be repaired by a non-homologous repair process such that deletions of at least one nucleotide, insertions of at least one nucleotide, substitutions of at least one nucleotide, or combinations thereof can occur during the repair of the break.
- the donor sequence in the donor polynucleotide can be exchanged with or integrated into the chromosomal sequence during repair of the double-stranded break by either a homology-based repair process (e.g., in embodiments in which the donor sequence is flanked by upstream and downstream sequences having substantial sequence identity with upstream and downstream sequences, respectively, of the targeted sites in the chromosomal sequence) or a non-homologous repair process (e.g., in embodiments in which the donor sequence is flanked by compatible overhangs).
- a homology-based repair process e.g., in embodiments in which the donor sequence is flanked by upstream and downstream sequences having substantial sequence identity with upstream and downstream sequences, respectively, of the targeted sites in the chromosomal sequence
- a non-homologous repair process e.g., in embodiments in which the donor sequence is flanked by compatible overhangs.
- the method can comprise introducing into the cell or embryo one fusion protein (or nucleic acid encoding one fusion protein) and one guide RNA (or DNA encoding one guide RNA).
- the guide RNA directs the fusion protein to a specific chromosomal sequence, wherein the transcriptional activation domain or a transcriptional repressor domain activates or represses expression, respectively, of the targeted chromosomal sequence. See FIG. 2A .
- the method can comprise introducing into the cell or embryo one fusion protein (or nucleic acid encoding one fusion protein) and one guide RNA (or DNA encoding one guide RNA).
- the guide RNA directs the fusion protein to a specific chromosomal sequence, wherein the epigenetic modification domain modifies the structure of the targeted the chromosomal sequence. See FIG. 2A .
- Epigenetic modifications include acetylation, methylation of histone proteins and/or nucleotide methylation.
- structural modification of the chromosomal sequence leads to changes in expression of the chromosomal sequence.
- the present disclosure encompasses genetically modified cells, non-human embryos, and non-human animals comprising at least one chromosomal sequence that has been modified using an RNA-guided endonuclease-mediated or fusion protein-mediated process, for example, using the methods described herein.
- the disclosure provides cells comprising at least one DNA or RNA molecule encoding an RNA-guided endonuclease or fusion protein targeted to a chromosomal sequence of interest or a fusion protein, at least one guide RNA, and optionally one or more donor polynucleotide(s).
- the disclosure also provides non-human embryos comprising at least one DNA or RNA molecule encoding an RNA-guided endonuclease or fusion protein targeted to a chromosomal sequence of interest, at least one guide RNA, and optionally one or more donor polynucleotide(s).
- the present disclosure provides genetically modified non-human animals, non-human embryos, or animal cells comprising at least one modified chromosomal sequence.
- the modified chromosomal sequence may be modified such that it is (1) inactivated, (2) has an altered expression or produces an altered protein product, or (3) comprises an integrated sequence.
- the chromosomal sequence is modified with an RNA guided endonuclease-mediated or fusion protein-mediated process, using the methods described herein.
- one aspect of the present disclosure provides a genetically modified animal in which at least one chromosomal sequence has been modified.
- the genetically modified animal comprises at least one inactivated chromosomal sequence.
- the modified chromosomal sequence may be inactivated such that the sequence is not transcribed and/or a functional protein product is not produced.
- a genetically modified animal comprising an inactivated chromosomal sequence may be termed a “knock out” or a “conditional knock out.”
- the inactivated chromosomal sequence can include a deletion mutation (i.e., deletion of one or more nucleotides), an insertion mutation (i.e., insertion of one or more nucleotides), or a nonsense mutation (i.e., substitution of a single nucleotide for another nucleotide such that a stop codon is introduced).
- a deletion mutation i.e., deletion of one or more nucleotides
- an insertion mutation i.e., insertion of one or more nucleotides
- a nonsense mutation i.e., substitution of a single nucleotide for another nucleotide such that a stop codon is introduced.
- the inactivated chromosomal sequence comprises no exogenously introduced sequence.
- genetically modified animals in which two, three, four, five
- the modified chromosomal sequence can be altered such that it codes for a variant protein product.
- a genetically modified animal comprising a modified chromosomal sequence can comprise a targeted point mutation(s) or other modification such that an altered protein product is produced.
- the chromosomal sequence can be modified such that at least one nucleotide is changed and the expressed protein comprises one changed amino acid residue (missense mutation).
- the chromosomal sequence can be modified to comprise more than one missense mutation such that more than one amino acid is changed.
- the chromosomal sequence can be modified to have a three nucleotide deletion or insertion such that the expressed protein comprises a single amino acid deletion or insertion.
- the altered or variant protein can have altered properties or activities compared to the wild type protein, such as altered substrate specificity, altered enzyme activity, altered kinetic rates, etc.
- the genetically modified animal can comprise at least one chromosomally integrated sequence.
- a genetically modified animal comprising an integrated sequence may be termed a “knock in” or a “conditional knock in.”
- the chromosomally integrated sequence can, for example, encode an orthologous protein, an endogenous protein, or combinations of both.
- a sequence encoding an orthologous protein or an endogenous protein can be integrated into a chromosomal sequence encoding a protein such that the chromosomal sequence is inactivated, but the exogenous sequence is expressed.
- the sequence encoding the orthologous protein or endogenous protein may be operably linked to a promoter control sequence.
- a sequence encoding an orthologous protein or an endogenous protein may be integrated into a chromosomal sequence without affecting expression of a chromosomal sequence.
- a sequence encoding a protein can be integrated into a “safe harbor” locus, such as the Rosa26 locus, HPRT locus, or AAV locus.
- the present disclosure also encompasses genetically modified animals in which two, three, four, five, six, seven, eight, nine, or ten or more sequences, including sequences encoding protein(s), are integrated into the genome.
- the chromosomally integrated sequence encoding a protein can encode the wild type form of a protein of interest or can encode a protein comprising at least one modification such that an altered version of the protein is produced.
- a chromosomally integrated sequence encoding a protein related to a disease or disorder can comprise at least one modification such that the altered version of the protein produced causes or potentiates the associated disorder.
- the chromosomally integrated sequence encoding a protein related to a disease or disorder can comprise at least one modification such that the altered version of the protein protects against the development of the associated disorder.
- the genetically modified animal can be a “humanized” animal comprising at least one chromosomally integrated sequence encoding a functional human protein.
- the functional human protein can have no corresponding ortholog in the genetically modified animal.
- the wild type animal from which the genetically modified animal is derived may comprise an ortholog corresponding to the functional human protein.
- the orthologous sequence in the “humanized” animal is inactivated such that no functional protein is made and the “humanized” animal comprises at least one chromosomally integrated sequence encoding the human protein.
- the genetically modified animal can comprise at least one modified chromosomal sequence encoding a protein such that the expression pattern of the protein is altered.
- regulatory regions controlling the expression of the protein such as a promoter or a transcription factor binding site, can be altered such that the protein is over-produced, or the tissue-specific or temporal expression of the protein is altered, or a combination thereof.
- the expression pattern of the protein can be altered using a conditional knockout system.
- a non-limiting example of a conditional knockout system includes a Cre-lox recombination system.
- a Cre-lox recombination system comprises a Cre recombinase enzyme, a site-specific DNA recombinase that can catalyze the recombination of a nucleic acid sequence between specific sites (lox sites) in a nucleic acid molecule.
- Methods of using this system to produce temporal and tissue specific expression are known in the art.
- a genetically modified animal is generated with lox sites flanking a chromosomal sequence.
- the genetically modified animal comprising the lox-flanked chromosomal sequence can then be crossed with another genetically modified animal expressing Cre recombinase.
- Progeny animals comprising the lox-flanked chromosomal sequence and the Cre recombinase are then produced, and the lox-flanked chromosomal sequence is recombined, leading to deletion or inversion of the chromosomal sequence encoding the protein.
- Expression of Cre recombinase can be temporally and conditionally regulated to effect temporally and conditionally regulated recombination of the chromosomal sequence.
- the genetically modified animal disclosed herein can be heterozygous for the modified chromosomal sequence.
- the genetically modified animal can be homozygous for the modified chromosomal sequence.
- the genetically modified animals disclosed herein can be crossbred to create animals comprising more than one modified chromosomal sequence or to create animals that are homozygous for one or more modified chromosomal sequences.
- two animals comprising the same modified chromosomal sequence can be crossbred to create an animal homozygous for the modified chromosomal sequence.
- animals with different modified chromosomal sequences can be crossbred to create an animal comprising both modified chromosomal sequences.
- a first animal comprising an inactivated chromosomal sequence gene “x” can be crossed with a second animal comprising a chromosomally integrated sequence encoding a human gene “X” protein to give rise to “humanized” gene “X” offspring comprising both the inactivated gene “x” chromosomal sequence and the chromosomally integrated human gene “X” sequence.
- a humanized gene “X” animal can be crossed with a humanized gene “Y” animal to create humanized gene X/gene Y offspring.
- an animal comprising a modified chromosomal sequence can be crossbred to combine the modified chromosomal sequence with other genetic backgrounds.
- other genetic backgrounds may include wild-type genetic backgrounds, genetic backgrounds with deletion mutations, genetic backgrounds with another targeted integration, and genetic backgrounds with non-targeted integrations.
- animal refers to a non-human animal.
- the animal may be an embryo, a juvenile, or an adult.
- Suitable animals include vertebrates such as mammals, birds, reptiles, amphibians, shellfish, and fish. Examples of suitable mammals include without limit rodents, companion animals, livestock, and primates.
- rodents include mice, rats, hamsters, gerbils, and guinea pigs.
- Suitable companion animals include but are not limited to cats, dogs, rabbits, hedgehogs, and ferrets.
- livestock include horses, goats, sheep, swine, cattle, llamas, and alpacas.
- Suitable primates include but are not limited to capuchin monkeys, chimpanzees, lemurs, macaques, marmosets, tamarins, spider monkeys, squirrel monkeys, and vervet monkeys.
- Non-limiting examples of birds include chickens, turkeys, ducks, and geese.
- the animal may be an invertebrate such as an insect, a nematode, and the like.
- Non-limiting examples of insects include Drosophila and mosquitoes.
- An exemplary animal is a rat.
- suitable rat strains include Dahl Salt-Sensitive, Fischer 344, Lewis, Long Evans Hooded, Sprague-Dawley, and Wistar.
- the animal is not a genetically modified mouse. In each of the foregoing iterations of suitable animals for the invention, the animal does not include exogenously introduced, randomly integrated transposon sequences.
- a further aspect of the present disclosure provides genetically modified cells or cell lines comprising at least one modified chromosomal sequence.
- the genetically modified cell or cell line can be derived from any of the genetically modified animals disclosed herein.
- the chromosomal sequence can be modified in a cell as described herein above (in the paragraphs describing chromosomal sequence modifications in animals) using the methods descried herein.
- the disclosure also encompasses a lysate of said cells or cell lines.
- the cells are eukaryotic cells.
- Suitable host cells include fungi or yeast, such as Pichia, Saccharomyces , or Schizosaccharomyces ; insect cells, such as SF9 cells from Spodoptera frugiperda or S2 cells from Drosophila melanogaster ; and animal cells, such as mouse, rat, hamster, non-human primate, or human cells.
- Exemplary cells are mammalian.
- the mammalian cells can be primary cells. In general, any primary cell that is sensitive to double strand breaks may be used.
- the cells may be of a variety of cell types, e.g., fibroblast, myoblast, T or B cell, macrophage, epithelial cell, and so forth.
- the cell line can be any established cell line or a primary cell line that is not yet described.
- the cell line can be adherent or non-adherent, or the cell line can be grown under conditions that encourage adherent, non-adherent or organotypic growth using standard techniques known to individuals skilled in the art.
- suitable mammalian cells and cell lines are provided herein in section (IV)(g).
- the cell can be a stem cell.
- suitable stem cells are provided in section (IV)(g).
- the present disclosure also provides a genetically modified non-human embryo comprising at least one modified chromosomal sequence.
- the chromosomal sequence can be modified in an embryo as described herein above (in the paragraphs describing chromosomal sequence modifications in animals) using the methods descried herein.
- the embryo is a non-human fertilized one-cell stage embryo of the animal species of interest.
- Exemplary mammalian embryos, including one cell embryos include without limit, mouse, rat, hamster, rodent, rabbit, feline, canine, ovine, porcine, bovine, equine, and primate embryos.
- endogenous sequence refers to a chromosomal sequence that is native to the cell.
- exogenous refers to a sequence that is not native to the cell, or a chromosomal sequence whose native location in the genome of the cell is in a different chromosomal location.
- a “gene,” as used herein, refers to a DNA region (including exons and introns) encoding a gene product, as well as all DNA regions which regulate the production of the gene product, whether or not such regulatory sequences are adjacent to coding and/or transcribed sequences. Accordingly, a gene includes, but is not necessarily limited to, promoter sequences, terminators, translational regulatory sequences such as ribosome binding sites and internal ribosome entry sites, enhancers, silencers, insulators, boundary elements, replication origins, matrix attachment sites, and locus control regions.
- heterologous refers to an entity that is not endogenous or native to the cell of interest.
- a heterologous protein refers to a protein that is derived from or was originally derived from an exogenous source, such as an exogenously introduced nucleic acid sequence. In some instances, the heterologous protein is not normally produced by the cell of interest.
- nucleic acid and “polynucleotide” refer to a deoxyribonucleotide or ribonucleotide polymer, in linear or circular conformation, and in either single- or double-stranded form. For the purposes of the present disclosure, these terms are not to be construed as limiting with respect to the length of a polymer.
- the terms can encompass known analogs of natural nucleotides, as well as nucleotides that are modified in the base, sugar and/or phosphate moieties (e.g., phosphorothioate backbones). In general, an analog of a particular nucleotide has the same base-pairing specificity; i.e., an analog of A will base-pair with T.
- nucleotide refers to deoxyribonucleotides or ribonucleotides.
- the nucleotides may be standard nucleotides (i.e., adenosine, guanosine, cytidine, thymidine, and uridine) or nucleotide analogs.
- a nucleotide analog refers to a nucleotide having a modified purine or pyrimidine base or a modified ribose moiety.
- a nucleotide analog may be a naturally occurring nucleotide (e.g., inosine) or a non-naturally occurring nucleotide.
- Non-limiting examples of modifications on the sugar or base moieties of a nucleotide include the addition (or removal) of acetyl groups, amino groups, carboxyl groups, carboxymethyl groups, hydroxyl groups, methyl groups, phosphoryl groups, and thiol groups, as well as the substitution of the carbon and nitrogen atoms of the bases with other atoms (e.g., 7-deaza purines).
- Nucleotide analogs also include dideoxy nucleotides, 2′-O-methyl nucleotides, locked nucleic acids (LNA), peptide nucleic acids (PNA), and morpholinos.
- polypeptide and “protein” are used interchangeably to refer to a polymer of amino acid residues.
- nucleic acid and amino acid sequence identity are known in the art. Typically, such techniques include determining the nucleotide sequence of the mRNA for a gene and/or determining the amino acid sequence encoded thereby, and comparing these sequences to a second nucleotide or amino acid sequence. Genomic sequences can also be determined and compared in this fashion. In general, identity refers to an exact nucleotide-to-nucleotide or amino acid-to-amino acid correspondence of two polynucleotides or polypeptide sequences, respectively. Two or more sequences (polynucleotide or amino acid) can be compared by determining their percent identity.
- the percent identity of two sequences is the number of exact matches between two aligned sequences divided by the length of the shorter sequences and multiplied by 100.
- An approximate alignment for nucleic acid sequences is provided by the local homology algorithm of Smith and Waterman, Advances in Applied Mathematics 2:482-489 (1981). This algorithm can be applied to amino acid sequences by using the scoring matrix developed by Dayhoff, Atlas of Protein Sequences and Structure, M. O. Dayhoff ed., 5 suppl. 3:353-358, National Biomedical Research Foundation, Washington, D.C., USA, and normalized by Gribskov, Nucl. Acids Res. 14(6):6745-6763 (1986).
- a Cas9 gene from Streptococcus pyogenes strain MGAS15252 was optimized with Homo sapiens codon preference to enhance its translation in mammalian cells.
- the Cas9 gene also was modified by adding a nuclear localization signal PKKKRKV (SEQ ID NO:1) at the C terminus for targeting the protein into the nuclei of mammalian cells.
- Table 1 presents the modified Cas9 amino acid sequence, with the nuclear localization sequence underlined.
- Table 2 presents the codon optimized, modified Cas9 DNA sequence.
- the modified Cas9 DNA sequence was placed under the control of cytomegalovirus (CMV) promoter for constituent expression in mammalian cells.
- CMV cytomegalovirus
- the modified Cas9 DNA sequence was also placed under the control T7 promoter for in vitro mRNA synthesis with T7 RNA polymerase.
- In vitro RNA transcription was performed by using MessageMAX T7 ARCA-Capped Message Transcription Kit and T7 mScript Standard mRNA Production System (Cellscript).
- the adeno-associated virus integration site 1 (AAVS1) locus was used as a target for Cas9-mediated human genome modification.
- the human AAVS1 locus is located in intron 1 (4427 bp) of protein phosphatase 1, regulatory subunit 12C (PPP1R12C).
- PPP1R12C protein phosphatase 1, regulatory subunit 12C
- Table 3 presents the first exon (shaded gray) and the first intron of PPP1R12C.
- the underlined sequence within the intron is the targeted modification site (i.e., AAVS1 locus).
- Cas9 guide RNAs were designed for targeting the human AAVS1 locus.
- a 42 nucleotide RNA (referred to herein as a “crRNA” sequence) comprising (5′ to 3′) a target recognition sequence (i.e., sequence complementary to the non-coding strand of the target sequence) and protospacer sequence; a 85 nucleotide RNA (referred to herein as a “tracrRNA” sequence) comprising 5′ sequence with complementarity to the 3′ sequence of the crRNA and additional hairpin sequence; and a chimeric RNA comprising nucleotides 1-32 of the crRNA, a GAAA loop, and nucleotides 19-45 of the tracrRNA were prepared.
- the crRNA was chemically synthesized by Sigma-Aldrich.
- the tracrRNA and chimeric RNA were synthesized by in vitro transcription with T7 RNA polymerase using T7-Scribe Standard RNA IVT Kit (Cellscript).
- the chimeric RNA coding sequence was also placed under the control of human U6 promoter for in vivo transcription in human cells.
- Table 4 presents the sequences of the guide RNAs.
- RNA 5′-3′ Sequence NO: AAVS1- ACCCCACAGUGGGGCCACUAGUUUUAGAG 12 crRNA CUAUGCUGUUUUG tracrRNA GGAACCAUUCAAAACAGCAUAGCAAGUUA 13 AAAUAAGGCUAGUCCGUUAUCAACUUGAA AAAGUGGCACCGAGUCGGUGCUUUUUU chimeric ACCCCACAGUGGGGCCACUAGUUUUAGAG 14 RNA CUAGAAAUAGCAAGUUAAAAUAAGGCUAG UCCG
- AAVS1-GFP DNA donor contained a 5′ (1185 bp) AAVS1 locus homologous arm, an RNA splicing receptor, a turbo GFP coding sequence, a 3′ transcription terminator, and a 3′ (1217 bp) AAVS1 locus homologous arm.
- Table 5 presents the sequences of the RNA splicing receptor and the GFP coding sequence followed by the 3′ transcription terminator.
- Plasmid DNA was prepared by using GenElute Endotoxin-Free Plasmid Maxiprep Kit (Sigma).
- Targeted gene integration will result in a fusion protein between the first 107 amino acids of the PPP1R12C and the turbo GFP.
- the expected fusion protein contains the first 107 amino acid residues of PPP1R12C (highlighted in grey) from RNA splicing between the first exon of PPP1R12C and the engineered splice receptor (see Table 6).
- the K562 cell line was obtained from American Type Culture Collection (ATCC) and grown in Iscove's Modified Dulbecco's Medium, supplemented with 10% FBS and 2 mM L-glutamine. All media and supplements were obtained from Sigma-Aldrich. Cultures were split one day before transfection (at approximately 0.5 million cells per mL before transfection). Cells were transfected with Nucleofector Solution V (Lonza) on a Nucleofector (Lonza) with the T-016 program. Each nucleofection contained approximately 0.6 million cells. Transfection treatments are detailed in Table 7. Cells were grown at 37° C. and 5% CO 2 immediately after nucleofection.
- Fluorescence-activated cell sorting was performed 4 days after transfection. FACS data are presented in FIG. 4 .
- the percent GFP detected in each of the four experimental treatments was greater than in the control treatments (E, F), confirming integration of the donor sequence and expression of the fusion protein.
- Genomic DNA was extracted from transfected cells with GenElute Mammalian Genomic DNA Miniprep Kit (Sigma) 12 days after transfection. Genomic DNA was then PCR amplified with a forward primer located outside the 5′ homologous arm of the AAVS1-GFP plasmid donor and a reverse primer located at the 5′ region of the GFP.
- the forward primer was 5′-CCACTCTGTGCTGACCACTCT-3′ (SEQ ID NO:18) and reverse primer was 5′-GCGGCACTCGATCTCCA-3′ (SEQ ID NO:19).
- the expected fragment size from the junction PCR was 1388 bp.
- the amplification was carried out with JumpStart Taq ReadyMix (Sigma), using the following cycling conditions: 98° C.
- PCR products were resolved on 1% agarose gel.
- the mouse Rosa26 locus can be targeted for genome modifications.
- Table 8 presents a portion of the mouse Rosa26 sequence in which potential target sites are shown in bold. Each target site comprises a protospacer.
- RNAs were designed to target each of the target sites in the mouse Rosa26 locus.
- the sequences are shown in Table 9, each is 42 nucleotides in length and the 5′ region is complementary to the strand that is not presented in Table 8 (i.e., the strand that is complementary to the strand shown in Table 8).
- the crRNAs were chemically synthesized and pre-annealed to the tracrRNA (SEQ ID NO:13; see Example 2).
- Pre-annealed crRNA/tracrRNA and in vitro transcribed mRNA encoding modified Cas9 protein (SEQ ID NO. 9; see Example 1) can be microinjected into the pronuclei of fertilized mouse embryos.
- the Cas9 protein cleaves the target site, and the resultant double-stranded break can be repaired via a non-homologous end-joining (NHEJ) repair process.
- NHEJ non-homologous end-joining
- the injected embryos can be either incubated at 37° C., 5% CO 2 overnight or for up to 4 days, followed by genotyping analysis, or the injected embryos can be implanted into recipient female mice such that live born animals can be genotyped.
- the in vitro-incubated embryos or tissues from live born animals can be screened for the presence of Cas9-induced mutation at the Rosa locus using standard methods.
- the embryos or tissues from fetus or live-born animals can be harvested for DNA extraction and analysis. DNA can be isolated using standard procedures.
- the targeted region of the Rosa26 locus can be PCR amplified using appropriate primers.
- NHEJ is error-prone, deletions of at least one nucleotide, insertions of at least one nucleotide, substitutions of at least one nucleotide, or combinations thereof can occur during the repair of the break. Mutations can be detected using PCR-based genotyping methods, such as Cel-I mismatch assays and DNA sequencing.
- the Rosa26 locus can be modified in mouse embryos by co-injecting a donor polynucleotide, as detailed above in section (IV)(d), along with the pre-annealed crRNA/tracrRNA and mRNA encoding modified Cas9 as described above in Example 6.
- a donor polynucleotide as detailed above in section (IV)(d)
- mRNA encoding modified Cas9 as described above in Example 6.
- In vitro-incubated embryos or tissues from live born animals (as described in Example 6) can be screened for a modified Rosa26 locus using PCR-based genotyping methods, such as RFLP assays, junction PCR, and DNA sequencing.
- the rat Rosa26 locus can be targeted for genome modifications.
- Table 10 presents a portion of the rat sequence in which potential target sites are shown in bold. Each target site comprises a protospacer.
- RNAs were designed to target each of the target sites in the rat Rosa26 locus.
- the sequences are shown in Table 11, each is 42 nucleotides in length and the 5′ region is complementary to the strand that is not presented in Table 10 (i.e., the strand that is complementary to the strand shown in Table 10).
- the crRNAs were chemically synthesized and pre-annealed to the tracrRNA (SEQ ID NO:13; see Example 2).
- Pre-annealed crRNA/tracrRNA and in vitro transcribed mRNA encoding modified Cas9 protein (SEQ ID NO. 9; see Example 1) can be microinjected into the pronuclei of fertilized rat embryos.
- the Cas9 protein cleaves the target site, and the resultant double-stranded break can be repaired via a non-homologous end-joining (NHEJ) repair process.
- NHEJ non-homologous end-joining
- the injected embryos can be either incubated at 37° C., 5% CO 2 overnight or for up to 4 days, followed by genotyping analysis, or the injected embryos can be implanted into recipient female mice such that live born animals can be genotyped.
- the in vitro-incubated embryos or tissues from live born animals can be screened for the presence of Cas9-induced mutation at the Rosa locus using standard methods.
- the embryos or tissues from fetus or live-born animals can be harvested for DNA extraction and analysis. DNA can be isolated using standard procedures.
- the targeted region of the Rosa26 locus can be PCR amplified using appropriate primers.
- NHEJ is error-prone, deletions of at least one nucleotide, insertions of at least one nucleotide, substitutions of at least one nucleotide, or combinations thereof can occur during the repair of the break. Mutations can be detected using PCR-based genotyping methods, such as Cel-I mismatch assays and DNA sequencing.
- the Rosa26 locus can be modified in rat embryos by co-injecting a donor polynucleotide, as detailed above in section (IV)(d), along with the pre-annealed crRNA/tracrRNA and mRNA encoding modified Cas9 as described above in Example 8.
- a donor polynucleotide as detailed above in section (IV)(d)
- mRNA encoding modified Cas9 as described above in Example 8.
- In vitro-incubated embryos or tissues from live born rats (as described in Example 8) can be screened for a modified Rosa26 locus using PCR-based genotyping methods, such as RFLP assays, junction PCR, and DNA sequencing.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Biophysics (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Medicinal Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Virology (AREA)
- Immunology (AREA)
- Crystallography & Structural Chemistry (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Mycology (AREA)
- Cell Biology (AREA)
- Epidemiology (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Ophthalmology & Optometry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Enzymes And Modification Thereof (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
The present invention provides RNA-guided endonucleases, which are engineered for expression in eukaryotic cells or embryos, and methods of using the RNA-guided endonuclease for targeted genome modification in eukaryotic cells or embryos. Also provided are fusion proteins, wherein each fusion protein comprises a CRISPR/Cas-like protein or fragment thereof and an effector domain. The effector domain can be a cleavage domain, an epigenetic modification domain, a transcriptional activation domain, or a transcriptional repressor domain. Also provided are methods for using the fusion proteins to modify a chromosomal sequence or regulate expression of a chromosomal sequence.
Description
- The present disclosure relates targeted genome modification. In particular, the disclosure relates to RNA-guided endonucleases or fusion proteins comprising CRISPR/Cas-like protein and methods of using said proteins to modify or regulate targeted chromosomal sequences.
- Targeted genome modification is a powerful tool for genetic manipulation of eukaryotic cells, embryos, and animals. For example, exogenous sequences can be integrated at targeted genomic locations and/or specific endogenous chromosomal sequences can be deleted, inactivated, or modified. Current methods rely on the use of engineered nuclease enzymes, such as, for example, zinc finger nucleases (ZFNs) or transcription activator-like effector nucleases (TALENs). These chimeric nucleases contain programmable, sequence-specific DNA-binding modules linked to a nonspecific DNA cleavage domain. Each new genomic target, however, requires the design of a new ZFN or TALEN comprising a novel sequence-specific DNA-binding module. Thus, these custom designed nucleases tend to be costly and time-consuming to prepare. Moreover, the specificities of ZFNs and TALENS are such that they can mediate off-target cleavages.
- Thus, there is a need for a targeted genome modification technology that does not require the design of a new nuclease for each new targeted genomic location. Additionally, there is a need for a technology with increased specificity with few or no off-target effects.
- Among the various aspects of the present disclosure is the provision of an isolated RNA-guided endonuclease, wherein the endonuclease comprises at least one nuclear localization signal, at least one nuclease domain, and at least one domain that interacts with a guide RNA to target the endonuclease to a specific nucleotide sequence for cleavage. In one embodiment, the endonuclease can be derived from a Cas9 protein. In another embodiment, the endonuclease can be modified to lack at least one functional nuclease domain. In other embodiments, the endonuclease can further comprise a cell-penetrating domain, a marker domain, or both. In a further embodiment, the endonuclease can be part of a protein-RNA complex comprising the guide RNA. In some instances, the guide RNA can be a single molecule comprising a 5′ region that is complementary to a target site. Also provided is an isolated nucleic acid encoding any of the RNA-guided endonucleases disclosed herein. In some embodiments, the nucleic acid can be codon optimized for translation in mammalian cells, such as, for example, human cells. In other embodiments, the nucleic acid sequence encoding the RNA-guided endonuclease can be operably linked to a promoter control sequence, and optionally, can be part of a vector. In other embodiments, a vector comprising sequence encoding the RNA-guided endonuclease, which can be operably linked to a promoter control sequence, can also comprise sequence encoding a guide RNA, which can be operably linked to a promoter control sequence.
- Another aspect of the present invention encompasses a method for modifying a chromosomal sequence in a eukaryotic cell or embryo. The method comprises introducing into a eukaryotic cell or embryo (i) at least one RNA-guided endonuclease comprising at least one nuclear localization signal or nucleic acid encoding at least one RNA-guided endonuclease as defined herein, (ii) at least one guide RNA or DNA encoding at least one guide RNA, and, optionally, (iii) at least one donor polynucleotide comprising a donor sequence. The method further comprises culturing the cell or embryo such that each guide RNA directs a RNA-guided endonuclease to a targeted site in the chromosomal sequence where the RNA-guided endonuclease introduces a double-stranded break in the targeted site, and the double-stranded break is repaired by a DNA repair process such that the chromosomal sequence is modified. In one embodiment, the RNA-guided endonuclease can be derived from a Cas9 protein. In another embodiment, the nucleic acid encoding the RNA-guided endonuclease introduced into the cell or embryo can be mRNA. In a further embodiment, wherein the nucleic acid encoding the RNA-guided endonuclease introduced into the cell or embryo can be DNA. In a further embodiment, the DNA encoding the RNA-guided endonuclease can be part of a vector that further comprises a sequence encoding the guide RNA. In certain embodiments, the eukaryotic cell can be a human cell, a non-human mammalian cell, a stem cell, a non-mammalian vertebrate cell, an invertebrate cell, a plant cell, or a single cell eukaryotic organism. In certain other embodiments, the embryo is a non-human one cell animal embryo.
- A further aspect of the disclosure provides a fusion protein comprising a CRISPR/Cas-like protein or fragment thereof and an effector domain. In general, the fusion protein comprises at least one nuclear localization signal. The effector domain of the fusion protein can be a cleavage domain, an epigenetic modification domain, a transcriptional activation domain, or a transcriptional repressor domain. In one embodiment, the CRISPR/Cas-like protein of the fusion protein can be derived from a Cas9 protein. In one iteration, the Cas9 protein can be modified to lack at least one functional nuclease domain. In an alternate iteration, the Cas9 protein can be modified to lack all nuclease activity. In one embodiment, the effector domain can be a cleavage domain, such as, for example, a FokI endonuclease domain or a modified FokI endonuclease domain. In another embodiment, one fusion protein can form a dimer with another fusion protein. The dimer can be a homodimer or a heterodimer. In another embodiment, the fusion protein can form a heterodimer with a zinc finger nuclease, wherein the cleavage domain of both the fusion protein and the zinc finger nucleases is a FokI endonuclease domain or a modified FokI endonuclease domain. In still another embodiment, the fusion protein comprises a CRISPR/Cas-like protein derived from a Cas9 protein modified to lack all nuclease activity, and the effector domain is a FokI endonuclease domain or a modified FokI endonuclease domain. In still another embodiment, the fusion protein comprises a CRISPR/Cas-like protein derived from a Cas9 protein modified to lack all nuclease activity, and the effector domain can be an epigenetic modification domain, a transcriptional activation domain, or a transcriptional repressor domain. In additional embodiments, any of the fusion proteins disclosed herein can comprise at least one additional domain chosen from a nuclear localization signal, a cell-penetrating domain, and a marker domain. Also provided are isolated nucleic acids encoding any of the fusion proteins provided herein.
- Still another aspect of the disclosure encompasses a method for modifying a chromosomal sequence or regulating expression of a chromosomal sequence in a cell or embryo. The method comprises introducing into the cell or embryo (a) at least one fusion protein or nucleic acid encoding at least one fusion protein, wherein the fusion protein comprises a CRISPR/Cas-like protein or a fragment thereof and an effector domain, and (b) at least one guide RNA or DNA encoding at least one guide RNA, wherein the guide RNA guides the CRISPR/Cas-like protein of the fusion protein to a targeted site in the chromosomal sequence and the effector domain of the fusion protein modifies the chromosomal sequence or regulates expression of the chromosomal sequence. In one embodiment, the CRISPR/Cas-like protein of the fusion protein can be derived from a Cas9 protein. In another embodiment, the CRISPR/Cas-like protein of the fusion protein can be modified to lack at least one functional nuclease domain. In still another embodiment, the CRISPR/Cas-like protein of the fusion protein can be modified to lack all nuclease activity. In one embodiment in which the fusion protein comprises a Cas9 protein modified to lack all nuclease activity and a FokI cleavage domain or a modified FokI cleavage domain, the method can comprise introducing into the cell or embryo one fusion protein or nucleic acid encoding one fusion protein and two guide RNAs or DNA encoding two guide RNAs, and wherein one double-stranded break is introduced in the chromosomal sequence. In another embodiment in which the fusion protein comprises a Cas9 protein modified to lack all nuclease activity and a FokI cleavage domain or a modified FokI cleavage domain, the method can comprise introducing into the cell or embryo two fusion proteins or nucleic acid encoding two fusion proteins and two guide RNAs or DNA encoding two guide RNAs, and wherein two double-stranded breaks are introduced in the chromosomal sequence. In still another one embodiment in which the fusion protein comprises a Cas9 protein modified to lack all nuclease activity and a FokI cleavage domain or a modified FokI cleavage domain, the method can comprise introducing into the cell or embryo one fusion protein or nucleic acid encoding one fusion protein, one guide RNA or nucleic acid encoding one guide RNA, and one zinc finger nuclease or nucleic acid encoding one zinc finger nuclease, wherein the zinc finger nuclease comprises a FokI cleavage domain or a modified a FokI cleavage domain, and wherein one double-stranded break is introduced into the chromosomal sequence. In certain embodiments in which the fusion protein comprises a cleavage domain, the method can further comprise introducing into the cell or embryo at least one donor polynucleotide. In embodiments in which the fusion protein comprises an effector domain chosen from an epigenetic modification domain, a transcriptional activation domain, or a transcriptional repressor domain, the fusion protein can comprise a Cas9 protein modified to lack all nuclease activity, and the method can comprise introducing into the cell or embryo one fusion protein or nucleic acid encoding one fusion protein, and one guide RNA or nucleic acid encoding one guide RNA, and wherein the structure or expression of the targeted chromosomal sequence is modified. In certain embodiments, the eukaryotic cell can be a human cell, a non-human mammalian cell, a stem cell, a non-mammalian vertebrate cell, an invertebrate cell, a plant cell, or a single cell eukaryotic organism. In certain other embodiments, the embryo is a non-human one cell animal embryo.
- Other aspects and iterations of the disclosure are detailed below.
-
FIG. 1 diagrams genome modification using protein dimers. (A) depicts a double stranded break created by a dimer composed of two fusion proteins, each of which comprises a Cas-like protein for DNA binding and a FokI cleavage domain. (B) depicts a double stranded break created by a dimer composed of a fusion protein comprising a Cas-like protein and a FokI cleavage domain and a zinc finger nuclease comprising a zinc finger (ZF) DNA-binding domain and a FokI cleavage domain. -
FIG. 2 illustrates regulation of gene expression using RNA-guided fusion proteins comprising gene regulatory domains. (A) depicts a fusion protein comprising a Cas-like protein used for DNA binding and an “AIR” domain that activates or represses gene expression. (B) diagrams a fusion protein comprising a Cas-like protein for DNA binding and a epigenetic modification domain (“Epi-mod”) that affects epigenetic states by covalent modification of proximal DNA or proteins. -
FIG. 3 diagrams genome modification using two RNA-guided endonuclease. (A) depicts a double stranded break created by two RNA-guided endonuclease that have been converted into nickases. (B) depicts two double stranded breaks created by two RNA-guided endonuclease having endonuclease activity. -
FIG. 4 presents fluorescence-activated cell sorting (FACS) of human K562 cells transfected with Cas9 nucleic acid, Cas9 guiding RNA, and AAVS1-GFP DNA donor. The Y axis represents the auto fluorescence intensity at a red channel, and the X axis represents the green fluorescence intensity. (A) K562 cells transfected with 10 μg of Cas9 mRNA transcribed with an Anti-Reverse Cap Analog, 0.3 nmol of pre-annealed crRNA-tracrRNA duplex, and 10 μg of AAVS1-GFP plasmid DNA; (B) K562 cells transfected 10 μg of Cas9 mRNA transcribed with an Anti-Reverse Cap Analog, 0.3 nmol of chimeric RNA, and 10 μg of AAVS1-GFP plasmid DNA; (C) K562 cells transfected 10 μg of Cas9 mRNA that was capped by post-transcription capping reaction, 0.3 nmol of chimeric RNA, and 10 μg of AAVS1-GFP plasmid DNA; (D) K562 cells transfected with 10 μg of Cas9 plasmid DNA, 5 μg of U6-chimeric RNA plasmid DNA, and 10 μg of AAVS1-GFP plasmid DNA; (E) K562 cells transfected with 10 μg of AAVS1-GFP plasmid DNA; (F) K562 cells transfected with transfection reagents only. -
FIG. 5 presents a junction PCR analysis documenting the targeted integration of GFP into the AAVS1 locus in human cells. Lane M: 1 kb DNA molecular markers; Lane A: K562 cells transfected with 10 μg of Cas9 mRNA transcribed with an Anti-Reverse Cap Analog, 0.3 nmol of pre-annealed crRNA-tracrRNA duplex, and 10 μg of AAVS1-GFP plasmid DNA; Lane B: K562 cells transfected 10 μg of Cas9 mRNA transcribed with an Anti-Reverse Cap Analog, 0.3 nmol of chimeric RNA, and 10 μg of AAVS1-GFP plasmid DNA; Lane C: K562 cells transfected 10 μg of Cas9 mRNA that was capped by post-transcription capping reaction, 0.3 nmol of chimeric RNA, and 10 μg of AAVS1-GFP plasmid DNA; Lane D: K562 cells transfected with 10 μg of Cas9 plasmid DNA, 5 μg of U6-chimeric RNA plasmid DNA, and 10 μg of AAVS1-GFP plasmid DNA; Lane E: K562 cells transfected with 10 μg of AAVS1-GFP plasmid DNA; Lane F: K562 cells transfected with transfection reagents only. - Provided herein are RNA-guided endonucleases, which comprise at least one nuclear localization signal, at least one nuclease domain, and at least one domain that interacts with a guide RNA to target the endonuclease to a specific nucleotide sequence for cleavage. Also provided are nucleic acids encoding the RNA-guided endonucleases, as well as methods of using the RNA-guided endonucleases to modify chromosomal sequences of eukaryotic cells or embryos. The RNA-guided endonuclease interacts with specific guide RNAs, each of which directs the endonuclease to a specific targeted site, at which site the RNA-guided endonuclease introduces a double-stranded break that can be repaired by a DNA repair process such that the chromosomal sequence is modified. Since the specificity is provided by the guide RNA, the RNA-based endonuclease is universal and can be used with different guide RNAs to target different genomic sequences. The methods disclosed herein can be used to target and modify specific chromosomal sequences and/or introduce exogenous sequences at targeted locations in the genome of cells or embryos. Furthermore, the targeting is specific with limited off target effects.
- The present disclosure provides fusion proteins, wherein a fusion protein comprises a CRISPR/Cas-like protein or fragment thereof and an effector domain. Suitable effector domains include, without limit, cleavage domains, epigenetic modification domains, transcriptional activation domains, and transcriptional repressor domains. Each fusion protein is guided to a specific chromosomal sequence by a specific guide RNA, wherein the effector domain mediates targeted genome modification or gene regulation. In one aspect, the fusion proteins can function as dimers thereby increasing the length of the target site and increasing the likelihood of its uniqueness in the genome (thus, reducing off target effects). For example, endogenous CRISPR systems modify genomic locations based on DNA binding word lengths of approximately 13-20 bp (Cong et al., Science, 339:819-823). At this word size, only 5-7% of the target sites are unique within the genome (Iseli et al, PLos One 2 (6):e579). In contrast, DNA binding word sizes for zinc finger nucleases typically range from 30-36 bp, resulting in target sites that are approximately 85-87% unique within the human genome. The smaller sized DNA binding sites utilized by CRISPR-based systems limits and complicates design of targeted CRISP-based nucleases near desired locations, such as disease SNPs, small exons, start codons, and stop codons, as well as other locations within complex genomes. The present disclosure not only provides means for expanding the CRISPR DNA binding word length (i.e., so as to limit off-target activity), but further provides CRISPR fusion proteins having modified functionality. According, the disclosed CRISPR fusion proteins have increased target specificity and unique functionality(ies). Also provided herein are methods of using the fusion proteins to modify or regulate expression of targeted chromosomal sequences.
- One aspect of the present disclosure provides RNA-guided endonucleases comprising at least one nuclear localization signal, which permits entry of the endonuclease into the nuclei of eukaryotic cells and embryos such as, for example, non-human one cell embryos. RNA-guided endonucleases also comprise at least one nuclease domain and at least one domain that interacts with a guide RNA. An RNA-guided endonuclease is directed to a specific nucleic acid sequence (or target site) by a guide RNA. The guide RNA interacts with the RNA-guided endonuclease as well as the target site such that, once directed to the target site, the RNA-guided endonuclease is able to introduce a double-stranded break into the target site nucleic acid sequence. Since the guide RNA provides the specificity for the targeted cleavage, the endonuclease of the RNA-guided endonuclease is universal and can be used with different guide RNAs to cleave different target nucleic acid sequences. Provided herein are isolated RNA-guided endonucleases, isolated nucleic acids (i.e., RNA or DNA) encoding the RNA-guided endonucleases, vectors comprising nucleic acids encoding the RNA-guided endonucleases, and protein-RNA complexes comprising the RNA-guided endonuclease plus a guide RNA.
- The RNA-guided endonuclease can be derived from a clustered regularly interspersed short palindromic repeats (CRISPR)/CRISPR-associated (Cas) system. The CRISPR/Cas system can be a type I, a type II, or a type III system. Non-limiting examples of suitable CRISPR/Cas proteins include Cas3, Cas4, Cas5, Cas5e (or CasD), Cas6, Cas6e, Cas6f, Cas7, Cas8a1, Cas8a2, Cas8b, Cas8c, Cas9, Cas10, Cas10d, CasF, CasG, CasH, Csy1, Csy2, Csy3, Cse1 (or CasA), Cse2 (or CasB), Cse3 (or CasE), Cse4 (or CasC), Csc1, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmr1, Cmr3, Cmr4, Cmr5, Cmr6, Csb1, Csb2, Csb3, Csx17, Csx14, Csx10, Csx16, CsaX, Csx3, Csz1, Csx15, Csf1, Csf2, Csf3, Csf4, and Cu1966.
- In one embodiment, the RNA-guided endonuclease is derived from a type II CRISPR/Cas system. In specific embodiments, the RNA-guided endonuclease is derived from a Cas9 protein. The Cas9 protein can be from Streptococcus pyogenes, Streptococcus thermophilus, Streptococcus sp., Nocardiopsis dassonvillei, Streptomyces pristinaespiralis, Streptomyces viridochromogenes, Streptomyces viridochromogenes, Streptosporangium roseum, Streptosporangium roseum, Alicyclobacillus acidocaldarius, Bacillus pseudomycoides, Bacillus selenitireducens, Exiguobacterium sibiricum, Lactobacillus delbrueckii, Lactobacillus salivarius, Microscilla marina, Burkholderiales bacterium, Polaromonas naphthalenivorans, Polaromonas sp., Crocosphaera watsonii, Cyanothece sp., Microcystis aeruginosa, Synechococcus sp., Acetohalobium arabaticum, Ammonifex degensii, Caldicelulosiruptor becscii, Candidatus Desulforudis, Clostridium botulinum, Clostridium difficile, Finegoldia magna, Natranaerobius thermophilus, Pelotomaculum thermopropionicum, Acidithiobacillus caldus, Acidithiobacillus ferrooxidans, Allochromatium vinosum, Marinobacter sp., Nitrosococcus halophilus, Nitrosococcus watsoni, Pseudoalteromonas haloplanktis, Ktedonobacter racemifer, Methanohalobium evestigatum, Anabaena variabilis, Nodularia spumigena, Nostoc sp., Arthrospira maxima, Arthrospira platensis, Arthrospira sp., Lyngbya sp., Microcoleus chthonoplastes, Oscillatoria sp., Petrotoga mobilis, Thermosipho africanus, or Acaryochloris marina.
- In general, CRISPR/Cas proteins comprise at least one RNA recognition and/or RNA binding domain. RNA recognition and/or RNA binding domains interact with guide RNAs. CRISPR/Cas proteins can also comprise nuclease domains (i.e., DNase or RNase domains), DNA binding domains, helicase domains, RNAse domains, protein-protein interaction domains, dimerization domains, as well as other domains.
- The CRISPR/Cas-like protein can be a wild type CRISPR/Cas protein, a modified CRISPR/Cas protein, or a fragment of a wild type or modified CRISPR/Cas protein. The CRISPR/Cas-like protein can be modified to increase nucleic acid binding affinity and/or specificity, alter an enzymatic activity, and/or change another property of the protein. For example, nuclease (i.e., DNase, RNase) domains of the CRISPR/Cas-like protein can be modified, deleted, or inactivated. Alternatively, the CRISPR/Cas-like protein can be truncated to remove domains that are not essential for the function of the fusion protein. The CRISPR/Cas-like protein can also be truncated or modified to optimize the activity of the effector domain of the fusion protein.
- In some embodiments, the CRISPR/Cas-like protein can be derived from a wild type Cas9 protein or fragment thereof. In other embodiments, the CRISPR/Cas-like protein can be derived from modified Cas9 protein. For example, the amino acid sequence of the Cas9 protein can be modified to alter one or more properties (e.g., nuclease activity, affinity, stability, etc.) of the protein. Alternatively, domains of the Cas9 protein not involved in RNA-guided cleavage can be eliminated from the protein such that the modified Cas9 protein is smaller than the wild type Cas9 protein.
- In general, a Cas9 protein comprises at least two nuclease (i.e., DNase) domains. For example, a Cas9 protein can comprise a RuvC-like nuclease domain and a HNH-like nuclease domain. The RuvC and HNH domains work together to cut single strands to make a double-stranded break in DNA. (Jinek et al., Science, 337: 816-821). In some embodiments, the Cas9-derived protein can be modified to contain only one functional nuclease domain (either a RuvC-like or a HNH-like nuclease domain). For example, the Cas9-derived protein can be modified such that one of the nuclease domains is deleted or mutated such that it is no longer functional (i.e., the nuclease activity is absent). In some embodiments in which one of the nuclease domains is inactive, the Cas9-derived protein is able to introduce a nick into a double-stranded nucleic acid (such protein is termed a “nickase”), but not cleave the double-stranded DNA. For example, an aspartate to alanine (D10A) conversion in a RuvC-like domain converts the Cas9-derived protein into a nickase. Likewise, a histidine to alanine (H840A or H839A) conversion in a HNH domain converts the Cas9-derived protein into a nickase. Each nuclease domain can be modified using well-known methods, such as site-directed mutagenesis, PCR-mediated mutagenesis, and total gene synthesis, as well as other methods known in the art.
- The RNA-guided endonuclease disclosed herein comprises at least one nuclear localization signal. In general, an NLS comprises a stretch of basic amino acids. Nuclear localization signals are known in the art (see, e.g., Lange et al., J. Biol. Chem., 2007, 282:5101-5105). For example, in one embodiment, the NLS can be a monopartite sequence, such as PKKKRKV (SEQ ID NO:1) or PKKKRRV (SEQ ID NO:2). In another embodiment, the NLS can be a bipartite sequence. In still another embodiment, the NLS can be KRPAATKKAGQAKKKK (SEQ ID NO:3). The NLS can be located at the N-terminus, the C-terminal, or in an internal location of the RNA-guided endonuclease.
- In some embodiments, the RNA-guided endonuclease can further comprise at least one cell-penetrating domain. In one embodiment, the cell-penetrating domain can be a cell-penetrating peptide sequence derived from the HIV-1 TAT protein. As an example, the TAT cell-penetrating sequence can be GRKKRRQRRRPPQPKKKRKV (SEQ ID NO:4). In another embodiment, the cell-penetrating domain can be TLM (PLSSIFSRIGDPPKKKRKV; SEQ ID NO:5), a cell-penetrating peptide sequence derived from the human hepatitis B virus. In still another embodiment, the cell-penetrating domain can be MPG (GALFLGWLGAAGSTMGAPKKKRKV; SEQ ID NO:6 or GALFLGFLGAAGSTMGAWSQPKKKRKV; SEQ ID NO:7). In an additional embodiment, the cell-penetrating domain can be Pep-1 (KETWWETWWTEWSQPKKKRKV; SEQ ID NO:8), VP22, a cell penetrating peptide from Herpes simplex virus, or a polyarginine peptide sequence. The cell-penetrating domain can be located at the N-terminus, the C-terminus, or in an internal location of the protein.
- In still other embodiments, the RNA-guided endonuclease can also comprise at least one marker domain. Non-limiting examples of marker domains include fluorescent proteins, purification tags, and epitope tags. In some embodiments, the marker domain can be a fluorescent protein. Non limiting examples of suitable fluorescent proteins include green fluorescent proteins (e.g., GFP, GFP-2, tagGFP, turboGFP, EGFP, Emerald, Azami Green, Monomeric Azami Green, CopGFP, AceGFP, ZsGreen1), yellow fluorescent proteins (e.g. YFP, EYFP, Citrine, Venus, YPet, PhiYFP, ZsYellow1), blue fluorescent proteins (e.g. EBFP, EBFP2, Azurite, mKalama1, GFPuv, Sapphire, T-sapphire), cyan fluorescent proteins (e.g. ECFP, Cerulean, CyPet, AmCyan1, Midoriishi-Cyan), red fluorescent proteins (mKate, mKate2, mPlum, DsRed monomer, mCherry, mRFP1, DsRed-Express, DsRed2, DsRed-Monomer, HcRed-Tandem, HcRed1, AsRed2, eqFP611, mRasberry, mStrawberry, Jred), and orange fluorescent proteins (mOrange, mKO, Kusabira-Orange, Monomeric Kusabira-Orange, mTangerine, tdTomato) or any other suitable fluorescent protein. In other embodiments, the marker domain can be a purification tag and/or an epitope tag. Exemplary tags include, but are not limited to, glutathione-S-transferase (GST), chitin binding protein (CBP), maltose binding protein, thioredoxin (TRX), poly(NANP), tandem affinity purification (TAP) tag, myc, AcV5, AU1, AU5, E, ECS, E2, FLAG, HA, nus, Softag 1, Softag 3, Strep, SBP, Glu-Glu, HSV, KT3, S, S1, T7, V5, VSV-G, 6×His, biotin carboxyl carrier protein (BCCP), and calmodulin.
- In certain embodiments, the RNA-guided endonuclease may be part of a protein-RNA complex comprising a guide RNA. The guide RNA interacts with the RNA-guided endonuclease to direct the endonuclease to a specific target site, wherein the 5′ end of the guide RNA base pairs with a specific protospacer sequence.
- Another aspect of the present disclosure provides a fusion protein comprising a CRISPR/Cas-like protein or fragment thereof and an effector domain. The CRISPR/Cas-like protein is directed to a target site by a guide RNA, at which site the effector domain can modify or effect the targeted nucleic acid sequence. The effector domain can be a cleavage domain, an epigenetic modification domain, a transcriptional activation domain, or a transcriptional repressor domain. The fusion protein can further comprise at least one additional domain chosen from a nuclear localization signal, a cell-penetrating domain, or a marker domain.
- (a) CRISPR/Cas-Like Protein
- The fusion protein comprises a CRISPR/Cas-like protein or a fragment thereof. CRISPR/Cas-like proteins are detailed above in section (I). The CRISPR/Cas-like protein can be located at the N-terminus, the C-terminus, or in an internal location of the fusion protein
- In some embodiments, the CRISPR/Cas-like protein of the fusion protein can be derived from a Cas9 protein. The Cas9-derived protein can be wild type, modified, or a fragment thereof. In some embodiments, the Cas9-derived protein can be modified to contain only one functional nuclease domain (either a RuvC-like or a HNH-like nuclease domain). For example, the Cas9-derived protein can be modified such that one of the nuclease domains is deleted or mutated such that it is no longer functional (i.e., the nuclease activity is absent). In some embodiments in which one of the nuclease domains is inactive, the Cas9-derived protein is able to introduce a nick into a double-stranded nucleic acid (such protein is termed a “nickase”), but not cleave the double-stranded DNA. For example, an aspartate to alanine (D10A) conversion in a RuvC-like domain converts the Cas9-derived protein into a nickase. Likewise, a histidine to alanine (H840A or H839A) conversion in a HNH domain converts the Cas9-derived protein into a nickase. In other embodiments, both of the RuvC-like nuclease domain and the HNH-like nuclease domain can be modified or eliminated such that the Cas9-derived protein is unable to nick or cleave double stranded nucleic acid. In still other embodiments, all nuclease domains of the Cas9-derived protein can be modified or eliminated such that the Cas9-derived protein lacks all nuclease activity.
- In any of the above-described embodiments, any or all of the nuclease domains can be inactivated by one or more deletion mutations, insertion mutations, and/or substitution mutations using well-known methods, such as site-directed mutagenesis, PCR-mediated mutagenesis, and total gene synthesis, as well as other methods known in the art. In an exemplary embodiment, the CRISPR/Cas-like protein of the fusion protein is derived from a Cas9 protein in which all the nuclease domains have been inactivated or deleted.
- (b) Effector Domain
- The fusion protein also comprises an effector domain. The effector domain can be a cleavage domain, an epigenetic modification domain, a transcriptional activation domain, or a transcriptional repressor domain. The effector domain can be located at the N-terminus, the C-terminus, or in an internal location of the fusion protein.
- (i) Cleavage Domain
- In some embodiments, the effector domain is a cleavage domain. As used herein, a “cleavage domain” refers to a domain that cleaves DNA. The cleavage domain can be obtained from any endonuclease or exonuclease. Non-limiting examples of endonucleases from which a cleavage domain can be derived include, but are not limited to, restriction endonucleases and homing endonucleases. See, for example, New England Biolabs Catalog or Belfort et al. (1997) Nucleic Acids Res. 25:3379-3388. Additional enzymes that cleave DNA are known (e.g., S1 Nuclease; mung bean nuclease; pancreatic DNase I; micrococcal nuclease; yeast HO endonuclease). See also Linn et al. (eds.) Nucleases, Cold Spring Harbor Laboratory Press, 1993. One or more of these enzymes (or functional fragments thereof) can be used as a source of cleavage domains.
- In some embodiments, the cleavage domain can be derived from a type II-S endonuclease. Type II-S endonucleases cleave DNA at sites that are typically several base pairs away the recognition site and, as such, have separable recognition and cleavage domains. These enzymes generally are monomers that transiently associate to form dimers to cleave each strand of DNA at staggered locations. Non-limiting examples of suitable type II-S endonucleases include BfiI, BpmI, BsaI, BsgI, BsmBI, BsmI, BspMI, FokI, MbolI, and SapI. In exemplary embodiments, the cleavage domain of the fusion protein is a FokI cleavage domain or a derivative thereof.
- In certain embodiments, the type II-S cleavage can be modified to facilitate dimerization of two different cleavage domains (each of which is attached to a CRISPR/Cas-like protein or fragment thereof). For example, the cleavage domain of FokI can be modified by mutating certain amino acid residues. By way of non-limiting example, amino acid residues at positions 446, 447, 479, 483, 484, 486, 487, 490, 491, 496, 498, 499, 500, 531, 534, 537, and 538 of FokI cleavage domains are targets for modification. For example, modified cleavage domains of FokI that form obligate heterodimers include a pair in which a first modified cleavage domain includes mutations at amino acid positions 490 and 538 and a second modified cleavage domain that includes mutations at amino acid positions 486 and 499 (Miller et al., 2007, Nat. Biotechnol, 25:778-785; Szczpek et al., 2007, Nat. Biotechnol, 25:786-793). For example, the Glu (E) at position 490 can be changed to Lys (K) and the Ile (I) at position 538 can be changed to K in one domain (E490K, I538K), and the Gln (Q) at position 486 can be changed to E and the I at position 499 can be changed to Leu (L) in another cleavage domain (Q486E, I499L). In other embodiments, modified FokI cleavage domains can include three amino acid changes (Doyon et al. 2011, Nat. Methods, 8:74-81). For example, one modified FokI domain (which is termed ELD) can comprise Q486E, I499L, N496D mutations and the other modified FokI domain (which is termed KKR) can comprise E490K, I538K, H537R mutations.
- In exemplary embodiments, the effector domain of the fusion protein is a FokI cleavage domain or a modified FokI cleavage domain.
- In embodiments wherein the effector domain is a cleavage domain and the CRISPR/Cas-like protein is derived from a Cas9 protein, the Cas9-derived can be modified as discussed herein such that its endonuclease activity is eliminated. For example, the Cas9-derived can be modified by mutating the RuvC and HNH domains such that they no longer possess nuclease activity.
- (ii) Epigenetic Modification Domain
- In other embodiments, the effector domain of the fusion protein can be an epigenetic modification domain. In general, epigenetic modification domains alter histone structure and/or chromosomal structure without altering the DNA sequence. Changes histone and/or chromatin structure can lead to changes in gene expression. Examples of epigenetic modification include, without limit, acetylation or methylation of lysine residues in histone proteins, and methylation of cytosine residues in DNA. Non-limiting examples of suitable epigenetic modification domains include histone acetyltansferase domains, histone deacetylase domains, histone methyltransferase domains, histone demethylase domains, DNA methyltransferase domains, and DNA demethylase domains.
- In embodiments in which the effector domain is a histone acetyltansferase (HAT) domain, the HAT domain can be derived from EP300 (i.e., E1A binding protein p300), CREBBP (i.e., CREB-binding protein), CDY1, CDY2, CDYL1, CLOCK, ELP3, ESA1, GCN5 (KAT2A), HAT1, KAT2B, KAT5, MYST1, MYST2, MYST3, MYST4, NCOA1, NCOA2, NCOA3, NCOAT, P/CAF, Tip60, TAFII250, or TF3C4. In one such embodiment, the HAT domain is p300
- In embodiments wherein the effector domain is an epigenetic modification domain and the CRISPR/Cas-like protein is derived from a Cas9 protein, the Cas9-derived can be modified as discussed herein such that its endonuclease activity is eliminated. For example, the Cas9-derived can be modified by mutating the RuvC and HNH domains such that they no longer possess nuclease activity.
- (iii) Transcriptional Activation Domain
- In other embodiments, the effector domain of the fusion protein can be a transcriptional activation domain. In general, a transcriptional activation domain interacts with transcriptional control elements and/or transcriptional regulatory proteins (i.e., transcription factors, RNA polymerases, etc.) to increase and/or activate transcription of a gene. In some embodiments, the transcriptional activation domain can be, without limit, a herpes simplex virus VP16 activation domain, VP64 (which is a tetrameric derivative of VP16), a NFκB p65 activation domain, p53 activation domains 1 and 2, a CREB (cAMP response element binding protein) activation domain, an E2A activation domain, and an NFAT (nuclear factor of activated T-cells) activation domain. In other embodiments, the transcriptional activation domain can be Gal4, Gcn4, MLL, Rtg3, Gln3, Oaf1, Pip2, Pdr1, Pdr3, Pho4, and Leu3. The transcriptional activation domain may be wild type, or it may be a modified version of the original transcriptional activation domain. In some embodiments, the effector domain of the fusion protein is a VP16 or VP64 transcriptional activation domain.
- In embodiments wherein the effector domain is a transcriptional activation domain and the CRISPR/Cas-like protein is derived from a Cas9 protein, the Cas9-derived protein can be modified as discussed herein such that its endonuclease activity is eliminated. For example, the Cas9-derived can be modified by mutating the RuvC and HNH domains such that they no longer possess nuclease activity.
- (iv) Transcriptional Repressor Domain
- In still other embodiments, the effector domain of the fusion protein can be a transcriptional repressor domain. In general, a transcriptional repressor domain interacts with transcriptional control elements and/or transcriptional regulatory proteins (i.e., transcription factors, RNA polymerases, etc.) to decrease and/or terminate transcription of a gene. Non-limiting examples of suitable transcriptional repressor domains include inducible cAMP early repressor (ICER) domains, Kruppel-associated box A (KRAB-A) repressor domains, YY1 glycine rich repressor domains, Sp1-like repressors, E(spl) repressors, IκB repressor, and MeCP2.
- In embodiments wherein the effector domain is a transcriptional repressor domain and the CRISPR/Cas-like protein is derived from a Cas9 protein, the Cas9-derived protein can be modified as discussed herein such that its endonuclease activity is eliminated. For example, the cas9 can be modified by mutating the RuvC and HNH domains such that they no longer possess nuclease activity.
- (c) Additional Domains
- In some embodiments, the fusion protein further comprises at least one additional domain. Non-limiting examples of suitable additional domains include nuclear localization signals, cell-penetrating or translocation domains, and marker domains. Non-limiting examples of suitable nuclear localization signals, cell-penetrating domains, and marker domains are presented above in section (I).
- (d) Fusion Protein Dimers
- In embodiments in which the effector domain of the fusion protein is a cleavage domain, a dimer comprising at least one fusion protein can form. The dimer can be a homodimer or a heterodimer. In some embodiments, the heterodimer comprises two different fusion proteins. In other embodiments, the heterodimer comprises one fusion protein and an additional protein.
- In some embodiments, the dimer is a homodimer in which the two fusion protein monomers are identical with respect to the primary amino acid sequence. In one embodiment where the dimer is a homodimer, the Cas9-derived proteins are modified such that their endonuclease activity is eliminated, i.e., such that they have no functional nuclease domains. In certain embodiments wherein the Cas9-derived proteins are modified such that their endonuclease activity is eliminated, each fusion protein monomer comprises an identical Cas9 like protein and an identical cleavage domain. The cleavage domain can be any cleavage domain, such as any of the exemplary cleavage domains provided herein. In one specific embodiment, the cleavage domain is a FokI cleavage domain or a modified FokI cleavage domain. In such embodiments, specific guide RNAs would direct the fusion protein monomers to different but closely adjacent sites such that, upon dimer formation, the nuclease domains of the two monomers would create a double stranded break in the target DNA.
- In other embodiments, the dimer is a heterodimer of two different fusion proteins. For example, the CRISPR/Cas-like protein of each fusion protein can be derived from a different CRISPR/Cas protein or from an orthologous CRISPR/Cas protein from a different bacterial species. For example, each fusion protein can comprise a Cas9-like protein, which Cas9-like protein is derived from a different bacterial species. In these embodiments, each fusion protein would recognize a different target site (i.e., specified by the protospacer and/or PAM sequence). For example, the guide RNAs could position the heterodimer to different but closely adjacent sites such that their nuclease domains results in an effective double stranded break in the target DNA. The heterodimer can also have modified Cas9 proteins with nicking activity such that the nicking locations are different.
- Alternatively, two fusion proteins of a heterodimer can have different effector domains. In embodiments in which the effector domain is a cleavage domain, each fusion protein can contain a different modified cleavage domain. For example, each fusion protein can contain a different modified FokI cleavage domain, as detailed above in section (II)(b)(i). In these embodiments, the Cas-9 proteins can be modified such that their endonuclease activities are eliminated.
- As will be appreciated by those skilled in the art, the two fusion proteins forming a heterodimer can differ in both the CRISPR/Cas-like protein domain and the effector domain.
- In any of the above-described embodiments, the homodimer or heterodimer can comprise at least one additional domain chosen from nuclear localization signals (NLSs), cell-penetrating, translocation domains and marker domains, as detailed above.
- In any of the above-described embodiments, one or both of the Cas9-derived proteins can be modified such that its endonuclease activity is eliminated or modified.
- In still alternate embodiments, the heterodimer comprises one fusion protein and an additional protein. For example, the additional protein can be a nuclease. In one embodiment, the nuclease is a zinc finger nuclease. A zinc finger nuclease comprises a zinc finger DNA binding domain and a cleavage domain. A zinc finger recognizes and binds three (3) nucleotides. A zinc finger DNA binding domain can comprise from about three zinc fingers to about seven zinc fingers. The zinc finger DNA binding domain can be derived from a naturally occurring protein or it can be engineered. See, for example, Beerli et al. (2002) Nat. Biotechnol. 20:135-141; Pabo et al. (2001) Ann. Rev. Biochem. 70:313-340; Isalan et al. (2001) Nat. Biotechnol. 19:656-660; Segal et al. (2001) Curr. Opin. Biotechnol. 12:632-637; Choo et al. (2000) Curr. Opin. Struct. Biol. 10:411-416; Zhang et al. (2000) J. Biol. Chem. 275(43):33850-33860; Doyon et al. (2008) Nat. Biotechnol. 26:702-708; and Santiago et al. (2008) Proc. Natl. Acad. Sci. USA 105:5809-5814. The cleavage domain of the zinc finger nuclease can be any cleavage domain detailed above in section (II)(b)(i). In exemplary embodiments, the cleavage domain of the zinc finger nuclease is a FokI cleavage domain or a modified FokI cleavage domain. Such a zinc finger nuclease will dimerize with a fusion protein comprising a FokI cleavage domain or a modified FokI cleavage domain.
- In some embodiments, the zinc finger nuclease can comprise at least one additional domain chosen from nuclear localization signals, cell-penetrating or translocation domains, which are detailed above.
- In certain embodiments, any of the fusion protein detailed above or a dimer comprising at least one fusion protein may be part of a protein-RNA complex comprising at least one guide RNA. A guide RNA interacts with the CRISPR-Cas0 like protein of the fusion protein to direct the fusion protein to a specific target site, wherein the 5′ end of the guide RNA base pairs with a specific protospacer sequence.
- Another aspect of the present disclosure provides nucleic acids encoding any of the RNA-guided endonucleases or fusion proteins described above in sections (I) and (II), respectively. The nucleic acid can be RNA or DNA. In one embodiment, the nucleic acid encoding the RNA-guided endonuclease or fusion protein is mRNA. The mRNA can be 5′ capped and/or 3′ polyadenylated. In another embodiment, the nucleic acid encoding the RNA-guided endonuclease or fusion protein is DNA. The DNA can be present in a vector (see below).
- The nucleic acid encoding the RNA-guided endonuclease or fusion protein can be codon optimized for efficient translation into protein in the eukaryotic cell or animal of interest. For example, codons can be optimized for expression in humans, mice, rats, hamsters, cows, pigs, cats, dogs, fish, amphibians, plants, yeast, insects, and so forth (see Codon Usage Database at www.kazusa.or.jp/codon/). Programs for codon optimization are available as freeware (e.g., OPTIMIZER at genomes.urv.es/OPTIMIZER; OptimumGene™ from GenScript at www.genscript.com/codon_opt.html). Commercial codon optimization programs are also available.
- In some embodiments, DNA encoding the RNA-guided endonuclease or fusion protein can be operably linked to at least one promoter control sequence. In some iterations, the DNA coding sequence can be operably linked to a promoter control sequence for expression in the eukaryotic cell or animal of interest. The promoter control sequence can be constitutive, regulated, or tissue-specific. Suitable constitutive promoter control sequences include, but are not limited to, cytomegalovirus immediate early promoter (CMV), simian virus (SV40) promoter, adenovirus major late promoter, Rous sarcoma virus (RSV) promoter, mouse mammary tumor virus (MMTV) promoter, phosphoglycerate kinase (PGK) promoter, elongation factor (ED1)-alpha promoter, ubiquitin promoters, actin promoters, tubulin promoters, immunoglobulin promoters, fragments thereof, or combinations of any of the foregoing. Examples of suitable regulated promoter control sequences include without limit those regulated by heat shock, metals, steroids, antibiotics, or alcohol. Non-limiting examples of tissue-specific promoters include B29 promoter, CD14 promoter, CD43 promoter, CD45 promoter, CD68 promoter, desmin promoter, elastase-1 promoter, endoglin promoter, fibronectin promoter, Flt-1 promoter, GFAP promoter, GPIIb promoter, ICAM-2 promoter, INF-β promoter, Mb promoter, NphsI promoter, 00-2 promoter, SP-B promoter, SYN1 promoter, and WASP promoter. The promoter sequence can be wild type or it can be modified for more efficient or efficacious expression. In one exemplary embodiment, the encoding DNA can be operably linked to a CMV promoter for constitutive expression in mammalian cells.
- In certain embodiments, the sequence encoding the RNA-guided endonuclease or fusion protein can be operably linked to a promoter sequence that is recognized by a phage RNA polymerase for in vitro mRNA synthesis. In such embodiments, the in vitro-transcribed RNA can be purified for use in the methods detailed below in sections (IV) and (V). For example, the promoter sequence can be a T7, T3, or SP6 promoter sequence or a variation of a T7, T3, or SP6 promoter sequence. In an exemplary embodiment, the DNA encoding the fusion protein is operably linked to a T7 promoter for in vitro mRNA synthesis using T7 RNA polymerase.
- In alternate embodiments, the sequence encoding the RNA-guided endonuclease or fusion protein can be operably linked to a promoter sequence for in vitro expression of the RNA-guided endonuclease or fusion protein in bacterial or eukaryotic cells. In such embodiments, the expressed protein can be purified for use in the methods detailed below in sections (IV) and (V). Suitable bacterial promoters include, without limit, T7 promoters, lac operon promoters, trp promoters, variations thereof, and combinations thereof. An exemplary bacterial promoter is tac which is a hybrid of trp and lac promoters. Non-limiting examples of suitable eukaryotic promoters are listed above.
- In additional aspects, the DNA encoding the RNA-guided endonuclease or fusion protein also can be linked to a polyadenylation signal (e.g., SV40 polyA signal, bovine growth hormone (BGH) polyA signal, etc.) and/or at least one transcriptional termination sequence. Additionally, the sequence encoding the RNA-guided endonuclease or fusion protein also can be linked to sequence encoding at least one nuclear localization signal, at least one cell-penetrating domain, and/or at least one marker domain, which are detailed above in section (I).
- In various embodiments, the DNA encoding the RNA-guided endonuclease or fusion protein can be present in a vector. Suitable vectors include plasmid vectors, phagemids, cosmids, artificial/mini-chromosomes, transposons, and viral vectors (e.g., lentiviral vectors, adeno-associated viral vectors, etc.). In one embodiment, the DNA encoding the RNA-guided endonuclease or fusion protein is present in a plasmid vector. Non-limiting examples of suitable plasmid vectors include pUC, pBR322, pET, pBluescript, and variants thereof. The vector can comprise additional expression control sequences (e.g., enhancer sequences, Kozak sequences, polyadenylation sequences, transcriptional termination sequences, etc.), selectable marker sequences (e.g., antibiotic resistance genes), origins of replication, and the like. Additional information can be found in “Current Protocols in Molecular Biology” Ausubel et al., John Wiley & Sons, New York, 2003 or “Molecular Cloning: A Laboratory Manual” Sambrook & Russell, Cold Spring Harbor Press, Cold Spring Harbor, N.Y., 3rd edition, 2001.
- In some embodiments, the expression vector comprising the sequence encoding the RNA-guided endonuclease or fusion protein can further comprise sequence encoding a guide RNA. The sequence encoding the guide RNA generally is operably linked to at least one transcriptional control sequence for expression of the guide RNA in the cell or embryo of interest. For example, DNA encoding the guide RNA can be operably linked to a promoter sequence that is recognized by RNA polymerase III (Pol III). Examples of suitable Pol III promoters include, but are not limited to, mammalian U6, U3, H1, and 7SL RNA promoters.
- Another aspect of the present disclosure encompasses a method for modifying a chromosomal sequence in a eukaryotic cell or embryo. The method comprises introducing into a eukaryotic cell or embryo (i) at least one RNA-guided endonuclease comprising at least one nuclear localization signal or nucleic acid encoding at least one RNA-guided endonuclease comprising at least one nuclear localization signal, (ii) at least one guide RNA or DNA encoding at least one guide RNA, and, optionally, (iii) at least one donor polynucleotide comprising a donor sequence. The method further comprises culturing the cell or embryo such that each guide RNA directs an RNA-guided endonuclease to a targeted site in the chromosomal sequence where the RNA-guided endonuclease introduces a double-stranded break in the targeted site, and the double-stranded break is repaired by a DNA repair process such that the chromosomal sequence is modified.
- In some embodiments, the method can comprise introducing one RNA-guided endonuclease (or encoding nucleic acid) and one guide RNA (or encoding DNA) into a cell or embryo, wherein the RNA-guided endonuclease introduces one double-stranded break in the targeted chromosomal sequence. In embodiments in which the optional donor polynucleotide is not present, the double-stranded break in the chromosomal sequence can be repaired by a non-homologous end-joining (NHEJ) repair process. Because NHEJ is error-prone, deletions of at least one nucleotide, insertions of at least one nucleotide, substitutions of at least one nucleotide, or combinations thereof can occur during the repair of the break. Accordingly, the targeted chromosomal sequence can be modified or inactivated. For example, a single nucleotide change (SNP) can give rise to an altered protein product, or a shift in the reading frame of a coding sequence can inactivate or “knock out” the sequence such that no protein product is made. In embodiments in which the optional donor polynucleotide is present, the donor sequence in the donor polynucleotide can be exchanged with or integrated into the chromosomal sequence at the targeted site during repair of the double-stranded break. For example, in embodiments in which the donor sequence is flanked by upstream and downstream sequences having substantial sequence identity with upstream and downstream sequences, respectively, of the targeted site in the chromosomal sequence, the donor sequence can be exchanged with or integrated into the chromosomal sequence at the targeted site during repair mediated by homology-directed repair process. Alternatively, in embodiments in which the donor sequence is flanked by compatible overhangs (or the compatible overhangs are generated in situ by the RNA-guided endonuclease) the donor sequence can be ligated directly with the cleaved chromosomal sequence by a non-homologous repair process during repair of the double-stranded break. Exchange or integration of the donor sequence into the chromosomal sequence modifies the targeted chromosomal sequence or introduces an exogenous sequence into the chromosomal sequence of the cell or embryo.
- In other embodiments, the method can comprise introducing two RNA-guided endonucleases (or encoding nucleic acid) and two guide RNAs (or encoding DNA) into a cell or embryo, wherein the RNA-guided endonucleases introduce two double-stranded breaks in the chromosomal sequence. See
FIG. 3B . The two breaks can be within several base pairs, within tens of base pairs, or can be separated by many thousands of base pairs. In embodiments in which the optional donor polynucleotide is not present, the resultant double-stranded breaks can be repaired by a non-homologous repair process such that the sequence between the two cleavage sites is lost and/or deletions of at least one nucleotide, insertions of at least one nucleotide, substitutions of at least one nucleotide, or combinations thereof can occur during the repair of the break(s). In embodiments in which the optional donor polynucleotide is present, the donor sequence in the donor polynucleotide can be exchanged with or integrated into the chromosomal sequence during repair of the double-stranded breaks by either a homology-based repair process (e.g., in embodiments in which the donor sequence is flanked by upstream and downstream sequences having substantial sequence identity with upstream and downstream sequences, respectively, of the targeted sites in the chromosomal sequence) or a non-homologous repair process (e.g., in embodiments in which the donor sequence is flanked by compatible overhangs). - In still other embodiments, the method can comprise introducing one RNA-guided endonuclease modified to cleave one strand of a double-stranded sequence (or encoding nucleic acid) and two guide RNAs (or encoding DNA) into a cell or embryo, wherein each guide RNA directs the RNA-guided endonuclease to a specific target site, at which site the modified endonuclease cleaves one strand (i.e., nicks) of the double-stranded chromosomal sequence, and wherein the two nicks are in opposite stands and in close enough proximity to constitute a double-stranded break. See
FIG. 3A . In embodiments in which the optional donor polynucleotide is not present, the resultant double-stranded break can be repaired by a non-homologous repair process such that deletions of at least one nucleotide, insertions of at least one nucleotide, substitutions of at least one nucleotide, or combinations thereof can occur during the repair of the break. In embodiments in which the optional donor polynucleotide is present, the donor sequence in the donor polynucleotide can be exchanged with or integrated into the chromosomal sequence during repair of the double-stranded break by either a homology-based repair process (e.g., in embodiments in which the donor sequence is flanked by upstream and downstream sequences having substantial sequence identity with upstream and downstream sequences, respectively, of the targeted sites in the chromosomal sequence) or a non-homologous repair process (e.g., in embodiments in which the donor sequence is flanked by compatible overhangs). - (a) RNA-Guided Endonuclease
- The method comprises introducing into a cell or embryo at least one RNA-guided endonuclease comprising at least one nuclear localization signal or nucleic acid encoding at least one RNA-guided endonuclease comprising at least one nuclear localization signal. Such RNA-guided endonucleases and nucleic acids encoding RNA-guided endonucleases are described above in sections (I) and (III), respectively.
- In some embodiments, the RNA-guided endonuclease can be introduced into the cell or embryo as an isolated protein. In such embodiments, the RNA-guided endonuclease can further comprise at least one cell-penetrating domain, which facilitates cellular uptake of the protein. In other embodiments, the RNA-guided endonuclease can be introduced into the cell or embryo as an mRNA molecule. In still other embodiments, the RNA-guided endonuclease can be introduced into the cell or embryo as a DNA molecule. In general, DNA sequence encoding the fusion protein is operably linked to a promoter sequence that will function in the cell or embryo of interest. The DNA sequence can be linear, or the DNA sequence can be part of a vector. In still other embodiments, the fusion protein can be introduced into the cell or embryo as an RNA-protein complex comprising the fusion protein and the guide RNA.
- In alternate embodiments, DNA encoding the RNA-guided endonuclease can further comprise sequence encoding a guide RNA. In general, each of the sequences encoding the RNA-guided endonuclease and the guide RNA is operably linked to appropriate promoter control sequence that allows expression of the RNA-guided endonuclease and the guide RNA, respectively, in the cell or embryo. The DNA sequence encoding the RNA-guided endonuclease and the guide RNA can further comprise additional expression control, regulatory, and/or processing sequence(s). The DNA sequence encoding the RNA-guided endonuclease and the guide RNA can be linear or can be part of a vector
- (b) Guide RNA
- The method also comprises introducing into a cell or embryo at least one guide RNA or DNA encoding at least one guide RNA. A guide RNA interacts with the RNA-guided endonuclease to direct the endonuclease to a specific target site, at which site the 5′ end of the guide RNA base pairs with a specific protospacer sequence in the chromosomal sequence.
- Each guide RNA comprises three regions: a first region at the 5′ end that is complementary to the target site in the chromosomal sequence, a second internal region that forms a stem loop structure, and a third 3′ region that remains essentially single-stranded. The first region of each guide RNA is different such that each guide RNA guides a fusion protein to a specific target site. The second and third regions of each guide RNA can be the same in all guide RNAs.
- The first region of the guide RNA is complementary to sequence (i.e., protospacer sequence) at the target site in the chromosomal sequence such that the first region of the guide RNA can base pair with the target site. In various embodiments, the first region of the guide RNA can comprise from about 10 nucleotides to more than about 25 nucleotides. For example, the region of base pairing between the first region of the guide RNA and the target site in the chromosomal sequence can be about 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 22, 23, 24, 25, or more than 25 nucleotides in length. In an exemplary embodiment, the first region of the guide RNA is about 19, 20, or 21 nucleotides in length.
- The guide RNA also comprises a second region that forms a secondary structure. In some embodiments, the secondary structure comprises a stem (or hairpin) and a loop. The length of the loop and the stem can vary. For example, the loop can range from about 3 to about 10 nucleotides in length, and the stem can range from about 6 to about 20 base pairs in length. The stem can comprise one or more bulges of 1 to about 10 nucleotides. Thus, the overall length of the second region can range from about 16 to about 60 nucleotides in length. In an exemplary embodiment, the loop is about 4 nucleotides in length and the stem comprises about 12 base pairs.
- The guide RNA also comprises a third region at the 3′ end that remains essentially single-stranded. Thus, the third region has no complementarity to any chromosomal sequence in the cell of interest and has no complementarity to the rest of the guide RNA. The length of the third region can vary. In general, the third region is more than about 4 nucleotides in length. For example, the length of the third region can range from about 5 to about 60 nucleotides in length.
- The combined length of the second and third regions (also called the universal or scaffold region) of the guide RNA can range from about 30 to about 120 nucleotides in length. In one aspect, the combined length of the second and third regions of the guide RNA range from about 70 to about 100 nucleotides in length.
- In some embodiments, the guide RNA comprises a single molecule comprising all three regions. In other embodiments, the guide RNA can comprise two separate molecules. The first RNA molecule can comprise the first region of the guide RNA and one half of the “stem” of the second region of the guide RNA. The second RNA molecule can comprise the other half of the “stem” of the second region of the guide RNA and the third region of the guide RNA. Thus, in this embodiment, the first and second RNA molecules each contain a sequence of nucleotides that are complementary to one another. For example, in one embodiment, the first and second RNA molecules each comprise a sequence (of about 6 to about 20 nucleotides) that base pairs to the other sequence to form a functional guide RNA.
- In some embodiments, the guide RNA can be introduced into the cell or embryo as a RNA molecule. The RNA molecule can be transcribed in vitro. Alternatively, the RNA molecule can be chemically synthesized.
- In other embodiments, the guide RNA can be introduced into the cell or embryo as a DNA molecule. In such cases, the DNA encoding the guide RNA can be operably linked to promoter control sequence for expression of the guide RNA in the cell or embryo of interest. For example, the RNA coding sequence can be operably linked to a promoter sequence that is recognized by RNA polymerase III (Pol III). Examples of suitable Pol III promoters include, but are not limited to, mammalian U6 or H1 promoters. In exemplary embodiments, the RNA coding sequence is linked to a mouse or human U6 promoter. In other exemplary embodiments, the RNA coding sequence is linked to a mouse or human H1 promoter.
- The DNA molecule encoding the guide RNA can be linear or circular. In some embodiments, the DNA sequence encoding the guide RNA can be part of a vector. Suitable vectors include plasmid vectors, phagemids, cosmids, artificial/mini-chromosomes, transposons, and viral vectors. In an exemplary embodiment, the DNA encoding the RNA-guided endonuclease is present in a plasmid vector. Non-limiting examples of suitable plasmid vectors include pUC, pBR322, pET, pBluescript, and variants thereof. The vector can comprise additional expression control sequences (e.g., enhancer sequences, Kozak sequences, polyadenylation sequences, transcriptional termination sequences, etc.), selectable marker sequences (e.g., antibiotic resistance genes), origins of replication, and the like.
- In embodiments in which both the RNA-guided endonuclease and the guide RNA are introduced into the cell as DNA molecules, each can be part of a separate molecule (e.g., one vector containing fusion protein coding sequence and a second vector containing guide RNA coding sequence) or both can be part of the same molecule (e.g., one vector containing coding (and regulatory) sequence for both the fusion protein and the guide RNA).
- (c) Target Site
- An RNA-guided endonuclease in conjunction with a guide RNA is directed to a target site in the chromosomal sequence, wherein the RNA-guided endonuclease introduces a double-stranded break in the chromosomal sequence. The target site has no sequence limitation except that the sequence is immediately followed (downstream) by a consensus sequence. This consensus sequence is also known as a protospacer adjacent motif (PAM). Examples of PAM include, but are not limited to, NGG, NGGNG, and NNAGAAW (wherein N is defined as any nucleotide and W is defined as either A or T). As detailed above in section (IV)(b), the first region (at the 5′ end) of the guide RNA is complementary to the protospacer of the target sequence. Typically, the first region of the guide RNA is about 19 to 21 nucleotides in length. Thus, in certain aspects, the sequence of the target site in the chromosomal sequence is 5′-N19-21-NGG-3′. The PAM is in italics.
- The target site can be in the coding region of a gene, in an intron of a gene, in a control region of a gene, in a non-coding region between genes, etc. The gene can be a protein coding gene or an RNA coding gene. The gene can be any gene of interest.
- (d) Optional Donor Polynucleotide
- In some embodiments, the method further comprises introducing at least one donor polynucleotide into the embryo. A donor polynucleotide comprises at least one donor sequence. In some aspects, a donor sequence of the donor polynucleotide corresponds to an endogenous or native chromosomal sequence. For example, the donor sequence can be essentially identical to a portion of the chromosomal sequence at or near the targeted site, but which comprises at least one nucleotide change. Thus, the donor sequence can comprise a modified version of the wild type sequence at the targeted site such that, upon integration or exchange with the native sequence, the sequence at the targeted chromosomal location comprises at least one nucleotide change. For example, the change can be an insertion of one or more nucleotides, a deletion of one or more nucleotides, a substitution of one or more nucleotides, or combinations thereof. As a consequence of the integration of the modified sequence, the cell or embryo/animal can produce a modified gene product from the targeted chromosomal sequence.
- In other aspects, the donor sequence of the donor polynucleotide corresponds to an exogenous sequence. As used herein, an “exogenous” sequence refers to a sequence that is not native to the cell or embryo, or a sequence whose native location in the genome of the cell or embryo is in a different location. For example, the exogenous sequence can comprise protein coding sequence, which can be operably linked to an exogenous promoter control sequence such that, upon integration into the genome, the cell or embryo/animal is able to express the protein coded by the integrated sequence. Alternatively, the exogenous sequence can be integrated into the chromosomal sequence such that its expression is regulated by an endogenous promoter control sequence. In other iterations, the exogenous sequence can be a transcriptional control sequence, another expression control sequence, an RNA coding sequence, and so forth. Integration of an exogenous sequence into a chromosomal sequence is termed a “knock in.”
- As can be appreciated by those skilled in the art, the length of the donor sequence can and will vary. For example, the donor sequence can vary in length from several nucleotides to hundreds of nucleotides to hundreds of thousands of nucleotides.
- Donor Polynucleotide Comprising Upstream and Downstream Sequences.
- In some embodiments, the donor sequence in the donor polynucleotide is flanked by an upstream sequence and a downstream sequence, which have substantial sequence identity to sequences located upstream and downstream, respectively, of the targeted site in the chromosomal sequence. Because of these sequence similarities, the upstream and downstream sequences of the donor polynucleotide permit homologous recombination between the donor polynucleotide and the targeted chromosomal sequence such that the donor sequence can be integrated into (or exchanged with) the chromosomal sequence.
- The upstream sequence, as used herein, refers to a nucleic acid sequence that shares substantial sequence identity with a chromosomal sequence upstream of the targeted site. Similarly, the downstream sequence refers to a nucleic acid sequence that shares substantial sequence identity with a chromosomal sequence downstream of the targeted site. As used herein, the phrase “substantial sequence identity” refers to sequences having at least about 75% sequence identity. Thus, the upstream and downstream sequences in the donor polynucleotide can have about 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity with sequence upstream or downstream to the targeted site. In an exemplary embodiment, the upstream and downstream sequences in the donor polynucleotide can have about 95% or 100% sequence identity with chromosomal sequences upstream or downstream to the targeted site. In one embodiment, the upstream sequence shares substantial sequence identity with a chromosomal sequence located immediately upstream of the targeted site (i.e., adjacent to the targeted site). In other embodiments, the upstream sequence shares substantial sequence identity with a chromosomal sequence that is located within about one hundred (100) nucleotides upstream from the targeted site. Thus, for example, the upstream sequence can share substantial sequence identity with a chromosomal sequence that is located about 1 to about 20, about 21 to about 40, about 41 to about 60, about 61 to about 80, or about 81 to about 100 nucleotides upstream from the targeted site. In one embodiment, the downstream sequence shares substantial sequence identity with a chromosomal sequence located immediately downstream of the targeted site (i.e., adjacent to the targeted site). In other embodiments, the downstream sequence shares substantial sequence identity with a chromosomal sequence that is located within about one hundred (100) nucleotides downstream from the targeted site. Thus, for example, the downstream sequence can share substantial sequence identity with a chromosomal sequence that is located about 1 to about 20, about 21 to about 40, about 41 to about 60, about 61 to about 80, or about 81 to about 100 nucleotides downstream from the targeted site.
- Each upstream or downstream sequence can range in length from about 20 nucleotides to about 5000 nucleotides. In some embodiments, upstream and downstream sequences can comprise about 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2100, 2200, 2300, 2400, 2500, 2600, 2800, 3000, 3200, 3400, 3600, 3800, 4000, 4200, 4400, 4600, 4800, or 5000 nucleotides. In exemplary embodiments, upstream and downstream sequences can range in length from about 50 to about 1500 nucleotides.
- Donor polynucleotides comprising the upstream and downstream sequences with sequence similarity to the targeted chromosomal sequence can be linear or circular. In embodiments in which the donor polynucleotide is circular, it can be part of a vector. For example, the vector can be a plasmid vector.
- Donor Polynucleotide Comprising Targeted Cleavage Site(s).
- In other embodiments, the donor polynucleotide can additionally comprise at least one targeted cleavage site that is recognized by the RNA-guided endonuclease. The targeted cleavage site added to the donor polynucleotide can be placed upstream or downstream or both upstream and downstream of the donor sequence. For example, the donor sequence can be flanked by targeted cleavage sites such that, upon cleavage by the RNA-guided endonuclease, the donor sequence is flanked by overhangs that are compatible with those in the chromosomal sequence generated upon cleavage by the RNA-guided endonuclease. Accordingly, the donor sequence can be ligated with the cleaved chromosomal sequence during repair of the double stranded break by a non-homologous repair process. Generally, donor polynucleotides comprising the targeted cleavage site(s) will be circular (e.g., can be part of a plasmid vector).
- Donor Polynucleotide Comprising a Short Donor Sequence with Optional Overhangs.
- In still alternate embodiments, the donor polynucleotide can be a linear molecule comprising a short donor sequence with optional short overhangs that are compatible with the overhangs generated by the RNA-guided endonuclease. In such embodiments, the donor sequence can be ligated directly with the cleaved chromosomal sequence during repair of the double-stranded break. In some instances, the donor sequence can be less than about 1,000, less than about 500, less than about 250, or less than about 100 nucleotides. In certain cases, the donor polynucleotide can be a linear molecule comprising a short donor sequence with blunt ends. In other iterations, the donor polynucleotide can be a linear molecule comprising a short donor sequence with 5′ and/or 3′ overhangs. The overhangs can comprise 1, 2, 3, 4, or 5 nucleotides.
- Typically, the donor polynucleotide will be DNA. The DNA may be single-stranded or double-stranded and/or linear or circular. The donor polynucleotide may be a DNA plasmid, a bacterial artificial chromosome (BAC), a yeast artificial chromosome (YAC), a viral vector, a linear piece of DNA, a PCR fragment, a naked nucleic acid, or a nucleic acid complexed with a delivery vehicle such as a liposome or poloxamer. In certain embodiments, the donor polynucleotide comprising the donor sequence can be part of a plasmid vector. In any of these situations, the donor polynucleotide comprising the donor sequence can further comprise at least one additional sequence.
- (e) Introducing into the Cell or Embryo
- The RNA-targeted endonuclease(s) (or encoding nucleic acid), the guide RNA(s) (or encoding DNA), and the optional donor polynucleotide(s) can be introduced into a cell or embryo by a variety of means. In some embodiments, the cell or embryo is transfected. Suitable transfection methods include calcium phosphate-mediated transfection, nucleofection (or electroporation), cationic polymer transfection (e.g., DEAE-dextran or polyethylenimine), viral transduction, virosome transfection, virion transfection, liposome transfection, cationic liposome transfection, immunoliposome transfection, nonliposomal lipid transfection, dendrimer transfection, heat shock transfection, magnetofection, lipofection, gene gun delivery, impalefection, sonoporation, optical transfection, and proprietary agent-enhanced uptake of nucleic acids. Transfection methods are well known in the art (see, e.g., “Current Protocols in Molecular Biology” Ausubel et al., John Wiley & Sons, New York, 2003 or “Molecular Cloning: A Laboratory Manual” Sambrook & Russell, Cold Spring Harbor Press, Cold Spring Harbor, N.Y., 3rd edition, 2001). In other embodiments, the molecules are introduced into the cell or embryo by microinjection. Typically, the embryo is a fertilized one-cell stage embryo of the species of interest. For example, the molecules can be injected into the pronuclei of one cell embryos.
- The RNA-targeted endonuclease(s) (or encoding nucleic acid), the guide RNA(s) (or DNAs encoding the guide RNA), and the optional donor polynucleotide(s) can be introduced into the cell or embryo simultaneously or sequentially. The ratio of the RNA-targeted endonuclease(s) (or encoding nucleic acid) to the guide RNA(s) (or encoding DNA) generally will be about stoichiometric such that they can form an RNA-protein complex. In one embodiment, DNA encoding an RNA-targeted endonuclease and DNA encoding a guide RNA are delivered together within the plasmid vector.
- (f) Culturing the Cell or Embryo
- The method further comprises maintaining the cell or embryo under appropriate conditions such that the guide RNA(s) directs the RNA-guided endonuclease(s) to the targeted site(s) in the chromosomal sequence, and the RNA-guided endonuclease(s) introduce at least one double-stranded break in the chromosomal sequence. A double-stranded break can be repaired by a DNA repair process such that the chromosomal sequence is modified by a deletion of at least one nucleotide, an insertion of at least one nucleotide, a substitution of at least one nucleotide, or a combination thereof.
- In embodiments in which no donor polynucleotide is introduced into the cell or embryo, the double-stranded break can be repaired via a non-homologous end-joining (NHEJ) repair process. Because NHEJ is error-prone, deletions of at least one nucleotide, insertions of at least one nucleotide, substitutions of at least one nucleotide, or combinations thereof can occur during the repair of the break. Accordingly, the sequence at the chromosomal sequence can be modified such that the reading frame of a coding region can be shifted and that the chromosomal sequence is inactivated or “knocked out.” An inactivated protein-coding chromosomal sequence does not give rise to the protein coded by the wild type chromosomal sequence.
- In embodiments in which a donor polynucleotide comprising upstream and downstream sequences is introduced into the cell or embryo, the double-stranded break can be repaired by a homology-directed repair (HDR) process such that the donor sequence is integrated into the chromosomal sequence. Accordingly, an exogenous sequence can be integrated into the genome of the cell or embryo, or the targeted chromosomal sequence can be modified by exchange of a modified sequence for the wild type chromosomal sequence.
- In embodiments in which a donor polynucleotide comprising the targeted cleave site is introduced into the cell or embryo, the RNA-guided endonuclease can cleave both the targeted chromosomal sequence and the donor polynucleotide. The linearized donor polynucleotide can be integrated into the chromosomal sequence at the site of the double-stranded break by ligation between the donor polynucleotide and the cleaved chromosomal sequence via a NHEJ process.
- In embodiments in which a linear donor polynucleotide comprising a short donor sequence is introduced into the cell or embryo, the short donor sequence can be integrated into the chromosomal sequence at the site of the double-stranded break via a NHEJ process. The integration can proceed via the ligation of blunt ends between the short donor sequence and the chromosomal sequence at the site of the double stranded break. Alternatively, the integration can proceed via the ligation of sticky ends (i.e., having 5′ or 3′ overhangs) between a short donor sequence that is flanked by overhangs that are compatible with those generated by the RNA-targeting endonuclease in the cleaved chromosomal sequence.
- In general, the cell is maintained under conditions appropriate for cell growth and/or maintenance. Suitable cell culture conditions are well known in the art and are described, for example, in Santiago et al. (2008) PNAS 105:5809-5814; Moehle et al. (2007) PNAS 104:3055-3060; Urnov et al. (2005) Nature 435:646-651; and Lombardo et al (2007) Nat. Biotechnology 25:1298-1306. Those of skill in the art appreciate that methods for culturing cells are known in the art and can and will vary depending on the cell type. Routine optimization may be used, in all cases, to determine the best techniques for a particular cell type.
- An embryo can be cultured in vitro (e.g., in cell culture). Typically, the embryo is cultured at an appropriate temperature and in appropriate media with the necessary O2/CO2 ratio to allow the expression of the RNA endonuclease and guide RNA, if necessary. Suitable non-limiting examples of media include M2, M16, KSOM, BMOC, and HTF media. A skilled artisan will appreciate that culture conditions can and will vary depending on the species of embryo. Routine optimization may be used, in all cases, to determine the best culture conditions for a particular species of embryo. In some cases, a cell line may be derived from an in vitro-cultured embryo (e.g., an embryonic stem cell line).
- Alternatively, an embryo may be cultured in vivo by transferring the embryo into the uterus of a female host. Generally speaking the female host is from the same or similar species as the embryo. Preferably, the female host is pseudo-pregnant. Methods of preparing pseudo-pregnant female hosts are known in the art. Additionally, methods of transferring an embryo into a female host are known. Culturing an embryo in vivo permits the embryo to develop and can result in a live birth of an animal derived from the embryo. Such an animal would comprise the modified chromosomal sequence in every cell of the body.
- (g) Cell and Embryo Types
- A variety of eukaryotic cells and embryos are suitable for use in the method. For example, the cell can be a human cell, a non-human mammalian cell, a non-mammalian vertebrate cell, an invertebrate cell, an insect cell, a plant cell, a yeast cell, or a single cell eukaryotic organism. In general, the embryo is non-human mammalian embryo. In specific embodiments, the embryos can be a one cell non-human mammalian embryo. Exemplary mammalian embryos, including one cell embryos, include without limit mouse, rat, hamster, rodent, rabbit, feline, canine, ovine, porcine, bovine, equine, and primate embryos. In still other embodiments, the cell can be a stem cell. Suitable stem cells include without limit embryonic stem cells, ES-like stem cells, fetal stem cells, adult stem cells, pluripotent stem cells, induced pluripotent stem cells, multipotent stem cells, oligopotent stem cells, unipotent stem cells and others. In exemplary embodiments, the cell is a mammalian cell.
- Non-limiting examples of suitable mammalian cells include Chinese hamster ovary (CHO) cells, baby hamster kidney (BHK) cells; mouse myeloma NS0 cells, mouse embryonic fibroblast 3T3 cells (NIH3T3), mouse B lymphoma A20 cells; mouse melanoma B16 cells; mouse myoblast C2C12 cells; mouse myeloma SP2/0 cells; mouse embryonic mesenchymal C3H-10T1/2 cells; mouse carcinoma CT26 cells, mouse prostate DuCuP cells; mouse breast EMT6 cells; mouse hepatoma Hepa1c1c7 cells; mouse myeloma J5582 cells; mouse epithelial MTD-1A cells; mouse myocardial MyEnd cells; mouse renal RenCa cells; mouse pancreatic RIN-5F cells; mouse melanoma X64 cells; mouse lymphoma YAC-1 cells; rat glioblastoma 9 L cells; rat B lymphoma RBL cells; rat neuroblastoma B35 cells; rat hepatoma cells (HTC); buffalo rat liver BRL 3A cells; canine kidney cells (MDCK); canine mammary (CMT) cells; rat osteosarcoma D17 cells; rat monocyte/macrophage DH82 cells; monkey kidney SV-40 transformed fibroblast (COS7) cells; monkey kidney CVI-76 cells; African green monkey kidney (VERO-76) cells; human embryonic kidney cells (HEK293, HEK293T); human cervical carcinoma cells (HELA); human lung cells (W138); human liver cells (Hep G2); human U2-OS osteosarcoma cells, human A549 cells, human A-431 cells, and human K562 cells. An extensive list of mammalian cell lines may be found in the American Type Culture Collection catalog (ATCC, Mamassas, Va.).
- Another aspect of the present disclosure encompasses a method for modifying a chromosomal sequence or regulating expression of a chromosomal sequence in a cell or embryo. The method comprises introducing into the cell or embryo (a) at least one fusion protein or nucleic acid encoding at least one fusion protein, wherein the fusion protein comprises a CRISPR/Cas-like protein or a fragment thereof and an effector domain, and (b) at least one guide RNA or DNA encoding the guide RNA, wherein the guide RNA guides the CRISPR/Cas-like protein of the fusion protein to a targeted site in the chromosomal sequence and the effector domain of the fusion protein modifies the chromosomal sequence or regulates expression of the chromosomal sequence.
- Fusion proteins comprising a CRISPR/Cas-like protein or a fragment thereof and an effector domain are detailed above in section (II). In general, the fusion proteins disclosed herein further comprise at least one nuclear localization signal. Nucleic acids encoding fusion proteins are described above in section (III). In some embodiments, the fusion protein can be introduced into the cell or embryo as an isolated protein (which can further comprise a cell-penetrating domain). Furthermore, the isolated fusion protein can be part of a protein-RNA complex comprising the guide RNA. In other embodiments, the fusion protein can be introduced into the cell or embryo as a RNA molecule (which can be capped and/or polyadenylated). In still other embodiments, the fusion protein can be introduced into the cell or embryo as a DNA molecule. For example, the fusion protein and the guide RNA can be introduced into the cell or embryo as discrete DNA molecules or as part of the same DNA molecule. Such DNA molecules can be plasmid vectors.
- In some embodiments, the method further comprises introducing into the cell or embryo at least one zinc finger nuclease. Zinc finger nucleases are described above in section (II)(d). In still other embodiments, the method further comprises introducing into the cell or embryo at least one donor polynucleotide. Donor polynucleotides are detailed above in section (IV)(d). Means for introducing molecules into cells or embryos, as well as means for culturing cell or embryos are described above in sections (IV)(e) and (IV)(f), respectively. Suitable cells and embryos are described above in section (IV)(g).
- In certain embodiments in which the effector domain of the fusion protein is a cleavage domain (e.g., a FokI cleavage domain or a modified FokI cleavage domain), the method can comprise introducing into the cell or embryo one fusion protein (or nucleic acid encoding one fusion protein) and two guide RNAs (or DNA encoding two guide RNAs). The two guide RNAs direct the fusion protein to two different target sites in the chromosomal sequence, wherein the fusion protein dimerizes (e.g., form a homodimer) such that the two cleavage domains can introduce a double stranded break into the chromosomal sequence. See
FIG. 1A . In embodiments in which the optional donor polynucleotide is not present, the double-stranded break in the chromosomal sequence can be repaired by a non-homologous end-joining (NHEJ) repair process. Because NHEJ is error-prone, deletions of at least one nucleotide, insertions of at least one nucleotide, substitutions of at least one nucleotide, or combinations thereof can occur during the repair of the break. Accordingly, the targeted chromosomal sequence can be modified or inactivated. For example, a single nucleotide change (SNP) can give rise to an altered protein product, or a shift in the reading frame of a coding sequence can inactivate or “knock out” the sequence such that no protein product is made. In embodiments in which the optional donor polynucleotide is present, the donor sequence in the donor polynucleotide can be exchanged with or integrated into the chromosomal sequence at the targeted site during repair of the double-stranded break. For example, in embodiments in which the donor sequence is flanked by upstream and downstream sequences having substantial sequence identity with upstream and downstream sequences, respectively, of the targeted site in the chromosomal sequence, the donor sequence can be exchanged with or integrated into the chromosomal sequence at the targeted site during repair mediated by homology-directed repair process. Alternatively, in embodiments in which the donor sequence is flanked by compatible overhangs (or the compatible overhangs are generated in situ by the RNA-guided endonuclease) the donor sequence can be ligated directly with the cleaved chromosomal sequence by a non-homologous repair process during repair of the double-stranded break. Exchange or integration of the donor sequence into the chromosomal sequence modifies the targeted chromosomal sequence or introduces an exogenous sequence into the chromosomal sequence of the cell or embryo. - In other embodiments in which the effector domain of the fusion protein is a cleavage domain (e.g., a FokI cleavage domain or a modified FokI cleavage domain), the method can comprise introducing into the cell or embryo two different fusion proteins (or nucleic acid encoding two different fusion proteins) and two guide RNAs (or DNA encoding two guide RNAs). The fusion proteins can differ as detailed above in section (II). Each guide RNA directs a fusion protein to a specific target site in the chromosomal sequence, wherein the fusion proteins dimerize (e.g., form a heterodimer) such that the two cleavage domains can introduce a double stranded break into the chromosomal sequence. In embodiments in which the optional donor polynucleotide is not present, the resultant double-stranded breaks can be repaired by a non-homologous repair process such that deletions of at least one nucleotide, insertions of at least one nucleotide, substitutions of at least one nucleotide, or combinations thereof can occur during the repair of the break. In embodiments in which the optional donor polynucleotide is present, the donor sequence in the donor polynucleotide can be exchanged with or integrated into the chromosomal sequence during repair of the double-stranded break by either a homology-based repair process (e.g., in embodiments in which the donor sequence is flanked by upstream and downstream sequences having substantial sequence identity with upstream and downstream sequences, respectively, of the targeted sites in the chromosomal sequence) or a non-homologous repair process (e.g., in embodiments in which the donor sequence is flanked by compatible overhangs).
- In still other embodiments in which the effector domain of the fusion protein is a cleavage domain (e.g., a FokI cleavage domain or a modified FokI cleavage domain), the method can comprise introducing into the cell or embryo one fusion protein (or nucleic acid encoding one fusion protein), one guide RNA (or DNA encoding one guide RNA), and one zinc finger nuclease (or nucleic acid encoding the zinc finger nuclease), wherein the zinc finger nuclease comprises a FokI cleavage domain or a modified FokI cleavage domain. The guide RNA directs the fusion protein to a specific chromosomal sequence, and the zinc finger nuclease is directed to another chromosomal sequence, wherein the fusion protein and the zinc finger nuclease dimerize such that the cleavage domain of the fusion protein and the cleavage domain of the zinc finger nuclease can introduce a double stranded break into the chromosomal sequence. See
FIG. 1B . In embodiments in which the optional donor polynucleotide is not present, the resultant double-stranded breaks can be repaired by a non-homologous repair process such that deletions of at least one nucleotide, insertions of at least one nucleotide, substitutions of at least one nucleotide, or combinations thereof can occur during the repair of the break. In embodiments in which the optional donor polynucleotide is present, the donor sequence in the donor polynucleotide can be exchanged with or integrated into the chromosomal sequence during repair of the double-stranded break by either a homology-based repair process (e.g., in embodiments in which the donor sequence is flanked by upstream and downstream sequences having substantial sequence identity with upstream and downstream sequences, respectively, of the targeted sites in the chromosomal sequence) or a non-homologous repair process (e.g., in embodiments in which the donor sequence is flanked by compatible overhangs). - In still other embodiments in which the effector domain of the fusion protein is a transcriptional activation domain or a transcriptional repressor domain, the method can comprise introducing into the cell or embryo one fusion protein (or nucleic acid encoding one fusion protein) and one guide RNA (or DNA encoding one guide RNA). The guide RNA directs the fusion protein to a specific chromosomal sequence, wherein the transcriptional activation domain or a transcriptional repressor domain activates or represses expression, respectively, of the targeted chromosomal sequence. See
FIG. 2A . - In alternate embodiments in which the effector domain of the fusion protein is an epigenetic modification domain, the method can comprise introducing into the cell or embryo one fusion protein (or nucleic acid encoding one fusion protein) and one guide RNA (or DNA encoding one guide RNA). The guide RNA directs the fusion protein to a specific chromosomal sequence, wherein the epigenetic modification domain modifies the structure of the targeted the chromosomal sequence. See
FIG. 2A . Epigenetic modifications include acetylation, methylation of histone proteins and/or nucleotide methylation. In some instances, structural modification of the chromosomal sequence leads to changes in expression of the chromosomal sequence. - The present disclosure encompasses genetically modified cells, non-human embryos, and non-human animals comprising at least one chromosomal sequence that has been modified using an RNA-guided endonuclease-mediated or fusion protein-mediated process, for example, using the methods described herein. The disclosure provides cells comprising at least one DNA or RNA molecule encoding an RNA-guided endonuclease or fusion protein targeted to a chromosomal sequence of interest or a fusion protein, at least one guide RNA, and optionally one or more donor polynucleotide(s). The disclosure also provides non-human embryos comprising at least one DNA or RNA molecule encoding an RNA-guided endonuclease or fusion protein targeted to a chromosomal sequence of interest, at least one guide RNA, and optionally one or more donor polynucleotide(s).
- The present disclosure provides genetically modified non-human animals, non-human embryos, or animal cells comprising at least one modified chromosomal sequence. The modified chromosomal sequence may be modified such that it is (1) inactivated, (2) has an altered expression or produces an altered protein product, or (3) comprises an integrated sequence. The chromosomal sequence is modified with an RNA guided endonuclease-mediated or fusion protein-mediated process, using the methods described herein.
- As discussed, one aspect of the present disclosure provides a genetically modified animal in which at least one chromosomal sequence has been modified. In one embodiment, the genetically modified animal comprises at least one inactivated chromosomal sequence. The modified chromosomal sequence may be inactivated such that the sequence is not transcribed and/or a functional protein product is not produced. Thus, a genetically modified animal comprising an inactivated chromosomal sequence may be termed a “knock out” or a “conditional knock out.” The inactivated chromosomal sequence can include a deletion mutation (i.e., deletion of one or more nucleotides), an insertion mutation (i.e., insertion of one or more nucleotides), or a nonsense mutation (i.e., substitution of a single nucleotide for another nucleotide such that a stop codon is introduced). As a consequence of the mutation, the targeted chromosomal sequence is inactivated and a functional protein is not produced. The inactivated chromosomal sequence comprises no exogenously introduced sequence. Also included herein are genetically modified animals in which two, three, four, five, six, seven, eight, nine, or ten or more chromosomal sequences are inactivated.
- In another embodiment, the modified chromosomal sequence can be altered such that it codes for a variant protein product. For example, a genetically modified animal comprising a modified chromosomal sequence can comprise a targeted point mutation(s) or other modification such that an altered protein product is produced. In one embodiment, the chromosomal sequence can be modified such that at least one nucleotide is changed and the expressed protein comprises one changed amino acid residue (missense mutation). In another embodiment, the chromosomal sequence can be modified to comprise more than one missense mutation such that more than one amino acid is changed. Additionally, the chromosomal sequence can be modified to have a three nucleotide deletion or insertion such that the expressed protein comprises a single amino acid deletion or insertion. The altered or variant protein can have altered properties or activities compared to the wild type protein, such as altered substrate specificity, altered enzyme activity, altered kinetic rates, etc.
- In another embodiment, the genetically modified animal can comprise at least one chromosomally integrated sequence. A genetically modified animal comprising an integrated sequence may be termed a “knock in” or a “conditional knock in.” The chromosomally integrated sequence can, for example, encode an orthologous protein, an endogenous protein, or combinations of both. In one embodiment, a sequence encoding an orthologous protein or an endogenous protein can be integrated into a chromosomal sequence encoding a protein such that the chromosomal sequence is inactivated, but the exogenous sequence is expressed. In such a case, the sequence encoding the orthologous protein or endogenous protein may be operably linked to a promoter control sequence. Alternatively, a sequence encoding an orthologous protein or an endogenous protein may be integrated into a chromosomal sequence without affecting expression of a chromosomal sequence. For example, a sequence encoding a protein can be integrated into a “safe harbor” locus, such as the Rosa26 locus, HPRT locus, or AAV locus. The present disclosure also encompasses genetically modified animals in which two, three, four, five, six, seven, eight, nine, or ten or more sequences, including sequences encoding protein(s), are integrated into the genome.
- The chromosomally integrated sequence encoding a protein can encode the wild type form of a protein of interest or can encode a protein comprising at least one modification such that an altered version of the protein is produced. For example, a chromosomally integrated sequence encoding a protein related to a disease or disorder can comprise at least one modification such that the altered version of the protein produced causes or potentiates the associated disorder. Alternatively, the chromosomally integrated sequence encoding a protein related to a disease or disorder can comprise at least one modification such that the altered version of the protein protects against the development of the associated disorder.
- In an additional embodiment, the genetically modified animal can be a “humanized” animal comprising at least one chromosomally integrated sequence encoding a functional human protein. The functional human protein can have no corresponding ortholog in the genetically modified animal. Alternatively, the wild type animal from which the genetically modified animal is derived may comprise an ortholog corresponding to the functional human protein. In this case, the orthologous sequence in the “humanized” animal is inactivated such that no functional protein is made and the “humanized” animal comprises at least one chromosomally integrated sequence encoding the human protein.
- In yet another embodiment, the genetically modified animal can comprise at least one modified chromosomal sequence encoding a protein such that the expression pattern of the protein is altered. For example, regulatory regions controlling the expression of the protein, such as a promoter or a transcription factor binding site, can be altered such that the protein is over-produced, or the tissue-specific or temporal expression of the protein is altered, or a combination thereof. Alternatively, the expression pattern of the protein can be altered using a conditional knockout system. A non-limiting example of a conditional knockout system includes a Cre-lox recombination system. A Cre-lox recombination system comprises a Cre recombinase enzyme, a site-specific DNA recombinase that can catalyze the recombination of a nucleic acid sequence between specific sites (lox sites) in a nucleic acid molecule. Methods of using this system to produce temporal and tissue specific expression are known in the art. In general, a genetically modified animal is generated with lox sites flanking a chromosomal sequence. The genetically modified animal comprising the lox-flanked chromosomal sequence can then be crossed with another genetically modified animal expressing Cre recombinase. Progeny animals comprising the lox-flanked chromosomal sequence and the Cre recombinase are then produced, and the lox-flanked chromosomal sequence is recombined, leading to deletion or inversion of the chromosomal sequence encoding the protein. Expression of Cre recombinase can be temporally and conditionally regulated to effect temporally and conditionally regulated recombination of the chromosomal sequence.
- In any of these embodiments, the genetically modified animal disclosed herein can be heterozygous for the modified chromosomal sequence. Alternatively, the genetically modified animal can be homozygous for the modified chromosomal sequence.
- The genetically modified animals disclosed herein can be crossbred to create animals comprising more than one modified chromosomal sequence or to create animals that are homozygous for one or more modified chromosomal sequences. For example, two animals comprising the same modified chromosomal sequence can be crossbred to create an animal homozygous for the modified chromosomal sequence. Alternatively, animals with different modified chromosomal sequences can be crossbred to create an animal comprising both modified chromosomal sequences.
- For example, a first animal comprising an inactivated chromosomal sequence gene “x” can be crossed with a second animal comprising a chromosomally integrated sequence encoding a human gene “X” protein to give rise to “humanized” gene “X” offspring comprising both the inactivated gene “x” chromosomal sequence and the chromosomally integrated human gene “X” sequence. Also, a humanized gene “X” animal can be crossed with a humanized gene “Y” animal to create humanized gene X/gene Y offspring. Those of skill in the art will appreciate that many combinations are possible.
- In other embodiments, an animal comprising a modified chromosomal sequence can be crossbred to combine the modified chromosomal sequence with other genetic backgrounds. By way of non-limiting example, other genetic backgrounds may include wild-type genetic backgrounds, genetic backgrounds with deletion mutations, genetic backgrounds with another targeted integration, and genetic backgrounds with non-targeted integrations.
- The term “animal,” as used herein, refers to a non-human animal. The animal may be an embryo, a juvenile, or an adult. Suitable animals include vertebrates such as mammals, birds, reptiles, amphibians, shellfish, and fish. Examples of suitable mammals include without limit rodents, companion animals, livestock, and primates. Non-limiting examples of rodents include mice, rats, hamsters, gerbils, and guinea pigs. Suitable companion animals include but are not limited to cats, dogs, rabbits, hedgehogs, and ferrets. Non-limiting examples of livestock include horses, goats, sheep, swine, cattle, llamas, and alpacas. Suitable primates include but are not limited to capuchin monkeys, chimpanzees, lemurs, macaques, marmosets, tamarins, spider monkeys, squirrel monkeys, and vervet monkeys. Non-limiting examples of birds include chickens, turkeys, ducks, and geese. Alternatively, the animal may be an invertebrate such as an insect, a nematode, and the like. Non-limiting examples of insects include Drosophila and mosquitoes. An exemplary animal is a rat. Non-limiting examples of suitable rat strains include Dahl Salt-Sensitive, Fischer 344, Lewis, Long Evans Hooded, Sprague-Dawley, and Wistar. In one embodiment, the animal is not a genetically modified mouse. In each of the foregoing iterations of suitable animals for the invention, the animal does not include exogenously introduced, randomly integrated transposon sequences.
- A further aspect of the present disclosure provides genetically modified cells or cell lines comprising at least one modified chromosomal sequence. The genetically modified cell or cell line can be derived from any of the genetically modified animals disclosed herein. Alternatively, the chromosomal sequence can be modified in a cell as described herein above (in the paragraphs describing chromosomal sequence modifications in animals) using the methods descried herein. The disclosure also encompasses a lysate of said cells or cell lines.
- In general, the cells are eukaryotic cells. Suitable host cells include fungi or yeast, such as Pichia, Saccharomyces, or Schizosaccharomyces; insect cells, such as SF9 cells from Spodoptera frugiperda or S2 cells from Drosophila melanogaster; and animal cells, such as mouse, rat, hamster, non-human primate, or human cells. Exemplary cells are mammalian. The mammalian cells can be primary cells. In general, any primary cell that is sensitive to double strand breaks may be used. The cells may be of a variety of cell types, e.g., fibroblast, myoblast, T or B cell, macrophage, epithelial cell, and so forth.
- When mammalian cell lines are used, the cell line can be any established cell line or a primary cell line that is not yet described. The cell line can be adherent or non-adherent, or the cell line can be grown under conditions that encourage adherent, non-adherent or organotypic growth using standard techniques known to individuals skilled in the art. Non-limiting examples of suitable mammalian cells and cell lines are provided herein in section (IV)(g). In still other embodiments, the cell can be a stem cell. Non-limiting examples of suitable stem cells are provided in section (IV)(g).
- The present disclosure also provides a genetically modified non-human embryo comprising at least one modified chromosomal sequence. The chromosomal sequence can be modified in an embryo as described herein above (in the paragraphs describing chromosomal sequence modifications in animals) using the methods descried herein. In one embodiment, the embryo is a non-human fertilized one-cell stage embryo of the animal species of interest. Exemplary mammalian embryos, including one cell embryos, include without limit, mouse, rat, hamster, rodent, rabbit, feline, canine, ovine, porcine, bovine, equine, and primate embryos.
- Unless defined otherwise, all technical and scientific terms used herein have the meaning commonly understood by a person skilled in the art to which this invention belongs. The following references provide one of skill with a general definition of many of the terms used in this invention: Singleton et al., Dictionary of Microbiology and Molecular Biology (2nd ed. 1994); The Cambridge Dictionary of Science and Technology (Walker ed., 1988); The Glossary of Genetics, 5th Ed., R. Rieger et al. (eds.), Springer Verlag (1991); and Hale & Marham, The Harper Collins Dictionary of Biology (1991). As used herein, the following terms have the meanings ascribed to them unless specified otherwise.
- When introducing elements of the present disclosure or the preferred embodiments(s) thereof, the articles “a”, “an”, “the” and “said” are intended to mean that there are one or more of the elements. The terms “comprising”, “including” and “having” are intended to be inclusive and mean that there may be additional elements other than the listed elements.
- As used herein, the term “endogenous sequence” refers to a chromosomal sequence that is native to the cell.
- The term “exogenous,” as used herein, refers to a sequence that is not native to the cell, or a chromosomal sequence whose native location in the genome of the cell is in a different chromosomal location.
- A “gene,” as used herein, refers to a DNA region (including exons and introns) encoding a gene product, as well as all DNA regions which regulate the production of the gene product, whether or not such regulatory sequences are adjacent to coding and/or transcribed sequences. Accordingly, a gene includes, but is not necessarily limited to, promoter sequences, terminators, translational regulatory sequences such as ribosome binding sites and internal ribosome entry sites, enhancers, silencers, insulators, boundary elements, replication origins, matrix attachment sites, and locus control regions.
- The term “heterologous” refers to an entity that is not endogenous or native to the cell of interest. For example, a heterologous protein refers to a protein that is derived from or was originally derived from an exogenous source, such as an exogenously introduced nucleic acid sequence. In some instances, the heterologous protein is not normally produced by the cell of interest.
- The terms “nucleic acid” and “polynucleotide” refer to a deoxyribonucleotide or ribonucleotide polymer, in linear or circular conformation, and in either single- or double-stranded form. For the purposes of the present disclosure, these terms are not to be construed as limiting with respect to the length of a polymer. The terms can encompass known analogs of natural nucleotides, as well as nucleotides that are modified in the base, sugar and/or phosphate moieties (e.g., phosphorothioate backbones). In general, an analog of a particular nucleotide has the same base-pairing specificity; i.e., an analog of A will base-pair with T.
- The term “nucleotide” refers to deoxyribonucleotides or ribonucleotides. The nucleotides may be standard nucleotides (i.e., adenosine, guanosine, cytidine, thymidine, and uridine) or nucleotide analogs. A nucleotide analog refers to a nucleotide having a modified purine or pyrimidine base or a modified ribose moiety. A nucleotide analog may be a naturally occurring nucleotide (e.g., inosine) or a non-naturally occurring nucleotide. Non-limiting examples of modifications on the sugar or base moieties of a nucleotide include the addition (or removal) of acetyl groups, amino groups, carboxyl groups, carboxymethyl groups, hydroxyl groups, methyl groups, phosphoryl groups, and thiol groups, as well as the substitution of the carbon and nitrogen atoms of the bases with other atoms (e.g., 7-deaza purines). Nucleotide analogs also include dideoxy nucleotides, 2′-O-methyl nucleotides, locked nucleic acids (LNA), peptide nucleic acids (PNA), and morpholinos.
- The terms “polypeptide” and “protein” are used interchangeably to refer to a polymer of amino acid residues.
- Techniques for determining nucleic acid and amino acid sequence identity are known in the art. Typically, such techniques include determining the nucleotide sequence of the mRNA for a gene and/or determining the amino acid sequence encoded thereby, and comparing these sequences to a second nucleotide or amino acid sequence. Genomic sequences can also be determined and compared in this fashion. In general, identity refers to an exact nucleotide-to-nucleotide or amino acid-to-amino acid correspondence of two polynucleotides or polypeptide sequences, respectively. Two or more sequences (polynucleotide or amino acid) can be compared by determining their percent identity. The percent identity of two sequences, whether nucleic acid or amino acid sequences, is the number of exact matches between two aligned sequences divided by the length of the shorter sequences and multiplied by 100. An approximate alignment for nucleic acid sequences is provided by the local homology algorithm of Smith and Waterman, Advances in Applied Mathematics 2:482-489 (1981). This algorithm can be applied to amino acid sequences by using the scoring matrix developed by Dayhoff, Atlas of Protein Sequences and Structure, M. O. Dayhoff ed., 5 suppl. 3:353-358, National Biomedical Research Foundation, Washington, D.C., USA, and normalized by Gribskov, Nucl. Acids Res. 14(6):6745-6763 (1986). An exemplary implementation of this algorithm to determine percent identity of a sequence is provided by the Genetics Computer Group (Madison, Wis.) in the “BestFit” utility application. Other suitable programs for calculating the percent identity or similarity between sequences are generally known in the art, for example, another alignment program is BLAST, used with default parameters. For example, BLASTN and BLASTP can be used using the following default parameters: genetic code=standard; filter=none; strand=both; cutoff=60; expect=10; Matrix=BLOSUM62; Descriptions=50 sequences; sort by=HIGH SCORE; Databases=non-redundant, GenBank+EMBL+DDBJ+PDB+GenBank CDS translations+Swiss protein+Spupdate+PIR. Details of these programs can be found on the GenBank website.
- As various changes could be made in the above-described cells and methods without departing from the scope of the invention, it is intended that all matter contained in the above description and in the examples given below, shall be interpreted as illustrative and not in a limiting sense.
- The following examples illustrate certain aspects of the invention.
- A Cas9 gene from Streptococcus pyogenes strain MGAS15252 (Accession number YP—005388840.1) was optimized with Homo sapiens codon preference to enhance its translation in mammalian cells. The Cas9 gene also was modified by adding a nuclear localization signal PKKKRKV (SEQ ID NO:1) at the C terminus for targeting the protein into the nuclei of mammalian cells. Table 1 presents the modified Cas9 amino acid sequence, with the nuclear localization sequence underlined. Table 2 presents the codon optimized, modified Cas9 DNA sequence.
-
TABLE 1 Modified Cas9 Amino Acid Sequence MDKKYSIGLDIGTNSVGWAVITDDYKVPSKKFKVLGNTDRHSIKKNLIGA LLFGSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHR LEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLADSTDKAD LRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQIYNQLFEENP INASRVDAKAILSARLSKSRRLENLIAQLPGEKRNGLFGNLIALSLGLTP NFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAI LLSDILRVNSEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEI FFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLR KQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPY YVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDK NLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVD LLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGAYHDLLKI IKDKDFLDNEENEDILEDIVLTLTLFEDRGMIEERLKTYAHLFDDKVMKQ LKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDD SLTFKEDIQKAQVSGQGHSLHEQIANLAGSPAIKKGILQTVKIVDELVKV MGHKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPV ENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDHIVPQSFIKDDS IDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLT KAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIR EVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKKY PKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTEIT LANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQ TGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEK GKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKY SLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSPED NEGKQLFVEQHKHYLDEIIEGISEFSKRVILADANLDKVLSAYNKHRDKP IREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQS ITGLYETRIDLSQLGGDPKKKRKV (SEQ ID NO:9) -
TABLE 2 Optimized Cas9 DNA Sequence (5′-3′) ATGGACAAGAAGTACAGCATCGGCCTGGACATCGGCACCAACTCTGTGGG CTGGGCCGTGATCACCGACGACTACAAGGTGCCCAGCAAGAAATTCAAGG TGCTGGGCAACACCGACCGGCACAGCATCAAGAAGAACCTGATCGGCGCC CTGCTGTTCGGCTCTGGCGAAACAGCCGAGGCCACCCGGCTGAAGAGAAC CGCCAGAAGAAGATACACCAGACGGAAGAACCGGATCTGCTATCTGCAAG AGATCTTCAGCAACGAGATGGCCAAGGTGGACGACAGCTTCTTCCACAGA CTGGAAGAGTCCTTCCTGGTGGAAGAGGATAAGAAGCACGAGCGGCACCC CATCTTCGGCAACATCGTGGACGAGGTGGCCTACCACGAGAAGTACCCCA CCATCTACCACCTGAGAAAGAAGCTGGCCGACAGCACCGACAAGGCCGAC CTGAGACTGATCTACCTGGCCCTGGCCCACATGATCAAGTTCCGGGGCCA CTTCCTGATCGAGGGCGACCTGAACCCCGACAACAGCGACGTGGACAAGC TGTTCATCCAGCTGGTGCAGATCTACAATCAGCTGTTCGAGGAAAACCCC ATCAACGCCAGCAGAGTGGACGCCAAGGCCATCCTGAGCGCCAGACTGAG CAAGAGCAGACGGCTGGAAAATCTGATCGCCCAGCTGCCCGGCGAGAAGC GGAATGGCCTGTTCGGCAACCTGATTGCCCTGAGCCTGGGCCTGACCCCC AACTTCAAGAGCAACTTCGACCTGGCCGAGGATGCCAAACTGCAGCTGAG CAAGGACACCTACGACGACGACCTGGACAACCTGCTGGCCCAGATCGGCG ACCAGTACGCCGACCTGTTTCTGGCCGCCAAGAACCTGTCCGACGCCATC CTGCTGAGCGACATCCTGAGAGTGAACAGCGAGATCACCAAGGCCCCCCT GTCCGCCTCTATGATCAAGAGATACGACGAGCACCACCAGGACCTGACCC TGCTGAAAGCTCTCGTGCGGCAGCAGCTGCCTGAGAAGTACAAAGAGATT TTCTTCGACCAGAGCAAGAACGGCTACGCCGGCTACATCGATGGCGGAGC CAGCCAGGAAGAGTTCTACAAGTTCATCAAGCCCATCCTGGAAAAGATGG ACGGCACCGAGGAACTGCTCGTGAAGCTGAACAGAGAGGACCTGCTGCGG AAGCAGCGGACCTTCGACAACGGCAGCATCCCCCACCAGATCCACCTGGG AGAGCTGCACGCCATTCTGCGGCGGCAGGAAGATTTTTACCCATTCCTGA AGGACAACCGGGAAAAGATCGAGAAGATCCTGACCTTCAGAATCCCCTAC TACGTGGGCCCTCTGGCCAGGGGAAACAGCAGATTCGCCTGGATGACCAG AAAGAGCGAGGAAACCATCACCCCCTGGAACTTCGAGGAAGTGGTGGACA AGGGCGCCAGCGCCCAGAGCTTCATCGAGCGGATGACCAACTTCGATAAG AACCTGCCCAACGAGAAGGTGCTGCCCAAGCACAGCCTGCTGTACGAGTA CTTCACCGTGTACAACGAGCTGACCAAAGTGAAATACGTGACCGAGGGAA TGCGGAAGCCCGCCTTTCTGAGCGGCGAGCAGAAAAAGGCCATCGTGGAC CTGCTGTTCAAGACCAACCGGAAAGTGACCGTGAAGCAGCTGAAAGAGGA CTACTTCAAGAAAATCGAGTGCTTCGACAGCGTGGAAATCAGCGGCGTGG AAGATCGGTTCAACGCCTCCCTGGGCGCCTATCACGATCTGCTGAAAATT ATCAAGGACAAGGACTTCCTGGACAATGAGGAAAACGAGGACATTCTGGA AGATATCGTGCTGACCCTGACACTGTTTGAGGACCGGGGCATGATCGAGG AACGGCTGAAAACCTATGCCCACCTGTTCGACGACAAAGTGATGAAGCAG CTGAAGCGGCGGAGATACACCGGCTGGGGCAGGCTGAGCCGGAAGCTGAT CAACGGCATCCGGGACAAGCAGTCCGGCAAGACAATCCTGGATTTCCTGA AGTCCGACGGCTTCGCCAACAGAAACTTCATGCAGCTGATCCACGACGAC AGCCTGACCTTTAAAGAGGACATCCAGAAAGCCCAGGTGTCCGGCCAGGG ACACTCTCTGCACGAGCAGATCGCCAATCTGGCCGGATCCCCCGCCATTA AGAAGGGCATCCTGCAGACAGTGAAGATTGTGGACGAGCTCGTGAAAGTG ATGGGCCACAAGCCCGAGAACATCGTGATCGAAATGGCCAGAGAGAACCA GACCACCCAGAAGGGACAGAAGAACAGCCGCGAGAGAATGAAGCGGATCG AAGAGGGCATCAAAGAGCTGGGCAGCCAGATCCTGAAAGAACACCCCGTG GAAAACACCCAGCTGCAGAACGAGAAGCTGTACCTGTACTACCTGCAGAA TGGGCGGGATATGTACGTGGACCAGGAACTGGACATCAACCGGCTGTCCG ACTACGATGTGGACCACATTGTGCCCCAGTCCTTCATCAAGGACGACTCC ATCGATAACAAAGTGCTGACTCGGAGCGACAAGAACCGGGGCAAGAGCGA CAACGTGCCCTCCGAAGAGGTCGTGAAGAAGATGAAGAACTACTGGCGCC AGCTGCTGAATGCCAAGCTGATTACCCAGAGGAAGTTCGACAATCTGACC AAGGCCGAGAGAGGCGGCCTGAGCGAACTGGATAAGGCCGGCTTCATTAA GCGGCAGCTGGTGGAAACCCGGCAGATCACAAAGCACGTGGCACAGATCC TGGACTCCCGGATGAACACTAAGTACGACGAGAACGACAAACTGATCCGG GAAGTGAAAGTGATCACCCTGAAGTCCAAGCTGGTGTCCGACTTCAGAAA GGATTTCCAGTTTTACAAAGTGCGCGAGATCAACAACTACCACCACGCCC ACGACGCCTACCTGAACGCCGTCGTGGGAACCGCCCTGATCAAAAAGTAC CCTAAGCTGGAAAGCGAGTTCGTGTACGGCGATTACAAGGTGTACGACGT GCGGAAGATGATCGCCAAGAGCGAGCAGGAAATCGGCAAGGCTACCGCCA AGTACTTCTTCTACAGCAACATCATGAACTTTTTCAAGACCGAGATCACA CTGGCCAACGGCGAGATCAGAAAGCGGCCTCTGATCGAGACAAACGGCGA AACCGGGGAGATCGTGTGGGATAAGGGCCGGGATTTTGCCACAGTGCGGA AAGTGCTGTCCATGCCCCAAGTGAATATCGTGAAAAAGACCGAGGTGCAG ACCGGCGGCTTCAGCAAAGAGTCTATCCTGCCCAAGAGGAACTCCGACAA GCTGATCGCCAGAAAGAAGGATTGGGACCCTAAGAAGTACGGCGGCTTTG ACAGCCCCACCGTGGCCTACTCTGTGCTGGTGGTGGCCAAAGTGGAAAAG GGCAAGTCCAAGAAACTGAAGAGTGTGAAAGAGCTGCTGGGGATCACCAT CATGGAAAGAAGCAGCTTCGAGAAGAATCCCATCGACTTTCTGGAAGCCA AGGGCTACAAAGAAGTGAAAAAGGACCTGATCATCAAGCTGCCTAAGTAC TCCCTGTTCGAGCTGGAAAACGGCCGGAAGCGGATGCTGGCTTCTGCCGG CGAACTGCAGAAGGGAAACGAGCTGGCCCTGCCCTCCAAATATGTGAACT TCCTGTACCTGGCCAGCCACTATGAGAAGCTGAAGGGCTCCCCCGAGGAT AATGAGCAGAAACAGCTGTTTGTGGAACAGCACAAGCACTACCTGGACGA GATCATCGAGCAGATTAGCGAGTTCTCCAAGCGCGTGATCCTGGCCGATG CCAACCTGGACAAGGTGCTGAGCGCCTACAACAAGCACCGGGATAAGCCC ATCAGAGAGCAGGCCGAGAATATCATCCACCTGTTTACCCTGACCAACCT GGGAGCCCCTGCCGCCTTCAAGTACTTTGACACCACCATCGACCGGAAGA GGTACACCAGCACCAAAGAGGTGCTGGACGCCACCCTGATCCACCAGAGC ATCACCGGCCTGTACGAGACACGGATCGACCTGTCTCAGCTGGGAGGCGA CCCCAAGAAAAAGCGCAAAGTG (SEQ ID NO: 10) - The modified Cas9 DNA sequence was placed under the control of cytomegalovirus (CMV) promoter for constituent expression in mammalian cells. The modified Cas9 DNA sequence was also placed under the control T7 promoter for in vitro mRNA synthesis with T7 RNA polymerase. In vitro RNA transcription was performed by using MessageMAX T7 ARCA-Capped Message Transcription Kit and T7 mScript Standard mRNA Production System (Cellscript).
- The adeno-associated virus integration site 1 (AAVS1) locus was used as a target for Cas9-mediated human genome modification. The human AAVS1 locus is located in intron 1 (4427 bp) of protein phosphatase 1, regulatory subunit 12C (PPP1R12C). Table 3 presents the first exon (shaded gray) and the first intron of PPP1R12C. The underlined sequence within the intron is the targeted modification site (i.e., AAVS1 locus).
-
TABLE 3 First Exon and Intron of PPP1R12C (5'-3') GCCCGGCGTCTCCCGGGGCCAGGTCCACCCTCTGCTGCGCCACCTGGGGC ATCCTCCTTCCCCGTTGCCAGTCTCGATCCGCCCCGTCGTTCCTGGCCCT GGGCTTTGCCACCCTATGCTGACACCCCGTCCCAGTCCCCCTTACCATTC CCCTTCGACCACCCCACTTCCGAATTGGAGCCGCTTCAACTGGCCCTGGG CTTAGCCACTCTGTGCTGACCACTCTGCCCCAGGCCTCCTTACCATTCCC CTTCGACCTACTCTCTTCCGCATTGGAGTCGCTTTAACTGGCCCTGGCTT TGGCAGCCTGTGCTGACCCATGCAGTCCTCCTTACCATCCCTCCCTCGAC TTCCCCTCTTCCGATGTTGAGCCCCTCCAGCCGGTCCTGGACTTTGTCTC CTTCCCTGCCCTGCCCTCTCCTGAACCTGAGCCAGCTCCCATAGCTCAGT CTGGTCTATCTGCCTGGCCCTGGCCATTGTCACTTTGCGCTGCCCTCCTC TCGCCCCCGAGTGCCCTTGCTGTGCCGCCGGAACTCTGCCCTCTAACGCT GCCGTCTCTCTCCTGAGTCCGGACCACTTTGAGCTCTACTGGCTTCTGCG CCGCCTCTGGCCCACTGTTTCCCCTTCCCAGGCAGGTCCTGCTTTCTCTG ACCTGCATTCTCTCCCCTGGGCCTGTGCCGCTTTCTGTCTGCAGCTTGTG GCCTGGGTCACCTCTACGGCTGGCCCAGATCCTTCCCTGCCGCCTCCTTC AGGTTCCGTCTTCCTCCACTCCCTCTTCCCCTTGCTCTCTGCTGTGTTGC TGCCCAAGGATGCTCTTTCCGGAGCACTTCCTTCTCGGCGCTGCACCACG TGATGTCCTCTGAGCGGATCCTCCCCGTGTCTGGGTCCTCTCCGGGCATC TCTCCTCCCTCACCCAACCCCATGCCGTCTTCACTCGCTGGGTTCCCTTT TCCTTCTCCTTCTGGGGCCTGTGCCATCTCTCGTTTCTTAGGATGGCCTT CTCCGACGGATGTCTCCCTTGCGTCCCGCCTCCCCTTCTTGTAGGCCTGC ATCATCACCGTTTTTCTGGACAACCCCAAAGTACCCCGTCTCCCTGGCTT TAGCCACCTCTCCATCCTCTTGCTTTCTTTGCCTGGACACCCCGTTCTCC TGTGGATTCGGGTCACCTCTCACTCCTTTCATTTGGGCAGCTCCCCTACC CCCCTTACCTCTCTAGTCTGTGCTAGCTCTTCCAGCCCCCTGTCATGGCA TCTTCCAGGGGTCCGAGAGCTCAGCTAGTCTTCTTCCTCCAACCCGGGCC CCTATGTCCACTTCAGGACAGCATGTTTGCTGCCTCCAGGGATCCTGTGT CCCCGAGCTGGGACCACCTTATATTCCCAGGGCCGGTTAATGTGGCTCTG GTTCTGGGTACTTTTATCTGTCCCCTCCACCCCACAGTGGGGCCACTAGG GACAGGATTGGTGACAGAAAAGCCCCATCCTTAGGCCTCCTCCTTCCTAG TCTCCTGATATTGGGTCTAACCCCCACCTCCTGTTAGGCAGATTCCTTAT CTGGTGACACACCCCCATTTCCTGGAGCCATCTCTCTCCTTGCCAGAACC TCTAAGGTTTGCTTACGATGGAGCCAGAGAGGATCCTGGGAGGGAGAGCT TGGCAGGGGGTGGGAGGGAAGGGGGGGATGCGTGACCTGCCCGGTTCTCA GTGGCCACCCTGCGCTACCCTCTCCCAGAACCTGAGCTGCTCTGACGCGG CCGTCTGGTGCGTTTCACTGATCCTGGTGCTGCAGCTTCCTTACACTTCC CAAGAGGAGAAGCAGTTTGGAAAAACAAAATCAGAATAAGTTGGTCCTGA GTTCTAACTTTGGCTCTTCACCTTTCTAGTCCCCAATTTATATTGTTCCT CCGTGCGTCAGTTTTACCTGTGAGATAAGGCCAGTAGCCAGCCCCGTCCT GGCAGGGCTGTGGTGAGGAGGGGGGTGTCCGTGTGGAAAACTCCCTTTGT GAGAATGGTGCGTCCTAGGTGTTCACCAGGTCGTGGCCGCCTCTACTCCC TTTCTCTTTCTCCATCCTTCTTTCCTTAAAGAGTCCCCAGTGCTATCTGG GACATATTCCTCCGCCCAGAGCAGGGTCCCGCTTCCCTAAGGCCCTGCTC TGGGCTTCTGGGTTTGAGTCCTTGGCAAGCCCAGGAGAGGCGCTCAGGCT TCCCTGTCCCCCTTCCTCGTCCACCATCTCATGCCCCTGGCTCTCCTGCC CCTTCCCTACAGGGGTTCCTGGCTCTGCTCTTCAGACTGAGCCCCGTTCC CCTGCATCCCCGTTCCCCTGCATCCCCCTTCCCCTGCATCCCCCAGAGGC CCCAGGCCACCTACTTGGCCTGGACCCCACGAGAGGCCACCCCAGCCCTG TCTACCAGGCTGCCTTTTGGGTGGATTCTCCTCCAACTGTGGGGTGACTG CTTGGCAAACTCACTCTTCGGGGTATCCCAGGAGGCCTGGAGCATTGGGG TGGGCTGGGGTTCAGAGAGGAGGGATTCCCTTCTCAGGTTACGTGGCCAA GAAGCAGGGGAGCTGGGTTTGGGTCAGGTCTGGGTGTGGGGTGACCAGCT TATGCTGTTTGCCCAGGACAGCCTAGTTTTAGCACTGAAACCCTCAGTCC TAGGAAAACAGGGATGGTTGGTCACTGTCTCTGGGTGACTCTTGATTCCC GGCCAGTTTCTCCACCTGGGGCTGTGTTTCTCGTCCTGCATCCTTCTCCA GGCAGGTCCCCAAGCATCGCCCCCCTGCTGTGGCTGTTCCCAAGTTCTTA GGGTACCCCACGTGGGTTTATCAACCACTTGGTGAGGCTGGTACCCTGCC CCCATTCCTGCACCCCAATTGCCTTAGTGGCTAGGGGGTTGGGGGCTAGA GTAGGAGGGGCTGGAGCCAGGATTCTTAGGGCTGAACAGAGAAGAGCTGG GGGCCTGGGCTCCTGGGTTTGAGAGAGGAGGGGCTGGGGCCTGGACTCCT GGGTCCGAGGGAGGAGGGGCTGGGGCCTGGACTCCTGGGTCTGAGGGTGG AGGGACTGGGGGCCTGGACTCCTGGGTCCGAGGGAGGAGGGGCTGGGGCC TGGACTCGTGGGTCTGAGGGAGGAGGGGCTGGGGGCCTGGACTTCTGGGT CTTAGGGAGGCGGGGCTGGGCCTGGACCCCTGGGTCTGAATGGGGAGAGG CTGGGGGCCTGGACTCCTTCATCTGAGGGCGGAAGGGCTGGGGCCTGGCC TCCTGGGTTGAATGGGGAGGGGTTGGGCCTGGACTCTGGAGTCCCTGGTG CCCAGGCCTCAGGCATCTTTCACAGGGATGCCTGTACTGGGCAGGTCCTT GAAAGGGAAAGGCCCATTGCTCTCCTTGCCCCCCTCCCCTATCGCCATGA CAACTGGGTGGAAATAAACGAGCCGAGTTCATCCCGTTCCCAGGGCACGT GCGGCCCCTTCACAGCCCGAGTTTCCATGACCTCATGCTCTTGGCCCTCG TAGCTCCCTCCCGCCTCCTCCAGATGGGCAGCTTTGGAGAGGTGAGGGAC TTGGGGGGTAATTTATCCCGTGGATCTAGGAGTTTAGCTTCACTCCTTCC TCAGCTCCAGTTCAGGTCCCGGAGCCCACCCAGTGTCCACAAGGCCTGGG GCAAGTCCCTCCTCCGACCCCCTGGACTTCGGCTTTTGTCCCCCCAAGTT TTGGACCCCTAAGGGAAGAATGAGAAACGGTGGCCCGTGTCAGCCCCTGG CTGCAGGGCCCCGTGCAGAGGGGGCCTCAGTGAACTGGAGTGTGACAGCC TGGGGCCCAGGCACACAGGTGTGCAGCTGTCTCACCCCTCTGGGAGTCCC GCCCAGGCCCCTGAGTCTGTCCCAGCACAGGGTGGCCTTCCTCCACCCTG CATAGCCCTGGGCCCACGGCTTCGTTCCTGCAGAGTATCTGCTGGGGTGG TTTCCGAGCTTGACCCTTGGAAGGACCTGGCTGGGTTTAAGGCAGGAGGG GCTGGGGGCCAGGACTCCTGGCTCTGAAGGAGGAGGGGCTGGAACCTCTT CCCTAGTCTGAGCACTGGAAGCGCCACCTGTGGGTGGTGACGGGGGTTTT GCCGTGTCTAACAGGTACCATGTGGGGTTCCCGCACCCAGATGAGAAGCC CCCTCCCTTCCCCGTTCACTTCCTGTTTGCAGATAGCCAGGAGTCCTTTC GTGGTTTCCACTGAGCACTGAAGGCCTGGCCGGCCTGACCACTGGGCAAC CAGGCGTATCTTAAACAGCCAGTGGCCAGAGGCTGTTGGGTCATTTTCCC CACTGTCCTAGCACCGTGTCCCTGGATCTGTTTTCGTGGCTCCCTCTGGA GTCCCGACTTGCTGGGACACCGTGGCTGGGGTAGGTGCGGCTGACGGCTG TTTCCCACCCCCAG (SEQ ID NO: 11) - Cas9 guide RNAs were designed for targeting the human AAVS1 locus. A 42 nucleotide RNA (referred to herein as a “crRNA” sequence) comprising (5′ to 3′) a target recognition sequence (i.e., sequence complementary to the non-coding strand of the target sequence) and protospacer sequence; a 85 nucleotide RNA (referred to herein as a “tracrRNA” sequence) comprising 5′ sequence with complementarity to the 3′ sequence of the crRNA and additional hairpin sequence; and a chimeric RNA comprising nucleotides 1-32 of the crRNA, a GAAA loop, and nucleotides 19-45 of the tracrRNA were prepared. The crRNA was chemically synthesized by Sigma-Aldrich. The tracrRNA and chimeric RNA were synthesized by in vitro transcription with T7 RNA polymerase using T7-Scribe Standard RNA IVT Kit (Cellscript). The chimeric RNA coding sequence was also placed under the control of human U6 promoter for in vivo transcription in human cells. Table 4 presents the sequences of the guide RNAs.
-
TABLE 4 Guide RNAs SEQ ID RNA 5′-3′ Sequence NO: AAVS1- ACCCCACAGUGGGGCCACUAGUUUUAGAG 12 crRNA CUAUGCUGUUUUG tracrRNA GGAACCAUUCAAAACAGCAUAGCAAGUUA 13 AAAUAAGGCUAGUCCGUUAUCAACUUGAA AAAGUGGCACCGAGUCGGUGCUUUUUUU chimeric ACCCCACAGUGGGGCCACUAGUUUUAGAG 14 RNA CUAGAAAUAGCAAGUUAAAAUAAGGCUAG UCCG - Targeted integration of a GFP protein into the N terminus of PPP1R12C was used to monitor Cas9-mediated genome modification. To mediate integration by homologous recombination a donor polynucleotide was prepared. The AAVS1-GFP DNA donor contained a 5′ (1185 bp) AAVS1 locus homologous arm, an RNA splicing receptor, a turbo GFP coding sequence, a 3′ transcription terminator, and a 3′ (1217 bp) AAVS1 locus homologous arm. Table 5 presents the sequences of the RNA splicing receptor and the GFP coding sequence followed by the 3′ transcription terminator. Plasmid DNA was prepared by using GenElute Endotoxin-Free Plasmid Maxiprep Kit (Sigma).
-
TABLE 5 Sequences in the AAVS1-GFP DNA donor sequence SEQ ID 5′-3′ Sequence NO: RNA splicing CTGACCTCTTCTCTTCCTCCCACAG 15 receptor GFP coding GCCACCATGGACTACAAAGACGATGACGAC 16 sequence and AAGGTCGACTCTAGAGCTGCAGAGAGCGAC transcription GAGAGCGGCCTGCCCGCCATGGAGATCGAG terminator TGCCGCATCACCGGCACCCTGAACGGCGTG GAGTTCGAGCTGGTGGGCGGCGGAGAGGGC ACCCCCGAGCAGGGCCGCATGACCAACAAG ATGAAGAGCACCAAAGGCGCCCTGACCTTC AGCCCCTACCTGCTGAGCCACGTGATGGGC TACGGCTTCTACCACTTCGGCACCTACCCC AGCGGCTACGAGAACCCCTTCCTGCACGCC ATCAACAACGGCGGCTACACCAACACCCGC ATCGAGAAGTACGAGGACGGCGGCGTGCTG CACGTGAGCTTCAGCTACCGCTACGAGGCC GGCCGCGTGATCGGCGACTTCAAGGTGATG GGCACCGGCTTCCCCGAGGACAGCGTGATC TTCACCGACAAGATCGTCCGCAGCAACGCC ACCGTGGAGCACCTGCACCCCATGGGCGAT AACGATCTGGATGGCAGCTTCACCCGCACC TTCAGCCTGCGCGACGGCGGCTACTACAGC TCCGTGGTGGACAGCCACATGCACTTCAAG AGCGCCATCCACCCCAGCATCCTGCAGAAC GGGGGCCCCATGTTCGCCTTCCGCCGCGTG GAGGAGGATCACAGCAACACCGAGCTGGGC ATCGTGGAGTACCAGCACGCCTTCAAGACC CCGGATGCAGATGCCGGTGAAGAATGAAGA TCTCTGTGCCTTCTAGTTGCCAGCCATCTG TTGTTTGCCCCTCCCCCGTGCCTTCCTTGA CCCTGGAAGGTGCCACTCCCACTGTCCTTT CCTAATAAAATGAGGAAATTGCATCGCATT GTCTGAGTAGGTGTCATTCTATTCTGGGGG GTGGGGTGGGGCAGGACAGCAAGGGGGAGG ATTGGGAAGACAATAGCAGGCATGCTGGGG ATGCGGTGGGCTCTATGGACTCGAGGTTTA AACGTCGACGCGGCCGCGT - Targeted gene integration will result in a fusion protein between the first 107 amino acids of the PPP1R12C and the turbo GFP. The expected fusion protein contains the first 107 amino acid residues of PPP1R12C (highlighted in grey) from RNA splicing between the first exon of PPP1R12C and the engineered splice receptor (see Table 6).
- Transfection was performed on human K562 cells. The K562 cell line was obtained from American Type Culture Collection (ATCC) and grown in Iscove's Modified Dulbecco's Medium, supplemented with 10% FBS and 2 mM L-glutamine. All media and supplements were obtained from Sigma-Aldrich. Cultures were split one day before transfection (at approximately 0.5 million cells per mL before transfection). Cells were transfected with Nucleofector Solution V (Lonza) on a Nucleofector (Lonza) with the T-016 program. Each nucleofection contained approximately 0.6 million cells. Transfection treatments are detailed in Table 7. Cells were grown at 37° C. and 5% CO2 immediately after nucleofection.
-
TABLE 7 Transfection Treatments. Treat- Donor ment Modified Cas9 Guide RNA sequence A Cas9 mRNA transcribed pre-annealed AAVS1-GFP with an Anti-Reverse Cap crRNA-tracrRNA plasmid DNA Analog (10 μg) duplex (0.3 nmol) (10 μg) B Cas9 mRNA transcribed chimeric RNA AAVS1-GFP with an Anti-Reverse Cap (0.3 nmol) plasmid DNA Analog (10 μg) (10 μg) C Cas9 mRNA capped via chimeric RNA AAVS1-GFP post-transcription capping (0.3 nmol) plasmid DNA reaction (10 μg) (10 μg) D Cas9 plasmid DNA (10 μg) U6-chimeric AAVS1-GFP RNA plasmid plasmid DNA DNA (5 μg) (10 μg) E None None AAVS1-GFP plasmid DNA (10 μg) F None None None - Fluorescence-activated cell sorting (FACS) was performed 4 days after transfection. FACS data are presented in
FIG. 4 . The percent GFP detected in each of the four experimental treatments (A-D) was greater than in the control treatments (E, F), confirming integration of the donor sequence and expression of the fusion protein. - Genomic DNA was extracted from transfected cells with GenElute Mammalian Genomic DNA Miniprep Kit (Sigma) 12 days after transfection. Genomic DNA was then PCR amplified with a forward primer located outside the 5′ homologous arm of the AAVS1-GFP plasmid donor and a reverse primer located at the 5′ region of the GFP. The forward primer was 5′-CCACTCTGTGCTGACCACTCT-3′ (SEQ ID NO:18) and reverse primer was 5′-GCGGCACTCGATCTCCA-3′ (SEQ ID NO:19). The expected fragment size from the junction PCR was 1388 bp. The amplification was carried out with JumpStart Taq ReadyMix (Sigma), using the following cycling conditions: 98° C. for 2 minutes for initial denaturation; 35 cycles of 98° C. for 15 seconds, 62° C. for 30 seconds, and 72° C. for 1 minutes and 30 seconds; and a final extension at 72° C. for 5 minutes. PCR products were resolved on 1% agarose gel.
- Cells transfected with 10 μg of Cas9 mRNA transcribed with an Anti-Reverse Cap Analog, 0.3 nmol of pre-annealed crRNA-tracrRNA duplex, and 10 μg of AAVS1-GFP plasmid DNA displayed a PCR product of the expected size (see lane A,
FIG. 5 ). - The mouse Rosa26 locus can be targeted for genome modifications. Table 8 presents a portion of the mouse Rosa26 sequence in which potential target sites are shown in bold. Each target site comprises a protospacer.
-
TABLE 8 Mouse Rosa26 Sequence GAGCGGCTGCGGGGCGGGTGCAAGCACGTTTCCGACTTGAGTTGCCTCAA GAGGGGCGTGCTGAGCCAGACCTCCATCGCGCACTCCGGGGAGTGGAGGG AAGGAGCGAGGGCTCAGTTGGGCTGTTTTGGAGGCAGGAAGCACTTGCTC TCCCAAAGTCGCTCTGAGTTGTTATCAGTAAGGGAGCTGCAGTGGAGTAG GCGGGGAGAAGGCCGCACCCTTCTCCGGAGGGGGGAGGGGAGTGTTGCAA TACCTTTCTGGGAGTTCTCTGCTGCCTCCTGGCTTCTGAGGACCGCCCTG GGCCTGGGAGAATCCCTTCCCCCTCTTCCCTCGTGATCTGCAACTCCAGT CTTTCTAGAAGATGGGCGGGAGTCTTCTGGGCAGGCTTAAAGGCTAACCT GGTGTGTGGGCGTTGTCCTGCAGGGGAATTGAACAGGTGTAAAATTGGAG GGACAAGACTTCCCACAGATTTTCGGTTTTGTCGGGAAGTTTTTTAATAG GGGCAAATAAGGAAAATGGGAGGATAGGTAGTCATCTGGGGTTTTATGCA GCAAAACTACAGGTTATTATTGCTTGTGATCCGCCTCGGAGTATTTTCCA TCGAGGTAGATTAAAGACATGCTCACCCGAGTTTTATACTCTCCTGCTTG AGATCCTTACTACAGTATGAAATTACAGTGTCGCGAGTTAGACTATGTAA GCAGAATTTTA (SEQ ID NO: 20) - Guide RNAs were designed to target each of the target sites in the mouse Rosa26 locus. The sequences are shown in Table 9, each is 42 nucleotides in length and the 5′ region is complementary to the strand that is not presented in Table 8 (i.e., the strand that is complementary to the strand shown in Table 8).
-
TABLE 9 Mouse Rosa26 Guide RNAs SEQ ID RNA 5′-3′ Sequence NO: mRosa26- CUCCAGUCUUUCUAGAAGAUGUUUUAGAGCUAU 21 crRNA-1 GCUGUUUUG mRosa26- UGAACAGGUGUAAAAUUGGAGUUUUAGAGCUAU 22 crRNA-2 GCUGUUUUG mRosa26- UGUCGGGAAGUUUUUUAAUAGUUUUAGAGCUAU 23 crRNA-3 GCUGUUUUG - The crRNAs were chemically synthesized and pre-annealed to the tracrRNA (SEQ ID NO:13; see Example 2). Pre-annealed crRNA/tracrRNA and in vitro transcribed mRNA encoding modified Cas9 protein (SEQ ID NO. 9; see Example 1) can be microinjected into the pronuclei of fertilized mouse embryos. Upon guidance to the target set by the crRNA, the Cas9 protein cleaves the target site, and the resultant double-stranded break can be repaired via a non-homologous end-joining (NHEJ) repair process. The injected embryos can be either incubated at 37° C., 5% CO2 overnight or for up to 4 days, followed by genotyping analysis, or the injected embryos can be implanted into recipient female mice such that live born animals can be genotyped. The in vitro-incubated embryos or tissues from live born animals can be screened for the presence of Cas9-induced mutation at the Rosa locus using standard methods. For example, the embryos or tissues from fetus or live-born animals can be harvested for DNA extraction and analysis. DNA can be isolated using standard procedures. The targeted region of the Rosa26 locus can be PCR amplified using appropriate primers. Because NHEJ is error-prone, deletions of at least one nucleotide, insertions of at least one nucleotide, substitutions of at least one nucleotide, or combinations thereof can occur during the repair of the break. Mutations can be detected using PCR-based genotyping methods, such as Cel-I mismatch assays and DNA sequencing.
- The Rosa26 locus can be modified in mouse embryos by co-injecting a donor polynucleotide, as detailed above in section (IV)(d), along with the pre-annealed crRNA/tracrRNA and mRNA encoding modified Cas9 as described above in Example 6. In vitro-incubated embryos or tissues from live born animals (as described in Example 6) can be screened for a modified Rosa26 locus using PCR-based genotyping methods, such as RFLP assays, junction PCR, and DNA sequencing.
- The rat Rosa26 locus can be targeted for genome modifications. Table 10 presents a portion of the rat sequence in which potential target sites are shown in bold. Each target site comprises a protospacer.
-
TABLE 10 Rat Rosa26 Sequence GGGATTCCTCCTTGAGTTGTGGCACTGAGGAACGTGCTGAACAAGACCT ACATTGCACTCCAGGGAGTGGATGAAGGAGTTGGGGCTCAGTCGGGTTG TATTGGAGACAAGAAGCACTTGCTCTCCAAAAGTCGGTTTGAGTTATCA TTAAGGGAGCTGCAGTGGAGTAGGCGGAGAAAAGGCCGCACCCTTCTCA GGACGGGGGAGGGGAGTGTTGCAATACCTTTCTGGGAGTTCTCTGCTGC CTCCTGTCTTCTGAGGACCGCCCTGGGCCTGGAAGATTCCCTTCCCCCT TCTTCCCTCGTGATCTGCAACTGGAGTCTTTCTGGAAGATAGGCGGGAG TCTTCTGGGCAGGCTTAAAGGCTAACCTGGTGCGTGGGGCGTTGTCCTG CAGAGGAATTGAACAGGTGTAAAATTGGAGGGGCAAGACTTCCCACAGA TTTTCGATTGTGTTGTTAAGTATTGTAATAGGGGCAAATAAGGGAAATA GACTAGGCACTCACCTGGGGTTTTATGCAGCAAAACTACAGGTTATTAT TGCTTGTGATCCGCCCTGGAGAATTTTTCACCGAGGTAGATTGAAGACA TGCCCACCCAAATTTTAATATTCTTCCACTTGCGATCCTTGCTACAGTA TGAAA (SEQ ID NO: 24) - Guide RNAs were designed to target each of the target sites in the rat Rosa26 locus. The sequences are shown in Table 11, each is 42 nucleotides in length and the 5′ region is complementary to the strand that is not presented in Table 10 (i.e., the strand that is complementary to the strand shown in Table 10).
-
TABLE 11 Rat Rosa26 Guide RNAs SEQ ID RNA 5′-3′ Sequence NO: rRosa26- AGGGGGAAGGGAAUCUUCCAGUUUUAGAGCUA 25 crRNA-1 UGCUGUUUUG rRosa26- UCUGCAACUGGAGUCUUUCUGUUUUAGAGCUA 26 crRNA-2 UGCUGUUUUG rRosa26- AGGCGGGAGUCUUCUGGGCAGUUUUAGAGCUA 27 crRNA-3 UGCUGUUUUG - The crRNAs were chemically synthesized and pre-annealed to the tracrRNA (SEQ ID NO:13; see Example 2). Pre-annealed crRNA/tracrRNA and in vitro transcribed mRNA encoding modified Cas9 protein (SEQ ID NO. 9; see Example 1) can be microinjected into the pronuclei of fertilized rat embryos. Upon guidance to the target site by the crRNA, the Cas9 protein cleaves the target site, and the resultant double-stranded break can be repaired via a non-homologous end-joining (NHEJ) repair process. The injected embryos can be either incubated at 37° C., 5% CO2 overnight or for up to 4 days, followed by genotyping analysis, or the injected embryos can be implanted into recipient female mice such that live born animals can be genotyped. The in vitro-incubated embryos or tissues from live born animals can be screened for the presence of Cas9-induced mutation at the Rosa locus using standard methods. For example, the embryos or tissues from fetus or live-born animals can be harvested for DNA extraction and analysis. DNA can be isolated using standard procedures. The targeted region of the Rosa26 locus can be PCR amplified using appropriate primers. Because NHEJ is error-prone, deletions of at least one nucleotide, insertions of at least one nucleotide, substitutions of at least one nucleotide, or combinations thereof can occur during the repair of the break. Mutations can be detected using PCR-based genotyping methods, such as Cel-I mismatch assays and DNA sequencing.
- The Rosa26 locus can be modified in rat embryos by co-injecting a donor polynucleotide, as detailed above in section (IV)(d), along with the pre-annealed crRNA/tracrRNA and mRNA encoding modified Cas9 as described above in Example 8. In vitro-incubated embryos or tissues from live born rats (as described in Example 8) can be screened for a modified Rosa26 locus using PCR-based genotyping methods, such as RFLP assays, junction PCR, and DNA sequencing.
Claims (32)
1-12. (canceled)
13. A method for modifying a chromosomal sequence in a eukaryotic cell or embryo, the method comprising:
a) introducing into the eukaryotic cell or embryo (i) at least one RNA-guided endonuclease comprising at least one nuclear localization signal or nucleic acid encoding at least one RNA-guided endonuclease comprising at least one nuclear localization signal, (ii) at least one guide RNA or DNA encoding at least one guide RNA, and, optionally, (iii) at least one donor polynucleotide; and
b) culturing the eukaryotic cell or embryo such that each guide RNA directs an RNA-guided endonuclease to a targeted site in the chromosomal sequence where the RNA-guided endonuclease introduces a double-stranded break in the targeted site, and the double-stranded break is repaired by a DNA repair process such that the chromosomal sequence is modified.
14. The method of claim 13 , wherein the RNA-guided endonuclease is derived from a Cas9 protein.
15. The method of claim 13 , wherein the nucleic acid encoding the RNA-guided endonuclease is mRNA.
16. The method of claim 13 , wherein the nucleic acid encoding the RNA-guided endonuclease is DNA.
17. The method of claim 16 , wherein the DNA is part of a vector that further comprises a sequence encoding the guide RNA.
18. The method of claim 13 , wherein the eukaryotic cell is a human cell, a non-human mammalian cell, a stem cell, a non-mammalian vertebrate cell, an invertebrate cell, a plant cell, or a single cell eukaryotic organism.
19. The method of claim 13 , wherein the embryo is a non-human one cell animal embryo.
20. A fusion protein comprising a CRISPR/Cas-like protein or fragment thereof and an effector domain.
21. The fusion protein of claim 20 , wherein the CRISPR/Cas-like protein is derived from a Cas9 protein.
22. The fusion protein of claim 21 , wherein the Cas9 protein is modified to lack at least one functional nuclease domain.
23. The fusion protein of claim 21 , wherein the Cas9 protein is modified to lack all nuclease activity.
24-28. (canceled)
29. The fusion protein of claim 20 , wherein the effector domain is chosen from a transcriptional activation domain, a transcriptional repressor domain, and an epigenetic modification domain.
30. The fusion protein of claim 20 , wherein the fusion protein further comprises at least one additional domain chosen from a nuclear localization signal, a cell-penetrating domain, and a marker domain.
31. (canceled)
32. A method for modifying a chromosomal sequence or regulating expression of a chromosomal sequence in a cell or embryo, the method comprising introducing into the cell or embryo (a) at least one fusion protein or nucleic acid encoding at least one fusion protein, wherein the fusion protein comprises a CRISPR/Cas-like protein or a fragment thereof and an effector domain, and (b) at least one guide RNA or DNA encoding at least one guide RNA, wherein the one guide RNA guides the CRISPR/Cas-like protein of the fusion protein to a targeted site in the chromosomal sequence and the effector domain of the fusion protein modifies the chromosomal sequence or regulates expression of the chromosomal sequence.
33. The method of claim 32 , wherein the CRISPR/Cas-like protein is derived from a Cas9 protein.
34. The method of claim 33 , wherein the cas9 protein is modified to lack at least one functional nuclease domain.
35. The method of claim 33 , wherein the cas9 protein is modified to lack all nuclease activity.
36. The method of claim 32 , wherein fusion protein further comprises at least one additional domain chosen from a nuclear localization signal, a cell-penetrating domain, and a marker domain.
37. (canceled)
38. The method of claim 32 , wherein one fusion protein or nucleic acid encoding one fusion protein and two guide RNAs or DNA encoding two guide RNAs are introduced into the cell or embryo.
39. The method of claim 38 , wherein the fusion protein comprises a Cas9 protein or fragment thereof.
40. The method of claim 32 , wherein two fusion proteins or nucleic acid encoding two fusion proteins and two guide RNAs or DNA encoding two guide RNAs are introduced into the cell or embryo.
41. The method of claim 40 , wherein each fusion protein comprises a different Cas9 protein or fragment thereof.
42-43. (canceled)
44. The method of claim 32 , further comprising introducing into the cell or embryo at least one donor polynucleotide.
45. The method of claim 32 , wherein the effector domain is chosen from an epigenetic modification domain, a transcriptional activation domain, or a transcriptional repressor domain.
46. The method of claim 45 , wherein one fusion protein or nucleic acid encoding one fusion protein, and one guide RNA or DNA encoding one guide RNA are introduced into the cell or embryo.
47. The method of claim 32 , wherein the cell is a human cell, a non-human mammalian cell, a stem cell, a non-mammalian vertebrate cell, an invertebrate cell, a plant cell, or a single cell eukaryotic organism.
48. The method of claim 32 , wherein the embryo is a non-human one cell animal embryo.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US14/649,777 US20160017366A1 (en) | 2012-12-06 | 2013-12-05 | Crispr-based genome modification and regulation |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201261734256P | 2012-12-06 | 2012-12-06 | |
| US201361758624P | 2013-01-30 | 2013-01-30 | |
| US201361761046P | 2013-02-05 | 2013-02-05 | |
| US201361794422P | 2013-03-15 | 2013-03-15 | |
| US14/649,777 US20160017366A1 (en) | 2012-12-06 | 2013-12-05 | Crispr-based genome modification and regulation |
| PCT/US2013/073307 WO2014089290A1 (en) | 2012-12-06 | 2013-12-05 | Crispr-based genome modification and regulation |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2013/073307 A-371-Of-International WO2014089290A1 (en) | 2012-12-06 | 2013-12-05 | Crispr-based genome modification and regulation |
Related Child Applications (9)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/188,899 Division US20160298125A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
| US15/188,902 Division US20160298132A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
| US15/188,911 Continuation US10731181B2 (en) | 2012-12-06 | 2016-06-21 | CRISPR-based genome modification and regulation |
| US15/188,924 Continuation US10745716B2 (en) | 2012-12-06 | 2016-06-21 | CRISPR-based genome modification and regulation |
| US15/188,927 Continuation US20160298136A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
| US15/188,931 Continuation US20160298137A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
| US15/188,909 Division US20160298133A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
| US15/188,933 Continuation US20160298138A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
| US15/342,976 Continuation US20170073705A1 (en) | 2012-12-06 | 2016-11-03 | Crispr-based genome modification and regulation |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20160017366A1 true US20160017366A1 (en) | 2016-01-21 |
Family
ID=50883989
Family Applications (15)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/649,777 Abandoned US20160017366A1 (en) | 2012-12-06 | 2013-12-05 | Crispr-based genome modification and regulation |
| US15/188,902 Abandoned US20160298132A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
| US15/188,924 Active US10745716B2 (en) | 2012-12-06 | 2016-06-21 | CRISPR-based genome modification and regulation |
| US15/188,899 Abandoned US20160298125A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
| US15/188,911 Active US10731181B2 (en) | 2012-12-06 | 2016-06-21 | CRISPR-based genome modification and regulation |
| US15/188,931 Abandoned US20160298137A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
| US15/188,909 Abandoned US20160298133A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
| US15/188,933 Abandoned US20160298138A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
| US15/188,927 Abandoned US20160298136A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
| US15/342,976 Abandoned US20170073705A1 (en) | 2012-12-06 | 2016-11-03 | Crispr-based genome modification and regulation |
| US15/456,204 Pending US20170191082A1 (en) | 2012-12-06 | 2017-03-10 | Crispr-based genome modification and regulation |
| US16/654,613 Abandoned US20200140897A1 (en) | 2012-12-06 | 2019-10-16 | Crispr-based genome modification and regulation |
| US16/943,767 Pending US20210207173A1 (en) | 2012-12-06 | 2020-07-30 | Crispr-based genome modification and regulation |
| US16/943,792 Abandoned US20210079427A1 (en) | 2012-12-06 | 2020-07-30 | Crispr-based genome modification and regulation |
| US17/398,648 Pending US20210388396A1 (en) | 2012-12-06 | 2021-08-10 | Crispr-based genome modification and regulation |
Family Applications After (14)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/188,902 Abandoned US20160298132A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
| US15/188,924 Active US10745716B2 (en) | 2012-12-06 | 2016-06-21 | CRISPR-based genome modification and regulation |
| US15/188,899 Abandoned US20160298125A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
| US15/188,911 Active US10731181B2 (en) | 2012-12-06 | 2016-06-21 | CRISPR-based genome modification and regulation |
| US15/188,931 Abandoned US20160298137A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
| US15/188,909 Abandoned US20160298133A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
| US15/188,933 Abandoned US20160298138A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
| US15/188,927 Abandoned US20160298136A1 (en) | 2012-12-06 | 2016-06-21 | Crispr-based genome modification and regulation |
| US15/342,976 Abandoned US20170073705A1 (en) | 2012-12-06 | 2016-11-03 | Crispr-based genome modification and regulation |
| US15/456,204 Pending US20170191082A1 (en) | 2012-12-06 | 2017-03-10 | Crispr-based genome modification and regulation |
| US16/654,613 Abandoned US20200140897A1 (en) | 2012-12-06 | 2019-10-16 | Crispr-based genome modification and regulation |
| US16/943,767 Pending US20210207173A1 (en) | 2012-12-06 | 2020-07-30 | Crispr-based genome modification and regulation |
| US16/943,792 Abandoned US20210079427A1 (en) | 2012-12-06 | 2020-07-30 | Crispr-based genome modification and regulation |
| US17/398,648 Pending US20210388396A1 (en) | 2012-12-06 | 2021-08-10 | Crispr-based genome modification and regulation |
Country Status (16)
| Country | Link |
|---|---|
| US (15) | US20160017366A1 (en) |
| EP (11) | EP3611263A1 (en) |
| JP (6) | JP6620018B2 (en) |
| KR (7) | KR102243092B1 (en) |
| CN (3) | CN105142669B (en) |
| AU (9) | AU2013355214B2 (en) |
| BR (1) | BR112015012375A2 (en) |
| CA (3) | CA2891347C (en) |
| DK (6) | DK3360964T3 (en) |
| ES (6) | ES2713243T3 (en) |
| IL (5) | IL300199B2 (en) |
| LT (4) | LT3138912T (en) |
| PL (6) | PL3360964T3 (en) |
| PT (6) | PT3138910T (en) |
| SG (4) | SG10202107423UA (en) |
| WO (1) | WO2014089290A1 (en) |
Cited By (92)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20160281072A1 (en) * | 2012-12-12 | 2016-09-29 | The Broad Institute Inc. | Crispr-cas systems and methods for altering expression of gene products |
| US9512446B1 (en) | 2015-08-28 | 2016-12-06 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
| US20170002339A1 (en) * | 2014-01-24 | 2017-01-05 | North Carolina State University | Methods and Compositions for Sequences Guiding Cas9 Targeting |
| US9567603B2 (en) | 2013-03-15 | 2017-02-14 | The General Hospital Corporation | Using RNA-guided FokI nucleases (RFNs) to increase specificity for RNA-guided genome editing |
| US20170051276A1 (en) * | 2013-03-14 | 2017-02-23 | Caribou Biosciences, Inc. | Compositions And Methods Of Nucleic Acid-Targeting Nucleic Acids |
| WO2017040348A1 (en) | 2015-08-28 | 2017-03-09 | The General Hospital Corporation | Engineered crispr-cas9 nucleases |
| US9822372B2 (en) | 2012-12-12 | 2017-11-21 | The Broad Institute Inc. | CRISPR-Cas component systems, methods and compositions for sequence manipulation |
| WO2017213896A1 (en) * | 2016-06-03 | 2017-12-14 | Temple University - Of The Commonwealth System Of Higher Education | Negative feedback regulation of hiv-1 by gene editing strategy |
| US20170369848A1 (en) * | 2014-11-11 | 2017-12-28 | Q Therapeutics, Inc. | Engineering mesenchymal stem cells using homologous recombination |
| US9856497B2 (en) | 2016-01-11 | 2018-01-02 | The Board Of Trustee Of The Leland Stanford Junior University | Chimeric proteins and methods of regulating gene expression |
| WO2018013720A1 (en) * | 2016-07-12 | 2018-01-18 | Washington University | Incorporation of internal polya-encoded poly-lysine sequence tags and their variations for the tunable control of protein synthesis in bacterial and eukaryotic cells |
| US9888673B2 (en) | 2014-12-10 | 2018-02-13 | Regents Of The University Of Minnesota | Genetically modified cells, tissues, and organs for treating disease |
| WO2018048827A1 (en) * | 2016-09-07 | 2018-03-15 | Massachusetts Institute Of Technology | Rna-guided endonuclease-based dna assembly |
| US9926546B2 (en) | 2015-08-28 | 2018-03-27 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
| US9970024B2 (en) | 2012-12-17 | 2018-05-15 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
| US10011850B2 (en) | 2013-06-21 | 2018-07-03 | The General Hospital Corporation | Using RNA-guided FokI Nucleases (RFNs) to increase specificity for RNA-Guided Genome Editing |
| WO2018195545A2 (en) | 2017-04-21 | 2018-10-25 | The General Hospital Corporation | Variants of cpf1 (cas12a) with altered pam specificity |
| US10136649B2 (en) | 2015-05-29 | 2018-11-27 | North Carolina State University | Methods for screening bacteria, archaea, algae, and yeast using CRISPR nucleic acids |
| WO2018218166A1 (en) | 2017-05-25 | 2018-11-29 | The General Hospital Corporation | Using split deaminases to limit unwanted off-target base editor deamination |
| US10166255B2 (en) | 2015-07-31 | 2019-01-01 | Regents Of The University Of Minnesota | Intracellular genomic transplant and methods of therapy |
| US10190137B2 (en) | 2013-11-07 | 2019-01-29 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAS |
| US10227611B2 (en) | 2012-05-25 | 2019-03-12 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10266851B2 (en) | 2016-06-02 | 2019-04-23 | Sigma-Aldrich Co. Llc | Using programmable DNA binding proteins to enhance targeted genome modification |
| US20190136230A1 (en) * | 2016-05-06 | 2019-05-09 | Juno Therapeutics, Inc. | Genetically engineered cells and methods of making the same |
| US10286084B2 (en) | 2014-02-18 | 2019-05-14 | Duke University | Compositions for the inactivation of virus replication and methods of making and using the same |
| US10336807B2 (en) | 2016-01-11 | 2019-07-02 | The Board Of Trustees Of The Leland Stanford Junior University | Chimeric proteins and methods of immunotherapy |
| CN110023494A (en) * | 2016-09-30 | 2019-07-16 | 加利福尼亚大学董事会 | RNA-guided nucleic acid-modifying enzymes and methods of using the same |
| WO2019147302A1 (en) * | 2018-01-26 | 2019-08-01 | Bauer Daniel E | Targeting bcl11a distal regulatory elements with a cas9-cas9 fusion for fetal hemoglobin reinduction |
| US10428319B2 (en) | 2017-06-09 | 2019-10-01 | Editas Medicine, Inc. | Engineered Cas9 nucleases |
| US10450584B2 (en) | 2014-08-28 | 2019-10-22 | North Carolina State University | Cas9 proteins and guiding features for DNA targeting and genome editing |
| US10494621B2 (en) | 2015-06-18 | 2019-12-03 | The Broad Institute, Inc. | Crispr enzyme mutations reducing off-target effects |
| US10526589B2 (en) | 2013-03-15 | 2020-01-07 | The General Hospital Corporation | Multiplex guide RNAs |
| US10550372B2 (en) | 2013-12-12 | 2020-02-04 | The Broad Institute, Inc. | Systems, methods and compositions for sequence manipulation with optimized functional CRISPR-Cas systems |
| US10577630B2 (en) | 2013-06-17 | 2020-03-03 | The Broad Institute, Inc. | Delivery and use of the CRISPR-Cas systems, vectors and compositions for hepatic targeting and therapy |
| US10584358B2 (en) | 2013-10-30 | 2020-03-10 | North Carolina State University | Compositions and methods related to a type-II CRISPR-Cas system in Lactobacillus buchneri |
| US10696986B2 (en) | 2014-12-12 | 2020-06-30 | The Board Institute, Inc. | Protected guide RNAS (PGRNAS) |
| US10711267B2 (en) | 2018-10-01 | 2020-07-14 | North Carolina State University | Recombinant type I CRISPR-Cas system |
| US10711285B2 (en) * | 2013-06-17 | 2020-07-14 | The Broad Institute, Inc. | Optimized CRISPR-Cas double nickase systems, methods and compositions for sequence manipulation |
| US10731181B2 (en) | 2012-12-06 | 2020-08-04 | Sigma, Aldrich Co. LLC | CRISPR-based genome modification and regulation |
| WO2020163396A1 (en) | 2019-02-04 | 2020-08-13 | The General Hospital Corporation | Adenine dna base editor variants with reduced off-target rna editing |
| US10781444B2 (en) | 2013-06-17 | 2020-09-22 | The Broad Institute, Inc. | Functional genomics using CRISPR-Cas systems, compositions, methods, screens and applications thereof |
| US10851380B2 (en) | 2012-10-23 | 2020-12-01 | Toolgen Incorporated | Methods for cleaving a target DNA using a guide RNA specific for the target DNA and Cas protein-encoding nucleic acid or Cas protein |
| US10851357B2 (en) | 2013-12-12 | 2020-12-01 | The Broad Institute, Inc. | Compositions and methods of use of CRISPR-Cas systems in nucleotide repeat disorders |
| US10912797B2 (en) | 2016-10-18 | 2021-02-09 | Intima Bioscience, Inc. | Tumor infiltrating lymphocytes and methods of therapy |
| US10930367B2 (en) | 2012-12-12 | 2021-02-23 | The Broad Institute, Inc. | Methods, models, systems, and apparatus for identifying target sequences for Cas enzymes or CRISPR-Cas systems for target sequences and conveying results thereof |
| US10946108B2 (en) | 2013-06-17 | 2021-03-16 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for targeting disorders and diseases using viral components |
| US11008588B2 (en) | 2013-06-17 | 2021-05-18 | The Broad Institute, Inc. | Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation |
| US11033584B2 (en) | 2017-10-27 | 2021-06-15 | The Regents Of The University Of California | Targeted replacement of endogenous T cell receptors |
| US11041173B2 (en) | 2012-12-12 | 2021-06-22 | The Broad Institute, Inc. | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US11078483B1 (en) | 2016-09-02 | 2021-08-03 | KSQ Therapeutics, Inc. | Methods for measuring and improving CRISPR reagent function |
| US11078481B1 (en) | 2016-08-03 | 2021-08-03 | KSQ Therapeutics, Inc. | Methods for screening for cancer targets |
| US11098325B2 (en) | 2017-06-30 | 2021-08-24 | Intima Bioscience, Inc. | Adeno-associated viral vectors for gene therapy |
| US11155823B2 (en) | 2015-06-15 | 2021-10-26 | North Carolina State University | Methods and compositions for efficient delivery of nucleic acids and RNA-based antimicrobials |
| US11155795B2 (en) | 2013-12-12 | 2021-10-26 | The Broad Institute, Inc. | CRISPR-Cas systems, crystal structure and uses thereof |
| US11236313B2 (en) | 2016-04-13 | 2022-02-01 | Editas Medicine, Inc. | Cas9 fusion molecules, gene editing systems, and methods of use thereof |
| US11286480B2 (en) | 2015-09-28 | 2022-03-29 | North Carolina State University | Methods and compositions for sequence specific antimicrobials |
| US11390884B2 (en) | 2015-05-11 | 2022-07-19 | Editas Medicine, Inc. | Optimized CRISPR/cas9 systems and methods for gene editing in stem cells |
| US11407985B2 (en) | 2013-12-12 | 2022-08-09 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for genome editing |
| US11439712B2 (en) | 2014-04-08 | 2022-09-13 | North Carolina State University | Methods and compositions for RNA-directed repression of transcription using CRISPR-associated genes |
| US11466271B2 (en) | 2017-02-06 | 2022-10-11 | Novartis Ag | Compositions and methods for the treatment of hemoglobinopathies |
| US11499151B2 (en) | 2017-04-28 | 2022-11-15 | Editas Medicine, Inc. | Methods and systems for analyzing guide RNA molecules |
| US11542466B2 (en) | 2015-12-22 | 2023-01-03 | North Carolina State University | Methods and compositions for delivery of CRISPR based antimicrobials |
| US11549126B2 (en) | 2015-06-03 | 2023-01-10 | Board Of Regents Of The University Of Nebraska | Treatment methods using DNA editing with single-stranded DNA |
| US11578312B2 (en) | 2015-06-18 | 2023-02-14 | The Broad Institute Inc. | Engineering and optimization of systems, methods, enzymes and guide scaffolds of CAS9 orthologs and variants for sequence manipulation |
| US11597924B2 (en) | 2016-03-25 | 2023-03-07 | Editas Medicine, Inc. | Genome editing systems comprising repair-modulating enzyme molecules and methods of their use |
| US20230122226A1 (en) * | 2020-03-05 | 2023-04-20 | Board Of Regents Of The University Of Nebraska | Crispr/cas9 system for multistrain hiv-1 treatment |
| US11667911B2 (en) | 2015-09-24 | 2023-06-06 | Editas Medicine, Inc. | Use of exonucleases to improve CRISPR/CAS-mediated genome editing |
| US11680268B2 (en) | 2014-11-07 | 2023-06-20 | Editas Medicine, Inc. | Methods for improving CRISPR/Cas-mediated genome-editing |
| EP4198124A1 (en) | 2021-12-15 | 2023-06-21 | Versitech Limited | Engineered cas9-nucleases and method of use thereof |
| US11814624B2 (en) | 2017-06-15 | 2023-11-14 | The Regents Of The University Of California | Targeted non-viral DNA insertions |
| US11827919B2 (en) | 2016-06-16 | 2023-11-28 | The Regents Of The University Of California | Methods and compositions for detecting a target RNA |
| US11834670B2 (en) | 2017-04-19 | 2023-12-05 | Global Life Sciences Solutions Usa Llc | Site-specific DNA modification using a donor DNA repair template having tandem repeat sequences |
| US11866726B2 (en) | 2017-07-14 | 2024-01-09 | Editas Medicine, Inc. | Systems and methods for targeted integration and genome editing and detection thereof using integrated priming sites |
| US11911415B2 (en) | 2015-06-09 | 2024-02-27 | Editas Medicine, Inc. | CRISPR/Cas-related methods and compositions for improving transplantation |
| US11970719B2 (en) | 2017-11-01 | 2024-04-30 | The Regents Of The University Of California | Class 2 CRISPR/Cas compositions and methods of use |
| US12037407B2 (en) | 2021-10-14 | 2024-07-16 | Arsenal Biosciences, Inc. | Immune cells having co-expressed shRNAS and logic gate systems |
| US12058986B2 (en) | 2017-04-20 | 2024-08-13 | Egenesis, Inc. | Method for generating a genetically modified pig with inactivated porcine endogenous retrovirus (PERV) elements |
| US12110545B2 (en) | 2017-01-06 | 2024-10-08 | Editas Medicine, Inc. | Methods of assessing nuclease cleavage |
| US12203123B2 (en) | 2018-10-01 | 2025-01-21 | North Carolina State University | Recombinant type I CRISPR-Cas system and uses thereof for screening for variant cells |
| US12201699B2 (en) | 2014-10-10 | 2025-01-21 | Editas Medicine, Inc. | Compositions and methods for promoting homology directed repair |
| US12227753B2 (en) | 2017-11-01 | 2025-02-18 | The Regents Of The University Of California | CasY compositions and methods of use |
| US12251450B2 (en) | 2013-12-12 | 2025-03-18 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for HBV and viral diseases and disorders |
| US12258575B2 (en) | 2016-09-30 | 2025-03-25 | The Regents Of The University Of California | RNA-guided nucleic acid modifying enzymes and methods of use thereof |
| US12264313B2 (en) | 2018-10-01 | 2025-04-01 | North Carolina State University | Recombinant type I CRISPR-Cas system and uses thereof for genome modification and alteration of expression |
| US12264314B1 (en) | 2017-11-01 | 2025-04-01 | The Regents Of The University Of California | CasZ compositions and methods of use |
| US12264330B2 (en) | 2018-10-01 | 2025-04-01 | North Carolina State University | Recombinant type I CRISPR-Cas system and uses thereof for killing target cells |
| US12286727B2 (en) | 2016-12-19 | 2025-04-29 | Editas Medicine, Inc. | Assessing nuclease cleavage |
| US12338436B2 (en) | 2018-06-29 | 2025-06-24 | Editas Medicine, Inc. | Synthetic guide molecules, compositions and methods relating thereto |
| US12421506B2 (en) | 2013-12-12 | 2025-09-23 | The Broad Institute, Inc. | Engineering of systems, methods and optimized guide compositions with new architectures for sequence manipulation |
| US12435320B2 (en) | 2014-12-24 | 2025-10-07 | The Broad Institute, Inc. | CRISPR having or associated with destabilization domains |
| US12454687B2 (en) | 2012-12-12 | 2025-10-28 | The Broad Institute, Inc. | Functional genomics using CRISPR-Cas systems, compositions, methods, knock out libraries and applications thereof |
| WO2026006542A2 (en) | 2024-06-26 | 2026-01-02 | Yale University | Compositions and methods for crispr/cas9 based reactivation of human angelman syndrome |
Families Citing this family (365)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8053191B2 (en) | 2006-08-31 | 2011-11-08 | Westend Asset Clearinghouse Company, Llc | Iterative nucleic acid assembly using activation of vector-encoded traits |
| CN103502448B (en) | 2010-11-12 | 2017-03-29 | Gen9股份有限公司 | Methods and devices for nucleic acid synthesis |
| WO2012064975A1 (en) | 2010-11-12 | 2012-05-18 | Gen9, Inc. | Protein arrays and methods of using and making the same |
| CA2831144A1 (en) | 2011-03-23 | 2012-09-27 | Pioneer Hi-Bred International, Inc. | Methods for producing a complex transgenic trait locus |
| US10323236B2 (en) | 2011-07-22 | 2019-06-18 | President And Fellows Of Harvard College | Evaluation and improvement of nuclease cleavage specificity |
| LT2944693T (en) | 2011-08-26 | 2019-08-26 | Gen9, Inc. | Compositions and methods for high fidelity assembly of nucleic acids |
| EP3604555B1 (en) | 2011-10-14 | 2024-12-25 | President and Fellows of Harvard College | Sequencing by structure assembly |
| ES2991004T3 (en) | 2011-12-22 | 2024-12-02 | Harvard College | Methods for the detection of analytes |
| GB201122458D0 (en) | 2011-12-30 | 2012-02-08 | Univ Wageningen | Modified cascade ribonucleoproteins and uses thereof |
| US9637739B2 (en) | 2012-03-20 | 2017-05-02 | Vilnius University | RNA-directed DNA cleavage by the Cas9-crRNA complex |
| US9150853B2 (en) | 2012-03-21 | 2015-10-06 | Gen9, Inc. | Methods for screening proteins using DNA encoded chemical libraries as templates for enzyme catalysis |
| CA2871505C (en) | 2012-04-24 | 2021-10-12 | Gen9, Inc. | Methods for sorting nucleic acids and multiplexed preparative in vitro cloning |
| SG11201406547YA (en) | 2012-04-25 | 2014-11-27 | Regeneron Pharma | Nuclease-mediated targeting with large targeting vectors |
| WO2013163628A2 (en) | 2012-04-27 | 2013-10-31 | Duke University | Genetic correction of mutated genes |
| US20150225734A1 (en) | 2012-06-19 | 2015-08-13 | Regents Of The University Of Minnesota | Gene targeting in plants using dna viruses |
| IL236303B (en) | 2012-06-25 | 2022-07-01 | Gen9 Inc | Methods for nucleic acid assembly and high throughput sequencing |
| AU2013293270B2 (en) * | 2012-07-25 | 2018-08-16 | Massachusetts Institute Of Technology | Inducible DNA binding proteins and genome perturbation tools and applications thereof |
| CA2891510C (en) | 2012-11-16 | 2022-10-18 | Transposagen Biopharmaceuticals, Inc. | Site-specific enzymes and methods of use |
| WO2014093655A2 (en) | 2012-12-12 | 2014-06-19 | The Broad Institute, Inc. | Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains |
| US20140186843A1 (en) | 2012-12-12 | 2014-07-03 | Massachusetts Institute Of Technology | Methods, systems, and apparatus for identifying target sequences for cas enzymes or crispr-cas systems for target sequences and conveying results thereof |
| IL239344B2 (en) * | 2012-12-12 | 2024-06-01 | Broad Inst Inc | Engineering of systems, methods and optimized guide compositions for sequence manipulation |
| US20140310830A1 (en) | 2012-12-12 | 2014-10-16 | Feng Zhang | CRISPR-Cas Nickase Systems, Methods And Compositions For Sequence Manipulation in Eukaryotes |
| CN113355357B (en) | 2012-12-12 | 2024-12-03 | 布罗德研究所有限公司 | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| EP2922393B2 (en) | 2013-02-27 | 2022-12-28 | Helmholtz Zentrum München - Deutsches Forschungszentrum für Gesundheit und Umwelt (GmbH) | Gene editing in the oocyte by cas9 nucleases |
| EP2971184B1 (en) | 2013-03-12 | 2019-04-17 | President and Fellows of Harvard College | Method of generating a three-dimensional nucleic acid containing matrix |
| US20140273230A1 (en) * | 2013-03-15 | 2014-09-18 | Sigma-Aldrich Co., Llc | Crispr-based genome modification and regulation |
| WO2014144155A1 (en) * | 2013-03-15 | 2014-09-18 | Regents Of The University Of Minnesota | Engineering plant genomes using crispr/cas systems |
| US9828582B2 (en) | 2013-03-19 | 2017-11-28 | Duke University | Compositions and methods for the induction and tuning of gene expression |
| US20160186208A1 (en) * | 2013-04-16 | 2016-06-30 | Whitehead Institute For Biomedical Research | Methods of Mutating, Modifying or Modulating Nucleic Acid in a Cell or Nonhuman Mammal |
| DK3456831T3 (en) | 2013-04-16 | 2021-09-06 | Regeneron Pharma | TARGETED MODIFICATION OF RAT GENOMES |
| CN105683376A (en) * | 2013-05-15 | 2016-06-15 | 桑格摩生物科学股份有限公司 | Methods and compositions for treating genetic conditions |
| AU2014273082B2 (en) * | 2013-05-29 | 2018-11-08 | Cellectis | A method for producing precise DNA cleavage using Cas9 nickase activity |
| US9267135B2 (en) | 2013-06-04 | 2016-02-23 | President And Fellows Of Harvard College | RNA-guided transcriptional regulation |
| SG10201913068PA (en) * | 2013-06-04 | 2020-02-27 | Harvard College | Rna-guided transcriptional regulation |
| WO2014197748A2 (en) * | 2013-06-05 | 2014-12-11 | Duke University | Rna-guided gene editing and gene regulation |
| JP2016521561A (en) | 2013-06-14 | 2016-07-25 | セレクティス | A method for non-transgenic genome editing in plants |
| CN105683379A (en) * | 2013-06-17 | 2016-06-15 | 布罗德研究所有限公司 | Delivery, engineering and optimization of systems, methods and compositions for targeting and modeling diseases and disorders of post mitotic cells |
| EP3666892A1 (en) * | 2013-07-10 | 2020-06-17 | President and Fellows of Harvard College | Orthogonal cas9 proteins for rna-guided gene regulation and editing |
| US11306328B2 (en) | 2013-07-26 | 2022-04-19 | President And Fellows Of Harvard College | Genome engineering |
| US9163284B2 (en) | 2013-08-09 | 2015-10-20 | President And Fellows Of Harvard College | Methods for identifying a target site of a Cas9 nuclease |
| CN120574876A (en) | 2013-08-22 | 2025-09-02 | 纳幕尔杜邦公司 | Plant genome modification using a guide RNA/CAS endonuclease system and methods of use thereof |
| US9359599B2 (en) | 2013-08-22 | 2016-06-07 | President And Fellows Of Harvard College | Engineered transcription activator-like effector (TALE) domains and uses thereof |
| US9228207B2 (en) | 2013-09-06 | 2016-01-05 | President And Fellows Of Harvard College | Switchable gRNAs comprising aptamers |
| US9526784B2 (en) | 2013-09-06 | 2016-12-27 | President And Fellows Of Harvard College | Delivery system for functional nucleases |
| US9322037B2 (en) | 2013-09-06 | 2016-04-26 | President And Fellows Of Harvard College | Cas9-FokI fusion proteins and uses thereof |
| EP3988649B1 (en) * | 2013-09-18 | 2024-11-27 | Kymab Limited | Methods, cells and organisms |
| WO2015065964A1 (en) | 2013-10-28 | 2015-05-07 | The Broad Institute Inc. | Functional genomics using crispr-cas systems, compositions, methods, screens and applications thereof |
| KR102170502B1 (en) | 2013-12-11 | 2020-10-28 | 리제너론 파마슈티칼스 인코포레이티드 | Methods and compositions for the targeted modification of a genome |
| EP3080279B1 (en) | 2013-12-11 | 2018-09-26 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for the targeted modification of a genome |
| US20150165054A1 (en) | 2013-12-12 | 2015-06-18 | President And Fellows Of Harvard College | Methods for correcting caspase-9 point mutations |
| WO2015089427A1 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Crispr-cas systems and methods for altering expression of gene products, structural information and inducible modular cas enzymes |
| EP3690044B1 (en) | 2014-02-11 | 2024-01-10 | The Regents of the University of Colorado, a body corporate | Crispr enabled multiplexed genome engineering |
| US11028388B2 (en) | 2014-03-05 | 2021-06-08 | Editas Medicine, Inc. | CRISPR/Cas-related methods and compositions for treating Usher syndrome and retinitis pigmentosa |
| US11141493B2 (en) | 2014-03-10 | 2021-10-12 | Editas Medicine, Inc. | Compositions and methods for treating CEP290-associated disease |
| US11339437B2 (en) | 2014-03-10 | 2022-05-24 | Editas Medicine, Inc. | Compositions and methods for treating CEP290-associated disease |
| ES2745769T3 (en) | 2014-03-10 | 2020-03-03 | Editas Medicine Inc | CRISPR / CAS related procedures and compositions for treating Leber 10 congenital amaurosis (LCA10) |
| WO2015148670A1 (en) * | 2014-03-25 | 2015-10-01 | Editas Medicine Inc. | Crispr/cas-related methods and compositions for treating hiv infection and aids |
| EP3122880B1 (en) | 2014-03-26 | 2021-05-05 | Editas Medicine, Inc. | Crispr/cas-related methods and compositions for treating sickle cell disease |
| EP3540061A1 (en) | 2014-04-02 | 2019-09-18 | Editas Medicine, Inc. | Crispr/cas-related methods and compositions for treating primary open angle glaucoma |
| BR112016024945A2 (en) | 2014-04-28 | 2017-10-24 | Recombinetics Inc | swine multiplex gene editing |
| WO2015188056A1 (en) | 2014-06-05 | 2015-12-10 | Sangamo Biosciences, Inc. | Methods and compositions for nuclease design |
| HRP20200529T1 (en) | 2014-06-06 | 2020-09-04 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for modifying a targeted locus |
| ES2788426T3 (en) * | 2014-06-16 | 2020-10-21 | Univ Johns Hopkins | Compositions and Methods for the Expression of CRISPR Guide RNAs Using the H1 Promoter |
| US20170107541A1 (en) * | 2014-06-17 | 2017-04-20 | Poseida Therapeutics, Inc. | A method for directing proteins to specific loci in the genome and uses thereof |
| ES2781323T3 (en) | 2014-06-23 | 2020-09-01 | Regeneron Pharma | Nuclease-mediated DNA assembly |
| SI3161128T1 (en) | 2014-06-26 | 2019-02-28 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for targeted genetic modifications and methods of use |
| US20170198268A1 (en) * | 2014-07-09 | 2017-07-13 | Gen9, Inc. | Compositions and Methods for Site-Directed DNA Nicking and Cleaving |
| WO2016007839A1 (en) | 2014-07-11 | 2016-01-14 | President And Fellows Of Harvard College | Methods for high-throughput labelling and detection of biological features in situ using microscopy |
| CA2954791C (en) * | 2014-07-14 | 2025-11-18 | The Regents Of The University Of California | Crispr/cas transcriptional modulation |
| US10077453B2 (en) | 2014-07-30 | 2018-09-18 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| EP4194557A1 (en) | 2014-08-06 | 2023-06-14 | Institute for Basic Science | Genome editing using campylobacter jejuni crispr/cas system-derived rgen |
| EP3188763B1 (en) | 2014-09-02 | 2020-05-13 | The Regents of The University of California | Methods and compositions for rna-directed target dna modification |
| MX2017002930A (en) | 2014-09-12 | 2017-06-06 | Du Pont | GENERATION OF SITE SPECIFIC INTEGRATION SITES FOR COMPLEX RANGE LOCIES IN CORN AND SOY, AND METHODS OF USE. |
| ES3015369T3 (en) * | 2014-10-09 | 2025-05-05 | Seattle Childrens Hospital Dba Seattle Childrens Res Inst | Long poly (a) plasmids and methods for introduction of long poly (a) sequences into the plasmid |
| US9879283B2 (en) * | 2014-10-09 | 2018-01-30 | Life Technologies Corporation | CRISPR oligonucleotides and gene editing |
| BR112017007770A2 (en) | 2014-10-15 | 2018-01-16 | Regeneron Pharma | in vitro culture, hipscs population, method for modifying a genomic target locus, and, hipsc. |
| GB201418965D0 (en) | 2014-10-24 | 2014-12-10 | Ospedale San Raffaele And Fond Telethon | |
| WO2016065364A1 (en) * | 2014-10-24 | 2016-04-28 | Life Technologies Corporation | Compositions and methods for enhancing homologous recombination |
| TWI716367B (en) * | 2014-10-31 | 2021-01-21 | 麻省理工學院 | Massively parallel combinatorial genetics for crispr |
| JP6823593B2 (en) | 2014-11-06 | 2021-02-03 | イー・アイ・デュポン・ドウ・ヌムール・アンド・カンパニーE.I.Du Pont De Nemours And Company | Peptide-mediated transport of RNA-induced endonucleases to cells |
| JP2017534294A (en) * | 2014-11-19 | 2017-11-24 | インスティチュート フォー ベーシック サイエンスInstitute For Basic Science | Method for regulating gene expression using CAS9 protein expressed from two vectors |
| KR102531016B1 (en) | 2014-11-21 | 2023-05-10 | 리제너론 파마슈티칼스 인코포레이티드 | METHODS AND COMPOSITIONS FOR TARGETED GENETIC MODIFICATION USING PAIRED GUIDE RNAs |
| GB201421096D0 (en) | 2014-11-27 | 2015-01-14 | Imp Innovations Ltd | Genome editing methods |
| CA2969619A1 (en) | 2014-12-03 | 2016-06-09 | Agilent Technologies, Inc. | Guide rna with chemical modifications |
| CA2970683A1 (en) * | 2014-12-18 | 2016-06-23 | Integrated Dna Technologies, Inc. | Crispr-based compositions and methods of use |
| ES2947714T3 (en) | 2014-12-19 | 2023-08-17 | Regeneron Pharma | Methods and Compositions for Targeted Genetic Modification Through Multiple Targeting in a Single Step |
| US10196613B2 (en) | 2014-12-19 | 2019-02-05 | Regeneron Pharmaceuticals, Inc. | Stem cells for modeling type 2 diabetes |
| US11248240B2 (en) | 2015-01-29 | 2022-02-15 | Meiogenix | Method for inducing targeted meiotic recombinations |
| WO2016130600A2 (en) | 2015-02-09 | 2016-08-18 | Duke University | Compositions and methods for epigenome editing |
| KR102888521B1 (en) | 2015-04-06 | 2025-11-19 | 더 보드 어브 트러스티스 어브 더 리랜드 스탠포드 주니어 유니버시티 | Chemically modified guide rnas for crispr/cas-mediated gene regulation |
| JP2018522249A (en) | 2015-04-24 | 2018-08-09 | エディタス・メディシン、インコーポレイテッド | Evaluation of CAS 9 molecule / guide RNA molecule complex |
| WO2016176617A2 (en) | 2015-04-29 | 2016-11-03 | New York University | Method for treating high-grade gliomas |
| WO2016178207A1 (en) | 2015-05-04 | 2016-11-10 | Ramot At Tel-Aviv University Ltd. | Methods and kits for fragmenting dna |
| AU2016261927B2 (en) * | 2015-05-12 | 2022-04-07 | Sangamo Therapeutics, Inc. | Nuclease-mediated regulation of gene expression |
| US11473082B2 (en) * | 2015-06-17 | 2022-10-18 | Poseida Therapeutics, Inc. | Compositions and methods for directing proteins to specific loci in the genome |
| CN107949400A (en) * | 2015-06-24 | 2018-04-20 | 西格马-奥尔德里奇有限责任公司 | Cell cycle dependant genome regulates and controls and modification |
| CA3033909A1 (en) | 2015-08-14 | 2017-02-23 | The University Of Sydney | Connexin 45 inhibition for therapy |
| WO2017035416A2 (en) | 2015-08-25 | 2017-03-02 | Duke University | Compositions and methods of improving specificity in genomic engineering using rna-guided endonucleases |
| KR101795999B1 (en) | 2015-09-25 | 2017-11-09 | 전남대학교산학협력단 | Primer for Beta2-Microglobulin gene remove using CRISPR/CAS9 system |
| KR101745863B1 (en) | 2015-09-25 | 2017-06-12 | 전남대학교산학협력단 | Primer for prohibitin2 gene remove using CRISPR/CAS9 system |
| EP4089175A1 (en) * | 2015-10-13 | 2022-11-16 | Duke University | Genome engineering with type i crispr systems in eukaryotic cells |
| RU2695636C1 (en) | 2015-10-22 | 2019-07-25 | Телефонактиеболагет Лм Эрикссон (Пабл) | Methods and device related to selective increase of radio signals level |
| IL310721B2 (en) | 2015-10-23 | 2025-11-01 | Harvard College | Nucleobase editors and their uses |
| WO2017075335A1 (en) | 2015-10-28 | 2017-05-04 | Voyager Therapeutics, Inc. | Regulatable expression using adeno-associated virus (aav) |
| AU2016349288A1 (en) | 2015-11-03 | 2018-05-31 | President And Fellows Of Harvard College | Method and apparatus for volumetric imaging of a three-dimensional nucleic acid containing matrix |
| US11905521B2 (en) | 2015-11-17 | 2024-02-20 | The Chinese University Of Hong Kong | Methods and systems for targeted gene manipulation |
| US10240145B2 (en) * | 2015-11-25 | 2019-03-26 | The Board Of Trustees Of The Leland Stanford Junior University | CRISPR/Cas-mediated genome editing to treat EGFR-mutant lung cancer |
| KR102787119B1 (en) | 2015-11-30 | 2025-03-27 | 듀크 유니버시티 | Therapeutic targets and methods for correcting the human dystrophin gene by gene editing |
| EP3219799A1 (en) | 2016-03-17 | 2017-09-20 | IMBA-Institut für Molekulare Biotechnologie GmbH | Conditional crispr sgrna expression |
| US11512311B2 (en) | 2016-03-25 | 2022-11-29 | Editas Medicine, Inc. | Systems and methods for treating alpha 1-antitrypsin (A1AT) deficiency |
| US20190127713A1 (en) | 2016-04-13 | 2019-05-02 | Duke University | Crispr/cas9-based repressors for silencing gene targets in vivo and methods of use |
| AU2017250683A1 (en) * | 2016-04-14 | 2018-11-01 | Boco Silicon Valley, Inc. | Genome editing of human neural stem cells using nucleases |
| EP4613756A3 (en) | 2016-04-25 | 2025-11-12 | President And Fellows Of Harvard College | Hybridization chain reaction methods for in situ molecular detection |
| US11499168B2 (en) * | 2016-04-25 | 2022-11-15 | Universitat Basel | Allele editing and applications thereof |
| CN113831407B (en) | 2016-05-20 | 2024-06-11 | 瑞泽恩制药公司 | Methods for breaking immune tolerance using multiple guide RNAs |
| CN109906271A (en) * | 2016-06-03 | 2019-06-18 | 国家医疗保健研究所 | Dietary-controlled expression of nucleic acids encoding Cas9 nuclease and uses thereof |
| US10767175B2 (en) | 2016-06-08 | 2020-09-08 | Agilent Technologies, Inc. | High specificity genome editing using chemically modified guide RNAs |
| US11293021B1 (en) | 2016-06-23 | 2022-04-05 | Inscripta, Inc. | Automated cell processing methods, modules, instruments, and systems |
| AU2017280353B2 (en) | 2016-06-24 | 2021-11-11 | Inscripta, Inc. | Methods for generating barcoded combinatorial libraries |
| JP7490211B2 (en) | 2016-07-19 | 2024-05-27 | デューク ユニバーシティ | Therapeutic Applications of CPF1-Based Genome Editing |
| EP3491014B1 (en) | 2016-07-28 | 2023-04-05 | Regeneron Pharmaceuticals, Inc. | Allele-specific primer or probe hybridized to a nucleic acid molecule encoding a gpr156 variant |
| JP2019523009A (en) | 2016-07-29 | 2019-08-22 | リジェネロン・ファーマシューティカルズ・インコーポレイテッドRegeneron Pharmaceuticals, Inc. | Mice having mutations leading to expression of C-terminal truncated fibrillin-1 |
| BR112019001887A2 (en) | 2016-08-02 | 2019-07-09 | Editas Medicine Inc | compositions and methods for treating cep290-associated disease |
| CN110214183A (en) | 2016-08-03 | 2019-09-06 | 哈佛大学的校长及成员们 | Adenosine nucleobase editing machine and application thereof |
| WO2018031683A1 (en) | 2016-08-09 | 2018-02-15 | President And Fellows Of Harvard College | Programmable cas9-recombinase fusion proteins and uses thereof |
| JP2019524149A (en) * | 2016-08-20 | 2019-09-05 | アベリノ ラボ ユーエスエー インコーポレイテッドAvellino Lab USA, Inc. | Single-stranded guide RNA, CRISPR / Cas9 system, and methods of use thereof |
| US11542509B2 (en) | 2016-08-24 | 2023-01-03 | President And Fellows Of Harvard College | Incorporation of unnatural amino acids into proteins using base editing |
| CN118853848A (en) | 2016-08-31 | 2024-10-29 | 哈佛学院董事及会员团体 | Methods for combining detection of biomolecules into a single assay using fluorescent in situ sequencing |
| CN106636197B (en) * | 2016-09-22 | 2019-09-03 | 南京市妇幼保健院 | A method for targeted knockdown of multiple copies of genes in the zebrafish genome |
| US20190225974A1 (en) | 2016-09-23 | 2019-07-25 | BASF Agricultural Solutions Seed US LLC | Targeted genome optimization in plants |
| CA3039924A1 (en) * | 2016-10-11 | 2018-04-19 | Stemgenics, Inc. | Nanoparticles functionalized with gene editing tools and related methods |
| KR102622411B1 (en) | 2016-10-14 | 2024-01-10 | 프레지던트 앤드 펠로우즈 오브 하바드 칼리지 | AAV delivery of nucleobase editor |
| KR20190067209A (en) | 2016-10-14 | 2019-06-14 | 더 제너럴 하스피탈 코포레이션 | The posteriorly regulated site-specific nuclease |
| GB201617559D0 (en) | 2016-10-17 | 2016-11-30 | University Court Of The University Of Edinburgh The | Swine comprising modified cd163 and associated methods |
| LT3535392T (en) * | 2016-11-02 | 2024-04-25 | Universität Basel | Immunologically discernible cell surface variants for use in cell therapy |
| TWI851534B (en) * | 2016-12-22 | 2024-08-11 | 美商英特利亞醫療公司 | Compositions and methods for treating alpha-1 antitrypsin deficiency |
| US20200385753A1 (en) * | 2016-12-23 | 2020-12-10 | Institute For Basic Science | Composition for base editing for animal embryo and base editing method |
| WO2018119359A1 (en) | 2016-12-23 | 2018-06-28 | President And Fellows Of Harvard College | Editing of ccr5 receptor gene to protect against hiv infection |
| US11859219B1 (en) | 2016-12-30 | 2024-01-02 | Flagship Pioneering Innovations V, Inc. | Methods of altering a target nucleotide sequence with an RNA-guided nuclease and a single guide RNA |
| RU2019126483A (en) | 2017-01-23 | 2021-02-24 | Ридженерон Фармасьютикалз, Инк. | VARIANTS OF 17-BETA-HYDROXYSTEROID DEHYDROGENASE 13 (HSD17B13) AND THEIR APPLICATION |
| WO2018140497A1 (en) | 2017-01-25 | 2018-08-02 | Efimov Igor R | Apparatus and methods for in vitro preclinical human trials |
| CN106978438B (en) * | 2017-02-27 | 2020-08-28 | 北京大北农生物技术有限公司 | Method for improving homologous recombination efficiency |
| US12390514B2 (en) | 2017-03-09 | 2025-08-19 | President And Fellows Of Harvard College | Cancer vaccine |
| EP3592853A1 (en) | 2017-03-09 | 2020-01-15 | President and Fellows of Harvard College | Suppression of pain by gene editing |
| US11542496B2 (en) | 2017-03-10 | 2023-01-03 | President And Fellows Of Harvard College | Cytosine to guanine base editor |
| WO2018170184A1 (en) | 2017-03-14 | 2018-09-20 | Editas Medicine, Inc. | Systems and methods for the treatment of hemoglobinopathies |
| KR20240116572A (en) | 2017-03-23 | 2024-07-29 | 프레지던트 앤드 펠로우즈 오브 하바드 칼리지 | Nucleobase editors comprising nucleic acid programmable dna binding proteins |
| WO2018195129A1 (en) | 2017-04-17 | 2018-10-25 | University Of Maryland, College Park | Embryonic cell cultures and methods of using the same |
| EP3622070A2 (en) | 2017-05-10 | 2020-03-18 | Editas Medicine, Inc. | Crispr/rna-guided nuclease systems and methods |
| US11560566B2 (en) | 2017-05-12 | 2023-01-24 | President And Fellows Of Harvard College | Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation |
| US10738284B2 (en) | 2017-06-05 | 2020-08-11 | Regeneron Pharmaceuticals, Inc. | B4GALT1 cDNA variants and compositions comprising the same |
| US10011849B1 (en) | 2017-06-23 | 2018-07-03 | Inscripta, Inc. | Nucleic acid-guided nucleases |
| US9982279B1 (en) | 2017-06-23 | 2018-05-29 | Inscripta, Inc. | Nucleic acid-guided nucleases |
| ES2996886T3 (en) | 2017-06-27 | 2025-02-13 | Regeneron Pharma | Rodents comprising a humanized asgr1 locus |
| JP2020530979A (en) | 2017-06-30 | 2020-11-05 | インスクリプタ, インコーポレイテッド | Automatic cell processing methods, modules, equipment and systems |
| KR102655021B1 (en) | 2017-07-11 | 2024-04-04 | 시그마-알드리치 컴퍼니., 엘엘씨 | Using nucleosome interacting protein domains to enhance targeted genome modification |
| CN111801345A (en) | 2017-07-28 | 2020-10-20 | 哈佛大学的校长及成员们 | Methods and compositions for evolutionary base editors using phage-assisted sequential evolution (PACE) |
| KR20200033259A (en) | 2017-07-31 | 2020-03-27 | 리제너론 파마슈티칼스 인코포레이티드 | Methods and compositions for evaluating CRISPR / Cas-mediated destruction or deletion in vivo and CRISPR / Cas-induced recombination with exogenous donor nucleic acids |
| BR112019028146A2 (en) * | 2017-07-31 | 2020-07-07 | Sigma-Aldrich Co. Llc | rna synthetic guide for crispr / cas activator systems |
| CN110891420B (en) | 2017-07-31 | 2022-06-03 | 瑞泽恩制药公司 | CAS transgenic mouse embryonic stem cell, mouse and application thereof |
| EP3585161A1 (en) | 2017-07-31 | 2020-01-01 | Regeneron Pharmaceuticals, Inc. | Assessment of crispr/cas-induced recombination with an exogenous donor nucleic acid in vivo |
| EP3665279B1 (en) * | 2017-08-09 | 2023-07-19 | Benson Hill, Inc. | Compositions and methods for modifying genomes |
| US10738327B2 (en) | 2017-08-28 | 2020-08-11 | Inscripta, Inc. | Electroporation cuvettes for automation |
| EP3676376B1 (en) | 2017-08-30 | 2025-01-15 | President and Fellows of Harvard College | High efficiency base editors comprising gam |
| EP3678680A4 (en) | 2017-09-05 | 2021-12-01 | Regeneron Pharmaceuticals, Inc. | RELEASE OF A GENEDITATION SYSTEM WITH A SINGLE RETROVIRAL PARTICLE AND METHOD OF GENERATION AND USE |
| MX2020002643A (en) | 2017-09-06 | 2020-09-25 | Regeneron Pharma | Single immunoglobulin interleukin-1 receptor related (sigirr) variants and uses thereof. |
| CN111278851A (en) | 2017-09-07 | 2020-06-12 | 雷杰纳荣制药公司 | Solute carrier family 14 member 1(SLC14a1) variants and uses thereof |
| US20190098879A1 (en) | 2017-09-29 | 2019-04-04 | Regeneron Pharmaceuticals, Inc. | Non-Human Animals Comprising A Humanized TTR Locus And Methods Of Use |
| JP6985508B2 (en) | 2017-09-30 | 2021-12-22 | インスクリプタ, インコーポレイテッド | Flow-through electroporation equipment organization |
| US11634716B2 (en) | 2017-10-16 | 2023-04-25 | University of Pittsburgh—of the Commonwealth System of Higher Education | Genetically modified mesenchymal stem cells for use in cardiovascular prosthetics |
| KR20250107288A (en) | 2017-10-16 | 2025-07-11 | 더 브로드 인스티튜트, 인코퍼레이티드 | Uses of adenosine base editors |
| AU2018352234A1 (en) | 2017-10-16 | 2020-04-23 | Regeneron Pharmaceuticals, Inc. | Cornulin (CRNN) variants and uses thereof |
| BR112020008627A2 (en) | 2017-11-03 | 2020-12-22 | University Of Florida Research Foundation, Inc. | METHODS AND COMPOSITIONS FOR RESISTANCE TO PLANT PATHOGENS IN PLANTS |
| JP7097440B2 (en) | 2017-11-10 | 2022-07-07 | リジェネロン・ファーマシューティカルズ・インコーポレイテッド | Non-human animals containing the SLC30A8 mutation and usage |
| CN120310773A (en) * | 2017-11-16 | 2025-07-15 | 阿斯利康(瑞典)有限公司 | Compositions and methods for improving the effectiveness of Cas9-based knock-in strategies |
| JP7361031B2 (en) | 2017-11-30 | 2023-10-13 | リジェネロン・ファーマシューティカルズ・インコーポレイテッド | Non-human animals containing a humanized TRKB locus |
| US12406749B2 (en) | 2017-12-15 | 2025-09-02 | The Broad Institute, Inc. | Systems and methods for predicting repair outcomes in genetic engineering |
| WO2019126578A1 (en) * | 2017-12-20 | 2019-06-27 | Poseida Therapeutics, Inc. | Compositions and methods for directing proteins to specific loci in the genome |
| EP3728589A4 (en) * | 2017-12-22 | 2021-11-03 | G+Flas Life Sciences | Chimeric genome engineering molecules and methods |
| AU2019207409B2 (en) | 2018-01-12 | 2023-02-23 | Basf Se | Gene underlying the number of spikelets per spike qtl in wheat on chromosome 7a |
| EP3740580A4 (en) | 2018-01-19 | 2021-10-20 | Duke University | GENOMIC ENGINEERING WITH CRISPR-CAS SYSTEMS IN EUKARYOTES |
| KR102465067B1 (en) | 2018-02-15 | 2022-11-10 | 시그마-알드리치 컴퍼니., 엘엘씨 | Engineered CAS9 System for Eukaryotic Genome Modification |
| WO2019165168A1 (en) | 2018-02-23 | 2019-08-29 | Pioneer Hi-Bred International, Inc. | Novel cas9 orthologs |
| KR102907245B1 (en) | 2018-03-14 | 2026-01-05 | 에디타스 메디신, 인코포레이티드 | Systems and methods for treating hemoglobinopathies |
| EP3592140A1 (en) | 2018-03-19 | 2020-01-15 | Regeneron Pharmaceuticals, Inc. | Transcription modulation in animals using crispr/cas systems |
| US10443031B1 (en) | 2018-03-29 | 2019-10-15 | Inscripta, Inc. | Methods for controlling the growth of prokaryotic and eukaryotic cells |
| WO2019200004A1 (en) | 2018-04-13 | 2019-10-17 | Inscripta, Inc. | Automated cell processing instruments comprising reagent cartridges |
| KR102922694B1 (en) | 2018-04-19 | 2026-02-03 | 더 리젠츠 오브 더 유니버시티 오브 캘리포니아 | Compositions and methods for gene editing |
| US10557216B2 (en) | 2018-04-24 | 2020-02-11 | Inscripta, Inc. | Automated instrumentation for production of T-cell receptor peptide libraries |
| US10858761B2 (en) | 2018-04-24 | 2020-12-08 | Inscripta, Inc. | Nucleic acid-guided editing of exogenous polynucleotides in heterologous cells |
| WO2019209926A1 (en) | 2018-04-24 | 2019-10-31 | Inscripta, Inc. | Automated instrumentation for production of peptide libraries |
| KR20210005178A (en) * | 2018-04-27 | 2021-01-13 | 시애틀 칠드런즈 호스피탈 디/비/에이 시애틀 칠드런즈 리서치 인스티튜트 | Therapeutic genome editing in X-linked high IGM syndrome |
| WO2019213430A1 (en) * | 2018-05-03 | 2019-11-07 | The Board Of Trustees Of The Leland Stanford Junior University | Compositions and methods for nicking target dna sequences |
| WO2019213910A1 (en) * | 2018-05-10 | 2019-11-14 | Syngenta Participations Ag | Methods and compositions for targeted editing of polynucleotides |
| EP3790974A1 (en) | 2018-05-10 | 2021-03-17 | Auxolytic Ltd | Gene therapy methods and compositions using auxotrophic regulatable cells |
| AU2019265019B2 (en) | 2018-05-11 | 2025-11-06 | Beam Therapeutics Inc. | Methods of substituting pathogenic amino acids using programmable base editor systems |
| KR20210045360A (en) | 2018-05-16 | 2021-04-26 | 신테고 코포레이션 | Methods and systems for guide RNA design and use |
| CN108624622A (en) * | 2018-05-16 | 2018-10-09 | 湖南艾佳生物科技股份有限公司 | A kind of genetically engineered cell strain that can secrete mouse interleukin -6 based on CRISPR-Cas9 systems structure |
| US12157760B2 (en) | 2018-05-23 | 2024-12-03 | The Broad Institute, Inc. | Base editors and uses thereof |
| EP3575402A1 (en) * | 2018-06-01 | 2019-12-04 | Algentech SAS | Gene targeting |
| EP3802839A1 (en) | 2018-06-07 | 2021-04-14 | The State of Israel, Ministry of Agriculture & Rural Development, Agricultural Research Organization (ARO) (Volcani Center) | Nucleic acid constructs and methods of using same |
| EP3800998A1 (en) | 2018-06-07 | 2021-04-14 | The State of Israel, Ministry of Agriculture & Rural Development, Agricultural Research Organization (ARO) (Volcani Center) | Methods of regenerating and transforming cannabis |
| CN112469834A (en) * | 2018-06-25 | 2021-03-09 | 生物纳米基因公司 | Labeling of DNA |
| CA3108767A1 (en) | 2018-06-30 | 2020-01-02 | Inscripta, Inc. | Instruments, modules, and methods for improved detection of edited sequences in live cells |
| US12522807B2 (en) | 2018-07-09 | 2026-01-13 | The Broad Institute, Inc. | RNA programmable epigenetic RNA modifiers and uses thereof |
| CA3108281A1 (en) * | 2018-08-03 | 2020-02-06 | Beam Therapeutics Inc. | Multi-effector nucleobase editors and methods of using same to modify a nucleic acid target sequence |
| GB201813011D0 (en) | 2018-08-10 | 2018-09-26 | Vib Vzw | Means and methods for drought tolerance in crops |
| US10532324B1 (en) | 2018-08-14 | 2020-01-14 | Inscripta, Inc. | Instruments, modules, and methods for improved detection of edited sequences in live cells |
| US11142740B2 (en) | 2018-08-14 | 2021-10-12 | Inscripta, Inc. | Detection of nuclease edited sequences in automated modules and instruments |
| US10752874B2 (en) | 2018-08-14 | 2020-08-25 | Inscripta, Inc. | Instruments, modules, and methods for improved detection of edited sequences in live cells |
| KR102103103B1 (en) | 2018-08-16 | 2020-04-21 | (주)라트바이오 | Transgenic animals and transgenic embryos producing an engineered nuclease |
| US20210246472A1 (en) * | 2018-08-21 | 2021-08-12 | Sigma-Aldrich Co. Llc | Down-regulation of the cytosolic dna sensor pathway |
| WO2020081149A2 (en) | 2018-08-30 | 2020-04-23 | Inscripta, Inc. | Improved detection of nuclease edited sequences in automated modules and instruments |
| WO2020051562A2 (en) | 2018-09-07 | 2020-03-12 | Beam Therapeutics Inc. | Compositions and methods for improving base editing |
| EP3847254A4 (en) | 2018-09-07 | 2022-08-10 | Beam Therapeutics Inc. | Compositions and methods for delivering a nucleobase editing system |
| CN109055379B (en) * | 2018-09-10 | 2022-04-15 | 石铭 | Preparation method of transgenic chicken oviduct bioreactor |
| KR102121817B1 (en) * | 2018-09-12 | 2020-06-26 | 한국화학연구원 | Vectors for expressing recombinant antigens using CRISPR and method for simultaneously multiplexing thereof |
| JP7222075B2 (en) | 2018-09-13 | 2023-02-14 | リジェネロン・ファーマシューティカルズ・インコーポレイテッド | Complement factor H gene knockout rats as a model of C3 glomerulopathy |
| WO2020076976A1 (en) | 2018-10-10 | 2020-04-16 | Readcoor, Inc. | Three-dimensional spatial molecular indexing |
| SG11202103917VA (en) | 2018-10-16 | 2021-05-28 | Blueallele Llc | Methods for targeted insertion of dna in genes |
| AU2019360270B2 (en) | 2018-10-18 | 2025-08-07 | Intellia Therapeutics, Inc. | Compositions and methods for expressing factor IX. |
| WO2020086475A1 (en) | 2018-10-22 | 2020-04-30 | Inscripta, Inc. | Engineered enzymes |
| US11214781B2 (en) | 2018-10-22 | 2022-01-04 | Inscripta, Inc. | Engineered enzyme |
| WO2020086908A1 (en) * | 2018-10-24 | 2020-04-30 | The Broad Institute, Inc. | Constructs for improved hdr-dependent genomic editing |
| WO2020092453A1 (en) | 2018-10-29 | 2020-05-07 | The Broad Institute, Inc. | Nucleobase editors comprising geocas9 and uses thereof |
| KR20200071198A (en) | 2018-12-10 | 2020-06-19 | 네오이뮨텍, 인코퍼레이티드 | Development of new adoptive T cell immunotherapy by modification of Nrf2 expression |
| WO2020123887A2 (en) | 2018-12-14 | 2020-06-18 | Pioneer Hi-Bred International, Inc. | Novel crispr-cas systems for genome editing |
| AU2019400930A1 (en) | 2018-12-19 | 2021-07-01 | King's College London | Immunotherapeutic methods and compositions |
| KR102925054B1 (en) | 2018-12-20 | 2026-02-10 | 리제너론 파마슈티칼스 인코포레이티드 | Nuclease-mediated repeat expansion |
| BR112021013173A2 (en) * | 2019-01-04 | 2021-09-28 | The University Of Chicago | SYSTEMS AND METHODS TO MODULATE RNA |
| US20220136004A1 (en) * | 2019-01-11 | 2022-05-05 | Chan Zuckerberg Biohub, Inc. | Targeted In Vivo Genome Modification |
| US12351837B2 (en) | 2019-01-23 | 2025-07-08 | The Broad Institute, Inc. | Supernegatively charged proteins and uses thereof |
| AU2020215730A1 (en) | 2019-01-31 | 2021-07-29 | Beam Therapeutics Inc. | Nucleobase editors having reduced non-target deamination and assays for characterizing nucleobase editors |
| CN120174005A (en) | 2019-02-13 | 2025-06-20 | 比姆医疗股份有限公司 | Modified immune cells with adenosine deaminase base editors for modifying nucleobases in target sequences |
| US20220298494A1 (en) * | 2019-02-14 | 2022-09-22 | Metagenomi Ip Technologies, Llc | Enzymes with ruvc domains |
| US10913941B2 (en) | 2019-02-14 | 2021-02-09 | Metagenomi Ip Technologies, Llc | Enzymes with RuvC domains |
| US10947517B2 (en) * | 2019-02-15 | 2021-03-16 | Sigma-Aldrich Co. Llc | CRISPR/Cas fusion proteins and systems |
| GB201902277D0 (en) | 2019-02-19 | 2019-04-03 | King S College London | Therapeutic agents |
| MX2021010559A (en) | 2019-03-07 | 2021-12-15 | Univ California | Crispr-cas effector polypeptides and methods of use thereof. |
| EP3769090B1 (en) | 2019-03-18 | 2023-11-15 | Regeneron Pharmaceuticals, Inc. | Crispr/cas dropout screening platform to reveal genetic vulnerabilities associated with tau aggregation |
| CN120648640A (en) | 2019-03-18 | 2025-09-16 | 瑞泽恩制药公司 | CRISPR/Cas screening platform for identifying genetic modification factors for tau vaccination or aggregation |
| WO2020191233A1 (en) | 2019-03-19 | 2020-09-24 | The Broad Institute, Inc. | Methods and compositions for editing nucleotide sequences |
| AU2020247900A1 (en) | 2019-03-25 | 2021-11-04 | Inscripta, Inc. | Simultaneous multiplex genome editing in yeast |
| US11001831B2 (en) | 2019-03-25 | 2021-05-11 | Inscripta, Inc. | Simultaneous multiplex genome editing in yeast |
| AU2020256225B9 (en) | 2019-04-03 | 2025-04-10 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for insertion of antibody coding sequences into a safe harbor locus |
| RU2771374C1 (en) | 2019-04-04 | 2022-05-04 | Редженерон Фармасьютикалс, Инк. | Methods for seamless introduction of target modifications to directional vectors |
| KR102661779B1 (en) | 2019-04-04 | 2024-04-30 | 리제너론 파마슈티칼스 인코포레이티드 | Non-human animals containing the humanized coagulation factor 12 locus |
| GB201905360D0 (en) | 2019-04-16 | 2019-05-29 | Univ Nottingham | Fungal strains, production and uses thereof |
| US12473543B2 (en) | 2019-04-17 | 2025-11-18 | The Broad Institute, Inc. | Adenine base editors with reduced off-target effects |
| EP3966334A1 (en) | 2019-05-10 | 2022-03-16 | Basf Se | Regulatory nucleic acid molecules for enhancing gene expression in plants |
| US11891618B2 (en) | 2019-06-04 | 2024-02-06 | Regeneron Pharmaceuticals, Inc. | Mouse comprising a humanized TTR locus with a beta-slip mutation and methods of use |
| AU2020288623A1 (en) | 2019-06-06 | 2022-01-06 | Inscripta, Inc. | Curing for recursive nucleic acid-guided cell editing |
| MX2021015122A (en) | 2019-06-07 | 2022-04-06 | Regeneron Pharma | NON-HUMAN ANIMALS COMPRISING A HUMANIZED ALBUMIN LOCUS. |
| CN113906134B (en) | 2019-06-14 | 2025-06-24 | 瑞泽恩制药公司 | TAU proteinopathy model |
| US10907125B2 (en) | 2019-06-20 | 2021-02-02 | Inscripta, Inc. | Flow through electroporation modules and instrumentation |
| WO2020257395A1 (en) | 2019-06-21 | 2020-12-24 | Inscripta, Inc. | Genome-wide rationally-designed mutations leading to enhanced lysine production in e. coli |
| US10927385B2 (en) | 2019-06-25 | 2021-02-23 | Inscripta, Inc. | Increased nucleic-acid guided cell editing in yeast |
| EP3783104A1 (en) * | 2019-08-20 | 2021-02-24 | Kemijski Institut | Coiled-coil mediated tethering of crispr-cas and exonucleases for enhanced genome editing |
| WO2021050398A1 (en) * | 2019-09-10 | 2021-03-18 | The Regents Of The University Of California | Synthetic lethality screening platform for cells undergoing alt |
| CN114729382A (en) | 2019-09-12 | 2022-07-08 | 巴斯夫欧洲公司 | Regulatory nucleic acid molecules for enhancing gene expression in plants |
| EP4028063A1 (en) | 2019-09-13 | 2022-07-20 | Regeneron Pharmaceuticals, Inc. | Transcription modulation in animals using crispr/cas systems delivered by lipid nanoparticles |
| EP4034138A4 (en) | 2019-09-27 | 2024-07-31 | Beam Therapeutics, Inc. | COMPOSITIONS AND METHODS FOR TREATING BLOOD CANCER |
| WO2021069387A1 (en) | 2019-10-07 | 2021-04-15 | Basf Se | Regulatory nucleic acid molecules for enhancing gene expression in plants |
| US12435330B2 (en) | 2019-10-10 | 2025-10-07 | The Broad Institute, Inc. | Methods and compositions for prime editing RNA |
| CN110628825A (en) * | 2019-10-14 | 2019-12-31 | 上海捷易生物科技有限公司 | A kind of NHEJ-dependent reporter knock-in composition and method of use thereof |
| US12521451B2 (en) | 2019-11-08 | 2026-01-13 | Regeneron Pharmaceuticals, Inc. | CRISPR and AAV strategies for x-linked juvenile retinoschisis therapy |
| US11203762B2 (en) | 2019-11-19 | 2021-12-21 | Inscripta, Inc. | Methods for increasing observed editing in bacteria |
| WO2021108363A1 (en) | 2019-11-25 | 2021-06-03 | Regeneron Pharmaceuticals, Inc. | Crispr/cas-mediated upregulation of humanized ttr allele |
| CA3159805A1 (en) | 2019-12-03 | 2021-06-10 | Frank Meulewaeter | Regulatory nucleic acid molecules for enhancing gene expression in plants |
| CA3157131A1 (en) | 2019-12-10 | 2021-06-17 | Inscripta, Inc. | Novel mad nucleases |
| US10704033B1 (en) | 2019-12-13 | 2020-07-07 | Inscripta, Inc. | Nucleic acid-guided nucleases |
| CA3161254A1 (en) | 2019-12-16 | 2021-06-24 | Katelijn D'HALLUIN | Improved genome editing using paired nickases |
| AU2020407048A1 (en) | 2019-12-18 | 2022-06-09 | Inscripta, Inc. | Cascade/dCas3 complementation assays for in vivo detection of nucleic acid-guided nuclease edited cells |
| WO2021141890A1 (en) * | 2020-01-09 | 2021-07-15 | Pioneer Hi-Bred International, Inc. | Two-step gene swap |
| US10689669B1 (en) | 2020-01-11 | 2020-06-23 | Inscripta, Inc. | Automated multi-module cell processing methods, instruments, and systems |
| US11225674B2 (en) | 2020-01-27 | 2022-01-18 | Inscripta, Inc. | Electroporation modules and instrumentation |
| WO2021154791A1 (en) | 2020-01-28 | 2021-08-05 | Regeneron Pharmaceuticals, Inc. | Non-human animals comprising a humanized pnpla3 locus and methods of use |
| EP4097251A1 (en) | 2020-01-29 | 2022-12-07 | 10X Genomics, Inc. | Compositions and methods for analyte detection |
| EP4099821A1 (en) | 2020-02-07 | 2022-12-14 | Regeneron Pharmaceuticals, Inc. | <smallcaps/>? ? ?klkb1? ? ? ? ?non-human animals comprising a humanizedlocus and methods of use |
| KR20230004456A (en) | 2020-03-04 | 2023-01-06 | 리제너론 파아마슈티컬스, 인크. | Methods and compositions for sensitization of tumor cells to immunotherapy |
| US20230102342A1 (en) | 2020-03-23 | 2023-03-30 | Regeneron Pharmaceuticals, Inc. | Non-human animals comprising a humanized ttr locus comprising a v30m mutation and methods of use |
| WO2021202568A1 (en) | 2020-03-31 | 2021-10-07 | Metagenomi Ip Technologies, Llc | Class ii, type ii crispr systems |
| US12057197B2 (en) | 2020-04-03 | 2024-08-06 | Creyon Bio, Inc. | Oligonucleotide-based machine learning |
| US20210332388A1 (en) | 2020-04-24 | 2021-10-28 | Inscripta, Inc. | Compositions, methods, modules and instruments for automated nucleic acid-guided nuclease editing in mammalian cells |
| IL297761A (en) | 2020-05-08 | 2022-12-01 | Broad Inst Inc | Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence |
| US11787841B2 (en) | 2020-05-19 | 2023-10-17 | Inscripta, Inc. | Rationally-designed mutations to the thrA gene for enhanced lysine production in E. coli |
| WO2021263146A2 (en) | 2020-06-26 | 2021-12-30 | Regeneron Pharmaceuticals, Inc. | Non-human animals comprising a humanized ace2 locus |
| CN111849986A (en) * | 2020-07-24 | 2020-10-30 | 江苏集萃药康生物科技有限公司 | Method for reducing tandem connection of double-stranded DNA (deoxyribonucleic acid) fragments in CRISPR-Cas9 gene editing and application thereof |
| US20220049303A1 (en) | 2020-08-17 | 2022-02-17 | Readcoor, Llc | Methods and systems for spatial mapping of genetic variants |
| US11299731B1 (en) | 2020-09-15 | 2022-04-12 | Inscripta, Inc. | CRISPR editing to embed nucleic acid landing pads into genomes of live cells |
| CA3196831A1 (en) | 2020-09-25 | 2022-03-31 | Beam Therapeutics Inc. | Fratricide resistant modified immune cells and methods of using the same |
| US11512297B2 (en) | 2020-11-09 | 2022-11-29 | Inscripta, Inc. | Affinity tag for recombination protein recruitment |
| WO2022120022A1 (en) | 2020-12-02 | 2022-06-09 | Regeneron Pharmaceuticals, Inc. | Crispr sam biosensor cell lines and methods of use thereof |
| US20240058390A1 (en) * | 2020-12-16 | 2024-02-22 | The Administrators Of The Tulane Educational Fund | Wnt+ adipocytes, exosomes from wnt+ adipocytes, and methods of making and using them |
| AU2021415461A1 (en) | 2021-01-04 | 2023-08-17 | Inscripta, Inc. | Mad nucleases |
| EP4274890A4 (en) | 2021-01-07 | 2024-11-27 | Inscripta, Inc. | Mad nucleases |
| CA3205865A1 (en) * | 2021-01-22 | 2022-07-28 | Brian C. Thomas | Novel engineered and chimeric nucleases |
| US12171813B2 (en) | 2021-02-05 | 2024-12-24 | Christiana Care Gene Editing Institute, Inc. | Methods of and compositions for reducing gene expression and/or activity |
| US11884924B2 (en) | 2021-02-16 | 2024-01-30 | Inscripta, Inc. | Dual strand nucleic acid-guided nickase editing |
| GB202103131D0 (en) | 2021-03-05 | 2021-04-21 | Biosystems Tech Limited | Method for preparation of research organisms |
| CA3218511A1 (en) | 2021-05-10 | 2022-11-17 | Sqz Biotechnologies Company | Methods for delivering genome editing molecules to the nucleus or cytosol of a cell and uses thereof |
| WO2022251644A1 (en) | 2021-05-28 | 2022-12-01 | Lyell Immunopharma, Inc. | Nr4a3-deficient immune cells and uses thereof |
| EP4347826A1 (en) | 2021-06-02 | 2024-04-10 | Lyell Immunopharma, Inc. | Nr4a3-deficient immune cells and uses thereof |
| AU2022335499A1 (en) | 2021-08-27 | 2024-02-22 | Metagenomi Therapeutics, Inc. | Enzymes with ruvc domains |
| JP2024534945A (en) | 2021-09-10 | 2024-09-26 | アジレント・テクノロジーズ・インク | Guide RNA for Prime Editing with Chemical Modifications |
| IL311962A (en) | 2021-10-14 | 2024-06-01 | Lonza Sales Ag | Producer cells are adapted to produce extracellular vesicles |
| US20240415980A1 (en) | 2021-10-28 | 2024-12-19 | Regeneron Pharmaceuticals, Inc. | Crispr/cas-related methods and compositions for knocking out c5 |
| EP4426828A1 (en) | 2021-11-01 | 2024-09-11 | Tome Biosciences, Inc. | Single construct platform for simultaneous delivery of gene editing machinery and nucleic acid cargo |
| IL312505A (en) | 2021-11-04 | 2024-07-01 | Regeneron Pharma | Non-human animals containing a mutated CACNG1 site |
| AU2022396533A1 (en) | 2021-11-24 | 2024-05-02 | Metagenomi Therapeutics, Inc. | Endonuclease systems |
| KR20240117571A (en) | 2021-12-08 | 2024-08-01 | 리제너론 파마슈티칼스 인코포레이티드 | Mutant myocilin disease model and uses thereof |
| GB202118058D0 (en) | 2021-12-14 | 2022-01-26 | Univ Warwick | Methods to increase yields in crops |
| US20250049006A1 (en) | 2021-12-20 | 2025-02-13 | C/O Regeneron Pharmaceuticals, Inc. | Non-human animals comprising humanized ace2 and tmprss loci |
| AU2022420615A1 (en) | 2021-12-22 | 2024-07-04 | Tome Biosciences, Inc. | Co-delivery of a gene editor construct and a donor template |
| AU2022424002A1 (en) | 2021-12-29 | 2024-06-13 | Bristol-Myers Squibb Company | Generation of landing pad cell lines |
| US20250230412A1 (en) | 2022-02-01 | 2025-07-17 | President And Fellows Of Harvard College | Methods and compositions for treating cancer |
| CA3242731A1 (en) | 2022-02-02 | 2023-08-10 | Regeneron Pharmaceuticals, Inc. | Insertion of anti-TFR:GAA and anti-CD63:GAA for the treatment of Pompe disease |
| WO2023150798A1 (en) | 2022-02-07 | 2023-08-10 | Regeneron Pharmaceuticals, Inc. | Compositions and methods for defining optimal treatment timeframes in lysosomal disease |
| WO2023205744A1 (en) | 2022-04-20 | 2023-10-26 | Tome Biosciences, Inc. | Programmable gene insertion compositions |
| WO2023212677A2 (en) | 2022-04-29 | 2023-11-02 | Regeneron Pharmaceuticals, Inc. | Identification of tissue-specific extragenic safe harbors for gene therapy approaches |
| WO2023215831A1 (en) | 2022-05-04 | 2023-11-09 | Tome Biosciences, Inc. | Guide rna compositions for programmable gene insertion |
| US20250302998A1 (en) | 2022-05-09 | 2025-10-02 | Regeneron Pharmaceuticals, Inc. | Vectors and methods for in vivo antibody production |
| JP2025516823A (en) | 2022-05-19 | 2025-05-30 | ライエル・イミュノファーマ・インコーポレイテッド | Polynucleotides targeting NR4A3 and uses thereof |
| WO2023225670A2 (en) | 2022-05-20 | 2023-11-23 | Tome Biosciences, Inc. | Ex vivo programmable gene insertion |
| JP2025521154A (en) | 2022-05-31 | 2025-07-08 | リジェネロン・ファーマシューティカルズ・インコーポレイテッド | CRISPR interference therapy for C9ORF72 repeat expansion disease |
| WO2023235725A2 (en) | 2022-05-31 | 2023-12-07 | Regeneron Pharmaceuticals, Inc. | Crispr-based therapeutics for c9orf72 repeat expansion disease |
| WO2023250384A2 (en) * | 2022-06-22 | 2023-12-28 | The Regents Of The University Of California | Crispr-cas effector polypeptides and methods of use thereof |
| IL317874A (en) | 2022-06-24 | 2025-02-01 | Tune Therapeutics Inc | Compositions, systems, and methods for reducing low-density lipoprotein through targeted gene repression |
| GB2621813A (en) | 2022-06-30 | 2024-02-28 | Univ Newcastle | Preventing disease recurrence in Mitochondrial replacement therapy |
| WO2024020587A2 (en) | 2022-07-22 | 2024-01-25 | Tome Biosciences, Inc. | Pleiopluripotent stem cell programmable gene insertion |
| IL317261A (en) | 2022-07-29 | 2025-01-01 | Regeneron Pharma | Non-human animals comprising a modified transferrin receptor locus |
| CN120659627A (en) | 2022-07-29 | 2025-09-16 | 瑞泽恩制药公司 | Compositions and methods for transferrin receptor (TFR) -mediated brain and muscle delivery |
| JP2025525745A (en) | 2022-08-05 | 2025-08-07 | リジェネロン・ファーマシューティカルズ・インコーポレイテッド | Aggregation-resistant variants of TDP-43 |
| WO2024064952A1 (en) | 2022-09-23 | 2024-03-28 | Lyell Immunopharma, Inc. | Methods for culturing nr4a-deficient cells overexpressing c-jun |
| WO2024064958A1 (en) | 2022-09-23 | 2024-03-28 | Lyell Immunopharma, Inc. | Methods for culturing nr4a-deficient cells |
| KR20250075694A (en) | 2022-09-28 | 2025-05-28 | 리제너론 파마슈티칼스 인코포레이티드 | Antibody-resistant variant receptors to enhance cell-based therapies |
| WO2024077174A1 (en) | 2022-10-05 | 2024-04-11 | Lyell Immunopharma, Inc. | Methods for culturing nr4a-deficient cells |
| EP4605524A1 (en) | 2022-10-20 | 2025-08-27 | Basf Se | Regulatory nucleic acid molecules for enhancing gene expression in plants |
| EP4612184A1 (en) | 2022-11-04 | 2025-09-10 | Regeneron Pharmaceuticals, Inc. | Calcium voltage-gated channel auxiliary subunit gamma 1 (cacng1) binding proteins and cacng1-mediated delivery to skeletal muscle |
| KR20250116795A (en) | 2022-11-14 | 2025-08-01 | 리제너론 파마슈티칼스 인코포레이티드 | Compositions and methods for fibroblast growth factor receptor 3-mediated delivery to astrocytes |
| CN120112547A (en) | 2022-11-16 | 2025-06-06 | 瑞泽恩制药公司 | Chimeric protein comprising membrane-bound IL-12 and a protease-cleavable linker |
| WO2024138194A1 (en) | 2022-12-22 | 2024-06-27 | Tome Biosciences, Inc. | Platforms, compositions, and methods for in vivo programmable gene insertion |
| US12415172B2 (en) | 2022-12-22 | 2025-09-16 | Synthego Corporation | Systems and method for automated oligonucleotide synthesis |
| WO2024159071A1 (en) | 2023-01-27 | 2024-08-02 | Regeneron Pharmaceuticals, Inc. | Modified rhabdovirus glycoproteins and uses thereof |
| WO2024234006A1 (en) | 2023-05-11 | 2024-11-14 | Tome Biosciences, Inc. | Systems, compositions, and methods for targeting liver sinusodial endothelial cells (lsecs) |
| KR20260026049A (en) | 2023-06-15 | 2026-02-25 | 리제너론 파아마슈티컬스, 인크. | Gene therapy for hearing impairment |
| KR20260032927A (en) | 2023-06-30 | 2026-03-10 | 리제너론 파마슈티칼스 인코포레이티드 | Methods and compositions for increasing homology-directed repair |
| CN121693566A (en) | 2023-07-28 | 2026-03-17 | 瑞泽恩制药公司 | Enhancement of transgene expression during unidirectional gene insertion using bGH-SV40L tandem PolyA |
| US20250049896A1 (en) | 2023-07-28 | 2025-02-13 | Regeneron Pharmaceuticals, Inc. | Anti-tfr:acid sphingomyelinase for treatment of acid sphingomyelinase deficiency |
| IL326018A (en) | 2023-07-28 | 2026-03-01 | Regeneron Pharma | Anti-tfr:gaa and anti-cd63:gaa insertion for treatment of pompe disease |
| WO2025038750A2 (en) | 2023-08-14 | 2025-02-20 | President And Fellows Of Harvard College | Methods and compositions for treating cancer |
| WO2025049524A1 (en) | 2023-08-28 | 2025-03-06 | Regeneron Pharmaceuticals, Inc. | Cxcr4 antibody-resistant modified receptors |
| WO2025050069A1 (en) | 2023-09-01 | 2025-03-06 | Tome Biosciences, Inc. | Programmable gene insertion using engineered integration enzymes |
| GB202314578D0 (en) | 2023-09-22 | 2023-11-08 | Univ Manchester | Methods of producing homoplasmic modified plants or parts thereof |
| WO2025122754A1 (en) | 2023-12-07 | 2025-06-12 | Regeneron Pharmaceuticals, Inc. | Gaa knockout non-human animals |
| US20250276092A1 (en) | 2024-03-01 | 2025-09-04 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for re-dosing aav using anti-cd40 antagonistic antibody to suppress host anti-aav antibody response |
| WO2025217398A1 (en) | 2024-04-10 | 2025-10-16 | Lyell Immunopharma, Inc. | Methods for culturing cells with improved culture medium |
| EP4677108A1 (en) | 2024-04-22 | 2026-01-14 | Basecamp Research Ltd | Method and compositions for detecting off-target editing |
| WO2025224182A2 (en) | 2024-04-23 | 2025-10-30 | Basecamp Research Ltd | Single construct platform for simultaneous delivery of gene editing machinery and nucleic acid cargo |
| WO2025235388A1 (en) | 2024-05-06 | 2025-11-13 | Regeneron Pharmaceuticals, Inc. | Transgene genomic identification by nuclease-mediated long read sequencing |
| WO2025259669A1 (en) | 2024-06-10 | 2025-12-18 | Regeneron Pharmaceuticals, Inc. | Methods and systems for characterizing modified oligonucleotides |
| WO2025265017A1 (en) | 2024-06-20 | 2025-12-26 | Regeneron Pharmaceuticals, Inc. | Ass1 gene insertion for the treatment of citrullinemia type i |
| WO2026064425A2 (en) | 2024-09-17 | 2026-03-26 | Dxome Co., Ltd. | Mirror image crispr-cas compositions |
| WO2026072529A1 (en) | 2024-09-24 | 2026-04-02 | University Of Florida Research Foundation, Incorporated | Mettl7a for improved embryo competence |
| WO2026080515A2 (en) | 2024-10-08 | 2026-04-16 | Regeneron Pharmaceuticals, Inc. | Crispr sam biosensor cells and cell lines and methods of use thereof |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8993233B2 (en) * | 2012-12-12 | 2015-03-31 | The Broad Institute Inc. | Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains |
| US9023649B2 (en) * | 2012-12-17 | 2015-05-05 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
Family Cites Families (166)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4952496A (en) | 1984-03-30 | 1990-08-28 | Associated Universities, Inc. | Cloning and expression of the gene for bacteriophage T7 RNA polymerase |
| WO1988008450A1 (en) | 1987-05-01 | 1988-11-03 | Birdwell Finlayson | Gene therapy for metabolite disorders |
| US5350689A (en) | 1987-05-20 | 1994-09-27 | Ciba-Geigy Corporation | Zea mays plants and transgenic Zea mays plants regenerated from protoplasts or protoplast-derived cells |
| US5767367A (en) | 1990-06-23 | 1998-06-16 | Hoechst Aktiengesellschaft | Zea mays (L.) with capability of long term, highly efficient plant regeneration including fertile transgenic maize plants having a heterologous gene, and their preparation |
| US7150982B2 (en) | 1991-09-09 | 2006-12-19 | Third Wave Technologies, Inc. | RNA detection assays |
| FR2763797B1 (en) * | 1997-05-30 | 1999-07-16 | Tabacs & Allumettes Ind | VERY LOW TAR RATE CIGARETTE WITH A TOBACCO TASTE COMPARABLE TO THAT OF A CLASSIC CIGARETTE WITH HIGHER TAR RATE |
| US20040186071A1 (en) | 1998-04-13 | 2004-09-23 | Bennett C. Frank | Antisense modulation of CD40 expression |
| US20020182673A1 (en) | 1998-05-15 | 2002-12-05 | Genentech, Inc. | IL-17 homologous polypedies and therapeutic uses thereof |
| CA2361191A1 (en) | 1999-02-03 | 2000-08-10 | The Children's Medical Center Corporation | Gene repair involving the induction of double-stranded dna cleavage at a chromosomal target site |
| US8183339B1 (en) * | 1999-10-12 | 2012-05-22 | Xigen S.A. | Cell-permeable peptide inhibitors of the JNK signal transduction pathway |
| US20020119570A1 (en) | 2000-09-25 | 2002-08-29 | Kyonggeun Yoon | Targeted gene correction by single-stranded oligodeoxynucleotides |
| CA2881568C (en) | 2000-10-27 | 2019-09-24 | Novartis Vaccines And Diagnostics, Inc. | Nucleic acids and proteins from streptococcus groups a & b |
| US7033744B2 (en) * | 2001-03-16 | 2006-04-25 | Naoya Kobayashi | Method for proliferating a liver cell, a liver cell obtained thereby, and use thereof |
| IL159756A0 (en) | 2001-07-12 | 2004-06-20 | Univ Massachusetts | IN VIVO PRODUCTION OF SMALL INTERFERING RNAs THAT MEDIATE GENE SILENCING |
| US20060253913A1 (en) | 2001-12-21 | 2006-11-09 | Yue-Jin Huang | Production of hSA-linked butyrylcholinesterases in transgenic mammals |
| WO2003087341A2 (en) | 2002-01-23 | 2003-10-23 | The University Of Utah Research Foundation | Targeted chromosomal mutagenesis using zinc finger nucleases |
| WO2003080809A2 (en) | 2002-03-21 | 2003-10-02 | Sangamo Biosciences, Inc. | Methods and compositions for using zinc finger endonucleases to enhance homologous recombination |
| US7539579B2 (en) | 2002-04-09 | 2009-05-26 | Beattie Kenneth L | Oligonucleotide probes for genosensor chips |
| WO2003104451A2 (en) * | 2002-06-06 | 2003-12-18 | Her Majesty The Queen In Right Of Canada As Represented By The Minister Of Agriculture And Agri-Food | Modifying dna recombination and repair |
| EP2806025B1 (en) | 2002-09-05 | 2019-04-03 | California Institute of Technology | Use of zinc finger nucleases to stimulate gene targeting |
| DE10260805A1 (en) * | 2002-12-23 | 2004-07-22 | Geneart Gmbh | Method and device for optimizing a nucleotide sequence for expression of a protein |
| US20070134796A1 (en) * | 2005-07-26 | 2007-06-14 | Sangamo Biosciences, Inc. | Targeted integration and expression of exogenous nucleic acid sequences |
| AU2004263865B2 (en) * | 2003-08-08 | 2007-05-17 | Sangamo Therapeutics, Inc. | Methods and compositions for targeted cleavage and recombination |
| US8053232B2 (en) | 2004-01-23 | 2011-11-08 | Virxsys Corporation | Correction of alpha-1-antitrypsin genetic defects using spliceosome mediated RNA trans splicing |
| US7972854B2 (en) | 2004-02-05 | 2011-07-05 | Sangamo Biosciences, Inc. | Methods and compositions for targeted cleavage and recombination |
| US20050220796A1 (en) | 2004-03-31 | 2005-10-06 | Dynan William S | Compositions and methods for modulating DNA repair |
| US7919277B2 (en) | 2004-04-28 | 2011-04-05 | Danisco A/S | Detection and typing of bacterial strains |
| EP2316942B1 (en) * | 2004-12-22 | 2021-04-21 | Alnylam Pharmaceuticals, Inc. | Conserved hbv and hcv sequences useful for gene silencing |
| US7892224B2 (en) | 2005-06-01 | 2011-02-22 | Brainlab Ag | Inverse catheter planning |
| US7534819B2 (en) | 2005-06-10 | 2009-05-19 | University Of Washington | Compositions and methods for intracellular delivery of biotinylated cargo |
| US20060282289A1 (en) | 2005-06-14 | 2006-12-14 | Healthmatch Solutions, Llc | System and method for health care financing |
| WO2007014181A2 (en) * | 2005-07-25 | 2007-02-01 | Johns Hopkins University | Site-specific modification of the human genome using custom-designed zinc finger nucleases |
| US10022457B2 (en) | 2005-08-05 | 2018-07-17 | Gholam A. Peyman | Methods to regulate polarization and enhance function of cells |
| DK2341149T3 (en) | 2005-08-26 | 2017-02-27 | Dupont Nutrition Biosci Aps | Use of CRISPR-associated genes (Cas) |
| KR100877824B1 (en) * | 2005-11-11 | 2009-01-12 | 한국생명공학연구원 | E2EPF UCP-VHL interaction and its uses |
| EP2522746B1 (en) * | 2006-03-02 | 2014-11-12 | The Ohio State University Research Foundation | MicroRNA expression profile associated with pancreatic cancer |
| US9677123B2 (en) | 2006-03-15 | 2017-06-13 | Siemens Healthcare Diagnostics Inc. | Degenerate nucleobase analogs |
| US20080300385A1 (en) * | 2006-03-28 | 2008-12-04 | Victoria Sharma | Covalently-linked complexes of HIV Tat and Env proteins |
| WO2007128338A1 (en) | 2006-05-10 | 2007-11-15 | Deinove | Process for chromosomal engineering using a novel dna repair system |
| DK2426220T3 (en) | 2006-05-19 | 2016-09-26 | Dupont Nutrition Biosci Aps | Labeled microorganisms, and methods for labeling |
| ES2465996T3 (en) | 2006-05-25 | 2014-06-09 | Sangamo Biosciences, Inc. | Methods and compositions for genetic inactivation |
| WO2007144770A2 (en) | 2006-06-16 | 2007-12-21 | Danisco A/S | Bacterium |
| US8481272B2 (en) * | 2006-08-04 | 2013-07-09 | Georgia State University Research Foundation, Inc. | Enzyme sensors, methods for preparing and using such sensors, and methods of detecting protease activity |
| CN101688241B (en) | 2007-03-02 | 2015-01-21 | 杜邦营养生物科学有限公司 | Cultures with improved phage resistance |
| GB0806086D0 (en) | 2008-04-04 | 2008-05-14 | Ulive Entpr Ltd | Dendrimer polymer hybrids |
| WO2010011961A2 (en) | 2008-07-25 | 2010-01-28 | University Of Georgia Research Foundation, Inc. | Prokaryotic rnai-like system and methods of use |
| SG191561A1 (en) | 2008-08-22 | 2013-07-31 | Sangamo Biosciences Inc | Methods and compositions for targeted single-stranded cleavage and targeted integration |
| US8383604B2 (en) | 2008-09-15 | 2013-02-26 | Children's Medical Center Corporation | Modulation of BCL11A for treatment of hemoglobinopathies |
| US20100076057A1 (en) * | 2008-09-23 | 2010-03-25 | Northwestern University | TARGET DNA INTERFERENCE WITH crRNA |
| US9404098B2 (en) | 2008-11-06 | 2016-08-02 | University Of Georgia Research Foundation, Inc. | Method for cleaving a target RNA using a Cas6 polypeptide |
| US10662227B2 (en) | 2008-11-07 | 2020-05-26 | Dupont Nutrition Biosciences Aps | Bifidobacteria CRISPR sequences |
| WO2010066907A1 (en) | 2008-12-12 | 2010-06-17 | Danisco A/S | Genetic cluster of strains of streptococcus thermophilus having unique rheological properties for dairy fermentation |
| WO2010075424A2 (en) | 2008-12-22 | 2010-07-01 | The Regents Of University Of California | Compositions and methods for downregulating prokaryotic genes |
| GB0823658D0 (en) | 2008-12-30 | 2009-02-04 | Angiomed Ag | Stent delivery device |
| US8392349B2 (en) | 2009-02-23 | 2013-03-05 | Shalini Vajjhala | Global adaptation atlas and method of creating same |
| EP2419511B1 (en) | 2009-04-09 | 2018-01-17 | Sangamo Therapeutics, Inc. | Targeted integration into stem cells |
| PL2424571T3 (en) | 2009-04-30 | 2020-10-19 | Ospedale San Raffaele S.R.L | Gene vector |
| EP2456877A4 (en) | 2009-07-24 | 2012-05-30 | Sigma Aldrich Co Llc | GENOME EDITING METHOD |
| US20120192298A1 (en) * | 2009-07-24 | 2012-07-26 | Sigma Aldrich Co. Llc | Method for genome editing |
| CA2769262C (en) | 2009-07-28 | 2019-04-30 | Sangamo Biosciences, Inc. | Methods and compositions for treating trinucleotide repeat disorders |
| US8586526B2 (en) | 2010-05-17 | 2013-11-19 | Sangamo Biosciences, Inc. | DNA-binding proteins and uses thereof |
| KR101418355B1 (en) | 2009-10-23 | 2014-07-11 | (주)바이오니아 | High throughput oligonucleotide synthesizer |
| DE102009052674B4 (en) | 2009-11-12 | 2012-10-18 | Karl Weinhold | Method and device for connecting double-walled pipes |
| US20110294114A1 (en) | 2009-12-04 | 2011-12-01 | Cincinnati Children's Hospital Medical Center | Optimization of determinants for successful genetic correction of diseases, mediated by hematopoietic stem cells |
| WO2011072246A2 (en) | 2009-12-10 | 2011-06-16 | Regents Of The University Of Minnesota | Tal effector-mediated dna modification |
| EP2660318A1 (en) | 2010-02-09 | 2013-11-06 | Sangamo BioSciences, Inc. | Targeted genomic modification with partially single-stranded donor molecules |
| US10087431B2 (en) | 2010-03-10 | 2018-10-02 | The Regents Of The University Of California | Methods of generating nucleic acid fragments |
| MX2012013037A (en) | 2010-05-10 | 2013-07-29 | Univ California | Endoribonuclease compositions and methods of use thereof. |
| EP2392208B1 (en) * | 2010-06-07 | 2016-05-04 | Helmholtz Zentrum München Deutsches Forschungszentrum für Gesundheit und Umwelt (GmbH) | Fusion proteins comprising a DNA-binding domain of a Tal effector protein and a non-specific cleavage domain of a restriction nuclease and their use |
| US20140148361A1 (en) | 2010-06-07 | 2014-05-29 | Barry L. Stoddard | Generation and Expression of Engineered I-ONUI Endonuclease and Its Homologues and Uses Thereof |
| AU2011265733B2 (en) | 2010-06-14 | 2014-04-17 | Iowa State University Research Foundation, Inc. | Nuclease activity of TAL effector and Foki fusion protein |
| US9512444B2 (en) * | 2010-07-23 | 2016-12-06 | Sigma-Aldrich Co. Llc | Genome editing using targeting endonucleases and single-stranded nucleic acids |
| DK2601611T3 (en) | 2010-08-02 | 2021-02-01 | Integrated Dna Tech Inc | PROCEDURES FOR PREDICTING STABILITY AND MELTING TEMPERATURES FOR NUCLEIC ACID DUPLEXES |
| CN103261213A (en) | 2010-10-20 | 2013-08-21 | 杜邦营养生物科学有限公司 | Lactococcus crispr-as sequences |
| WO2012069657A1 (en) * | 2010-11-26 | 2012-05-31 | Institut Pasteur | Identification of a human gyrovirus and applications. |
| US20120214241A1 (en) | 2010-12-22 | 2012-08-23 | Josee Laganiere | Zinc finger nuclease modification of leucine rich repeat kinase 2 (lrrk2) mutant fibroblasts and ipscs |
| KR20120096395A (en) | 2011-02-22 | 2012-08-30 | 주식회사 툴젠 | Methods for enriching cells containing nuclease-induced gene disruptions |
| WO2012164565A1 (en) | 2011-06-01 | 2012-12-06 | Yeda Research And Development Co. Ltd. | Compositions and methods for downregulating prokaryotic genes |
| CA2848417C (en) | 2011-09-21 | 2023-05-02 | Sangamo Biosciences, Inc. | Methods and compositions for regulation of transgene expression |
| HK1200871A1 (en) * | 2011-11-16 | 2015-08-14 | Sangamo Therapeutics, Inc. | Modified dna-binding proteins and uses thereof |
| US8450107B1 (en) | 2011-11-30 | 2013-05-28 | The Broad Institute Inc. | Nucleotide-specific recognition sequences for designer TAL effectors |
| GB201122458D0 (en) | 2011-12-30 | 2012-02-08 | Univ Wageningen | Modified cascade ribonucleoproteins and uses thereof |
| US20150166969A1 (en) | 2012-02-24 | 2015-06-18 | Fred Hutchinson Cancer Research Center | Compositions and methods for the treatment of hemoglobinopathies |
| WO2013130824A1 (en) | 2012-02-29 | 2013-09-06 | Sangamo Biosciences, Inc. | Methods and compositions for treating huntington's disease |
| WO2013141680A1 (en) | 2012-03-20 | 2013-09-26 | Vilnius University | RNA-DIRECTED DNA CLEAVAGE BY THE Cas9-crRNA COMPLEX |
| US9637739B2 (en) * | 2012-03-20 | 2017-05-02 | Vilnius University | RNA-directed DNA cleavage by the Cas9-crRNA complex |
| AU2013204327B2 (en) | 2012-04-20 | 2016-09-01 | Aviagen | Cell transfection method |
| CN104245940A (en) | 2012-04-23 | 2014-12-24 | 拜尔作物科学公司 | Targeted genome engineering in plants |
| SG11201406547YA (en) | 2012-04-25 | 2014-11-27 | Regeneron Pharma | Nuclease-mediated targeting with large targeting vectors |
| MX369788B (en) | 2012-05-02 | 2019-11-21 | Dow Agrosciences Llc | Targeted modification of malate dehydrogenase. |
| AU2013259647B2 (en) * | 2012-05-07 | 2018-11-08 | Corteva Agriscience Llc | Methods and compositions for nuclease-mediated targeted integration of transgenes |
| US11120889B2 (en) | 2012-05-09 | 2021-09-14 | Georgia Tech Research Corporation | Method for synthesizing a nuclease with reduced off-site cleavage |
| AU2013266968B2 (en) * | 2012-05-25 | 2017-06-29 | Emmanuelle CHARPENTIER | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| CA2876860A1 (en) | 2012-05-30 | 2013-12-05 | Baylor College Of Medicine | Supercoiled minivectors as a tool for dna repair, alteration and replacement |
| WO2013188037A2 (en) | 2012-06-11 | 2013-12-19 | Agilent Technologies, Inc | Method of adaptor-dimer subtraction using a crispr cas6 protein |
| CN104540382A (en) | 2012-06-12 | 2015-04-22 | 弗·哈夫曼-拉罗切有限公司 | Methods and compositions for generating conditional knock-out alleles |
| EP2674501A1 (en) | 2012-06-14 | 2013-12-18 | Agence nationale de sécurité sanitaire de l'alimentation,de l'environnement et du travail | Method for detecting and identifying enterohemorrhagic Escherichia coli |
| WO2013188638A2 (en) | 2012-06-15 | 2013-12-19 | The Regents Of The University Of California | Endoribonucleases and methods of use thereof |
| US20150225734A1 (en) | 2012-06-19 | 2015-08-13 | Regents Of The University Of Minnesota | Gene targeting in plants using dna viruses |
| JP6329537B2 (en) | 2012-07-11 | 2018-05-23 | サンガモ セラピューティクス, インコーポレイテッド | Methods and compositions for delivery of biological agents |
| EP3196301B1 (en) | 2012-07-11 | 2018-10-17 | Sangamo Therapeutics, Inc. | Methods and compositions for the treatment of monogenic diseases |
| AU2013293270B2 (en) | 2012-07-25 | 2018-08-16 | Massachusetts Institute Of Technology | Inducible DNA binding proteins and genome perturbation tools and applications thereof |
| WO2014022702A2 (en) | 2012-08-03 | 2014-02-06 | The Regents Of The University Of California | Methods and compositions for controlling gene expression by rna processing |
| SG10201701601WA (en) | 2012-08-29 | 2017-04-27 | Sangamo Biosciences Inc | Methods and compositions for treatment of a genetic condition |
| US9914930B2 (en) | 2012-09-07 | 2018-03-13 | Dow Agrosciences Llc | FAD3 performance loci and corresponding target site specific binding proteins capable of inducing targeted breaks |
| UA118090C2 (en) | 2012-09-07 | 2018-11-26 | ДАУ АГРОСАЙЄНСІЗ ЕлЕлСі | METHOD OF THE METHER OF THE METHOD OF THE INTEGRED EMBLED SUBSTITUTION OF NUCLEIC NUCLE OF NUCLEIC ACID AND NON-NUCLIC ACID AND NON-SPECIAL SPECIES |
| UA119135C2 (en) | 2012-09-07 | 2019-05-10 | ДАУ АГРОСАЙЄНСІЗ ЕлЕлСі | Engineered transgene integration platform (etip) for gene targeting and trait stacking |
| EP3789405A1 (en) | 2012-10-12 | 2021-03-10 | The General Hospital Corporation | Transcription activator-like effector (tale) - lysine-specific demethylase 1 (lsd1) fusion proteins |
| AU2013335451C1 (en) | 2012-10-23 | 2024-07-04 | Toolgen Incorporated | Composition for cleaving a target DNA comprising a guide RNA specific for the target DNA and Cas protein-encoding nucleic acid or Cas protein, and use thereof |
| AP2015008495A0 (en) | 2012-10-30 | 2015-05-31 | Ct For Aquaculture Technologies Inc | Control of sexual maturation in animals |
| CA2890160A1 (en) | 2012-10-31 | 2014-05-08 | Cellectis | Coupling herbicide resistance with targeted insertion of transgenes in plants |
| US20140127752A1 (en) | 2012-11-07 | 2014-05-08 | Zhaohui Zhou | Method, composition, and reagent kit for targeted genomic enrichment |
| PL3360964T3 (en) | 2012-12-06 | 2020-03-31 | Sigma-Aldrich Co. Llc | Crispr-based genome modification and regulation |
| WO2014093479A1 (en) | 2012-12-11 | 2014-06-19 | Montana State University | Crispr (clustered regularly interspaced short palindromic repeats) rna-guided control of gene regulation |
| US20140310830A1 (en) | 2012-12-12 | 2014-10-16 | Feng Zhang | CRISPR-Cas Nickase Systems, Methods And Compositions For Sequence Manipulation in Eukaryotes |
| US20140186843A1 (en) | 2012-12-12 | 2014-07-03 | Massachusetts Institute Of Technology | Methods, systems, and apparatus for identifying target sequences for cas enzymes or crispr-cas systems for target sequences and conveying results thereof |
| EP2931899A1 (en) | 2012-12-12 | 2015-10-21 | The Broad Institute, Inc. | Functional genomics using crispr-cas systems, compositions, methods, knock out libraries and applications thereof |
| EP2840140B2 (en) | 2012-12-12 | 2023-02-22 | The Broad Institute, Inc. | Crispr-Cas based method for mutation of prokaryotic cells |
| US8697359B1 (en) | 2012-12-12 | 2014-04-15 | The Broad Institute, Inc. | CRISPR-Cas systems and methods for altering expression of gene products |
| EP3031921B1 (en) | 2012-12-12 | 2025-03-12 | The Broad Institute, Inc. | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| IL239344B2 (en) | 2012-12-12 | 2024-06-01 | Broad Inst Inc | Engineering of systems, methods and optimized guide compositions for sequence manipulation |
| CN113355357B (en) | 2012-12-12 | 2024-12-03 | 布罗德研究所有限公司 | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| WO2014093709A1 (en) | 2012-12-12 | 2014-06-19 | The Broad Institute, Inc. | Methods, models, systems, and apparatus for identifying target sequences for cas enzymes or crispr-cas systems for target sequences and conveying results thereof |
| CN105074061B (en) | 2012-12-13 | 2021-03-09 | 美国陶氏益农公司 | DNA detection method for site-specific nuclease activity |
| ES2953523T3 (en) | 2012-12-27 | 2023-11-14 | Keygene Nv | Method for inducing a directed translocation in a plant |
| CA2898184A1 (en) | 2013-01-16 | 2014-07-24 | Emory University | Cas9-nucleic acid complexes and uses related thereto |
| CN103233028B (en) | 2013-01-25 | 2015-05-13 | 南京徇齐生物技术有限公司 | Specie limitation-free eucaryote gene targeting method having no bio-safety influence and helical-structure DNA sequence |
| WO2014127287A1 (en) | 2013-02-14 | 2014-08-21 | Massachusetts Institute Of Technology | Method for in vivo tergated mutagenesis |
| MX384291B (en) | 2013-02-20 | 2025-03-14 | Regeneron Pharma | GENETIC MODIFICATION OF RATS. |
| US10227610B2 (en) | 2013-02-25 | 2019-03-12 | Sangamo Therapeutics, Inc. | Methods and compositions for enhancing nuclease-mediated gene disruption |
| RU2662932C2 (en) | 2013-03-14 | 2018-07-31 | Карибо Биосайенсиз, Инк. | Compositions and methods with use of nucleic acids targeted at nucleic acids |
| CN112301024A (en) | 2013-03-15 | 2021-02-02 | 通用医疗公司 | Improving the specificity of RNA-guided genome editing using RNA-guided FokI nuclease (RFN) |
| WO2014144155A1 (en) | 2013-03-15 | 2014-09-18 | Regents Of The University Of Minnesota | Engineering plant genomes using crispr/cas systems |
| US20140364333A1 (en) | 2013-03-15 | 2014-12-11 | President And Fellows Of Harvard College | Methods for Live Imaging of Cells |
| US9234213B2 (en) | 2013-03-15 | 2016-01-12 | System Biosciences, Llc | Compositions and methods directed to CRISPR/Cas genomic engineering systems |
| US10760064B2 (en) | 2013-03-15 | 2020-09-01 | The General Hospital Corporation | RNA-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci |
| US20140273230A1 (en) | 2013-03-15 | 2014-09-18 | Sigma-Aldrich Co., Llc | Crispr-based genome modification and regulation |
| US11332719B2 (en) | 2013-03-15 | 2022-05-17 | The Broad Institute, Inc. | Recombinant virus and preparations thereof |
| EP4286517A3 (en) | 2013-04-04 | 2024-03-13 | President and Fellows of Harvard College | Therapeutic uses of genome editing with crispr/cas systems |
| CN105263312A (en) | 2013-04-05 | 2016-01-20 | 美国陶氏益农公司 | Methods and compositions for integration of an exogenous sequence within the genome of plants |
| DK3456831T3 (en) | 2013-04-16 | 2021-09-06 | Regeneron Pharma | TARGETED MODIFICATION OF RAT GENOMES |
| CN103224947B (en) | 2013-04-28 | 2015-06-10 | 陕西师范大学 | Gene targeting system |
| EP2994531B1 (en) | 2013-05-10 | 2018-03-28 | Sangamo Therapeutics, Inc. | Delivery methods and compositions for nuclease-mediated genome engineering |
| CA2913234A1 (en) | 2013-05-22 | 2014-11-27 | Northwestern University | Rna-directed dna cleavage and gene editing by cas9 enzyme from neisseria meningitidis |
| US9873907B2 (en) | 2013-05-29 | 2018-01-23 | Agilent Technologies, Inc. | Method for fragmenting genomic DNA using CAS9 |
| US9267135B2 (en) | 2013-06-04 | 2016-02-23 | President And Fellows Of Harvard College | RNA-guided transcriptional regulation |
| CN105492611A (en) | 2013-06-17 | 2016-04-13 | 布罗德研究所有限公司 | Optimized CRISPR-CAS double nickase systems, methods and compositions for sequence manipulation |
| EP3725885A1 (en) | 2013-06-17 | 2020-10-21 | The Broad Institute, Inc. | Functional genomics using crispr-cas systems, compositions methods, screens and applications thereof |
| RU2716420C2 (en) | 2013-06-17 | 2020-03-11 | Те Брод Инститьют Инк. | Delivery and use of systems of crispr-cas, vectors and compositions for targeted action and therapy in liver |
| CN105683379A (en) | 2013-06-17 | 2016-06-15 | 布罗德研究所有限公司 | Delivery, engineering and optimization of systems, methods and compositions for targeting and modeling diseases and disorders of post mitotic cells |
| MX374532B (en) | 2013-06-17 | 2025-03-06 | Broad Inst Inc | SUPPLY, USE AND THERAPEUTIC APPLICATIONS OF CRISPR-CAS SYSTEMS AND COMPOSITIONS, TO ACT ON DISORDERS AND DISEASES USING VIRAL COMPONENTS. |
| CN103343120B (en) | 2013-07-04 | 2015-03-04 | 中国科学院遗传与发育生物学研究所 | Wheat genome site-specific modification method |
| CN103382468B (en) * | 2013-07-04 | 2015-04-29 | 中国科学院遗传与发育生物学研究所 | Site-directed modification method of rice genome |
| EP3666892A1 (en) | 2013-07-10 | 2020-06-17 | President and Fellows of Harvard College | Orthogonal cas9 proteins for rna-guided gene regulation and editing |
| CN103388006B (en) | 2013-07-26 | 2015-10-28 | 华东师范大学 | A kind of construction process of site-directed point mutation |
| US10421957B2 (en) | 2013-07-29 | 2019-09-24 | Agilent Technologies, Inc. | DNA assembly using an RNA-programmable nickase |
| NZ746567A (en) | 2013-11-04 | 2019-09-27 | Dow Agrosciences Llc | Optimal soybean loci |
| UY35812A (en) | 2013-11-04 | 2015-05-29 | Dow Agrosciences Llc | ? OPTIMUM CORN LOCI ?. |
| CN105980395A (en) | 2013-11-04 | 2016-09-28 | 美国陶氏益农公司 | Optimal soybean loci |
| CN106459995B (en) | 2013-11-07 | 2020-02-21 | 爱迪塔斯医药有限公司 | CRISPR-related methods and compositions using dominant gRNAs |
| KR102170502B1 (en) | 2013-12-11 | 2020-10-28 | 리제너론 파마슈티칼스 인코포레이티드 | Methods and compositions for the targeted modification of a genome |
| US9850525B2 (en) | 2014-01-29 | 2017-12-26 | Agilent Technologies, Inc. | CAS9-based isothermal method of detection of specific DNA sequence |
| US20150291969A1 (en) | 2014-01-30 | 2015-10-15 | Chromatin, Inc. | Compositions for reduced lignin content in sorghum and improving cell wall digestibility, and methods of making the same |
| US20150225801A1 (en) | 2014-02-11 | 2015-08-13 | California Institute Of Technology | Recording and mapping lineage information and molecular events in individual cells |
| WO2015127439A1 (en) | 2014-02-24 | 2015-08-27 | Sangamo Biosciences, Inc. | Methods and compositions for nuclease-mediated targeted integration |
| CN106459894B (en) | 2014-03-18 | 2020-02-18 | 桑格摩生物科学股份有限公司 | Methods and compositions for modulating zinc finger protein expression |
-
2013
- 2013-12-05 PL PL18156734T patent/PL3360964T3/en unknown
- 2013-12-05 KR KR1020207023229A patent/KR102243092B1/en active Active
- 2013-12-05 EP EP19201769.7A patent/EP3611263A1/en active Pending
- 2013-12-05 PT PT161837232T patent/PT3138910T/en unknown
- 2013-12-05 DK DK18156734T patent/DK3360964T3/en active
- 2013-12-05 KR KR1020157013843A patent/KR101844123B1/en active Active
- 2013-12-05 SG SG10202107423UA patent/SG10202107423UA/en unknown
- 2013-12-05 CA CA2891347A patent/CA2891347C/en active Active
- 2013-12-05 LT LTEP16183725.7T patent/LT3138912T/en unknown
- 2013-12-05 PL PL13859964T patent/PL2928496T3/en unknown
- 2013-12-05 SG SG11201503824SA patent/SG11201503824SA/en unknown
- 2013-12-05 EP EP18156734.8A patent/EP3360964B1/en not_active Revoked
- 2013-12-05 CA CA3034794A patent/CA3034794A1/en active Pending
- 2013-12-05 PL PL16183723T patent/PL3138910T3/en unknown
- 2013-12-05 CA CA2977152A patent/CA2977152C/en active Active
- 2013-12-05 DK DK16183723.2T patent/DK3138910T3/en active
- 2013-12-05 KR KR1020217011309A patent/KR102479178B1/en active Active
- 2013-12-05 CN CN201380072477.4A patent/CN105142669B/en active Active
- 2013-12-05 PT PT16183725T patent/PT3138912T/en unknown
- 2013-12-05 SG SG10201800585VA patent/SG10201800585VA/en unknown
- 2013-12-05 EP EP18160519.7A patent/EP3363902B1/en not_active Revoked
- 2013-12-05 EP EP16183724.0A patent/EP3138911B1/en not_active Revoked
- 2013-12-05 PT PT181567348T patent/PT3360964T/en unknown
- 2013-12-05 ES ES16183725T patent/ES2713243T3/en active Active
- 2013-12-05 DK DK16183725.7T patent/DK3138912T3/en active
- 2013-12-05 PL PL18160519T patent/PL3363902T3/en unknown
- 2013-12-05 WO PCT/US2013/073307 patent/WO2014089290A1/en not_active Ceased
- 2013-12-05 AU AU2013355214A patent/AU2013355214B2/en active Active
- 2013-12-05 PL PL16183725T patent/PL3138912T3/en unknown
- 2013-12-05 KR KR1020197022305A patent/KR102145760B1/en active Active
- 2013-12-05 BR BR112015012375A patent/BR112015012375A2/en active Search and Examination
- 2013-12-05 PL PL16183724T patent/PL3138911T3/en unknown
- 2013-12-05 LT LTEP16183724.0T patent/LT3138911T/en unknown
- 2013-12-05 EP EP16183720.8A patent/EP3141604A1/en not_active Withdrawn
- 2013-12-05 EP EP16183719.0A patent/EP3135765A1/en not_active Withdrawn
- 2013-12-05 ES ES18156734T patent/ES2757808T3/en active Active
- 2013-12-05 KR KR1020187001934A patent/KR102006880B1/en active Active
- 2013-12-05 PT PT138599642T patent/PT2928496T/en unknown
- 2013-12-05 IL IL300199A patent/IL300199B2/en unknown
- 2013-12-05 ES ES13859964T patent/ES2757325T3/en active Active
- 2013-12-05 LT LTEP16183723.2T patent/LT3138910T/en unknown
- 2013-12-05 CN CN201810574719.4A patent/CN108913676B/en active Active
- 2013-12-05 JP JP2015545838A patent/JP6620018B2/en active Active
- 2013-12-05 ES ES18160519T patent/ES2769310T3/en active Active
- 2013-12-05 DK DK16183724.0T patent/DK3138911T3/en active
- 2013-12-05 EP EP19189913.7A patent/EP3617309A3/en active Pending
- 2013-12-05 ES ES16183724T patent/ES2714154T3/en active Active
- 2013-12-05 SG SG10201910987SA patent/SG10201910987SA/en unknown
- 2013-12-05 KR KR1020227043854A patent/KR102531576B1/en active Active
- 2013-12-05 CN CN201810540449.5A patent/CN108715602A/en active Pending
- 2013-12-05 EP EP13859964.2A patent/EP2928496B1/en not_active Revoked
- 2013-12-05 LT LTEP18160519.7T patent/LT3363902T/en unknown
- 2013-12-05 ES ES16183723.2T patent/ES2653212T3/en active Active
- 2013-12-05 PT PT16183724T patent/PT3138911T/en unknown
- 2013-12-05 PT PT181605197T patent/PT3363902T/en unknown
- 2013-12-05 US US14/649,777 patent/US20160017366A1/en not_active Abandoned
- 2013-12-05 EP EP16183717.4A patent/EP3138909A1/en not_active Withdrawn
- 2013-12-05 DK DK13859964T patent/DK2928496T3/en active
- 2013-12-05 EP EP16183723.2A patent/EP3138910B1/en not_active Revoked
- 2013-12-05 DK DK18160519.7T patent/DK3363902T3/en active
- 2013-12-05 EP EP16183725.7A patent/EP3138912B1/en not_active Revoked
- 2013-12-05 KR KR1020237015558A patent/KR102676910B1/en active Active
-
2015
- 2015-05-17 IL IL238856A patent/IL238856B/en active IP Right Grant
-
2016
- 2016-06-21 US US15/188,902 patent/US20160298132A1/en not_active Abandoned
- 2016-06-21 US US15/188,924 patent/US10745716B2/en active Active
- 2016-06-21 US US15/188,899 patent/US20160298125A1/en not_active Abandoned
- 2016-06-21 US US15/188,911 patent/US10731181B2/en active Active
- 2016-06-21 US US15/188,931 patent/US20160298137A1/en not_active Abandoned
- 2016-06-21 US US15/188,909 patent/US20160298133A1/en not_active Abandoned
- 2016-06-21 US US15/188,933 patent/US20160298138A1/en not_active Abandoned
- 2016-06-21 US US15/188,927 patent/US20160298136A1/en not_active Abandoned
- 2016-11-03 US US15/342,976 patent/US20170073705A1/en not_active Abandoned
-
2017
- 2017-03-10 US US15/456,204 patent/US20170191082A1/en active Pending
- 2017-06-13 JP JP2017115672A patent/JP2017192392A/en active Pending
- 2017-06-15 AU AU2017204031A patent/AU2017204031B2/en active Active
-
2018
- 2018-01-28 IL IL257178A patent/IL257178B/en active IP Right Grant
- 2018-09-13 AU AU2018229489A patent/AU2018229489B2/en active Active
- 2018-09-28 JP JP2018183815A patent/JP2019037231A/en active Pending
-
2019
- 2019-02-26 AU AU2019201344A patent/AU2019201344C1/en active Active
- 2019-06-24 IL IL267598A patent/IL267598B/en unknown
- 2019-10-16 US US16/654,613 patent/US20200140897A1/en not_active Abandoned
-
2020
- 2020-04-17 JP JP2020074283A patent/JP2020120674A/en active Pending
- 2020-07-30 US US16/943,767 patent/US20210207173A1/en active Pending
- 2020-07-30 US US16/943,792 patent/US20210079427A1/en not_active Abandoned
- 2020-09-08 AU AU2020230243A patent/AU2020230243B2/en active Active
- 2020-09-08 AU AU2020230246A patent/AU2020230246B2/en active Active
- 2020-11-19 AU AU2020273316A patent/AU2020273316B2/en active Active
-
2021
- 2021-03-03 JP JP2021033258A patent/JP2021101706A/en active Pending
- 2021-08-10 US US17/398,648 patent/US20210388396A1/en active Pending
-
2022
- 2022-01-19 AU AU2022200330A patent/AU2022200330B2/en active Active
- 2022-03-06 IL IL291129A patent/IL291129B2/en unknown
- 2022-05-06 JP JP2022076698A patent/JP7478772B2/en active Active
-
2023
- 2023-08-17 AU AU2023216829A patent/AU2023216829B2/en active Active
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8993233B2 (en) * | 2012-12-12 | 2015-03-31 | The Broad Institute Inc. | Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains |
| US9023649B2 (en) * | 2012-12-17 | 2015-05-05 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
Non-Patent Citations (3)
| Title |
|---|
| Chalaya et al. Tissue specificity of methylation of cytosines in regulatory regions of four genes located in the locus FXYD5-COX7A1 of human chromosome 19: Correlation with their expression level. Biochemistry (Moscow), Vol. 71, No. 3, pages 294-2999, February 2006. * |
| Jiang et al. The structural biology of CRISPR-Cas systems. Current Opinion in Structural Biology, Vol. 30, pages 100-111, February 2015. * |
| Makarova et al. Unification of Cas protein families and a simple scenario for the origin and evolution of CRISPR-Cas systems. Biology Direct, Vol. 6, No. 38, pages 1/27-27/27, 2011. * |
Cited By (249)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10612045B2 (en) | 2012-05-25 | 2020-04-07 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11186849B2 (en) | 2012-05-25 | 2021-11-30 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10982231B2 (en) | 2012-05-25 | 2021-04-20 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10900054B2 (en) | 2012-05-25 | 2021-01-26 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10982230B2 (en) | 2012-05-25 | 2021-04-20 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10988780B2 (en) | 2012-05-25 | 2021-04-27 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10988782B2 (en) | 2012-05-25 | 2021-04-27 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10793878B1 (en) | 2012-05-25 | 2020-10-06 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11001863B2 (en) | 2012-05-25 | 2021-05-11 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10428352B2 (en) | 2012-05-25 | 2019-10-01 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11008589B2 (en) | 2012-05-25 | 2021-05-18 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10774344B1 (en) | 2012-05-25 | 2020-09-15 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10752920B2 (en) | 2012-05-25 | 2020-08-25 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11008590B2 (en) | 2012-05-25 | 2021-05-18 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US12215343B2 (en) | 2012-05-25 | 2025-02-04 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US12180504B2 (en) | 2012-05-25 | 2024-12-31 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US12180503B2 (en) | 2012-05-25 | 2024-12-31 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11028412B2 (en) | 2012-05-25 | 2021-06-08 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US12123015B2 (en) | 2012-05-25 | 2024-10-22 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10676759B2 (en) | 2012-05-25 | 2020-06-09 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10669560B2 (en) | 2012-05-25 | 2020-06-02 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10640791B2 (en) | 2012-05-25 | 2020-05-05 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10626419B2 (en) | 2012-05-25 | 2020-04-21 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11970711B2 (en) | 2012-05-25 | 2024-04-30 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10421980B2 (en) | 2012-05-25 | 2019-09-24 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10597680B2 (en) | 2012-05-25 | 2020-03-24 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11814645B2 (en) | 2012-05-25 | 2023-11-14 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11674159B2 (en) | 2012-05-25 | 2023-06-13 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10227611B2 (en) | 2012-05-25 | 2019-03-12 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11634730B2 (en) | 2012-05-25 | 2023-04-25 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10266850B2 (en) | 2012-05-25 | 2019-04-23 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11242543B2 (en) | 2012-05-25 | 2022-02-08 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10577631B2 (en) | 2012-05-25 | 2020-03-03 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11549127B2 (en) | 2012-05-25 | 2023-01-10 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10570419B2 (en) | 2012-05-25 | 2020-02-25 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10301651B2 (en) | 2012-05-25 | 2019-05-28 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10308961B2 (en) | 2012-05-25 | 2019-06-04 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10337029B2 (en) | 2012-05-25 | 2019-07-02 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10563227B2 (en) | 2012-05-25 | 2020-02-18 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10351878B2 (en) | 2012-05-25 | 2019-07-16 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11479794B2 (en) | 2012-05-25 | 2022-10-25 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10358659B2 (en) | 2012-05-25 | 2019-07-23 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10358658B2 (en) | 2012-05-25 | 2019-07-23 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11473108B2 (en) | 2012-05-25 | 2022-10-18 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10550407B2 (en) | 2012-05-25 | 2020-02-04 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10385360B2 (en) | 2012-05-25 | 2019-08-20 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10400253B2 (en) | 2012-05-25 | 2019-09-03 | The Regents Of The University Of California | Methods and compositions or RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10407697B2 (en) | 2012-05-25 | 2019-09-10 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11401532B2 (en) | 2012-05-25 | 2022-08-02 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10415061B2 (en) | 2012-05-25 | 2019-09-17 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11274318B2 (en) | 2012-05-25 | 2022-03-15 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10533190B2 (en) | 2012-05-25 | 2020-01-14 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10526619B2 (en) | 2012-05-25 | 2020-01-07 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11293034B2 (en) | 2012-05-25 | 2022-04-05 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10519467B2 (en) | 2012-05-25 | 2019-12-31 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10443076B2 (en) | 2012-05-25 | 2019-10-15 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10513712B2 (en) | 2012-05-25 | 2019-12-24 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11332761B2 (en) | 2012-05-25 | 2022-05-17 | The Regenis of Wie University of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10487341B2 (en) | 2012-05-25 | 2019-11-26 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US12612634B2 (en) | 2012-10-23 | 2026-04-28 | Toolgen Incorporated | Compositions for inducing modifications of target endogenous nucleic acid sequences in nucleuses of eukaryotic cells |
| US12606832B2 (en) | 2012-10-23 | 2026-04-21 | Toolgen Incorporated | Compositions for inducing modifications of target endogenous nucleic acid sequences in nucleuses of eukaryotic cells |
| US12473559B2 (en) | 2012-10-23 | 2025-11-18 | Toolgen Incorporated | Cas9/RNA complexes for inducing modifications of target endogenous nucleic acid sequences in nucleuses of eukaryotic cells |
| US10851380B2 (en) | 2012-10-23 | 2020-12-01 | Toolgen Incorporated | Methods for cleaving a target DNA using a guide RNA specific for the target DNA and Cas protein-encoding nucleic acid or Cas protein |
| US12612633B2 (en) | 2012-10-23 | 2026-04-28 | Toolgen Incorporated | Compositions for inducing modifications of target endogenous nucleic acid sequences in nucleuses of eukaryotic cells |
| US10745716B2 (en) | 2012-12-06 | 2020-08-18 | Sigma-Aldrich Co. Llc | CRISPR-based genome modification and regulation |
| US10731181B2 (en) | 2012-12-06 | 2020-08-04 | Sigma, Aldrich Co. LLC | CRISPR-based genome modification and regulation |
| US20160281072A1 (en) * | 2012-12-12 | 2016-09-29 | The Broad Institute Inc. | Crispr-cas systems and methods for altering expression of gene products |
| US11041173B2 (en) | 2012-12-12 | 2021-06-22 | The Broad Institute, Inc. | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US9822372B2 (en) | 2012-12-12 | 2017-11-21 | The Broad Institute Inc. | CRISPR-Cas component systems, methods and compositions for sequence manipulation |
| US9840713B2 (en) | 2012-12-12 | 2017-12-12 | The Broad Institute Inc. | CRISPR-Cas component systems, methods and compositions for sequence manipulation |
| US12252707B2 (en) | 2012-12-12 | 2025-03-18 | The Broad Institute, Inc. | Delivery, Engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US12454687B2 (en) | 2012-12-12 | 2025-10-28 | The Broad Institute, Inc. | Functional genomics using CRISPR-Cas systems, compositions, methods, knock out libraries and applications thereof |
| US10930367B2 (en) | 2012-12-12 | 2021-02-23 | The Broad Institute, Inc. | Methods, models, systems, and apparatus for identifying target sequences for Cas enzymes or CRISPR-Cas systems for target sequences and conveying results thereof |
| US10435708B2 (en) | 2012-12-17 | 2019-10-08 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
| US12612643B2 (en) | 2012-12-17 | 2026-04-28 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
| US11236359B2 (en) | 2012-12-17 | 2022-02-01 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
| US11359211B2 (en) | 2012-12-17 | 2022-06-14 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
| US9970024B2 (en) | 2012-12-17 | 2018-05-15 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
| US12018272B2 (en) | 2012-12-17 | 2024-06-25 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
| US11535863B2 (en) | 2012-12-17 | 2022-12-27 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
| US10273501B2 (en) | 2012-12-17 | 2019-04-30 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
| US11512325B2 (en) | 2012-12-17 | 2022-11-29 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
| US10717990B2 (en) | 2012-12-17 | 2020-07-21 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
| US11365429B2 (en) | 2012-12-17 | 2022-06-21 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
| US11312953B2 (en) * | 2013-03-14 | 2022-04-26 | Caribou Biosciences, Inc. | Compositions and methods of nucleic acid-targeting nucleic acids |
| US20170051276A1 (en) * | 2013-03-14 | 2017-02-23 | Caribou Biosciences, Inc. | Compositions And Methods Of Nucleic Acid-Targeting Nucleic Acids |
| US10415059B2 (en) | 2013-03-15 | 2019-09-17 | The General Hospital Corporation | Using truncated guide RNAs (tru-gRNAs) to increase specificity for RNA-guided genome editing |
| US10844403B2 (en) | 2013-03-15 | 2020-11-24 | The General Hospital Corporation | Increasing specificity for RNA-guided genome editing |
| US10119133B2 (en) | 2013-03-15 | 2018-11-06 | The General Hospital Corporation | Using truncated guide RNAs (tru-gRNAs) to increase specificity for RNA-guided genome editing |
| US11168338B2 (en) | 2013-03-15 | 2021-11-09 | The General Hospital Corporation | RNA-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci |
| US10760064B2 (en) | 2013-03-15 | 2020-09-01 | The General Hospital Corporation | RNA-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci |
| US10138476B2 (en) | 2013-03-15 | 2018-11-27 | The General Hospital Corporation | Using RNA-guided FokI nucleases (RFNs) to increase specificity for RNA-guided genome editing |
| US9885033B2 (en) | 2013-03-15 | 2018-02-06 | The General Hospital Corporation | Increasing specificity for RNA-guided genome editing |
| US11634731B2 (en) | 2013-03-15 | 2023-04-25 | The General Hospital Corporation | Using truncated guide RNAs (tru-gRNAs) to increase specificity for RNA-guided genome editing |
| US10378027B2 (en) | 2013-03-15 | 2019-08-13 | The General Hospital Corporation | RNA-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci |
| US11098326B2 (en) | 2013-03-15 | 2021-08-24 | The General Hospital Corporation | Using RNA-guided FokI nucleases (RFNs) to increase specificity for RNA-guided genome editing |
| US10544433B2 (en) | 2013-03-15 | 2020-01-28 | The General Hospital Corporation | Using RNA-guided FokI nucleases (RFNs) to increase specificity for RNA-guided genome editing |
| US11920152B2 (en) | 2013-03-15 | 2024-03-05 | The General Hospital Corporation | Increasing specificity for RNA-guided genome editing |
| US12065668B2 (en) | 2013-03-15 | 2024-08-20 | The General Hospital Corporation | RNA-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci |
| US9567604B2 (en) | 2013-03-15 | 2017-02-14 | The General Hospital Corporation | Using truncated guide RNAs (tru-gRNAs) to increase specificity for RNA-guided genome editing |
| US9567603B2 (en) | 2013-03-15 | 2017-02-14 | The General Hospital Corporation | Using RNA-guided FokI nucleases (RFNs) to increase specificity for RNA-guided genome editing |
| US10526589B2 (en) | 2013-03-15 | 2020-01-07 | The General Hospital Corporation | Multiplex guide RNAs |
| US20230374550A1 (en) * | 2013-06-17 | 2023-11-23 | The Broad Institute, Inc. | Optimized crispr-cas double nickase systems, methods and compositions for sequence manipulation |
| US12441995B2 (en) | 2013-06-17 | 2025-10-14 | The Broad Institute, Inc. | Functional genomics using CRISPR-Cas systems, compositions, methods, screens and applications thereof |
| US10946108B2 (en) | 2013-06-17 | 2021-03-16 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for targeting disorders and diseases using viral components |
| US10577630B2 (en) | 2013-06-17 | 2020-03-03 | The Broad Institute, Inc. | Delivery and use of the CRISPR-Cas systems, vectors and compositions for hepatic targeting and therapy |
| US12018275B2 (en) | 2013-06-17 | 2024-06-25 | The Broad Institute, Inc. | Delivery and use of the CRISPR-CAS systems, vectors and compositions for hepatic targeting and therapy |
| US11597949B2 (en) | 2013-06-17 | 2023-03-07 | The Broad Institute, Inc. | Optimized CRISPR-Cas double nickase systems, methods and compositions for sequence manipulation |
| US12553065B2 (en) * | 2013-06-17 | 2026-02-17 | The Broad Institute, Inc. | Optimized CRISPR-CAS double nickase systems, methods and compositions for sequence manipulation |
| US10711285B2 (en) * | 2013-06-17 | 2020-07-14 | The Broad Institute, Inc. | Optimized CRISPR-Cas double nickase systems, methods and compositions for sequence manipulation |
| US11008588B2 (en) | 2013-06-17 | 2021-05-18 | The Broad Institute, Inc. | Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation |
| US10781444B2 (en) | 2013-06-17 | 2020-09-22 | The Broad Institute, Inc. | Functional genomics using CRISPR-Cas systems, compositions, methods, screens and applications thereof |
| US10011850B2 (en) | 2013-06-21 | 2018-07-03 | The General Hospital Corporation | Using RNA-guided FokI Nucleases (RFNs) to increase specificity for RNA-Guided Genome Editing |
| US11499169B2 (en) | 2013-10-30 | 2022-11-15 | North Carolina State University | Compositions and methods related to a type-II CRISPR-Cas system in Lactobacillus buchneri |
| US10584358B2 (en) | 2013-10-30 | 2020-03-10 | North Carolina State University | Compositions and methods related to a type-II CRISPR-Cas system in Lactobacillus buchneri |
| US10640788B2 (en) | 2013-11-07 | 2020-05-05 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAs |
| US11390887B2 (en) | 2013-11-07 | 2022-07-19 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAS |
| US10190137B2 (en) | 2013-11-07 | 2019-01-29 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAS |
| US11407985B2 (en) | 2013-12-12 | 2022-08-09 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for genome editing |
| US11597919B2 (en) | 2013-12-12 | 2023-03-07 | The Broad Institute Inc. | Systems, methods and compositions for sequence manipulation with optimized functional CRISPR-Cas systems |
| US12421506B2 (en) | 2013-12-12 | 2025-09-23 | The Broad Institute, Inc. | Engineering of systems, methods and optimized guide compositions with new architectures for sequence manipulation |
| US12410435B2 (en) | 2013-12-12 | 2025-09-09 | The Broad Institute, Inc. | Compositions and methods of use of CRISPR-Cas systems in nucleotide repeat disorders |
| US10851357B2 (en) | 2013-12-12 | 2020-12-01 | The Broad Institute, Inc. | Compositions and methods of use of CRISPR-Cas systems in nucleotide repeat disorders |
| US12258595B2 (en) | 2013-12-12 | 2025-03-25 | The Broad Institute, Inc. | Systems, methods and compositions for sequence manipulation with optimized functional CRISPR-Cas systems |
| US12251450B2 (en) | 2013-12-12 | 2025-03-18 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for HBV and viral diseases and disorders |
| US11591581B2 (en) | 2013-12-12 | 2023-02-28 | The Broad Institute, Inc. | Compositions and methods of use of CRISPR-Cas systems in nucleotide repeat disorders |
| US10550372B2 (en) | 2013-12-12 | 2020-02-04 | The Broad Institute, Inc. | Systems, methods and compositions for sequence manipulation with optimized functional CRISPR-Cas systems |
| US11155795B2 (en) | 2013-12-12 | 2021-10-26 | The Broad Institute, Inc. | CRISPR-Cas systems, crystal structure and uses thereof |
| US20170002339A1 (en) * | 2014-01-24 | 2017-01-05 | North Carolina State University | Methods and Compositions for Sequences Guiding Cas9 Targeting |
| US10787654B2 (en) * | 2014-01-24 | 2020-09-29 | North Carolina State University | Methods and compositions for sequence guiding Cas9 targeting |
| US20210017507A1 (en) * | 2014-01-24 | 2021-01-21 | North Carolina State University | Methods and compositions for sequences guiding cas9 targeting |
| US10286084B2 (en) | 2014-02-18 | 2019-05-14 | Duke University | Compositions for the inactivation of virus replication and methods of making and using the same |
| US11439712B2 (en) | 2014-04-08 | 2022-09-13 | North Carolina State University | Methods and compositions for RNA-directed repression of transcription using CRISPR-associated genes |
| US10450584B2 (en) | 2014-08-28 | 2019-10-22 | North Carolina State University | Cas9 proteins and guiding features for DNA targeting and genome editing |
| US11753651B2 (en) | 2014-08-28 | 2023-09-12 | North Carolina State University | Cas9 proteins and guiding features for DNA targeting and genome editing |
| US12201699B2 (en) | 2014-10-10 | 2025-01-21 | Editas Medicine, Inc. | Compositions and methods for promoting homology directed repair |
| US11680268B2 (en) | 2014-11-07 | 2023-06-20 | Editas Medicine, Inc. | Methods for improving CRISPR/Cas-mediated genome-editing |
| US20170369848A1 (en) * | 2014-11-11 | 2017-12-28 | Q Therapeutics, Inc. | Engineering mesenchymal stem cells using homologous recombination |
| US9888673B2 (en) | 2014-12-10 | 2018-02-13 | Regents Of The University Of Minnesota | Genetically modified cells, tissues, and organs for treating disease |
| US10993419B2 (en) | 2014-12-10 | 2021-05-04 | Regents Of The University Of Minnesota | Genetically modified cells, tissues, and organs for treating disease |
| US11234418B2 (en) | 2014-12-10 | 2022-02-01 | Regents Of The University Of Minnesota | Genetically modified cells, tissues, and organs for treating disease |
| US10278372B2 (en) | 2014-12-10 | 2019-05-07 | Regents Of The University Of Minnesota | Genetically modified cells, tissues, and organs for treating disease |
| US12465029B2 (en) | 2014-12-10 | 2025-11-11 | Regents Of The University Of Minnesota | Genetically modified cells, tissues, and organs for treating disease |
| US12571005B2 (en) | 2014-12-12 | 2026-03-10 | The Broad Institute, Inc. | Protected guide RNAs (pgRNAs) |
| US11624078B2 (en) | 2014-12-12 | 2023-04-11 | The Broad Institute, Inc. | Protected guide RNAS (pgRNAS) |
| US10696986B2 (en) | 2014-12-12 | 2020-06-30 | The Board Institute, Inc. | Protected guide RNAS (PGRNAS) |
| US12435320B2 (en) | 2014-12-24 | 2025-10-07 | The Broad Institute, Inc. | CRISPR having or associated with destabilization domains |
| US11390884B2 (en) | 2015-05-11 | 2022-07-19 | Editas Medicine, Inc. | Optimized CRISPR/cas9 systems and methods for gene editing in stem cells |
| US11261451B2 (en) | 2015-05-29 | 2022-03-01 | North Carolina State University | Methods for screening bacteria, archaea, algae, and yeast using CRISPR nucleic acids |
| US10136649B2 (en) | 2015-05-29 | 2018-11-27 | North Carolina State University | Methods for screening bacteria, archaea, algae, and yeast using CRISPR nucleic acids |
| US11549126B2 (en) | 2015-06-03 | 2023-01-10 | Board Of Regents Of The University Of Nebraska | Treatment methods using DNA editing with single-stranded DNA |
| US11555208B2 (en) | 2015-06-03 | 2023-01-17 | Board Of Regents Of The University Of Nebraska | DNA editing using relatively long single-stranded DNA and CRISPR/Cas9 to increase success rate in methods for preparing transgenic embryos and animals |
| US11911415B2 (en) | 2015-06-09 | 2024-02-27 | Editas Medicine, Inc. | CRISPR/Cas-related methods and compositions for improving transplantation |
| US11155823B2 (en) | 2015-06-15 | 2021-10-26 | North Carolina State University | Methods and compositions for efficient delivery of nucleic acids and RNA-based antimicrobials |
| US12606834B2 (en) | 2015-06-15 | 2026-04-21 | North Carolina State University | Methods and compositions for efficient delivery of nucleic acids and rna-based antimicrobials |
| US12123032B2 (en) | 2015-06-18 | 2024-10-22 | The Broad Institute, Inc. | CRISPR enzyme mutations reducing off-target effects |
| US12168789B2 (en) | 2015-06-18 | 2024-12-17 | The Broad Institute, Inc. | Engineering and optimization of systems, methods, enzymes and guide scaffolds of CAS9 orthologs and variants for sequence manipulation |
| US10876100B2 (en) | 2015-06-18 | 2020-12-29 | The Broad Institute, Inc. | Crispr enzyme mutations reducing off-target effects |
| US11578312B2 (en) | 2015-06-18 | 2023-02-14 | The Broad Institute Inc. | Engineering and optimization of systems, methods, enzymes and guide scaffolds of CAS9 orthologs and variants for sequence manipulation |
| US10494621B2 (en) | 2015-06-18 | 2019-12-03 | The Broad Institute, Inc. | Crispr enzyme mutations reducing off-target effects |
| US11642375B2 (en) | 2015-07-31 | 2023-05-09 | Intima Bioscience, Inc. | Intracellular genomic transplant and methods of therapy |
| US11266692B2 (en) | 2015-07-31 | 2022-03-08 | Regents Of The University Of Minnesota | Intracellular genomic transplant and methods of therapy |
| US10406177B2 (en) | 2015-07-31 | 2019-09-10 | Regents Of The University Of Minnesota | Modified cells and methods of therapy |
| US11583556B2 (en) | 2015-07-31 | 2023-02-21 | Regents Of The University Of Minnesota | Modified cells and methods of therapy |
| US10166255B2 (en) | 2015-07-31 | 2019-01-01 | Regents Of The University Of Minnesota | Intracellular genomic transplant and methods of therapy |
| US11147837B2 (en) | 2015-07-31 | 2021-10-19 | Regents Of The University Of Minnesota | Modified cells and methods of therapy |
| US11642374B2 (en) | 2015-07-31 | 2023-05-09 | Intima Bioscience, Inc. | Intracellular genomic transplant and methods of therapy |
| US11903966B2 (en) | 2015-07-31 | 2024-02-20 | Regents Of The University Of Minnesota | Intracellular genomic transplant and methods of therapy |
| US11925664B2 (en) | 2015-07-31 | 2024-03-12 | Intima Bioscience, Inc. | Intracellular genomic transplant and methods of therapy |
| US9512446B1 (en) | 2015-08-28 | 2016-12-06 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
| US11060078B2 (en) | 2015-08-28 | 2021-07-13 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
| WO2017040348A1 (en) | 2015-08-28 | 2017-03-09 | The General Hospital Corporation | Engineered crispr-cas9 nucleases |
| US9926546B2 (en) | 2015-08-28 | 2018-03-27 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
| US10526591B2 (en) | 2015-08-28 | 2020-01-07 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
| US10633642B2 (en) | 2015-08-28 | 2020-04-28 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
| EP4036236A1 (en) | 2015-08-28 | 2022-08-03 | The General Hospital Corporation | Engineered crispr-cas9 nucleases |
| US10093910B2 (en) | 2015-08-28 | 2018-10-09 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
| US11667911B2 (en) | 2015-09-24 | 2023-06-06 | Editas Medicine, Inc. | Use of exonucleases to improve CRISPR/CAS-mediated genome editing |
| US11286480B2 (en) | 2015-09-28 | 2022-03-29 | North Carolina State University | Methods and compositions for sequence specific antimicrobials |
| US11542466B2 (en) | 2015-12-22 | 2023-01-03 | North Carolina State University | Methods and compositions for delivery of CRISPR based antimicrobials |
| US11111287B2 (en) | 2016-01-11 | 2021-09-07 | The Board Of Trustees Of The Leland Stanford Junior University | Chimeric proteins and methods of immunotherapy |
| US11773411B2 (en) | 2016-01-11 | 2023-10-03 | The Board Of Trustees Of The Leland Stanford Junior University | Chimeric proteins and methods of regulating gene expression |
| US10336807B2 (en) | 2016-01-11 | 2019-07-02 | The Board Of Trustees Of The Leland Stanford Junior University | Chimeric proteins and methods of immunotherapy |
| US10457961B2 (en) | 2016-01-11 | 2019-10-29 | The Board Of Trustees Of The Leland Stanford Junior University | Chimeric proteins and methods of regulating gene expression |
| US9856497B2 (en) | 2016-01-11 | 2018-01-02 | The Board Of Trustee Of The Leland Stanford Junior University | Chimeric proteins and methods of regulating gene expression |
| US11597924B2 (en) | 2016-03-25 | 2023-03-07 | Editas Medicine, Inc. | Genome editing systems comprising repair-modulating enzyme molecules and methods of their use |
| US11236313B2 (en) | 2016-04-13 | 2022-02-01 | Editas Medicine, Inc. | Cas9 fusion molecules, gene editing systems, and methods of use thereof |
| US12049651B2 (en) | 2016-04-13 | 2024-07-30 | Editas Medicine, Inc. | Cas9 fusion molecules, gene editing systems, and methods of use thereof |
| US20190136230A1 (en) * | 2016-05-06 | 2019-05-09 | Juno Therapeutics, Inc. | Genetically engineered cells and methods of making the same |
| US12275952B2 (en) | 2016-06-02 | 2025-04-15 | Sigma-Aldrich Co. Llc | Using programmable DNA binding proteins to enhance targeted genome modification |
| US10266851B2 (en) | 2016-06-02 | 2019-04-23 | Sigma-Aldrich Co. Llc | Using programmable DNA binding proteins to enhance targeted genome modification |
| US12084675B2 (en) | 2016-06-02 | 2024-09-10 | Sigma-Aldrich Co. Llc | Using programmable DNA binding proteins to enhance targeted genome modification |
| WO2017213896A1 (en) * | 2016-06-03 | 2017-12-14 | Temple University - Of The Commonwealth System Of Higher Education | Negative feedback regulation of hiv-1 by gene editing strategy |
| US11840725B2 (en) | 2016-06-16 | 2023-12-12 | The Regents Of The University Of California | Methods and compositions for detecting a target RNA |
| US11827919B2 (en) | 2016-06-16 | 2023-11-28 | The Regents Of The University Of California | Methods and compositions for detecting a target RNA |
| WO2018013720A1 (en) * | 2016-07-12 | 2018-01-18 | Washington University | Incorporation of internal polya-encoded poly-lysine sequence tags and their variations for the tunable control of protein synthesis in bacterial and eukaryotic cells |
| US11603533B2 (en) | 2016-07-12 | 2023-03-14 | Washington University | Incorporation of internal polya-encoded poly-lysine sequence tags and their variations for the tunable control of protein synthesis in bacterial and eukaryotic cells |
| US12410437B2 (en) | 2016-07-12 | 2025-09-09 | Washington University | Incorporation of internal polya-encoded poly-lysine sequence tags and their variations for the tunable control of protein synthesis in bacterial and eukaryotic cells |
| US11912987B2 (en) | 2016-08-03 | 2024-02-27 | KSQ Therapeutics, Inc. | Methods for screening for cancer targets |
| US11078481B1 (en) | 2016-08-03 | 2021-08-03 | KSQ Therapeutics, Inc. | Methods for screening for cancer targets |
| US11078483B1 (en) | 2016-09-02 | 2021-08-03 | KSQ Therapeutics, Inc. | Methods for measuring and improving CRISPR reagent function |
| US11946163B2 (en) | 2016-09-02 | 2024-04-02 | KSQ Therapeutics, Inc. | Methods for measuring and improving CRISPR reagent function |
| WO2018048827A1 (en) * | 2016-09-07 | 2018-03-15 | Massachusetts Institute Of Technology | Rna-guided endonuclease-based dna assembly |
| US11795472B2 (en) | 2016-09-30 | 2023-10-24 | The Regents Of The University Of California | RNA-guided nucleic acid modifying enzymes and methods of use thereof |
| CN110023494A (en) * | 2016-09-30 | 2019-07-16 | 加利福尼亚大学董事会 | RNA-guided nucleic acid-modifying enzymes and methods of using the same |
| US12258575B2 (en) | 2016-09-30 | 2025-03-25 | The Regents Of The University Of California | RNA-guided nucleic acid modifying enzymes and methods of use thereof |
| US11873504B2 (en) | 2016-09-30 | 2024-01-16 | The Regents Of The University Of California | RNA-guided nucleic acid modifying enzymes and methods of use thereof |
| US10912797B2 (en) | 2016-10-18 | 2021-02-09 | Intima Bioscience, Inc. | Tumor infiltrating lymphocytes and methods of therapy |
| US11154574B2 (en) | 2016-10-18 | 2021-10-26 | Regents Of The University Of Minnesota | Tumor infiltrating lymphocytes and methods of therapy |
| US12286727B2 (en) | 2016-12-19 | 2025-04-29 | Editas Medicine, Inc. | Assessing nuclease cleavage |
| US12110545B2 (en) | 2017-01-06 | 2024-10-08 | Editas Medicine, Inc. | Methods of assessing nuclease cleavage |
| US12559748B2 (en) | 2017-02-06 | 2026-02-24 | Novartis Ag | Compositions and methods for the treatment of hemoglobinopathies |
| US11466271B2 (en) | 2017-02-06 | 2022-10-11 | Novartis Ag | Compositions and methods for the treatment of hemoglobinopathies |
| US11834670B2 (en) | 2017-04-19 | 2023-12-05 | Global Life Sciences Solutions Usa Llc | Site-specific DNA modification using a donor DNA repair template having tandem repeat sequences |
| US12058986B2 (en) | 2017-04-20 | 2024-08-13 | Egenesis, Inc. | Method for generating a genetically modified pig with inactivated porcine endogenous retrovirus (PERV) elements |
| EP4481049A2 (en) | 2017-04-21 | 2024-12-25 | The General Hospital Corporation | Variants of cpf1 (cas12a) with altered pam specificity |
| WO2018195545A2 (en) | 2017-04-21 | 2018-10-25 | The General Hospital Corporation | Variants of cpf1 (cas12a) with altered pam specificity |
| US11499151B2 (en) | 2017-04-28 | 2022-11-15 | Editas Medicine, Inc. | Methods and systems for analyzing guide RNA molecules |
| WO2018218206A1 (en) | 2017-05-25 | 2018-11-29 | The General Hospital Corporation | Bipartite base editor (bbe) architectures and type-ii-c-cas9 zinc finger editing |
| WO2018218166A1 (en) | 2017-05-25 | 2018-11-29 | The General Hospital Corporation | Using split deaminases to limit unwanted off-target base editor deamination |
| US10428319B2 (en) | 2017-06-09 | 2019-10-01 | Editas Medicine, Inc. | Engineered Cas9 nucleases |
| US11098297B2 (en) | 2017-06-09 | 2021-08-24 | Editas Medicine, Inc. | Engineered Cas9 nucleases |
| US12297466B2 (en) | 2017-06-09 | 2025-05-13 | Editas Medicine, Inc. | Engineered Cas9 nucleases |
| US11814624B2 (en) | 2017-06-15 | 2023-11-14 | The Regents Of The University Of California | Targeted non-viral DNA insertions |
| US12234461B2 (en) | 2017-06-15 | 2025-02-25 | The Regents Of The University Of California, A California Corporation | Targeted non-viral DNA insertions |
| US11098325B2 (en) | 2017-06-30 | 2021-08-24 | Intima Bioscience, Inc. | Adeno-associated viral vectors for gene therapy |
| US11866726B2 (en) | 2017-07-14 | 2024-01-09 | Editas Medicine, Inc. | Systems and methods for targeted integration and genome editing and detection thereof using integrated priming sites |
| US11331346B2 (en) | 2017-10-27 | 2022-05-17 | The Regents Of The University Of California | Targeted replacement of endogenous T cell receptors |
| US12398193B2 (en) | 2017-10-27 | 2025-08-26 | The Regents Of The University Of California | Targeted replacement of endogenous T cell receptors |
| US11033584B2 (en) | 2017-10-27 | 2021-06-15 | The Regents Of The University Of California | Targeted replacement of endogenous T cell receptors |
| US11083753B1 (en) | 2017-10-27 | 2021-08-10 | The Regents Of The University Of California | Targeted replacement of endogenous T cell receptors |
| US11590171B2 (en) | 2017-10-27 | 2023-02-28 | The Regents Of The University Of California | Targeted replacement of endogenous T cell receptors |
| US11970719B2 (en) | 2017-11-01 | 2024-04-30 | The Regents Of The University Of California | Class 2 CRISPR/Cas compositions and methods of use |
| US12264314B1 (en) | 2017-11-01 | 2025-04-01 | The Regents Of The University Of California | CasZ compositions and methods of use |
| US12227753B2 (en) | 2017-11-01 | 2025-02-18 | The Regents Of The University Of California | CasY compositions and methods of use |
| US12098363B2 (en) * | 2018-01-26 | 2024-09-24 | The Children's Medical Center Corporation | Targeting BCL11A distal regulatory elements with a CAS9-CAS9 fusion for fetal hemoglobin reinduction |
| US20210047632A1 (en) * | 2018-01-26 | 2021-02-18 | The Children's Medical Center Corporation | Targeting bcl11a distal regulatory elements with a cas9-cas9 fusion for fetal hemoglobin reinduction |
| WO2019147302A1 (en) * | 2018-01-26 | 2019-08-01 | Bauer Daniel E | Targeting bcl11a distal regulatory elements with a cas9-cas9 fusion for fetal hemoglobin reinduction |
| US12338436B2 (en) | 2018-06-29 | 2025-06-24 | Editas Medicine, Inc. | Synthetic guide molecules, compositions and methods relating thereto |
| US12203123B2 (en) | 2018-10-01 | 2025-01-21 | North Carolina State University | Recombinant type I CRISPR-Cas system and uses thereof for screening for variant cells |
| US10711267B2 (en) | 2018-10-01 | 2020-07-14 | North Carolina State University | Recombinant type I CRISPR-Cas system |
| US11680259B2 (en) | 2018-10-01 | 2023-06-20 | North Carolina State University | Recombinant type I CRISPR-CAS system |
| US12264330B2 (en) | 2018-10-01 | 2025-04-01 | North Carolina State University | Recombinant type I CRISPR-Cas system and uses thereof for killing target cells |
| US12264313B2 (en) | 2018-10-01 | 2025-04-01 | North Carolina State University | Recombinant type I CRISPR-Cas system and uses thereof for genome modification and alteration of expression |
| WO2020163396A1 (en) | 2019-02-04 | 2020-08-13 | The General Hospital Corporation | Adenine dna base editor variants with reduced off-target rna editing |
| US20230122226A1 (en) * | 2020-03-05 | 2023-04-20 | Board Of Regents Of The University Of Nebraska | Crispr/cas9 system for multistrain hiv-1 treatment |
| US12037407B2 (en) | 2021-10-14 | 2024-07-16 | Arsenal Biosciences, Inc. | Immune cells having co-expressed shRNAS and logic gate systems |
| EP4198124A1 (en) | 2021-12-15 | 2023-06-21 | Versitech Limited | Engineered cas9-nucleases and method of use thereof |
| WO2026006542A2 (en) | 2024-06-26 | 2026-01-02 | Yale University | Compositions and methods for crispr/cas9 based reactivation of human angelman syndrome |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP7478772B2 (en) | CRISPR-Based Genome Modification and Regulation | |
| HK1218389B (en) | Crispr-based genome modification and regulation |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: SIGMA-ALDRICH CO. LLC, MISSOURI Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:CHEN, FUQIANG;DAVIS, GREGORY D.;KANG, QIAOHUA;AND OTHERS;SIGNING DATES FROM 20150619 TO 20150728;REEL/FRAME:036334/0403 |
|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |
