US20120315277A1 - Compositions and Methods for the Therapy and Diagnosis of Influenza - Google Patents
Compositions and Methods for the Therapy and Diagnosis of Influenza Download PDFInfo
- Publication number
- US20120315277A1 US20120315277A1 US13/418,923 US201213418923A US2012315277A1 US 20120315277 A1 US20120315277 A1 US 20120315277A1 US 201213418923 A US201213418923 A US 201213418923A US 2012315277 A1 US2012315277 A1 US 2012315277A1
- Authority
- US
- United States
- Prior art keywords
- seq
- antibody
- tcn
- oseltamivir
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 238000000034 method Methods 0.000 title claims abstract description 175
- 239000000203 mixture Substances 0.000 title claims abstract description 93
- 206010022000 influenza Diseases 0.000 title claims abstract description 81
- 238000003745 diagnosis Methods 0.000 title abstract description 5
- 238000002560 therapeutic procedure Methods 0.000 title description 20
- 241000282414 Homo sapiens Species 0.000 claims abstract description 123
- 238000011282 treatment Methods 0.000 claims abstract description 41
- VSZGPKBBMSAYNT-RRFJBIMHSA-N oseltamivir Chemical compound CCOC(=O)C1=C[C@@H](OC(CC)CC)[C@H](NC(C)=O)[C@@H](N)C1 VSZGPKBBMSAYNT-RRFJBIMHSA-N 0.000 claims description 167
- 229960003752 oseltamivir Drugs 0.000 claims description 162
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 157
- 208000037797 influenza A Diseases 0.000 claims description 44
- 241000712461 unidentified influenza virus Species 0.000 claims description 31
- 239000008194 pharmaceutical composition Substances 0.000 claims description 12
- 239000003937 drug carrier Substances 0.000 claims description 8
- 230000002265 prevention Effects 0.000 claims description 8
- 229960002194 oseltamivir phosphate Drugs 0.000 claims description 5
- 230000009385 viral infection Effects 0.000 claims description 5
- 210000004027 cell Anatomy 0.000 description 323
- 108090000765 processed proteins & peptides Proteins 0.000 description 230
- 102000004196 processed proteins & peptides Human genes 0.000 description 202
- 229920001184 polypeptide Polymers 0.000 description 193
- 108090000623 proteins and genes Proteins 0.000 description 132
- 102100035360 Cerebellar degeneration-related antigen 1 Human genes 0.000 description 127
- 230000027455 binding Effects 0.000 description 126
- 102000040430 polynucleotide Human genes 0.000 description 107
- 108091033319 polynucleotide Proteins 0.000 description 107
- 239000002157 polynucleotide Substances 0.000 description 107
- 208000015181 infectious disease Diseases 0.000 description 101
- 235000001014 amino acid Nutrition 0.000 description 83
- 239000000427 antigen Substances 0.000 description 80
- 239000012634 fragment Substances 0.000 description 80
- 108091007433 antigens Proteins 0.000 description 79
- 102000036639 antigens Human genes 0.000 description 79
- 229940024606 amino acid Drugs 0.000 description 76
- 231100000111 LD50 Toxicity 0.000 description 73
- 150000001413 amino acids Chemical class 0.000 description 72
- 150000007523 nucleic acids Chemical group 0.000 description 72
- 239000013642 negative control Substances 0.000 description 70
- 239000002773 nucleotide Substances 0.000 description 68
- 125000003729 nucleotide group Chemical group 0.000 description 68
- 241000699670 Mus sp. Species 0.000 description 66
- 102000004169 proteins and genes Human genes 0.000 description 66
- 235000018102 proteins Nutrition 0.000 description 63
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 62
- 239000002953 phosphate buffered saline Substances 0.000 description 62
- 108091028043 Nucleic acid sequence Proteins 0.000 description 57
- 210000004602 germ cell Anatomy 0.000 description 57
- 239000013598 vector Substances 0.000 description 53
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 48
- 241000712431 Influenza A virus Species 0.000 description 48
- 230000004083 survival effect Effects 0.000 description 48
- 241000699666 Mus <mouse, genus> Species 0.000 description 47
- 238000013519 translation Methods 0.000 description 42
- 241000700605 Viruses Species 0.000 description 38
- 210000003719 b-lymphocyte Anatomy 0.000 description 38
- 239000013604 expression vector Substances 0.000 description 38
- 230000014509 gene expression Effects 0.000 description 37
- 210000001519 tissue Anatomy 0.000 description 35
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 31
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 31
- 238000006467 substitution reaction Methods 0.000 description 30
- 230000000295 complement effect Effects 0.000 description 28
- 239000013641 positive control Substances 0.000 description 28
- 230000001225 therapeutic effect Effects 0.000 description 28
- 101001039853 Sonchus yellow net virus Matrix protein Proteins 0.000 description 27
- 238000002474 experimental method Methods 0.000 description 27
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 26
- 238000004519 manufacturing process Methods 0.000 description 25
- 102000004190 Enzymes Human genes 0.000 description 24
- 108090000790 Enzymes Proteins 0.000 description 24
- 108060003951 Immunoglobulin Proteins 0.000 description 24
- 229940088598 enzyme Drugs 0.000 description 24
- 102000018358 immunoglobulin Human genes 0.000 description 24
- 239000000902 placebo Substances 0.000 description 24
- 229940068196 placebo Drugs 0.000 description 24
- 230000003612 virological effect Effects 0.000 description 24
- 238000003556 assay Methods 0.000 description 23
- 239000012472 biological sample Substances 0.000 description 23
- 102000039446 nucleic acids Human genes 0.000 description 23
- 108020004707 nucleic acids Proteins 0.000 description 23
- 239000000523 sample Substances 0.000 description 23
- 108010087819 Fc receptors Proteins 0.000 description 22
- 102000009109 Fc receptors Human genes 0.000 description 22
- 230000006870 function Effects 0.000 description 22
- 108020004414 DNA Proteins 0.000 description 21
- 239000003443 antiviral agent Substances 0.000 description 21
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 21
- 239000003814 drug Substances 0.000 description 20
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 20
- 230000000875 corresponding effect Effects 0.000 description 19
- 230000012010 growth Effects 0.000 description 19
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 18
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 18
- 230000004071 biological effect Effects 0.000 description 18
- 239000003795 chemical substances by application Substances 0.000 description 18
- 239000013615 primer Substances 0.000 description 18
- 238000000746 purification Methods 0.000 description 18
- 239000006228 supernatant Substances 0.000 description 18
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 17
- 229940127089 cytotoxic agent Drugs 0.000 description 17
- -1 i.e. Substances 0.000 description 17
- 238000009396 hybridization Methods 0.000 description 16
- 238000001727 in vivo Methods 0.000 description 16
- 239000012678 infectious agent Substances 0.000 description 16
- 210000002966 serum Anatomy 0.000 description 16
- 125000000539 amino acid group Chemical group 0.000 description 15
- 230000008901 benefit Effects 0.000 description 15
- 239000012636 effector Substances 0.000 description 15
- 229940127121 immunoconjugate Drugs 0.000 description 15
- 230000004048 modification Effects 0.000 description 15
- 238000012986 modification Methods 0.000 description 15
- 241000588724 Escherichia coli Species 0.000 description 14
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 14
- 238000004458 analytical method Methods 0.000 description 14
- 230000008859 change Effects 0.000 description 14
- 230000009089 cytolysis Effects 0.000 description 14
- 102000005962 receptors Human genes 0.000 description 14
- 108020003175 receptors Proteins 0.000 description 14
- 239000000872 buffer Substances 0.000 description 13
- 239000002254 cytotoxic agent Substances 0.000 description 13
- 231100000599 cytotoxic agent Toxicity 0.000 description 13
- 201000010099 disease Diseases 0.000 description 13
- 229940079593 drug Drugs 0.000 description 13
- 230000000694 effects Effects 0.000 description 13
- 239000003112 inhibitor Substances 0.000 description 13
- 230000002401 inhibitory effect Effects 0.000 description 13
- 235000004400 serine Nutrition 0.000 description 13
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 12
- 238000002965 ELISA Methods 0.000 description 12
- 241000196324 Embryophyta Species 0.000 description 12
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 12
- 238000007792 addition Methods 0.000 description 12
- 239000002246 antineoplastic agent Substances 0.000 description 12
- 238000012217 deletion Methods 0.000 description 12
- 230000037430 deletion Effects 0.000 description 12
- 238000003780 insertion Methods 0.000 description 12
- 230000037431 insertion Effects 0.000 description 12
- 239000002502 liposome Substances 0.000 description 12
- 239000003550 marker Substances 0.000 description 12
- 239000011159 matrix material Substances 0.000 description 12
- 238000013518 transcription Methods 0.000 description 12
- 230000035897 transcription Effects 0.000 description 12
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 11
- 238000013459 approach Methods 0.000 description 11
- 125000005647 linker group Chemical group 0.000 description 11
- 230000035772 mutation Effects 0.000 description 11
- 238000003752 polymerase chain reaction Methods 0.000 description 11
- 239000003053 toxin Substances 0.000 description 11
- 231100000765 toxin Toxicity 0.000 description 11
- 108700012359 toxins Proteins 0.000 description 11
- 229960005486 vaccine Drugs 0.000 description 11
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 10
- 108091007491 NSP3 Papain-like protease domains Proteins 0.000 description 10
- 239000004473 Threonine Substances 0.000 description 10
- 239000003623 enhancer Substances 0.000 description 10
- 230000004927 fusion Effects 0.000 description 10
- 108020001507 fusion proteins Proteins 0.000 description 10
- 102000037865 fusion proteins Human genes 0.000 description 10
- 230000001965 increasing effect Effects 0.000 description 10
- 231100000518 lethal Toxicity 0.000 description 10
- 230000001665 lethal effect Effects 0.000 description 10
- 229940002612 prodrug Drugs 0.000 description 10
- 239000000651 prodrug Substances 0.000 description 10
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 9
- 230000013595 glycosylation Effects 0.000 description 9
- 238000006206 glycosylation reaction Methods 0.000 description 9
- 210000004072 lung Anatomy 0.000 description 9
- 230000001404 mediated effect Effects 0.000 description 9
- 239000013612 plasmid Substances 0.000 description 9
- 239000000047 product Substances 0.000 description 9
- 241000894007 species Species 0.000 description 9
- 239000000126 substance Substances 0.000 description 9
- 241000894006 Bacteria Species 0.000 description 8
- 241000283707 Capra Species 0.000 description 8
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 8
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 8
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 8
- 241000124008 Mammalia Species 0.000 description 8
- 206010028980 Neoplasm Diseases 0.000 description 8
- 108010076504 Protein Sorting Signals Proteins 0.000 description 8
- 235000004279 alanine Nutrition 0.000 description 8
- 230000015572 biosynthetic process Effects 0.000 description 8
- 239000002299 complementary DNA Substances 0.000 description 8
- 231100000433 cytotoxic Toxicity 0.000 description 8
- 230000001472 cytotoxic effect Effects 0.000 description 8
- 230000034994 death Effects 0.000 description 8
- 231100000517 death Toxicity 0.000 description 8
- 208000035475 disorder Diseases 0.000 description 8
- 238000005516 engineering process Methods 0.000 description 8
- 238000009472 formulation Methods 0.000 description 8
- 210000004180 plasmocyte Anatomy 0.000 description 8
- 230000010076 replication Effects 0.000 description 8
- 238000001890 transfection Methods 0.000 description 8
- QWPXBEHQFHACTK-KZVYIGENSA-N (10e,12e)-86-chloro-12,14,4-trihydroxy-85,14-dimethoxy-33,2,7,10-tetramethyl-15,16-dihydro-14h-7-aza-1(6,4)-oxazina-3(2,3)-oxirana-8(1,3)-benzenacyclotetradecaphane-10,12-dien-6-one Chemical compound CN1C(=O)CC(O)C2(C)OC2C(C)C(OC(=O)N2)CC2(O)C(OC)\C=C\C=C(C)\CC2=CC(OC)=C(Cl)C1=C2 QWPXBEHQFHACTK-KZVYIGENSA-N 0.000 description 7
- 239000004475 Arginine Substances 0.000 description 7
- 241000271566 Aves Species 0.000 description 7
- 101710132601 Capsid protein Proteins 0.000 description 7
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 7
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 7
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 7
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 7
- 241001465754 Metazoa Species 0.000 description 7
- 229940123424 Neuraminidase inhibitor Drugs 0.000 description 7
- 108020004511 Recombinant DNA Proteins 0.000 description 7
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 7
- 230000001580 bacterial effect Effects 0.000 description 7
- 238000004113 cell culture Methods 0.000 description 7
- 238000010367 cloning Methods 0.000 description 7
- 238000000338 in vitro Methods 0.000 description 7
- 230000001939 inductive effect Effects 0.000 description 7
- 239000003094 microcapsule Substances 0.000 description 7
- 230000001681 protective effect Effects 0.000 description 7
- 230000002285 radioactive effect Effects 0.000 description 7
- 238000003757 reverse transcription PCR Methods 0.000 description 7
- 239000002911 sialidase inhibitor Substances 0.000 description 7
- 239000000758 substrate Substances 0.000 description 7
- 229940124597 therapeutic agent Drugs 0.000 description 7
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 6
- 238000012413 Fluorescence activated cell sorting analysis Methods 0.000 description 6
- 241000287828 Gallus gallus Species 0.000 description 6
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 6
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 6
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 6
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 6
- 239000004472 Lysine Substances 0.000 description 6
- 239000002202 Polyethylene glycol Substances 0.000 description 6
- 239000002253 acid Substances 0.000 description 6
- 230000006907 apoptotic process Effects 0.000 description 6
- 235000009582 asparagine Nutrition 0.000 description 6
- 229960001230 asparagine Drugs 0.000 description 6
- 239000011324 bead Substances 0.000 description 6
- 230000037396 body weight Effects 0.000 description 6
- 229930195731 calicheamicin Natural products 0.000 description 6
- 238000003776 cleavage reaction Methods 0.000 description 6
- 238000002648 combination therapy Methods 0.000 description 6
- 150000001875 compounds Chemical class 0.000 description 6
- 230000001186 cumulative effect Effects 0.000 description 6
- 125000000151 cysteine group Chemical class N[C@@H](CS)C(=O)* 0.000 description 6
- 238000000684 flow cytometry Methods 0.000 description 6
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 6
- 229940072221 immunoglobulins Drugs 0.000 description 6
- 229940126181 ion channel inhibitor Drugs 0.000 description 6
- 230000002147 killing effect Effects 0.000 description 6
- 238000002703 mutagenesis Methods 0.000 description 6
- 231100000350 mutagenesis Toxicity 0.000 description 6
- YBYRMVIVWMBXKQ-UHFFFAOYSA-N phenylmethanesulfonyl fluoride Chemical compound FS(=O)(=O)CC1=CC=CC=C1 YBYRMVIVWMBXKQ-UHFFFAOYSA-N 0.000 description 6
- 229920001223 polyethylene glycol Polymers 0.000 description 6
- 239000002987 primer (paints) Substances 0.000 description 6
- 230000007017 scission Effects 0.000 description 6
- 208000024891 symptom Diseases 0.000 description 6
- 230000002195 synergetic effect Effects 0.000 description 6
- 238000012360 testing method Methods 0.000 description 6
- 238000003146 transient transfection Methods 0.000 description 6
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 6
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 5
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 5
- 108091026890 Coding region Proteins 0.000 description 5
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 5
- 239000004471 Glycine Substances 0.000 description 5
- 241000238631 Hexapoda Species 0.000 description 5
- 241000282412 Homo Species 0.000 description 5
- 108010073807 IgG Receptors Proteins 0.000 description 5
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 5
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 5
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 5
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 5
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 5
- 108010006232 Neuraminidase Proteins 0.000 description 5
- 102000005348 Neuraminidase Human genes 0.000 description 5
- 241000282898 Sus scrofa Species 0.000 description 5
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 5
- 102100040029 Zinc finger protein 197 Human genes 0.000 description 5
- 229960003805 amantadine Drugs 0.000 description 5
- DKNWSYNQZKUICI-UHFFFAOYSA-N amantadine Chemical compound C1C(C2)CC3CC2CC1(N)C3 DKNWSYNQZKUICI-UHFFFAOYSA-N 0.000 description 5
- 239000005557 antagonist Substances 0.000 description 5
- 229940041181 antineoplastic drug Drugs 0.000 description 5
- 210000004556 brain Anatomy 0.000 description 5
- HXCHCVDVKSCDHU-LULTVBGHSA-N calicheamicin Chemical compound C1[C@H](OC)[C@@H](NCC)CO[C@H]1O[C@H]1[C@H](O[C@@H]2C\3=C(NC(=O)OC)C(=O)C[C@](C/3=C/CSSSC)(O)C#C\C=C/C#C2)O[C@H](C)[C@@H](NO[C@@H]2O[C@H](C)[C@@H](SC(=O)C=3C(=C(OC)C(O[C@H]4[C@@H]([C@H](OC)[C@@H](O)[C@H](C)O4)O)=C(I)C=3C)OC)[C@@H](O)C2)[C@@H]1O HXCHCVDVKSCDHU-LULTVBGHSA-N 0.000 description 5
- 150000001720 carbohydrates Chemical class 0.000 description 5
- 230000022534 cell killing Effects 0.000 description 5
- 235000018417 cysteine Nutrition 0.000 description 5
- 238000011161 development Methods 0.000 description 5
- 229960002989 glutamic acid Drugs 0.000 description 5
- 210000004185 liver Anatomy 0.000 description 5
- 230000007246 mechanism Effects 0.000 description 5
- 239000012528 membrane Substances 0.000 description 5
- 108020004999 messenger RNA Proteins 0.000 description 5
- 238000010369 molecular cloning Methods 0.000 description 5
- 210000005087 mononuclear cell Anatomy 0.000 description 5
- 210000000822 natural killer cell Anatomy 0.000 description 5
- 230000003472 neutralizing effect Effects 0.000 description 5
- 239000002245 particle Substances 0.000 description 5
- 210000002381 plasma Anatomy 0.000 description 5
- 238000002360 preparation method Methods 0.000 description 5
- 230000008569 process Effects 0.000 description 5
- 230000009467 reduction Effects 0.000 description 5
- 230000002829 reductive effect Effects 0.000 description 5
- 230000001105 regulatory effect Effects 0.000 description 5
- 238000011160 research Methods 0.000 description 5
- 238000012552 review Methods 0.000 description 5
- 238000012216 screening Methods 0.000 description 5
- 239000000243 solution Substances 0.000 description 5
- 238000010186 staining Methods 0.000 description 5
- 229960001028 zanamivir Drugs 0.000 description 5
- ARAIBEBZBOPLMB-UFGQHTETSA-N zanamivir Chemical compound CC(=O)N[C@@H]1[C@@H](N=C(N)N)C=C(C(O)=O)O[C@H]1[C@H](O)[C@H](O)CO ARAIBEBZBOPLMB-UFGQHTETSA-N 0.000 description 5
- JWDFQMWEFLOOED-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(pyridin-2-yldisulfanyl)propanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCSSC1=CC=CC=N1 JWDFQMWEFLOOED-UHFFFAOYSA-N 0.000 description 4
- UBCHPRBFMUDMNC-UHFFFAOYSA-N 1-(1-adamantyl)ethanamine Chemical compound C1C(C2)CC3CC2CC1(C(N)C)C3 UBCHPRBFMUDMNC-UHFFFAOYSA-N 0.000 description 4
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 4
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 4
- 108020004635 Complementary DNA Proteins 0.000 description 4
- 241000701022 Cytomegalovirus Species 0.000 description 4
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 4
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 4
- 101710154606 Hemagglutinin Proteins 0.000 description 4
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 4
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 4
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 4
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 4
- QWPXBEHQFHACTK-UHFFFAOYSA-N Maytansinol Natural products CN1C(=O)CC(O)C2(C)OC2C(C)C(OC(=O)N2)CC2(O)C(OC)C=CC=C(C)CC2=CC(OC)=C(Cl)C1=C2 QWPXBEHQFHACTK-UHFFFAOYSA-N 0.000 description 4
- 101710093908 Outer capsid protein VP4 Proteins 0.000 description 4
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 description 4
- 101710176177 Protein A56 Proteins 0.000 description 4
- PXIPVTKHYLBLMZ-UHFFFAOYSA-N Sodium azide Chemical compound [Na+].[N-]=[N+]=[N-] PXIPVTKHYLBLMZ-UHFFFAOYSA-N 0.000 description 4
- 241000256251 Spodoptera frugiperda Species 0.000 description 4
- 108091081024 Start codon Proteins 0.000 description 4
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 4
- 108010067390 Viral Proteins Proteins 0.000 description 4
- 238000002835 absorbance Methods 0.000 description 4
- 230000004913 activation Effects 0.000 description 4
- 238000001042 affinity chromatography Methods 0.000 description 4
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 4
- 238000012867 alanine scanning Methods 0.000 description 4
- 210000004102 animal cell Anatomy 0.000 description 4
- 230000000890 antigenic effect Effects 0.000 description 4
- 239000000969 carrier Substances 0.000 description 4
- 238000012512 characterization method Methods 0.000 description 4
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 4
- 230000004540 complement-dependent cytotoxicity Effects 0.000 description 4
- 239000013068 control sample Substances 0.000 description 4
- 229920001577 copolymer Polymers 0.000 description 4
- 238000004132 cross linking Methods 0.000 description 4
- 230000003247 decreasing effect Effects 0.000 description 4
- 238000001514 detection method Methods 0.000 description 4
- 230000018109 developmental process Effects 0.000 description 4
- 238000013467 fragmentation Methods 0.000 description 4
- 238000006062 fragmentation reaction Methods 0.000 description 4
- 235000013922 glutamic acid Nutrition 0.000 description 4
- 239000004220 glutamic acid Substances 0.000 description 4
- 230000009036 growth inhibition Effects 0.000 description 4
- 239000000185 hemagglutinin Substances 0.000 description 4
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 4
- 210000004408 hybridoma Anatomy 0.000 description 4
- 230000003053 immunization Effects 0.000 description 4
- 238000002649 immunization Methods 0.000 description 4
- 238000003364 immunohistochemistry Methods 0.000 description 4
- 230000008676 import Effects 0.000 description 4
- 230000001976 improved effect Effects 0.000 description 4
- 238000001802 infusion Methods 0.000 description 4
- 210000003292 kidney cell Anatomy 0.000 description 4
- 210000001165 lymph node Anatomy 0.000 description 4
- 210000004962 mammalian cell Anatomy 0.000 description 4
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 4
- 229960000485 methotrexate Drugs 0.000 description 4
- 210000001616 monocyte Anatomy 0.000 description 4
- 210000005259 peripheral blood Anatomy 0.000 description 4
- 239000011886 peripheral blood Substances 0.000 description 4
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 4
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 4
- 230000000069 prophylactic effect Effects 0.000 description 4
- 238000010188 recombinant method Methods 0.000 description 4
- 238000011084 recovery Methods 0.000 description 4
- 229960000888 rimantadine Drugs 0.000 description 4
- 150000003839 salts Chemical class 0.000 description 4
- 230000035945 sensitivity Effects 0.000 description 4
- 238000009097 single-agent therapy Methods 0.000 description 4
- 238000002741 site-directed mutagenesis Methods 0.000 description 4
- 241000701161 unidentified adenovirus Species 0.000 description 4
- 239000003981 vehicle Substances 0.000 description 4
- 230000029812 viral genome replication Effects 0.000 description 4
- 210000002845 virion Anatomy 0.000 description 4
- 230000004580 weight loss Effects 0.000 description 4
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 3
- GZCWLCBFPRFLKL-UHFFFAOYSA-N 1-prop-2-ynoxypropan-2-ol Chemical compound CC(O)COCC#C GZCWLCBFPRFLKL-UHFFFAOYSA-N 0.000 description 3
- 108010051457 Acid Phosphatase Proteins 0.000 description 3
- 102000013563 Acid Phosphatase Human genes 0.000 description 3
- 229920000936 Agarose Polymers 0.000 description 3
- 108010088751 Albumins Proteins 0.000 description 3
- 102000009027 Albumins Human genes 0.000 description 3
- 239000012114 Alexa Fluor 647 Substances 0.000 description 3
- 239000012099 Alexa Fluor family Substances 0.000 description 3
- 108700028369 Alleles Proteins 0.000 description 3
- 102000000412 Annexin Human genes 0.000 description 3
- 108050008874 Annexin Proteins 0.000 description 3
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 3
- UHOVQNZJYSORNB-UHFFFAOYSA-N Benzene Chemical compound C1=CC=CC=C1 UHOVQNZJYSORNB-UHFFFAOYSA-N 0.000 description 3
- WVDDGKGOMKODPV-UHFFFAOYSA-N Benzyl alcohol Chemical compound OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 description 3
- 206010057248 Cell death Diseases 0.000 description 3
- 241000282693 Cercopithecidae Species 0.000 description 3
- 108020004705 Codon Proteins 0.000 description 3
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 3
- 102000053602 DNA Human genes 0.000 description 3
- 108010013369 Enteropeptidase Proteins 0.000 description 3
- 102100029727 Enteropeptidase Human genes 0.000 description 3
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 3
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 3
- 108010070675 Glutathione transferase Proteins 0.000 description 3
- 102100029100 Hematopoietic prostaglandin D synthase Human genes 0.000 description 3
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 3
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 3
- 102000003855 L-lactate dehydrogenase Human genes 0.000 description 3
- 108700023483 L-lactate dehydrogenases Proteins 0.000 description 3
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 3
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 3
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 3
- 108091034117 Oligonucleotide Proteins 0.000 description 3
- 241000283973 Oryctolagus cuniculus Species 0.000 description 3
- 229910019142 PO4 Inorganic materials 0.000 description 3
- 108091005804 Peptidases Proteins 0.000 description 3
- 102000035195 Peptidases Human genes 0.000 description 3
- 102000003992 Peroxidases Human genes 0.000 description 3
- 101710182846 Polyhedrin Proteins 0.000 description 3
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 3
- 239000004365 Protease Substances 0.000 description 3
- 108010039491 Ricin Proteins 0.000 description 3
- 241000607720 Serratia Species 0.000 description 3
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 3
- 241000723873 Tobacco mosaic virus Species 0.000 description 3
- 229940122803 Vinca alkaloid Drugs 0.000 description 3
- 229940118555 Viral entry inhibitor Drugs 0.000 description 3
- 150000007513 acids Chemical class 0.000 description 3
- ORILYTVJVMAKLC-UHFFFAOYSA-N adamantane Chemical class C1C(C2)CC3CC1CC2C3 ORILYTVJVMAKLC-UHFFFAOYSA-N 0.000 description 3
- 230000004075 alteration Effects 0.000 description 3
- 239000003242 anti bacterial agent Substances 0.000 description 3
- 229940088710 antibiotic agent Drugs 0.000 description 3
- 229940121357 antivirals Drugs 0.000 description 3
- 229940009098 aspartate Drugs 0.000 description 3
- 108010005774 beta-Galactosidase Proteins 0.000 description 3
- SQVRNKJHWKZAKO-UHFFFAOYSA-N beta-N-Acetyl-D-neuraminic acid Natural products CC(=O)NC1C(O)CC(O)(C(O)=O)OC1C(O)C(O)CO SQVRNKJHWKZAKO-UHFFFAOYSA-N 0.000 description 3
- 210000004369 blood Anatomy 0.000 description 3
- 239000008280 blood Substances 0.000 description 3
- 230000001413 cellular effect Effects 0.000 description 3
- 239000002738 chelating agent Substances 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 238000004587 chromatography analysis Methods 0.000 description 3
- 239000000356 contaminant Substances 0.000 description 3
- 238000007796 conventional method Methods 0.000 description 3
- 239000007822 coupling agent Substances 0.000 description 3
- 239000012228 culture supernatant Substances 0.000 description 3
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 3
- 230000001086 cytosolic effect Effects 0.000 description 3
- 230000003013 cytotoxicity Effects 0.000 description 3
- 231100000135 cytotoxicity Toxicity 0.000 description 3
- 230000006378 damage Effects 0.000 description 3
- 230000007423 decrease Effects 0.000 description 3
- 230000001419 dependent effect Effects 0.000 description 3
- 239000000539 dimer Substances 0.000 description 3
- 238000010494 dissociation reaction Methods 0.000 description 3
- 230000005593 dissociations Effects 0.000 description 3
- 229960003668 docetaxel Drugs 0.000 description 3
- 230000002255 enzymatic effect Effects 0.000 description 3
- 210000003527 eukaryotic cell Anatomy 0.000 description 3
- 229960002949 fluorouracil Drugs 0.000 description 3
- 229930195712 glutamate Natural products 0.000 description 3
- 229940049906 glutamate Drugs 0.000 description 3
- 230000036541 health Effects 0.000 description 3
- 230000001900 immune effect Effects 0.000 description 3
- 230000028993 immune response Effects 0.000 description 3
- 238000003018 immunoassay Methods 0.000 description 3
- 238000010166 immunofluorescence Methods 0.000 description 3
- 230000006872 improvement Effects 0.000 description 3
- 230000005764 inhibitory process Effects 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- 230000002452 interceptive effect Effects 0.000 description 3
- 238000007912 intraperitoneal administration Methods 0.000 description 3
- 238000002955 isolation Methods 0.000 description 3
- 229960000310 isoleucine Drugs 0.000 description 3
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 3
- 238000002372 labelling Methods 0.000 description 3
- 210000000265 leukocyte Anatomy 0.000 description 3
- 150000002632 lipids Chemical class 0.000 description 3
- 210000002540 macrophage Anatomy 0.000 description 3
- 230000005291 magnetic effect Effects 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 229910052751 metal Inorganic materials 0.000 description 3
- 239000002184 metal Substances 0.000 description 3
- 229930182817 methionine Natural products 0.000 description 3
- 239000004005 microsphere Substances 0.000 description 3
- 235000013336 milk Nutrition 0.000 description 3
- 239000008267 milk Substances 0.000 description 3
- 210000004080 milk Anatomy 0.000 description 3
- 231100000252 nontoxic Toxicity 0.000 description 3
- 230000003000 nontoxic effect Effects 0.000 description 3
- 230000001717 pathogenic effect Effects 0.000 description 3
- 108040007629 peroxidase activity proteins Proteins 0.000 description 3
- 239000000546 pharmaceutical excipient Substances 0.000 description 3
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 3
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 3
- 239000010452 phosphate Substances 0.000 description 3
- 230000003389 potentiating effect Effects 0.000 description 3
- 238000012545 processing Methods 0.000 description 3
- 230000005180 public health Effects 0.000 description 3
- 238000003127 radioimmunoassay Methods 0.000 description 3
- 108091008146 restriction endonucleases Proteins 0.000 description 3
- 230000001932 seasonal effect Effects 0.000 description 3
- 230000028327 secretion Effects 0.000 description 3
- SQVRNKJHWKZAKO-OQPLDHBCSA-N sialic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)OC1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-OQPLDHBCSA-N 0.000 description 3
- 150000003384 small molecules Chemical class 0.000 description 3
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 3
- 239000007787 solid Substances 0.000 description 3
- 230000009870 specific binding Effects 0.000 description 3
- 239000003381 stabilizer Substances 0.000 description 3
- 238000010561 standard procedure Methods 0.000 description 3
- 238000003786 synthesis reaction Methods 0.000 description 3
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 3
- 238000004448 titration Methods 0.000 description 3
- 238000012546 transfer Methods 0.000 description 3
- 230000009466 transformation Effects 0.000 description 3
- 230000001052 transient effect Effects 0.000 description 3
- 238000012384 transportation and delivery Methods 0.000 description 3
- 238000011144 upstream manufacturing Methods 0.000 description 3
- 239000004474 valine Substances 0.000 description 3
- 229960004528 vincristine Drugs 0.000 description 3
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 3
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 3
- 230000007501 viral attachment Effects 0.000 description 3
- 238000005406 washing Methods 0.000 description 3
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 description 2
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- TZCPCKNHXULUIY-RGULYWFUSA-N 1,2-distearoyl-sn-glycero-3-phosphoserine Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(=O)OC[C@H](N)C(O)=O)OC(=O)CCCCCCCCCCCCCCCCC TZCPCKNHXULUIY-RGULYWFUSA-N 0.000 description 2
- VPFUWHKTPYPNGT-UHFFFAOYSA-N 3-(3,4-dihydroxyphenyl)-1-(5-hydroxy-2,2-dimethylchromen-6-yl)propan-1-one Chemical compound OC1=C2C=CC(C)(C)OC2=CC=C1C(=O)CCC1=CC=C(O)C(O)=C1 VPFUWHKTPYPNGT-UHFFFAOYSA-N 0.000 description 2
- OSJPPGNTCRNQQC-UWTATZPHSA-N 3-phospho-D-glyceric acid Chemical compound OC(=O)[C@H](O)COP(O)(O)=O OSJPPGNTCRNQQC-UWTATZPHSA-N 0.000 description 2
- QFVHZQCOUORWEI-UHFFFAOYSA-N 4-[(4-anilino-5-sulfonaphthalen-1-yl)diazenyl]-5-hydroxynaphthalene-2,7-disulfonic acid Chemical compound C=12C(O)=CC(S(O)(=O)=O)=CC2=CC(S(O)(=O)=O)=CC=1N=NC(C1=CC=CC(=C11)S(O)(=O)=O)=CC=C1NC1=CC=CC=C1 QFVHZQCOUORWEI-UHFFFAOYSA-N 0.000 description 2
- GANZODCWZFAEGN-UHFFFAOYSA-N 5-mercapto-2-nitro-benzoic acid Chemical compound OC(=O)C1=CC(S)=CC=C1[N+]([O-])=O GANZODCWZFAEGN-UHFFFAOYSA-N 0.000 description 2
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 2
- 206010069754 Acquired gene mutation Diseases 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 241000201370 Autographa californica nucleopolyhedrovirus Species 0.000 description 2
- 241000194108 Bacillus licheniformis Species 0.000 description 2
- 102100026189 Beta-galactosidase Human genes 0.000 description 2
- 206010006187 Breast cancer Diseases 0.000 description 2
- 108010029697 CD40 Ligand Proteins 0.000 description 2
- 102100032937 CD40 ligand Human genes 0.000 description 2
- 108010084457 Cathepsins Proteins 0.000 description 2
- 102000005600 Cathepsins Human genes 0.000 description 2
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 2
- 101710094648 Coat protein Proteins 0.000 description 2
- 206010009944 Colon cancer Diseases 0.000 description 2
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 2
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 2
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 2
- SRBFZHDQGSBBOR-IOVATXLUSA-N D-xylopyranose Chemical compound O[C@@H]1COC(O)[C@H](O)[C@H]1O SRBFZHDQGSBBOR-IOVATXLUSA-N 0.000 description 2
- 239000003155 DNA primer Substances 0.000 description 2
- 102000007260 Deoxyribonuclease I Human genes 0.000 description 2
- 108010008532 Deoxyribonuclease I Proteins 0.000 description 2
- 108010053770 Deoxyribonucleases Proteins 0.000 description 2
- 102000016911 Deoxyribonucleases Human genes 0.000 description 2
- 239000004375 Dextrin Substances 0.000 description 2
- 229920001353 Dextrin Polymers 0.000 description 2
- 238000009007 Diagnostic Kit Methods 0.000 description 2
- 108090000204 Dipeptidase 1 Proteins 0.000 description 2
- 241000255925 Diptera Species 0.000 description 2
- 241000283086 Equidae Species 0.000 description 2
- 241000206602 Eukaryota Species 0.000 description 2
- 108010074860 Factor Xa Proteins 0.000 description 2
- 108010021468 Fc gamma receptor IIA Proteins 0.000 description 2
- 108010021472 Fc gamma receptor IIB Proteins 0.000 description 2
- PXGOKWXKJXAPGV-UHFFFAOYSA-N Fluorine Chemical compound FF PXGOKWXKJXAPGV-UHFFFAOYSA-N 0.000 description 2
- 241000233866 Fungi Species 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 2
- 102000005731 Glucose-6-phosphate isomerase Human genes 0.000 description 2
- 108010070600 Glucose-6-phosphate isomerase Proteins 0.000 description 2
- 108010060309 Glucuronidase Proteins 0.000 description 2
- 102000053187 Glucuronidase Human genes 0.000 description 2
- ZWZWYGMENQVNFU-UHFFFAOYSA-N Glycerophosphorylserin Natural products OC(=O)C(N)COP(O)(=O)OCC(O)CO ZWZWYGMENQVNFU-UHFFFAOYSA-N 0.000 description 2
- 244000068988 Glycine max Species 0.000 description 2
- 235000010469 Glycine max Nutrition 0.000 description 2
- 108090000288 Glycoproteins Proteins 0.000 description 2
- 102000003886 Glycoproteins Human genes 0.000 description 2
- 102100021181 Golgi phosphoprotein 3 Human genes 0.000 description 2
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 2
- 101000840258 Homo sapiens Immunoglobulin J chain Proteins 0.000 description 2
- 241000701024 Human betaherpesvirus 5 Species 0.000 description 2
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 2
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 2
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 2
- 102100029571 Immunoglobulin J chain Human genes 0.000 description 2
- 102000013463 Immunoglobulin Light Chains Human genes 0.000 description 2
- 108010065825 Immunoglobulin Light Chains Proteins 0.000 description 2
- SIKJAQJRHWYJAI-UHFFFAOYSA-N Indole Chemical compound C1=CC=C2NC=CC2=C1 SIKJAQJRHWYJAI-UHFFFAOYSA-N 0.000 description 2
- 208000002979 Influenza in Birds Diseases 0.000 description 2
- 241001500351 Influenzavirus A Species 0.000 description 2
- 238000012695 Interfacial polymerization Methods 0.000 description 2
- 108091092195 Intron Proteins 0.000 description 2
- ZCYVEMRRCGMTRW-AHCXROLUSA-N Iodine-123 Chemical compound [123I] ZCYVEMRRCGMTRW-AHCXROLUSA-N 0.000 description 2
- 108090000862 Ion Channels Proteins 0.000 description 2
- 102000004310 Ion Channels Human genes 0.000 description 2
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical compound [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 2
- 241000235649 Kluyveromyces Species 0.000 description 2
- 244000285963 Kluyveromyces fragilis Species 0.000 description 2
- 241001138401 Kluyveromyces lactis Species 0.000 description 2
- 241000235058 Komagataella pastoris Species 0.000 description 2
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 2
- 108010000817 Leuprolide Proteins 0.000 description 2
- 102100029204 Low affinity immunoglobulin gamma Fc region receptor II-a Human genes 0.000 description 2
- 230000027311 M phase Effects 0.000 description 2
- 239000004907 Macro-emulsion Substances 0.000 description 2
- 101710125418 Major capsid protein Proteins 0.000 description 2
- 229930195725 Mannitol Natural products 0.000 description 2
- 229930126263 Maytansine Natural products 0.000 description 2
- 102000029749 Microtubule Human genes 0.000 description 2
- 108091022875 Microtubule Proteins 0.000 description 2
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 2
- 238000005481 NMR spectroscopy Methods 0.000 description 2
- 244000061176 Nicotiana tabacum Species 0.000 description 2
- 235000002637 Nicotiana tabacum Nutrition 0.000 description 2
- 101710141454 Nucleoprotein Proteins 0.000 description 2
- 230000004989 O-glycosylation Effects 0.000 description 2
- 229930012538 Paclitaxel Natural products 0.000 description 2
- 206010057249 Phagocytosis Diseases 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Natural products OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 206010035226 Plasma cell myeloma Diseases 0.000 description 2
- 101710083689 Probable capsid protein Proteins 0.000 description 2
- 108020005091 Replication Origin Proteins 0.000 description 2
- 108010083644 Ribonucleases Proteins 0.000 description 2
- 102000006382 Ribonucleases Human genes 0.000 description 2
- 241000714474 Rous sarcoma virus Species 0.000 description 2
- 241000235347 Schizosaccharomyces pombe Species 0.000 description 2
- 108010071390 Serum Albumin Proteins 0.000 description 2
- 102000007562 Serum Albumin Human genes 0.000 description 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 2
- BQCADISMDOOEFD-UHFFFAOYSA-N Silver Chemical compound [Ag] BQCADISMDOOEFD-UHFFFAOYSA-N 0.000 description 2
- 241000282887 Suidae Species 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 2
- 229940123237 Taxane Drugs 0.000 description 2
- 241001116498 Taxus baccata Species 0.000 description 2
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 2
- 241000255985 Trichoplusia Species 0.000 description 2
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 2
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 2
- IXKSXJFAGXLQOQ-XISFHERQSA-N WHWLQLKPGQPMY Chemical compound C([C@@H](C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)NC(=O)[C@@H](N)CC=1C2=CC=CC=C2NC=1)C1=CNC=N1 IXKSXJFAGXLQOQ-XISFHERQSA-N 0.000 description 2
- 240000008042 Zea mays Species 0.000 description 2
- 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 description 2
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 2
- 238000009825 accumulation Methods 0.000 description 2
- 230000021736 acetylation Effects 0.000 description 2
- 238000006640 acetylation reaction Methods 0.000 description 2
- 230000003213 activating effect Effects 0.000 description 2
- 239000000654 additive Substances 0.000 description 2
- 230000000996 additive effect Effects 0.000 description 2
- 150000001299 aldehydes Chemical class 0.000 description 2
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 2
- WQZGKKKJIJFFOK-PHYPRBDBSA-N alpha-D-galactose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 description 2
- 230000003321 amplification Effects 0.000 description 2
- 230000000259 anti-tumor effect Effects 0.000 description 2
- 210000000628 antibody-producing cell Anatomy 0.000 description 2
- 238000010913 antigen-directed enzyme pro-drug therapy Methods 0.000 description 2
- 239000003963 antioxidant agent Substances 0.000 description 2
- 235000006708 antioxidants Nutrition 0.000 description 2
- 229960005070 ascorbic acid Drugs 0.000 description 2
- 235000010323 ascorbic acid Nutrition 0.000 description 2
- 239000011668 ascorbic acid Substances 0.000 description 2
- 206010064097 avian influenza Diseases 0.000 description 2
- 210000003651 basophil Anatomy 0.000 description 2
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 2
- 102000006635 beta-lactamase Human genes 0.000 description 2
- 230000001588 bifunctional effect Effects 0.000 description 2
- 210000000621 bronchi Anatomy 0.000 description 2
- 210000003123 bronchiole Anatomy 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- 201000011510 cancer Diseases 0.000 description 2
- 150000001718 carbodiimides Chemical class 0.000 description 2
- 235000014633 carbohydrates Nutrition 0.000 description 2
- YCIMNLLNPGFGHC-UHFFFAOYSA-N catechol Chemical compound OC1=CC=CC=C1O YCIMNLLNPGFGHC-UHFFFAOYSA-N 0.000 description 2
- 230000004663 cell proliferation Effects 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 2
- 238000012412 chemical coupling Methods 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 238000005354 coacervation Methods 0.000 description 2
- 230000024203 complement activation Effects 0.000 description 2
- 230000021615 conjugation Effects 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 235000005822 corn Nutrition 0.000 description 2
- 239000003431 cross linking reagent Substances 0.000 description 2
- 238000012258 culturing Methods 0.000 description 2
- 229960000975 daunorubicin Drugs 0.000 description 2
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 2
- 239000003405 delayed action preparation Substances 0.000 description 2
- 235000019425 dextrin Nutrition 0.000 description 2
- 238000002405 diagnostic procedure Methods 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- 230000029087 digestion Effects 0.000 description 2
- 125000005442 diisocyanate group Chemical group 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 238000006471 dimerization reaction Methods 0.000 description 2
- 230000003292 diminished effect Effects 0.000 description 2
- 150000002016 disaccharides Chemical class 0.000 description 2
- 150000004662 dithiols Chemical class 0.000 description 2
- 229960004679 doxorubicin Drugs 0.000 description 2
- 238000012377 drug delivery Methods 0.000 description 2
- 238000010828 elution Methods 0.000 description 2
- 239000002158 endotoxin Substances 0.000 description 2
- 230000002708 enhancing effect Effects 0.000 description 2
- 210000003979 eosinophil Anatomy 0.000 description 2
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 2
- 229960005420 etoposide Drugs 0.000 description 2
- 230000002349 favourable effect Effects 0.000 description 2
- 239000012091 fetal bovine serum Substances 0.000 description 2
- 229930182830 galactose Natural products 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 238000001415 gene therapy Methods 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 239000008103 glucose Substances 0.000 description 2
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 2
- 102000006602 glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 2
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 2
- 229940093915 gynecological organic acid Drugs 0.000 description 2
- 244000000013 helminth Species 0.000 description 2
- 229960002897 heparin Drugs 0.000 description 2
- 229920000669 heparin Polymers 0.000 description 2
- 210000003630 histaminocyte Anatomy 0.000 description 2
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 description 2
- 229920001477 hydrophilic polymer Polymers 0.000 description 2
- 229920003063 hydroxymethyl cellulose Polymers 0.000 description 2
- 229940031574 hydroxymethyl cellulose Drugs 0.000 description 2
- 150000002463 imidates Chemical class 0.000 description 2
- 210000000987 immune system Anatomy 0.000 description 2
- 230000016784 immunoglobulin production Effects 0.000 description 2
- 230000002055 immunohistochemical effect Effects 0.000 description 2
- 238000011065 in-situ storage Methods 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 229960003971 influenza vaccine Drugs 0.000 description 2
- 238000007689 inspection Methods 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 238000010253 intravenous injection Methods 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 231100000636 lethal dose Toxicity 0.000 description 2
- RGLRXNKKBLIBQS-XNHQSDQCSA-N leuprolide acetate Chemical compound CC(O)=O.CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=CC=C(O)C=C1 RGLRXNKKBLIBQS-XNHQSDQCSA-N 0.000 description 2
- 239000003446 ligand Substances 0.000 description 2
- 229920006008 lipopolysaccharide Polymers 0.000 description 2
- 210000005229 liver cell Anatomy 0.000 description 2
- 210000004698 lymphocyte Anatomy 0.000 description 2
- RLSSMJSEOOYNOY-UHFFFAOYSA-N m-cresol Chemical compound CC1=CC=CC(O)=C1 RLSSMJSEOOYNOY-UHFFFAOYSA-N 0.000 description 2
- 238000002595 magnetic resonance imaging Methods 0.000 description 2
- 239000000594 mannitol Substances 0.000 description 2
- 235000010355 mannitol Nutrition 0.000 description 2
- WKPWGQKGSOKKOO-RSFHAFMBSA-N maytansine Chemical compound CO[C@@H]([C@@]1(O)C[C@](OC(=O)N1)([C@H]([C@@H]1O[C@@]1(C)[C@@H](OC(=O)[C@H](C)N(C)C(C)=O)CC(=O)N1C)C)[H])\C=C\C=C(C)\CC2=CC(OC)=C(Cl)C1=C2 WKPWGQKGSOKKOO-RSFHAFMBSA-N 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 2
- 239000004530 micro-emulsion Substances 0.000 description 2
- 238000002493 microarray Methods 0.000 description 2
- 244000005700 microbiome Species 0.000 description 2
- 210000004688 microtubule Anatomy 0.000 description 2
- 238000001823 molecular biology technique Methods 0.000 description 2
- 238000012544 monitoring process Methods 0.000 description 2
- 150000002772 monosaccharides Chemical class 0.000 description 2
- 201000000050 myeloid neoplasm Diseases 0.000 description 2
- 239000002088 nanocapsule Substances 0.000 description 2
- 239000002105 nanoparticle Substances 0.000 description 2
- 210000000440 neutrophil Anatomy 0.000 description 2
- 239000002736 nonionic surfactant Substances 0.000 description 2
- 238000003199 nucleic acid amplification method Methods 0.000 description 2
- 238000007899 nucleic acid hybridization Methods 0.000 description 2
- 230000001293 nucleolytic effect Effects 0.000 description 2
- 238000002515 oligonucleotide synthesis Methods 0.000 description 2
- 150000007524 organic acids Chemical class 0.000 description 2
- 235000005985 organic acids Nutrition 0.000 description 2
- 229960001592 paclitaxel Drugs 0.000 description 2
- 239000013610 patient sample Substances 0.000 description 2
- AQIXEPGDORPWBJ-UHFFFAOYSA-N pentan-3-ol Chemical compound CCC(O)CC AQIXEPGDORPWBJ-UHFFFAOYSA-N 0.000 description 2
- 238000010647 peptide synthesis reaction Methods 0.000 description 2
- 210000001322 periplasm Anatomy 0.000 description 2
- 230000008782 phagocytosis Effects 0.000 description 2
- 230000026731 phosphorylation Effects 0.000 description 2
- 238000006366 phosphorylation reaction Methods 0.000 description 2
- 210000003720 plasmablast Anatomy 0.000 description 2
- 230000008488 polyadenylation Effects 0.000 description 2
- 229920000642 polymer Polymers 0.000 description 2
- 229920001451 polypropylene glycol Polymers 0.000 description 2
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 2
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 2
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 2
- 230000001323 posttranslational effect Effects 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 2
- 238000000159 protein binding assay Methods 0.000 description 2
- 238000003259 recombinant expression Methods 0.000 description 2
- GHMLBKRAJCXXBS-UHFFFAOYSA-N resorcinol Chemical compound OC1=CC=CC(O)=C1 GHMLBKRAJCXXBS-UHFFFAOYSA-N 0.000 description 2
- 210000002345 respiratory system Anatomy 0.000 description 2
- 210000003296 saliva Anatomy 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 238000002864 sequence alignment Methods 0.000 description 2
- 150000003355 serines Chemical class 0.000 description 2
- 230000000405 serological effect Effects 0.000 description 2
- 230000037432 silent mutation Effects 0.000 description 2
- 229910052709 silver Inorganic materials 0.000 description 2
- 239000004332 silver Substances 0.000 description 2
- 239000011734 sodium Substances 0.000 description 2
- 229910052708 sodium Inorganic materials 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 230000037439 somatic mutation Effects 0.000 description 2
- 239000000600 sorbitol Substances 0.000 description 2
- 238000009987 spinning Methods 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 150000008163 sugars Chemical class 0.000 description 2
- 239000004094 surface-active agent Substances 0.000 description 2
- 231100001274 therapeutic index Toxicity 0.000 description 2
- 125000000101 thioether group Chemical group 0.000 description 2
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- 230000002103 transcriptional effect Effects 0.000 description 2
- 238000000108 ultra-filtration Methods 0.000 description 2
- 229960003048 vinblastine Drugs 0.000 description 2
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 2
- DIGQNXIGRZPYDK-WKSCXVIASA-N (2R)-6-amino-2-[[2-[[(2S)-2-[[2-[[(2R)-2-[[(2S)-2-[[(2R,3S)-2-[[2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2R)-2-[[(2S,3S)-2-[[(2R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2R)-2-[[2-[[2-[[2-[(2-amino-1-hydroxyethylidene)amino]-3-carboxy-1-hydroxypropylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxybutylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1,5-dihydroxy-5-iminopentylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxybutylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxyethylidene]amino]hexanoic acid Chemical compound C[C@@H]([C@@H](C(=N[C@@H](CS)C(=N[C@@H](C)C(=N[C@@H](CO)C(=NCC(=N[C@@H](CCC(=N)O)C(=NC(CS)C(=N[C@H]([C@H](C)O)C(=N[C@H](CS)C(=N[C@H](CO)C(=NCC(=N[C@H](CS)C(=NCC(=N[C@H](CCCCN)C(=O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)N=C([C@H](CS)N=C([C@H](CO)N=C([C@H](CO)N=C([C@H](C)N=C(CN=C([C@H](CO)N=C([C@H](CS)N=C(CN=C(C(CS)N=C(C(CC(=O)O)N=C(CN)O)O)O)O)O)O)O)O)O)O)O)O DIGQNXIGRZPYDK-WKSCXVIASA-N 0.000 description 1
- OCUSNPIJIZCRSZ-ZTZWCFDHSA-N (2s)-2-amino-3-methylbutanoic acid;(2s)-2-amino-4-methylpentanoic acid;(2s,3s)-2-amino-3-methylpentanoic acid Chemical compound CC(C)[C@H](N)C(O)=O.CC[C@H](C)[C@H](N)C(O)=O.CC(C)C[C@H](N)C(O)=O OCUSNPIJIZCRSZ-ZTZWCFDHSA-N 0.000 description 1
- XMQUEQJCYRFIQS-YFKPBYRVSA-N (2s)-2-amino-5-ethoxy-5-oxopentanoic acid Chemical compound CCOC(=O)CC[C@H](N)C(O)=O XMQUEQJCYRFIQS-YFKPBYRVSA-N 0.000 description 1
- KYBXNPIASYUWLN-WUCPZUCCSA-N (2s)-5-hydroxypyrrolidine-2-carboxylic acid Chemical compound OC1CC[C@@H](C(O)=O)N1 KYBXNPIASYUWLN-WUCPZUCCSA-N 0.000 description 1
- IEUUDEWWMRQUDS-UHFFFAOYSA-N (6-azaniumylidene-1,6-dimethoxyhexylidene)azanium;dichloride Chemical compound Cl.Cl.COC(=N)CCCCC(=N)OC IEUUDEWWMRQUDS-UHFFFAOYSA-N 0.000 description 1
- FDKXTQMXEQVLRF-ZHACJKMWSA-N (E)-dacarbazine Chemical compound CN(C)\N=N\c1[nH]cnc1C(N)=O FDKXTQMXEQVLRF-ZHACJKMWSA-N 0.000 description 1
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- NWUYHJFMYQTDRP-UHFFFAOYSA-N 1,2-bis(ethenyl)benzene;1-ethenyl-2-ethylbenzene;styrene Chemical compound C=CC1=CC=CC=C1.CCC1=CC=CC=C1C=C.C=CC1=CC=CC=C1C=C NWUYHJFMYQTDRP-UHFFFAOYSA-N 0.000 description 1
- FJQZXCPWAGYPSD-UHFFFAOYSA-N 1,3,4,6-tetrachloro-3a,6a-diphenylimidazo[4,5-d]imidazole-2,5-dione Chemical compound ClN1C(=O)N(Cl)C2(C=3C=CC=CC=3)N(Cl)C(=O)N(Cl)C12C1=CC=CC=C1 FJQZXCPWAGYPSD-UHFFFAOYSA-N 0.000 description 1
- VILFTWLXLYIEMV-UHFFFAOYSA-N 1,5-difluoro-2,4-dinitrobenzene Chemical compound [O-][N+](=O)C1=CC([N+]([O-])=O)=C(F)C=C1F VILFTWLXLYIEMV-UHFFFAOYSA-N 0.000 description 1
- MQLACMBJVPINKE-UHFFFAOYSA-N 10-[(3-hydroxy-4-methoxyphenyl)methylidene]anthracen-9-one Chemical compound C1=C(O)C(OC)=CC=C1C=C1C2=CC=CC=C2C(=O)C2=CC=CC=C21 MQLACMBJVPINKE-UHFFFAOYSA-N 0.000 description 1
- PNDPGZBMCMUPRI-HVTJNCQCSA-N 10043-66-0 Chemical compound [131I][131I] PNDPGZBMCMUPRI-HVTJNCQCSA-N 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- YBBNVCVOACOHIG-UHFFFAOYSA-N 2,2-diamino-1,4-bis(4-azidophenyl)-3-butylbutane-1,4-dione Chemical compound C=1C=C(N=[N+]=[N-])C=CC=1C(=O)C(N)(N)C(CCCC)C(=O)C1=CC=C(N=[N+]=[N-])C=C1 YBBNVCVOACOHIG-UHFFFAOYSA-N 0.000 description 1
- NHBKXEKEPDILRR-UHFFFAOYSA-N 2,3-bis(butanoylsulfanyl)propyl butanoate Chemical compound CCCC(=O)OCC(SC(=O)CCC)CSC(=O)CCC NHBKXEKEPDILRR-UHFFFAOYSA-N 0.000 description 1
- KGLPWQKSKUVKMJ-UHFFFAOYSA-N 2,3-dihydrophthalazine-1,4-dione Chemical class C1=CC=C2C(=O)NNC(=O)C2=C1 KGLPWQKSKUVKMJ-UHFFFAOYSA-N 0.000 description 1
- KAWIOCMUARENDQ-UHFFFAOYSA-N 2-(4-chlorophenyl)sulfanyl-n-(4-pyridin-2-yl-1,3-thiazol-2-yl)acetamide Chemical compound C1=CC(Cl)=CC=C1SCC(=O)NC1=NC(C=2N=CC=CC=2)=CS1 KAWIOCMUARENDQ-UHFFFAOYSA-N 0.000 description 1
- FZDFGHZZPBUTGP-UHFFFAOYSA-N 2-[[2-[bis(carboxymethyl)amino]-3-(4-isothiocyanatophenyl)propyl]-[2-[bis(carboxymethyl)amino]propyl]amino]acetic acid Chemical compound OC(=O)CN(CC(O)=O)C(C)CN(CC(O)=O)CC(N(CC(O)=O)CC(O)=O)CC1=CC=C(N=C=S)C=C1 FZDFGHZZPBUTGP-UHFFFAOYSA-N 0.000 description 1
- FBUTXZSKZCQABC-UHFFFAOYSA-N 2-amino-1-methyl-7h-purine-6-thione Chemical compound S=C1N(C)C(N)=NC2=C1NC=N2 FBUTXZSKZCQABC-UHFFFAOYSA-N 0.000 description 1
- 125000000979 2-amino-2-oxoethyl group Chemical group [H]C([*])([H])C(=O)N([H])[H] 0.000 description 1
- UAIUNKRWKOVEES-UHFFFAOYSA-N 3,3',5,5'-tetramethylbenzidine Chemical compound CC1=C(N)C(C)=CC(C=2C=C(C)C(N)=C(C)C=2)=C1 UAIUNKRWKOVEES-UHFFFAOYSA-N 0.000 description 1
- AOJJSUZBOXZQNB-VTZDEGQISA-N 4'-epidoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-VTZDEGQISA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 229940117976 5-hydroxylysine Drugs 0.000 description 1
- 102100031126 6-phosphogluconolactonase Human genes 0.000 description 1
- 108010029731 6-phosphogluconolactonase Proteins 0.000 description 1
- CJIJXIFQYOPWTF-UHFFFAOYSA-N 7-hydroxycoumarin Natural products O1C(=O)C=CC2=CC(O)=CC=C21 CJIJXIFQYOPWTF-UHFFFAOYSA-N 0.000 description 1
- 108010066676 Abrin Proteins 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 102100029457 Adenine phosphoribosyltransferase Human genes 0.000 description 1
- 108010024223 Adenine phosphoribosyltransferase Proteins 0.000 description 1
- 241000256111 Aedes <genus> Species 0.000 description 1
- 241000256118 Aedes aegypti Species 0.000 description 1
- 101710187573 Alcohol dehydrogenase 2 Proteins 0.000 description 1
- 101710133776 Alcohol dehydrogenase class-3 Proteins 0.000 description 1
- 108010025188 Alcohol oxidase Proteins 0.000 description 1
- 102100023635 Alpha-fetoprotein Human genes 0.000 description 1
- QGZKDVFQNNGYKY-OUBTZVSYSA-N Ammonia-15N Chemical compound [15NH3] QGZKDVFQNNGYKY-OUBTZVSYSA-N 0.000 description 1
- 108090000672 Annexin A5 Proteins 0.000 description 1
- 102000004121 Annexin A5 Human genes 0.000 description 1
- 108010032595 Antibody Binding Sites Proteins 0.000 description 1
- 102000009133 Arylsulfatases Human genes 0.000 description 1
- 206010003445 Ascites Diseases 0.000 description 1
- 241000228212 Aspergillus Species 0.000 description 1
- 241000351920 Aspergillus nidulans Species 0.000 description 1
- 241000228245 Aspergillus niger Species 0.000 description 1
- 101000669426 Aspergillus restrictus Ribonuclease mitogillin Proteins 0.000 description 1
- 241001203868 Autographa californica Species 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 238000012935 Averaging Methods 0.000 description 1
- 241000713842 Avian sarcoma virus Species 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 108091008875 B cell receptors Proteins 0.000 description 1
- 230000003844 B-cell-activation Effects 0.000 description 1
- 238000011725 BALB/c mouse Methods 0.000 description 1
- 235000014469 Bacillus subtilis Nutrition 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 241000255789 Bombyx mori Species 0.000 description 1
- 241000409811 Bombyx mori nucleopolyhedrovirus Species 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 241000701822 Bovine papillomavirus Species 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- 241000222120 Candida <Saccharomycetales> Species 0.000 description 1
- 241000222122 Candida albicans Species 0.000 description 1
- 241000282465 Canis Species 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 101710158575 Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase Proteins 0.000 description 1
- OKTJSMMVPCPJKN-OUBTZVSYSA-N Carbon-13 Chemical compound [13C] OKTJSMMVPCPJKN-OUBTZVSYSA-N 0.000 description 1
- OKTJSMMVPCPJKN-NJFSPNSNSA-N Carbon-14 Chemical compound [14C] OKTJSMMVPCPJKN-NJFSPNSNSA-N 0.000 description 1
- 108010006303 Carboxypeptidases Proteins 0.000 description 1
- 102000005367 Carboxypeptidases Human genes 0.000 description 1
- DLGOEMSEDOSKAD-UHFFFAOYSA-N Carmustine Chemical compound ClCCNC(=O)N(N=O)CCCl DLGOEMSEDOSKAD-UHFFFAOYSA-N 0.000 description 1
- 241000701489 Cauliflower mosaic virus Species 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 241000282552 Chlorocebus aethiops Species 0.000 description 1
- 239000005496 Chlorsulfuron Substances 0.000 description 1
- 108700010070 Codon Usage Proteins 0.000 description 1
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 1
- 229920000742 Cotton Polymers 0.000 description 1
- 206010011224 Cough Diseases 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 239000004971 Cross linker Substances 0.000 description 1
- 108700032819 Croton tiglium crotin II Proteins 0.000 description 1
- XZMCDFZZKTWFGF-UHFFFAOYSA-N Cyanamide Chemical compound NC#N XZMCDFZZKTWFGF-UHFFFAOYSA-N 0.000 description 1
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 1
- 102000000311 Cytosine Deaminase Human genes 0.000 description 1
- 108010080611 Cytosine Deaminase Proteins 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- 150000008574 D-amino acids Chemical group 0.000 description 1
- LEVWYRKDKASIDU-QWWZWVQMSA-N D-cystine Chemical compound OC(=O)[C@H](N)CSSC[C@@H](N)C(O)=O LEVWYRKDKASIDU-QWWZWVQMSA-N 0.000 description 1
- 101150074155 DHFR gene Proteins 0.000 description 1
- 239000012624 DNA alkylating agent Substances 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 229940124087 DNA topoisomerase II inhibitor Drugs 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- CYCGRDQQIOGCKX-UHFFFAOYSA-N Dehydro-luciferin Natural products OC(=O)C1=CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 CYCGRDQQIOGCKX-UHFFFAOYSA-N 0.000 description 1
- 102000016607 Diphtheria Toxin Human genes 0.000 description 1
- 108010053187 Diphtheria Toxin Proteins 0.000 description 1
- 241000255601 Drosophila melanogaster Species 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 206010014020 Ear pain Diseases 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 241000588914 Enterobacter Species 0.000 description 1
- 241000588921 Enterobacteriaceae Species 0.000 description 1
- HTIJFSOGRVMCQR-UHFFFAOYSA-N Epirubicin Natural products COc1cccc2C(=O)c3c(O)c4CC(O)(CC(OC5CC(N)C(=O)C(C)O5)c4c(O)c3C(=O)c12)C(=O)CO HTIJFSOGRVMCQR-UHFFFAOYSA-N 0.000 description 1
- 241000588698 Erwinia Species 0.000 description 1
- 241000588722 Escherichia Species 0.000 description 1
- 241001522878 Escherichia coli B Species 0.000 description 1
- 241001302584 Escherichia coli str. K-12 substr. W3110 Species 0.000 description 1
- 229930189413 Esperamicin Natural products 0.000 description 1
- 108090000371 Esterases Proteins 0.000 description 1
- 101710082714 Exotoxin A Proteins 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 241000724791 Filamentous phage Species 0.000 description 1
- BJGNCJDXODQBOB-UHFFFAOYSA-N Fivefly Luciferin Natural products OC(=O)C1CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 BJGNCJDXODQBOB-UHFFFAOYSA-N 0.000 description 1
- 241000700662 Fowlpox virus Species 0.000 description 1
- 230000037057 G1 phase arrest Effects 0.000 description 1
- 229910052688 Gadolinium Inorganic materials 0.000 description 1
- 108010015133 Galactose oxidase Proteins 0.000 description 1
- 108700004714 Gelonium multiflorum GEL Proteins 0.000 description 1
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 1
- 108010073178 Glucan 1,4-alpha-Glucosidase Proteins 0.000 description 1
- 102100022624 Glucoamylase Human genes 0.000 description 1
- 102000030595 Glucokinase Human genes 0.000 description 1
- 108010021582 Glucokinase Proteins 0.000 description 1
- 239000004366 Glucose oxidase Substances 0.000 description 1
- 108010015776 Glucose oxidase Proteins 0.000 description 1
- 108010018962 Glucosephosphate Dehydrogenase Proteins 0.000 description 1
- SXRSQZLOMIGNAQ-UHFFFAOYSA-N Glutaraldehyde Chemical compound O=CCCCC=O SXRSQZLOMIGNAQ-UHFFFAOYSA-N 0.000 description 1
- 108010024636 Glutathione Proteins 0.000 description 1
- JZNWSCPGTDBMEW-UHFFFAOYSA-N Glycerophosphorylethanolamin Natural products NCCOP(O)(=O)OCC(O)CO JZNWSCPGTDBMEW-UHFFFAOYSA-N 0.000 description 1
- 241000219146 Gossypium Species 0.000 description 1
- 206010069767 H1N1 influenza Diseases 0.000 description 1
- 208000031886 HIV Infections Diseases 0.000 description 1
- 208000037357 HIV infectious disease Diseases 0.000 description 1
- 206010019233 Headaches Diseases 0.000 description 1
- 108010034145 Helminth Proteins Proteins 0.000 description 1
- 241000700721 Hepatitis B virus Species 0.000 description 1
- 208000009889 Herpes Simplex Diseases 0.000 description 1
- 102000005548 Hexokinase Human genes 0.000 description 1
- 108700040460 Hexokinases Proteins 0.000 description 1
- 101000917826 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-a Proteins 0.000 description 1
- 101000917824 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-b Proteins 0.000 description 1
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 1
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 1
- 101000582320 Homo sapiens Neurogenic differentiation factor 6 Proteins 0.000 description 1
- 101001136592 Homo sapiens Prostate stem cell antigen Proteins 0.000 description 1
- 108091006905 Human Serum Albumin Proteins 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 241000701109 Human adenovirus 2 Species 0.000 description 1
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 1
- 206010020751 Hypersensitivity Diseases 0.000 description 1
- 102100026120 IgG receptor FcRn large subunit p51 Human genes 0.000 description 1
- 101710177940 IgG receptor FcRn large subunit p51 Proteins 0.000 description 1
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 1
- 206010022005 Influenza viral infections Diseases 0.000 description 1
- 108020005350 Initiator Codon Proteins 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 102000004877 Insulin Human genes 0.000 description 1
- 241000588748 Klebsiella Species 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- 125000000174 L-prolyl group Chemical group [H]N1C([H])([H])C([H])([H])C([H])([H])[C@@]1([H])C(*)=O 0.000 description 1
- 125000000510 L-tryptophano group Chemical group [H]C1=C([H])C([H])=C2N([H])C([H])=C(C([H])([H])[C@@]([H])(C(O[H])=O)N([H])[*])C2=C1[H] 0.000 description 1
- 241000481961 Lachancea thermotolerans Species 0.000 description 1
- 241000235651 Lachancea waltii Species 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 108091026898 Leader sequence (mRNA) Proteins 0.000 description 1
- 102100029205 Low affinity immunoglobulin gamma Fc region receptor II-b Human genes 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- DDWFXDSYGUXRAY-UHFFFAOYSA-N Luciferin Natural products CCc1c(C)c(CC2NC(=O)C(=C2C=C)C)[nH]c1Cc3[nH]c4C(=C5/NC(CC(=O)O)C(C)C5CC(=O)O)CC(=O)c4c3C DDWFXDSYGUXRAY-UHFFFAOYSA-N 0.000 description 1
- 235000007688 Lycopersicon esculentum Nutrition 0.000 description 1
- 101001133631 Lysinibacillus sphaericus Penicillin acylase Proteins 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- PWHULOQIROXLJO-UHFFFAOYSA-N Manganese Chemical compound [Mn] PWHULOQIROXLJO-UHFFFAOYSA-N 0.000 description 1
- 241001441512 Maytenus serrata Species 0.000 description 1
- 102000003792 Metallothionein Human genes 0.000 description 1
- 108090000157 Metallothionein Proteins 0.000 description 1
- 101100261636 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg) trpB2 gene Proteins 0.000 description 1
- 244000302512 Momordica charantia Species 0.000 description 1
- 235000009811 Momordica charantia Nutrition 0.000 description 1
- 241000204795 Muraena helena Species 0.000 description 1
- 108010014251 Muramidase Proteins 0.000 description 1
- 102000016943 Muramidase Human genes 0.000 description 1
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 1
- 230000004988 N-glycosylation Effects 0.000 description 1
- WTBIAPVQQBCLFP-UHFFFAOYSA-N N.N.N.CC(O)=O.CC(O)=O.CC(O)=O.CC(O)=O.CC(O)=O Chemical compound N.N.N.CC(O)=O.CC(O)=O.CC(O)=O.CC(O)=O.CC(O)=O WTBIAPVQQBCLFP-UHFFFAOYSA-N 0.000 description 1
- 206010028735 Nasal congestion Diseases 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 102100030589 Neurogenic differentiation factor 6 Human genes 0.000 description 1
- 241000221960 Neurospora Species 0.000 description 1
- 241000221961 Neurospora crassa Species 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- 108020004711 Nucleic Acid Probes Proteins 0.000 description 1
- 108091005461 Nucleic proteins Proteins 0.000 description 1
- 108010038807 Oligopeptides Proteins 0.000 description 1
- 102000015636 Oligopeptides Human genes 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- 102000043276 Oncogene Human genes 0.000 description 1
- 108700022034 Opsonin Proteins Proteins 0.000 description 1
- 206010068319 Oropharyngeal pain Diseases 0.000 description 1
- 241000712464 Orthomyxoviridae Species 0.000 description 1
- 240000007594 Oryza sativa Species 0.000 description 1
- 235000007164 Oryza sativa Nutrition 0.000 description 1
- 208000005141 Otitis Diseases 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 241000845082 Panama Species 0.000 description 1
- 102000016387 Pancreatic elastase Human genes 0.000 description 1
- 108010067372 Pancreatic elastase Proteins 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 206010034133 Pathogen resistance Diseases 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 108010073038 Penicillin Amidase Proteins 0.000 description 1
- 101710123388 Penicillin G acylase Proteins 0.000 description 1
- 108010087702 Penicillinase Proteins 0.000 description 1
- 241000228143 Penicillium Species 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 240000007377 Petunia x hybrida Species 0.000 description 1
- 201000007100 Pharyngitis Diseases 0.000 description 1
- 241000286209 Phasianidae Species 0.000 description 1
- 102000001105 Phosphofructokinases Human genes 0.000 description 1
- 108010069341 Phosphofructokinases Proteins 0.000 description 1
- 102000012288 Phosphopyruvate Hydratase Human genes 0.000 description 1
- 108010022181 Phosphopyruvate Hydratase Proteins 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 101100124346 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) hisCD gene Proteins 0.000 description 1
- 101100413173 Phytolacca americana PAP2 gene Proteins 0.000 description 1
- 208000002151 Pleural effusion Diseases 0.000 description 1
- 206010035664 Pneumonia Diseases 0.000 description 1
- 229920000805 Polyaspartic acid Polymers 0.000 description 1
- 241001505332 Polyomavirus sp. Species 0.000 description 1
- 206010036790 Productive cough Diseases 0.000 description 1
- 102100036735 Prostate stem cell antigen Human genes 0.000 description 1
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 1
- 241000588769 Proteus <enterobacteria> Species 0.000 description 1
- 241000589516 Pseudomonas Species 0.000 description 1
- 241000589517 Pseudomonas aeruginosa Species 0.000 description 1
- 206010037660 Pyrexia Diseases 0.000 description 1
- 108010011939 Pyruvate Decarboxylase Proteins 0.000 description 1
- 102000013009 Pyruvate Kinase Human genes 0.000 description 1
- 108020005115 Pyruvate Kinase Proteins 0.000 description 1
- 108020004518 RNA Probes Proteins 0.000 description 1
- 239000003391 RNA probe Substances 0.000 description 1
- 241000700157 Rattus norvegicus Species 0.000 description 1
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 1
- 101710100968 Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 108010003581 Ribulose-bisphosphate carboxylase Proteins 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 230000018199 S phase Effects 0.000 description 1
- 241000235070 Saccharomyces Species 0.000 description 1
- 241000607142 Salmonella Species 0.000 description 1
- 241000293869 Salmonella enterica subsp. enterica serovar Typhimurium Species 0.000 description 1
- 108010084592 Saporins Proteins 0.000 description 1
- 241000311088 Schwanniomyces Species 0.000 description 1
- 241001123650 Schwanniomyces occidentalis Species 0.000 description 1
- 241000607768 Shigella Species 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 206010040742 Sinus congestion Diseases 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 240000003768 Solanum lycopersicum Species 0.000 description 1
- 244000061456 Solanum tuberosum Species 0.000 description 1
- 235000002595 Solanum tuberosum Nutrition 0.000 description 1
- 238000002105 Southern blotting Methods 0.000 description 1
- 241000187747 Streptomyces Species 0.000 description 1
- 108090000787 Subtilisin Proteins 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- 241000255588 Tephritidae Species 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- 108090001109 Thermolysin Proteins 0.000 description 1
- 102000002933 Thioredoxin Human genes 0.000 description 1
- 108091036066 Three prime untranslated region Proteins 0.000 description 1
- 108090000190 Thrombin Proteins 0.000 description 1
- 102000006601 Thymidine Kinase Human genes 0.000 description 1
- 108020004440 Thymidine kinase Proteins 0.000 description 1
- 241001149964 Tolypocladium Species 0.000 description 1
- 239000000317 Topoisomerase II Inhibitor Substances 0.000 description 1
- 101710120037 Toxin CcdB Proteins 0.000 description 1
- 241000223259 Trichoderma Species 0.000 description 1
- 102000005924 Triose-Phosphate Isomerase Human genes 0.000 description 1
- 108700015934 Triose-phosphate isomerases Proteins 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 102000004243 Tubulin Human genes 0.000 description 1
- 108090000704 Tubulin Proteins 0.000 description 1
- 108091023045 Untranslated Region Proteins 0.000 description 1
- 108010046334 Urease Proteins 0.000 description 1
- 244000000188 Vaccinium ovalifolium Species 0.000 description 1
- 240000001866 Vernicia fordii Species 0.000 description 1
- 108020005202 Viral DNA Proteins 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 241000235013 Yarrowia Species 0.000 description 1
- VWQVUPCCIRVNHF-OUBTZVSYSA-N Yttrium-90 Chemical compound [90Y] VWQVUPCCIRVNHF-OUBTZVSYSA-N 0.000 description 1
- 230000001594 aberrant effect Effects 0.000 description 1
- 102000005421 acetyltransferase Human genes 0.000 description 1
- 108020002494 acetyltransferase Proteins 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 230000010933 acylation Effects 0.000 description 1
- 238000005917 acylation reaction Methods 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 230000009824 affinity maturation Effects 0.000 description 1
- 238000001261 affinity purification Methods 0.000 description 1
- 230000004520 agglutination Effects 0.000 description 1
- 125000000217 alkyl group Chemical group 0.000 description 1
- 239000013566 allergen Substances 0.000 description 1
- 230000000172 allergic effect Effects 0.000 description 1
- 108010026331 alpha-Fetoproteins Proteins 0.000 description 1
- 108010001818 alpha-sarcin Proteins 0.000 description 1
- 229940126575 aminoglycoside Drugs 0.000 description 1
- 238000012870 ammonium sulfate precipitation Methods 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 239000003957 anion exchange resin Substances 0.000 description 1
- 150000001450 anions Chemical class 0.000 description 1
- 235000010208 anthocyanin Nutrition 0.000 description 1
- 239000004410 anthocyanin Substances 0.000 description 1
- 229930002877 anthocyanin Natural products 0.000 description 1
- 150000004636 anthocyanins Chemical class 0.000 description 1
- 230000003432 anti-folate effect Effects 0.000 description 1
- 230000002924 anti-infective effect Effects 0.000 description 1
- 230000000340 anti-metabolite Effects 0.000 description 1
- 230000000692 anti-sense effect Effects 0.000 description 1
- 230000005875 antibody response Effects 0.000 description 1
- 238000009175 antibody therapy Methods 0.000 description 1
- 229940127074 antifolate Drugs 0.000 description 1
- 229960005475 antiinfective agent Drugs 0.000 description 1
- 229940100197 antimetabolite Drugs 0.000 description 1
- 239000002256 antimetabolite Substances 0.000 description 1
- 239000004599 antimicrobial Substances 0.000 description 1
- 230000001640 apoptogenic effect Effects 0.000 description 1
- 238000003782 apoptosis assay Methods 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 208000010668 atopic eczema Diseases 0.000 description 1
- JPIYZTWMUGTEHX-UHFFFAOYSA-N auramine O free base Chemical compound C1=CC(N(C)C)=CC=C1C(=N)C1=CC=C(N(C)C)C=C1 JPIYZTWMUGTEHX-UHFFFAOYSA-N 0.000 description 1
- 244000052616 bacterial pathogen Species 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 229960000686 benzalkonium chloride Drugs 0.000 description 1
- 229960001950 benzethonium chloride Drugs 0.000 description 1
- UREZNYTWGJKWBI-UHFFFAOYSA-M benzethonium chloride Chemical compound [Cl-].C1=CC(C(C)(C)CC(C)(C)C)=CC=C1OCCOCC[N+](C)(C)CC1=CC=CC=C1 UREZNYTWGJKWBI-UHFFFAOYSA-M 0.000 description 1
- 235000019445 benzyl alcohol Nutrition 0.000 description 1
- CADWTSSKOVRVJC-UHFFFAOYSA-N benzyl(dimethyl)azanium;chloride Chemical compound [Cl-].C[NH+](C)CC1=CC=CC=C1 CADWTSSKOVRVJC-UHFFFAOYSA-N 0.000 description 1
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 1
- 108010051210 beta-Fructofuranosidase Proteins 0.000 description 1
- 102000005936 beta-Galactosidase Human genes 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QUYVBRFLSA-N beta-maltose Chemical compound OC[C@H]1O[C@H](O[C@H]2[C@H](O)[C@@H](O)[C@H](O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@@H]1O GUBGYTABKSRVRQ-QUYVBRFLSA-N 0.000 description 1
- VEZXCJBBBCKRPI-UHFFFAOYSA-N beta-propiolactone Chemical compound O=C1CCO1 VEZXCJBBBCKRPI-UHFFFAOYSA-N 0.000 description 1
- 238000004166 bioassay Methods 0.000 description 1
- 238000002306 biochemical method Methods 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000008033 biological extinction Effects 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 238000005460 biophysical method Methods 0.000 description 1
- 238000001574 biopsy Methods 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- HUTDDBSSHVOYJR-UHFFFAOYSA-H bis[(2-oxo-1,3,2$l^{5},4$l^{2}-dioxaphosphaplumbetan-2-yl)oxy]lead Chemical compound [Pb+2].[Pb+2].[Pb+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O HUTDDBSSHVOYJR-UHFFFAOYSA-H 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 208000027499 body ache Diseases 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- 108010006025 bovine growth hormone Proteins 0.000 description 1
- 206010006451 bronchitis Diseases 0.000 description 1
- 239000008366 buffered solution Substances 0.000 description 1
- DQXBYHZEEUGOBF-UHFFFAOYSA-N but-3-enoic acid;ethene Chemical compound C=C.OC(=O)CC=C DQXBYHZEEUGOBF-UHFFFAOYSA-N 0.000 description 1
- LRHPLDYGYMQRHN-UHFFFAOYSA-N butyl alcohol Substances CCCCO LRHPLDYGYMQRHN-UHFFFAOYSA-N 0.000 description 1
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 230000021523 carboxylation Effects 0.000 description 1
- 238000006473 carboxylation reaction Methods 0.000 description 1
- 239000003729 cation exchange resin Substances 0.000 description 1
- 238000010366 cell biology technique Methods 0.000 description 1
- 230000006369 cell cycle progression Effects 0.000 description 1
- 230000011712 cell development Effects 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000002032 cellular defenses Effects 0.000 description 1
- 230000007248 cellular mechanism Effects 0.000 description 1
- 230000004700 cellular uptake Effects 0.000 description 1
- 208000019065 cervical carcinoma Diseases 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 229960004630 chlorambucil Drugs 0.000 description 1
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 1
- VJYIFXVZLXQVHO-UHFFFAOYSA-N chlorsulfuron Chemical compound COC1=NC(C)=NC(NC(=O)NS(=O)(=O)C=2C(=CC=CC=2)Cl)=N1 VJYIFXVZLXQVHO-UHFFFAOYSA-N 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 230000010428 chromatin condensation Effects 0.000 description 1
- 238000011098 chromatofocusing Methods 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- 238000011260 co-administration Methods 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 230000001447 compensatory effect Effects 0.000 description 1
- 238000012875 competitive assay Methods 0.000 description 1
- 230000004154 complement system Effects 0.000 description 1
- 239000008139 complexing agent Substances 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 230000001268 conjugating effect Effects 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 239000005289 controlled pore glass Substances 0.000 description 1
- 230000009260 cross reactivity Effects 0.000 description 1
- 230000005574 cross-species transmission Effects 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 125000004122 cyclic group Chemical group 0.000 description 1
- HPXRVTGHNJAIIH-UHFFFAOYSA-N cyclohexanol Chemical compound OC1CCCCC1 HPXRVTGHNJAIIH-UHFFFAOYSA-N 0.000 description 1
- UFULAYFCSOUIOV-UHFFFAOYSA-N cysteamine Chemical compound NCCS UFULAYFCSOUIOV-UHFFFAOYSA-N 0.000 description 1
- 229960003067 cystine Drugs 0.000 description 1
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 1
- 239000002619 cytotoxin Substances 0.000 description 1
- 229960003901 dacarbazine Drugs 0.000 description 1
- 125000001295 dansyl group Chemical group [H]C1=C([H])C(N(C([H])([H])[H])C([H])([H])[H])=C2C([H])=C([H])C([H])=C(C2=C1[H])S(*)(=O)=O 0.000 description 1
- 230000003413 degradative effect Effects 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- YSMODUONRAFBET-UHFFFAOYSA-N delta-DL-hydroxylysine Natural products NCC(O)CCC(N)C(O)=O YSMODUONRAFBET-UHFFFAOYSA-N 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 229930191339 dianthin Natural products 0.000 description 1
- 230000010339 dilation Effects 0.000 description 1
- 238000007865 diluting Methods 0.000 description 1
- 230000003467 diminishing effect Effects 0.000 description 1
- 206010013023 diphtheria Diseases 0.000 description 1
- 235000021186 dishes Nutrition 0.000 description 1
- ZWIBGKZDAWNIFC-UHFFFAOYSA-N disuccinimidyl suberate Chemical compound O=C1CCC(=O)N1OC(=O)CCCCCCC(=O)ON1C(=O)CCC1=O ZWIBGKZDAWNIFC-UHFFFAOYSA-N 0.000 description 1
- 125000002228 disulfide group Chemical group 0.000 description 1
- 150000002019 disulfides Chemical class 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- 238000009510 drug design Methods 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 208000019258 ear infection Diseases 0.000 description 1
- 208000007176 earache Diseases 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 239000012149 elution buffer Substances 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 210000002472 endoplasmic reticulum Anatomy 0.000 description 1
- 108010028531 enomycin Proteins 0.000 description 1
- 238000006911 enzymatic reaction Methods 0.000 description 1
- 229960001904 epirubicin Drugs 0.000 description 1
- YSMODUONRAFBET-UHNVWZDZSA-N erythro-5-hydroxy-L-lysine Chemical compound NC[C@H](O)CC[C@H](N)C(O)=O YSMODUONRAFBET-UHNVWZDZSA-N 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 238000012869 ethanol precipitation Methods 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- 239000005038 ethylene vinyl acetate Substances 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 238000001704 evaporation Methods 0.000 description 1
- 235000013861 fat-free Nutrition 0.000 description 1
- 206010016256 fatigue Diseases 0.000 description 1
- 210000003754 fetus Anatomy 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- XRECTZIEBJDKEO-UHFFFAOYSA-N flucytosine Chemical compound NC1=NC(=O)NC=C1F XRECTZIEBJDKEO-UHFFFAOYSA-N 0.000 description 1
- 229960004413 flucytosine Drugs 0.000 description 1
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 1
- 150000002222 fluorine compounds Chemical class 0.000 description 1
- 239000004052 folic acid antagonist Substances 0.000 description 1
- 238000005194 fractionation Methods 0.000 description 1
- 230000005714 functional activity Effects 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- UIWYJDYFSGRHKR-UHFFFAOYSA-N gadolinium atom Chemical compound [Gd] UIWYJDYFSGRHKR-UHFFFAOYSA-N 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 238000003500 gene array Methods 0.000 description 1
- 108060003196 globin Proteins 0.000 description 1
- 102000018146 globin Human genes 0.000 description 1
- 229940116332 glucose oxidase Drugs 0.000 description 1
- 235000019420 glucose oxidase Nutrition 0.000 description 1
- 125000000291 glutamic acid group Chemical group N[C@@H](CCC(O)=O)C(=O)* 0.000 description 1
- 229960003180 glutathione Drugs 0.000 description 1
- 230000002414 glycolytic effect Effects 0.000 description 1
- 231100000869 headache Toxicity 0.000 description 1
- 108010067006 heat stable toxin (E coli) Proteins 0.000 description 1
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 1
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 1
- 230000002363 herbicidal effect Effects 0.000 description 1
- 239000004009 herbicide Substances 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- 238000013537 high throughput screening Methods 0.000 description 1
- 101150113423 hisD gene Proteins 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 208000033519 human immunodeficiency virus infectious disease Diseases 0.000 description 1
- 238000011577 humanized mouse model Methods 0.000 description 1
- 239000000017 hydrogel Substances 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 1
- 229920001600 hydrophobic polymer Polymers 0.000 description 1
- 125000002349 hydroxyamino group Chemical group [H]ON([H])[*] 0.000 description 1
- 238000012872 hydroxylapatite chromatography Methods 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 239000012642 immune effector Substances 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 230000002998 immunogenetic effect Effects 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 229940121354 immunomodulator Drugs 0.000 description 1
- 238000009169 immunotherapy Methods 0.000 description 1
- 230000002637 immunotoxin Effects 0.000 description 1
- 239000002596 immunotoxin Substances 0.000 description 1
- 229940051026 immunotoxin Drugs 0.000 description 1
- 231100000608 immunotoxin Toxicity 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- APFVFJFRJDLVQX-AHCXROLUSA-N indium-111 Chemical compound [111In] APFVFJFRJDLVQX-AHCXROLUSA-N 0.000 description 1
- 229940055742 indium-111 Drugs 0.000 description 1
- PZOUSPYUWWUPPK-UHFFFAOYSA-N indole Natural products CC1=CC=CC2=C1C=CN2 PZOUSPYUWWUPPK-UHFFFAOYSA-N 0.000 description 1
- RKJUIXBNRJVNHR-UHFFFAOYSA-N indolenine Natural products C1=CC=C2CC=NC2=C1 RKJUIXBNRJVNHR-UHFFFAOYSA-N 0.000 description 1
- 208000027866 inflammatory disease Diseases 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 239000000138 intercalating agent Substances 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 239000007928 intraperitoneal injection Substances 0.000 description 1
- 238000007919 intrasynovial administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 239000001573 invertase Substances 0.000 description 1
- 235000011073 invertase Nutrition 0.000 description 1
- 238000005342 ion exchange Methods 0.000 description 1
- 229910052742 iron Inorganic materials 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- 101150066555 lacZ gene Proteins 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 239000004816 latex Substances 0.000 description 1
- 229920000126 latex Polymers 0.000 description 1
- 229960004338 leuprorelin Drugs 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 230000029226 lipidation Effects 0.000 description 1
- 238000001638 lipofection Methods 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 239000012669 liquid formulation Substances 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 210000005265 lung cell Anatomy 0.000 description 1
- 229940087857 lupron Drugs 0.000 description 1
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 239000004325 lysozyme Substances 0.000 description 1
- 229960000274 lysozyme Drugs 0.000 description 1
- 235000010335 lysozyme Nutrition 0.000 description 1
- 230000002101 lytic effect Effects 0.000 description 1
- 239000006249 magnetic particle Substances 0.000 description 1
- 229910052748 manganese Inorganic materials 0.000 description 1
- 239000011572 manganese Substances 0.000 description 1
- 230000008774 maternal effect Effects 0.000 description 1
- 210000003622 mature neutrocyte Anatomy 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical compound ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 1
- 229960004961 mechlorethamine Drugs 0.000 description 1
- 229960001924 melphalan Drugs 0.000 description 1
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 1
- 210000001806 memory b lymphocyte Anatomy 0.000 description 1
- 229960003151 mercaptamine Drugs 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 229910021645 metal ion Inorganic materials 0.000 description 1
- 150000002739 metals Chemical class 0.000 description 1
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 1
- 239000004292 methyl p-hydroxybenzoate Substances 0.000 description 1
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 1
- 229960002216 methylparaben Drugs 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 239000003226 mitogen Substances 0.000 description 1
- 229960004857 mitomycin Drugs 0.000 description 1
- 108010010621 modeccin Proteins 0.000 description 1
- 239000003607 modifier Substances 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 230000027498 negative regulation of mitosis Effects 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 108010087904 neutravidin Proteins 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 230000008518 non respiratory effect Effects 0.000 description 1
- 239000002687 nonaqueous vehicle Substances 0.000 description 1
- 230000009871 nonspecific binding Effects 0.000 description 1
- 239000000346 nonvolatile oil Substances 0.000 description 1
- 239000002853 nucleic acid probe Substances 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 230000001590 oxidative effect Effects 0.000 description 1
- LXCFILQKKLGQFO-UHFFFAOYSA-N p-hydroxybenzoic acid methyl ester Natural products COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 230000005298 paramagnetic effect Effects 0.000 description 1
- 244000045947 parasite Species 0.000 description 1
- 230000003071 parasitic effect Effects 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 229950009506 penicillinase Drugs 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 125000001151 peptidyl group Chemical group 0.000 description 1
- KHIWWQKSHDUIBK-UHFFFAOYSA-N periodic acid Chemical compound OI(=O)(=O)=O KHIWWQKSHDUIBK-UHFFFAOYSA-N 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 239000000825 pharmaceutical preparation Substances 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 210000003800 pharynx Anatomy 0.000 description 1
- 108010076042 phenomycin Proteins 0.000 description 1
- WTJKGGKOPKCXLL-RRHRGVEJSA-N phosphatidylcholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCC=CCCCCCCCC WTJKGGKOPKCXLL-RRHRGVEJSA-N 0.000 description 1
- 150000008104 phosphatidylethanolamines Chemical class 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 210000002826 placenta Anatomy 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 108010054442 polyalanine Proteins 0.000 description 1
- 108010064470 polyaspartate Proteins 0.000 description 1
- 229920000728 polyester Polymers 0.000 description 1
- 229920002338 polyhydroxyethylmethacrylate Polymers 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 229950008882 polysorbate Drugs 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 239000011148 porous material Substances 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 244000144977 poultry Species 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- XOFYZVNMUHMLCC-ZPOLXVRWSA-N prednisone Chemical compound O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 XOFYZVNMUHMLCC-ZPOLXVRWSA-N 0.000 description 1
- 229960004618 prednisone Drugs 0.000 description 1
- 230000005522 programmed cell death Effects 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 238000012342 propidium iodide staining Methods 0.000 description 1
- 229960000380 propiolactone Drugs 0.000 description 1
- 235000010232 propyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004405 propyl p-hydroxybenzoate Substances 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- 235000019833 protease Nutrition 0.000 description 1
- 235000019419 proteases Nutrition 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 230000002685 pulmonary effect Effects 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 150000003254 radicals Chemical class 0.000 description 1
- 238000007420 radioactive assay Methods 0.000 description 1
- 238000002708 random mutagenesis Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 230000022983 regulation of cell cycle Effects 0.000 description 1
- 230000017610 release of virus from host Effects 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 238000004007 reversed phase HPLC Methods 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 235000009566 rice Nutrition 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 239000006152 selective media Substances 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 1
- 210000000717 sertoli cell Anatomy 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 239000013605 shuttle vector Substances 0.000 description 1
- 125000005629 sialic acid group Chemical group 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- 230000003007 single stranded DNA break Effects 0.000 description 1
- 201000009890 sinusitis Diseases 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- PTLRDCMBXHILCL-UHFFFAOYSA-M sodium arsenite Chemical compound [Na+].[O-][As]=O PTLRDCMBXHILCL-UHFFFAOYSA-M 0.000 description 1
- JJGWLCLUQNFDIS-GTSONSFRSA-M sodium;1-[6-[5-[(3as,4s,6ar)-2-oxo-1,3,3a,4,6,6a-hexahydrothieno[3,4-d]imidazol-4-yl]pentanoylamino]hexanoyloxy]-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].O=C1C(S(=O)(=O)[O-])CC(=O)N1OC(=O)CCCCCNC(=O)CCCC[C@H]1[C@H]2NC(=O)N[C@H]2CS1 JJGWLCLUQNFDIS-GTSONSFRSA-M 0.000 description 1
- 238000001179 sorption measurement Methods 0.000 description 1
- 210000003802 sputum Anatomy 0.000 description 1
- 208000024794 sputum Diseases 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 230000010473 stable expression Effects 0.000 description 1
- SFVFIFLLYFPGHH-UHFFFAOYSA-M stearalkonium chloride Chemical compound [Cl-].CCCCCCCCCCCCCCCCCC[N+](C)(C)CC1=CC=CC=C1 SFVFIFLLYFPGHH-UHFFFAOYSA-M 0.000 description 1
- 238000011146 sterile filtration Methods 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- KZNICNPSHKQLFF-UHFFFAOYSA-N succinimide Chemical class O=C1CCC(=O)N1 KZNICNPSHKQLFF-UHFFFAOYSA-N 0.000 description 1
- JJAHTWIKCUJRDK-UHFFFAOYSA-N succinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate Chemical compound C1CC(CN2C(C=CC2=O)=O)CCC1C(=O)ON1C(=O)CCC1=O JJAHTWIKCUJRDK-UHFFFAOYSA-N 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 150000005846 sugar alcohols Chemical class 0.000 description 1
- 108060007951 sulfatase Proteins 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 238000004114 suspension culture Methods 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 201000010740 swine influenza Diseases 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 229960001603 tamoxifen Drugs 0.000 description 1
- RCINICONZNJXQF-XAZOAEDWSA-N taxol® Chemical compound O([C@@H]1[C@@]2(CC(C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3(C21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-XAZOAEDWSA-N 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 238000011285 therapeutic regimen Methods 0.000 description 1
- 125000003396 thiol group Chemical group [H]S* 0.000 description 1
- CNHYKKNIIGEXAY-UHFFFAOYSA-N thiolan-2-imine Chemical compound N=C1CCCS1 CNHYKKNIIGEXAY-UHFFFAOYSA-N 0.000 description 1
- 108060008226 thioredoxin Proteins 0.000 description 1
- 229940094937 thioredoxin Drugs 0.000 description 1
- 229960004072 thrombin Drugs 0.000 description 1
- 238000012090 tissue culture technique Methods 0.000 description 1
- RUELTTOHQODFPA-UHFFFAOYSA-N toluene 2,6-diisocyanate Chemical compound CC1=C(N=C=O)C=CC=C1N=C=O RUELTTOHQODFPA-UHFFFAOYSA-N 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 230000007888 toxin activity Effects 0.000 description 1
- 210000003437 trachea Anatomy 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- 230000005945 translocation Effects 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 101150081616 trpB gene Proteins 0.000 description 1
- 101150111232 trpB-1 gene Proteins 0.000 description 1
- 210000004881 tumor cell Anatomy 0.000 description 1
- 230000004614 tumor growth Effects 0.000 description 1
- 108010087967 type I signal peptidase Proteins 0.000 description 1
- ORHBXUUXSCNDEV-UHFFFAOYSA-N umbelliferone Chemical compound C1=CC(=O)OC2=CC(O)=CC=C21 ORHBXUUXSCNDEV-UHFFFAOYSA-N 0.000 description 1
- HFTAFOQKODTIJY-UHFFFAOYSA-N umbelliferone Natural products Cc1cc2C=CC(=O)Oc2cc1OCC=CC(C)(C)O HFTAFOQKODTIJY-UHFFFAOYSA-N 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 210000002700 urine Anatomy 0.000 description 1
- NQPDZGIKBAWPEJ-UHFFFAOYSA-N valeric acid Chemical compound CCCCC(O)=O NQPDZGIKBAWPEJ-UHFFFAOYSA-N 0.000 description 1
- GBABOYUKABKIAF-GHYRFKGUSA-N vinorelbine Chemical compound C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC GBABOYUKABKIAF-GHYRFKGUSA-N 0.000 description 1
- 229960002066 vinorelbine Drugs 0.000 description 1
- 230000005727 virus proliferation Effects 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- XLYOFNOQVPJJNP-OUBTZVSYSA-N water-17o Chemical compound [17OH2] XLYOFNOQVPJJNP-OUBTZVSYSA-N 0.000 description 1
- 150000003952 β-lactams Chemical class 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/21—Esters, e.g. nitroglycerine, selenocyanates
- A61K31/215—Esters, e.g. nitroglycerine, selenocyanates of carboxylic acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/16—Amides, e.g. hydroxamic acids
- A61K31/17—Amides, e.g. hydroxamic acids having the group >N—C(O)—N< or >N—C(S)—N<, e.g. urea, thiourea, carmustine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/42—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum viral
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/16—Antivirals for RNA viruses for influenza or rhinoviruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
- C07K16/1018—Orthomyxoviridae, e.g. influenza virus
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/42—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against immunoglobulins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/734—Complement-dependent cytotoxicity [CDC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the present invention relates generally to therapy, diagnosis and monitoring of influenza infection.
- the invention is more specifically related to methods of identifying influenza matrix 2 protein-specific antibodies and their manufacture and use. Such antibodies are useful in pharmaceutical compositions for the prevention and treatment of influenza, and for the diagnosis and monitoring of influenza infection.
- Influenza virus infects 5-20% of the population and results in 30,000-50,000 deaths each year in the U.S.
- the influenza vaccine is the primary method of infection prevention
- four antiviral drugs are also available in the U.S.: amantadine, rimantadine, oseltamivir and zanamivir.
- amantadine rimantadine
- oseltamivir oseltamivir
- zanamivir As of December 2005, only oseltamivir (TAMIFLUTM) is recommended for treatment of influenza A due to the increasing resistance of the virus to amantadine and rimantidine resulting from an amino acid substitution in the M2 protein of the virus.
- the M2 protein is found in a homotetramer that forms an ion channel and is thought to aid in the uncoating of the virus upon entering the cell. After infection, M2 can be found in abundance at the cell surface. It is subsequently incorporated into the virion coat, where it only comprises about 2% of total coat protein.
- the M2 extracellular domain (M2e) is short, with the aminoterminal 2-24 amino acids displayed outside of the cell. Anti-M2 MAbs to date have been directed towards this linear sequence. Thus, they may not exhibit desired binding properties to cellularly expressed M2, including conformational determinants on native M2.
- the present invention provides fully human monoclonal antibodies specifically directed against M2e.
- the fully human monoclonal anti-M2e antibodies of the invention are potent and broadly protective antibodies for the prevention and treatment of influenza infection. Alternatively, or in addition, these antibodies are also neutralizing. For instance, these antibodies are protective against the most highly virulent H1N1 strains.
- the mechanism of action of these antibodies is, for instance, antibody-mediated killing of infected cells using a nanomolar or micromolar potency.
- the fully human monoclonal anti-M2e antibodies of the invention used either alone, or in combination with an anti-viral drug, prevent, inhibit, decrease, or minimize spread of the influenza virus beyond the airway of the infected individual, subject, or patient.
- Administration of an anti-M2e antibody monotherapy or a combinatorial therapy, including an anti-M2e antibody and an anti-viral drug can occur anytime before or after exposure to the influenza virus.
- An exemplary therapeutic window for administration of an anti-M2e antibody monotherapy or a combinatorial therapy, including an anti-M2e antibody and an anti-viral drug is between 1 days post-infection and 30 days post-infection.
- the combinatorial therapy described herein is meant to include a therapeutic regime in which an anti-M2e antibody and an anti-viral drug are provided to the same individual for either the treatment or prevention of influenza infection, however, the antibody and the anti-viral drug are not required to be administered in the same mixture, composition, or pharmaceutical formulation, the antibody and the anti-viral drug are not required to be administered at the same time, the antibody and the anti-viral drug are not required to be administered by the same route, and the antibody and the anti-viral drug are not required to be administered in at the same dosage.
- the antibody is isolated form a B-cell from a human donor.
- exemplary monoclonal antibodies include 8i10 (also known as TCN-032), 21B15, 23K12 (also known as TCN-031), 3241_G23, 3244_I10, 3243_J07, 3259_J21, 3245_O19, 3244_H04, 3136_G05, 3252_C13, 3255_J06, 3420_I23, 3139_P23, 3248_P18, 3253_P10, 3260_D19, 3362_B11, and 3242_P05 described herein.
- the monoclonal antibody is an antibody that binds to the same epitope as 8i10, 21B15 23K12, 3241_G23, 3244_I10, 3243_J07, 3259_J21, 3245_O19, 3244_H04, 3136_G05, 3252_C13, 3255_J06, 3420_I23, 3139_P23, 3248_P18, 3253_P10, 3260_D19, 3362_B11, or 3242_P05.
- the antibodies respectively referred to herein are huM2e antibodies.
- the huM2e antibody has one or more of the following characteristics: a) binds to an epitope in the extracellular domain of the matrix 2 ectodomain (M2e) polypeptide of an influenza virus; b) binds to influenza A infected cells; or c) binds to influenza A virus.
- M2e matrix 2 ectodomain
- the epitope that huM2e antibody binds to is a non-linear epitope of a M2 polypeptide.
- the epitope includes the amino terminal region of the M2e polypeptide. More preferably the epitope wholly or partially includes the amino acid sequence SLLTEV (SEQ ID NO: 42).
- the epitope includes the amino acid at position 2, 5 and 6 of the M2e polypeptide when numbered in accordance with SEQ ID NO: 1.
- the amino acid at position 2 is a serine; at position 5 is a threonine; and at position 6 is a glutamic acid.
- a huM2e antibody contains a heavy chain variable having the amino acid sequence of SEQ ID NOS: 44 or 50 and a light chain variable having the amino acid sequence of SEQ ID NOS: 46 or 52.
- the three heavy chain CDRs include an amino acid sequence at least 90%, 92%, 95%, 97% 98%, 99% or more identical to the amino acid sequence of NYYWS (SEQ ID NO: 72), FIYYGGNTKYNPSLKS (SEQ ID NO: 74), ASCSGGYCILD (SEQ ID NO: 76), SNYMS (SEQ ID NO: 103), VIYSGGSTYYADSVK (SEQ ID NO: 105), CLSRMRGYGLDV (SEQ ID NO: 107) (as determined by the Kabat method) or ASCSGGYCILD (SEQ ID NO: 76), CLSRMRGYGLDV (SEQ ID NO: 107), GSSISN (SEQ ID NO: 109), FIYYGGNTK (SEQ ID NO: 110), G
- VH CDR1 SEQ ID NOs: 179, 187, 196, 204, 212, 224, 230, 235, 242, 248, or 254
- VH CDR2 SEQ ID NOs: 180, 188, 195, 197, 205, 213, 218, 225, 231, 236, 243, 249, 246, or 256
- VH CDR3 SEQ ID NOs: 181, 189, 198, 206, 214, 219, 226, 232, 237, 244, or 250
- VL CDR1 SEQ ID NOs: 184, 192, 199, 215, 220,
- the invention provides an isolated fully human monoclonal anti-matrix 2 ectodomain (M2e) antibody including: a) a heavy chain sequence comprising the amino acid sequence of SEQ ID NO: 44 and a light chain sequence comprising amino acid sequence SEQ ID NO: 46; b) a heavy chain sequence comprising the amino acid sequence of SEQ ID NO: 263 and a light chain sequence comprising amino acid sequence SEQ ID NO: 46; c) a heavy chain sequence comprising the amino acid sequence of SEQ ID NO: 265 and a light chain sequence comprising amino acid sequence SEQ ID NO: 46; d) a heavy chain sequence comprising the amino acid sequence of SEQ ID NO: 50 and a light chain sequence comprising amino acid sequence SEQ ID NO: 52; e) a heavy chain sequence comprising the amino acid sequence of SEQ ID NO: 267 and a light chain sequence comprising amino acid sequence SEQ ID NO: 52; or f) a heavy chain sequence comprising the amino acid sequence of SEQ ID NO: 269 and a
- the heavy chain of an M2e antibody is derived from a germ line V (variable) gene such as, for example, the IgHV4 or the IgHV3 germline gene.
- the M2e antibodies of the invention include a variable heavy chain (V H ) region encoded by a human IgHV4 or the IgHV3 germline gene sequence.
- An IgHV4 germline gene sequence is shown, e.g., in Accession numbers L10088, M29812, M95114, X56360 and M95117.
- An IgHV3 germline gene sequence is shown, e.g., in Accession numbers X92218, X70208, Z27504, M99679 and AB019437.
- the M2e antibodies of the invention include a V H region that is encoded by a nucleic acid sequence that is at least 80% homologous to the IgHV4 or the IgHV3 germline gene sequence.
- the nucleic acid sequence is at least 90%, 95%, 96%, 97% homologous to the IgHV4 or the IgHV3 germline gene sequence, and more preferably, at least 98%, 99% homologous to the IgHV4 or the IgHV3 germline gene sequence.
- the V H region of the M2e antibody is at least 80% homologous to the amino acid sequence of the V H region encoded by the IgHV4 or the IgHV3 V H germline gene sequence.
- the amino acid sequence of V H region of the M2e antibody is at least 90%, 95%, 96%, 97% homologous to the amino acid sequence encoded by the IgHV4 or the IgHV3 germline gene sequence, and more preferably, at least 98%, 99% homologous to the sequence encoded by the IgHV4 or the IgHV3 germline gene sequence.
- the M2e antibodies of the invention also include a variable light chain (V L ) region encoded by a human IgKV1 germline gene sequence.
- V L variable light chain
- a human IgKV1 V L germline gene sequence is shown, e.g., Accession numbers X59315, X59312, X59318, J00248, and Y14865.
- the M2e antibodies include a V L region that is encoded by a nucleic acid sequence that is at least 80% homologous to the IgKV1 germline gene sequence.
- the nucleic acid sequence is at least 90%, 95%, 96%, 97% homologous to the IgKV1 germline gene sequence, and more preferably, at least 98%, 99% homologous to the IgKV1 germline gene sequence.
- the V L region of the M2e antibody is at least 80% homologous to the amino acid sequence of the V L region encoded the IgKV1 germline gene sequence.
- the amino acid sequence of V L region of the M2e antibody is at least 90%, 95%, 96%, 97% homologous to the amino acid sequence encoded by the IgKV1 germline gene sequence, and more preferably, at least 98%, 99% homologous to the sequence encoded by e the IgKV1 germline gene sequence.
- the invention provides a composition including an huM2e antibody according to the invention.
- the composition is optionally a pharmaceutical composition including any one of the M2e antibodies described herein and a pharmaceutical carrier.
- the composition further includes an anti-viral drug, a viral entry inhibitor or a viral attachment inhibitor.
- the anti-viral drug is for example a neuraminidase inhibitor, a HA inhibitor, a sialic acid inhibitor or an M2 ion channel inhibitor.
- the M2 ion channel inhibitor is for example amantadine or rimantadine.
- the neuraminidase inhibitor is for example zanamivir, or oseltamivir phosphate.
- the composition further includes a second anti-influenza A antibody.
- huM2e antibodies according to the invention are operably-linked to a therapeutic agent or a detectable label.
- the invention provides methods for stimulating an immune response, treating, preventing or alleviating a symptom of an influenza viral infection by administering an huM2e antibody to a subject
- the subject is further administered with a second agent such as, but not limited to, an influenza virus antibody, an anti-viral drug such as a neuraminidase inhibitor, a HA inhibitor, a sialic acid inhibitor or an M2 ion channel inhibitor, a viral entry inhibitor or a viral attachment inhibitor.
- a second agent such as, but not limited to, an influenza virus antibody, an anti-viral drug such as a neuraminidase inhibitor, a HA inhibitor, a sialic acid inhibitor or an M2 ion channel inhibitor, a viral entry inhibitor or a viral attachment inhibitor.
- the M2 ion channel inhibitor is for example amantadine or rimantadine.
- the neuraminidase inhibitor for example zanamivir, or oseltamivir phosphate.
- the subject is suffering from or is predisposed to developing an influenza virus infection, such as, for example, an autoimmune disease or an inflammatory disorder.
- the invention provides methods of administering the huM2e antibody of the invention to a subject prior to, and/or after exposure to an influenza virus.
- the huM2e antibody of the invention is used to treat or prevent rejection influenza infection.
- the huM2e antibody is administered at a dose sufficient to promote viral clearance or eliminate influenza A infected cells.
- Also included in the invention is a method for determining the presence of an influenza virus infection in a patient, by contacting a biological sample obtained from the patient with a humM2e antibody; detecting an amount of the antibody that binds to the biological sample; and comparing the amount of antibody that binds to the biological sample to a control value.
- the invention further provides a kit or a diagnostic kit comprising a huM2e antibody.
- the invention provides a preferred composition comprising: (a) an isolated fully human monoclonal anti-M2e antibody composition, wherein the antibody comprises a V H CDR1 region comprising the amino acid sequence of NYYWS (SEQ ID NO: 72); a V H CDR2 region comprising the amino acid sequence of FIYYGGNTKYNPSLKS (SEQ ID NO: 74); a V H CDR3 region comprising the amino acid sequence of ASCSGGYCILD (SEQ ID NO: 76); a V L CDR1 region comprising the amino acid sequence of RASQNIYKYLN (SEQ ID NO: 59); a V L CDR2 region comprising the amino acid sequence of AASGLQS (SEQ ID NO: 61); and a V L CDR3 region comprising the amino acid sequence of QQSYSPPLT (SEQ ID NO: 63); and (b) an oseltamivir composition.
- the invention also provides a preferred composition comprising: (a) an isolated fully human monoclonal anti-M2e antibody composition, wherein the antibody comprises a V H CDR1 region comprising the amino acid sequence of SNYMS (SEQ ID NO: 103); a V H CDR2 region comprising the amino acid sequence of VIYSGGSTYYADSVK (SEQ ID NO: 105); a V H CDR3 region comprising the amino acid sequence of CLSRMRGYGLDV (SEQ ID NO: 107); a V L CDR1 region comprising the amino acid sequence of RTSQSISSYLN (SEQ ID NO: 92); a V L CDR2 region comprising the amino acid sequence of AASSLQSGVPSRF (SEQ ID NO: 94); and a V L CDR3 region comprising the amino acid sequence of QQSYSMPA (SEQ ID NO: 96); and (b) an oseltamivir composition.
- a pharmaceutical composition may comprise the preferred compositions described herein, which include the combination of an isolated fully human monoclonal anti-M2e antibody composition and an oseltamivir composition, and a pharmaceutical carrier.
- the oseltamivir composition is oseltamivir phosphate.
- the oseltamivir composition may also include any prodrug, salt, analog or derivative thereof.
- the oseltamivir composition optionally includes a pharmaceutical carrier.
- compositions described herein which include the combination of an isolated fully human monoclonal anti-M2e antibody composition and an oseltamivir composition, further comprises a second anti-influenza A antibody.
- the second anti-influenza A antibody is an anti-M2e antibody or an anti-HA antibody.
- the anti-HA antibody can be any antibody disclosed in International Application No. WO/2008/028946, the contents of which are incorporated herein by reference in their entirety.
- the invention also provides a preferred method for the treatment or prevention of an influenza virus infection in a subject, comprising administering to the subject one or more of the preferred compositions described herein, which include the combination of an isolated fully human monoclonal anti-M2e antibody composition and an oseltamivir composition, and which optionally include a pharmaceutical carrier.
- the anti-M2e antibody is administered at a dosage of between 10 and 40 mg/kg/day.
- the anti-M2e antibody may be administered once or twice per day (q.d. or bid, respectively), once or twice per week, or once or twice per month.
- the anti-M2e antibody may be systemically administered by, for instance, any parenteral route, the anti-M2e antibody is preferably administered intravenous injection or infusion.
- An exemplary administration regime includes intravenous injection or infusion of the anti-M2e antibody once a week for three weeks.
- the oseltamivir composition is administered at a dosage of between 0.1-100 mg/kg.
- the administration regime is typically a 75 mg capsule provided orally twice per day, however, the methods include administration of between 5-100 mg of oseltamivir per day.
- the oseltamivir composition may also be administered once or twice per day (q.d. or bid, respectively).
- the anti-M2e antibody or the oseltamivir composition may be administered prior to influenza infection.
- the anti-M2e antibody or the oseltamivir composition may be administered after influenza infection.
- the anti-M2e antibody is administered within a preferred therapeutic window.
- the therapeutic window may extend from the time of infection until 4 days or 96 hours after influenza infection.
- the anti-M2e antibody and the oseltamivir composition are administered simultaneously or sequentially.
- the anti-M2e antibody and the oseltamivir composition are administered sequentially, the anti-M2e antibody may be administered before or after the oseltamivir composition.
- the invention further comprises a preferred kit or diagnostic kit comprising the combination of an isolated fully human monoclonal anti-M2e antibody composition and an oseltamivir composition.
- the anti-M2e antibody composition and the oseltamivir composition are provided separately and/or administered separately.
- the anti-M2e antibody composition is provided in a liquid formulation and the oseltamivir composition is provided in a liquid or solid formulation.
- the anti-M2e antibody composition may be administered intravenously.
- the oseltamivir composition may be administered orally.
- the compositions of the kit further include a pharmaceutical carrier.
- the anti-M2e antibody and the oseltamivir composition act synergistically to treat or prevent influenza infection or influenza-mediated death.
- the M2e antibodies of the invention are protective against infection and, furthermore, minimize viral spread beyond the immediate tissues of primary contact with the influenza virus (e.g. the airway of the subject, which includes, but is not limited to, the pulmonary airway, the respiratory system, the respiratory tract, the nose, the mouth, and the alveoli of the lungs. Specifically, as air passes from the nose or mouth through the pharynx into the trachea, where it separates into the left and right main bronchi the influenza virus may contact each one of these tissues or structures.
- the influenza virus e.g. the airway of the subject, which includes, but is not limited to, the pulmonary airway, the respiratory system, the respiratory tract, the nose, the mouth, and the alveoli of the lungs.
- the main bronchi then branch into large bronchioles, one for each lobe of the lung. Within the lobes, the bronchioles further subdivide and terminate in clusters of alveoli.
- the influenza virus may initially contact or infect cells within any one of these tissues or structures, treatment with the anti-M2e antibodies of the invention, either alone or in combination with an oseltamivir composition, will either prevent infection if administered prophylatically, or otherwise, treat the infection and prevent spread of the virus to non-respiratory tissues.
- anti-M2e antibodies of the invention are either protective or neutralizing. In either case, anti-M2e antibodies of the invention either selectively or specifically induce antibody-dependent cell-mediated cytotoxicity (ADCC). ADCC destroys the infected cells, thereby, treating the infection and preventing the spread of the virus.
- ADCC antibody-dependent cell-mediated cytotoxicity
- Oseltamivir is an antiviral drug, and specifically, a neuraminidase inhibitor, which also inhibits the spread of influenza virus between cells by interfering with the ability of neuraminidase to cleave sialic acid groups from glycoproteins on the host cell. This cleavage event is required for viral replication and release of the virus from its host cell.
- the anti-M2e antibodies of the invention and the oseltamivir composition act by separate cellular mechanisms, which are activated in concert in the preferred compositions and methods described herein.
- the combination of an anti-M2e antibody and an oseltamivir composition are administered to a subject, the observed benefit in a lethal infection challenge, for instance, demonstrates synergistic effects.
- the combinatorial therapy may retard, inhibit, or prevent a subject's development of resistance to oseltamivir.
- a primary benefit of this combination therapy is the inhibition or prevention of generation of escape mutant forms of the influenza virus
- the combination of an anti-M2e antibody and an oseltamivir composition provides superior protection than either therapy can produce alone.
- the therapeutic benefit of administration of the combination of an anti-M2e antibody and an oseltamivir composition is superior to the additive benefits of the therapies when applied alone, particularly when the subject is challenged with high-risk stains of influenza or lethal doses.
- FIG. 1 shows the binding of three antibodies of the present invention and control hu14C2 antibody to 293-HEK cells transfected with an M2 expression construct or control vector, in the presence or absence of free M2 peptide.
- FIGS. 2A and B are graphs showing human monoclonal antibody binding to influenza A/Puerto Rico/8/32.
- FIG. 3A is a chart showing amino acid sequences of extracellular domains of M2 variants (SEQ ID NOs 1-3, 272, and 5-40, respectfully).
- FIGS. 3B and C are bar charts showing binding of human monoclonal anti-influenza antibody binding to M2 variants shown in FIG. 3A .
- FIGS. 4A and B are bar charts showing binding of human monoclonal anti-influenza antibody binding to M2 peptides subjected to alanine scanning mutagenesis.
- FIG. 5 is a series of bar charts showing binding of MAbs 8i10 and 23K12 to M2 protein representing influenza strain A/HK/483/1997 sequence that was stably expressed in the CHO cell line DG44.
- FIG. 6A is a chart showing that anti-M2 antibodies do not cross-react or bind to variant M2 peptides (SEQ ID NOs 273-297, respectfully), because they do not include a three-dimensional, non-linear, or conformational epitope.
- FIG. 6B is a chart showing that anti-M2 antibodies do not cross-react or bind to truncated M2 peptides (SEQ ID NOs 273, 298-316, 271, and 1, respectively), because they do not include a three-dimensional, non-linear, or conformational epitope.
- FIG. 7 is a graph showing survival of influenza infected mice treated with human anti-influenza monoclonal antibodies.
- FIG. 8 is an illustration showing the anti-M2 antibodies bind a highly conserved region in the N-Terminus of M2e (SEQ ID NO: 1).
- FIG. 9 is a graph showing anti-M2 rHMAb clones from crude supernatant bound to influenza on ELISA, whereas the control anti-M2e mAb 14C2 did not readily bind virus.
- FIG. 10 is a series of photographs showing anti-M2 rHMAbs bound to cells infected with influenza. MDCK cells were or were not infected with influenza A/PR/8/32 and Ab binding from crude supernatant was tested 24 hours later. Data were gathered from the FMAT plate scanner.
- FIG. 11 is a graph showing anti-M2 rHMAb clones from crude supernatant bound to cells transfected with the influenza subtype H1N1 M2 proteins. Plasmids encoding full length M2 cDNAs corresponding to influenza strainH1N1, as well as a mock plasmid control, were transiently transfected into 293 cells. The 14C2, 8i10, 23K12, and 21B15 mABs were tested for binding to the transfectants, and were detected with an AF647-conjugated anti-human IgG secondary antibody. Shown are the mean fluorescence intensities of the specific mAB bound after FACS analysis.
- FIGS. 12A-B are amino acid sequences of the variable regions of anti-M2e mAbs.
- Framework regions 1-4 FR 1-4
- complementarity determining regions 1-3 CDR 1-3
- FR, CDR, and gene names are defined using the nomenclature in the IMGT database (IMGT®, the International ImMunoGeneTics Information System® http://www.imgt.org).
- Grey boxes denote identity with the germline sequence which is shown in light blue boxes, hyphens denote gaps, and white boxes are amino acid replacement mutations from the germline.
- FIG. 13 is a graph depicting the results of a competition binding analysis of a panel of anti-M2e mAbs with TCN-032 Fab.
- the indicated anti-M2e mAbs were used to bind to the stable CHO transfectant expressing M2 of A/Hong Kong/483/97 that had previously been treated with or without 10 ⁇ g/mL TCN-032 Fab fragment.
- the anti-M2e mAb bound to the cell surface was detected with goat anti-huIgG FcAlexafluor488 FACS and analyzed by flow cytometry. The results are derived from one experiment.
- FIG. 14A is a graph depicting the ability of anti-M2e mAbs TCN-032 and TCN-031 to bind virus particles and virus-infected cells but not M2e-derived synthetic peptide.
- Purified influenza virus A/Puerto Rico/8/34
- FIG. 14B is a graph depicting the ability of anti-M2e mAbs TCN-032 and TCN-031 to bind virus particles and virus-infected cells but not M2e-derived synthetic peptide.
- 23mer synthetic peptide of M2 derived from A/Fort Worth/1/50 was coated at 1 ⁇ g/ml on ELISA wells and binding of mAbs TCN-031, TCN-032, ch14C2, and 2N9 were evaluated as in panel a. Results shown are representative of 3 experiments.
- FIG. 14C is a graph depicting the ability of anti-M2e mAbs TCN-032 and TCN-031 to bind virus particles and virus-infected cells but not M2e-derived synthetic peptide.
- MDCK cells were infected with A/Puerto Rico/8/34 (PR8) and subsequently stained with mAbs TCN-031, TCN-032, ch14C2 and the HCMV mAb 5J12. Binding of antibodies was detected using Alexafluor 647-conjugated goat anti-Human IgG H&L antibody and quantified by flow cytometry. Results shown are representative of 3 experiments.
- FIG. 14D is a series of photographs depicting HEK 293 cells stably transfected with the M2 ectodomain of A/Fort Worth/1/50 (D20) were stained with transient transfection supernatant containing mAbs TCN-031, TCN-032, or the control ch14C2 and analyzed by FMAT for binding to M2 in the presence or absence of 5 ⁇ g/ml M2e peptide.
- Mock transfected cells are 293 cells stably transfected with vector alone. Results shown are representative of one experiment.
- FIGS. 15A-D are graphs depicting the Therapeutic efficacy of anti-M2 mAbs TCN-031 and TCN-032 in mice.
- the results shown for the treatment study of mice infected with A/Vietnam/1203/04 (H5N1) are representative of 2 experiments.
- FIG. 16 is a series of graphs depicting the viral titers in lung, liver, and brain of mice treated with anti-M2e mAbs TCN-031 and TCN-032 after challenge with H5N1 A/Vietnam/1203/04.
- Tissue viral titers were determined from 3 mice per group at 3 and 6 days post-infection in the lungs (as an indicator of local replication) and in liver and brain (as an indicator of the systemic spread which is characteristic of H5N1 infection).
- FIG. 17 is a graph depicting the ability of TCN-031 and TCN-032 can potentiate cytolysis by NK cells.
- MDCK cells were infected with A/Solomon Island/3/2006 (H1N1) virus, and were treated with mAbs TCN-031, TCN-032, or the subclass-matched negative control mAb 2N9. The cells were then challenged with purified human NK cells, and the lactate dehydrogenase released as a result of cell lysis was measured through light absorbance. The results are representative of two separate experiments with two different normal human donors.
- FIG. 18 is a graph depicting complement-dependent cytolysis (CDC) of M2-expressing cells bound with anti-M2 mAb.
- CDC complement-dependent cytolysis
- FIGS. 19A-C are graphs depicting binding of anti-M2e mAbs TCN-031 and TCN-032 to M2 mutants indicates the epitope is located in the highly conserved N-terminal of M2e.
- Mutants with alanine substituted at each position of the M2 ectodomain of A/Fort Worth/1/50 (D20)(A) or forty wild-type M2 mutants including A/Vietnam/1203/04 (VN) and A/Hong Kong/483/97 (HK) (B) were transiently transfected into 293 cells. The identity of each wild-type M2 mutant is listed in Table 6.
- Transfected cells were stained with mAbs TCN-031, TCN-032, or the control ch14C2 and analyzed by FACS for binding to M2 at 24 hours post-transfection.
- mAbs TCN-031 and TCN-032 do not bind variants with amino acid substitutions at positions 1, 4, or 5 of M2e.
- C The deduced epitope for TCN-031 and TCN-032 occurs in a highly conserved region of M2e and is distinct from that found for ch14C2. Results shown for (A) and (B) are representative of 3 experiments.
- FIG. 21 is a graph depicting anti-M2e mAbs TCN-031 and TCN-032 bind cells that have been infected with H1N1 A/California/4/09.
- MDCK cells were infected with Influenza A strain H1N1 A/Memphis/14/96, H1N1 A/California/4/09, or mock infected.
- Twenty four hours post-infection cells were stained with mAbs TCN-031, TCN-032, or the control ch14C2 and analyzed by FACS for binding to M2. Results shown are for one experiment.
- FIG. 22 is a graph depicting the percent survival versus days post-infection for mouse populations challenged with 5 fold LD 50 (5LD 50 ) dosage of H5N1 (A/VN/1203/04) influenza A virus and subsequently treated with either PBS (administration control), antibody isotype control, isotype control/oseltamivir, oseltamivir, TCN-032 antibody, or the TCN-032/oseltamivir combination.
- Statistically significant differences in percent survival are demonstrated between the following: TCN-032 vs. isotype control (p ⁇ 0.027), TCN-032/oseltamivir vs. isotype control/oseltamivir (p ⁇ 0.012), TCN-032 vs. untreated (p ⁇ 0.031), TCN-032/oseltamivir vs. untreated (p ⁇ 0.0001), and oseltamivir vs. untreated (p ⁇ 0.0001).
- FIG. 23 is a graph depicting the percent (%) weight change versus days post-infection for mouse populations challenged with 5 fold LD 50 (5LD 50 ) dosage of H5N1 (A/VN/1203/04) influenza A virus and subsequently treated with either PBS (administration control), antibody isotype control, isotype control/oseltamivir, oseltamivir, TCN-032 antibody, or the TCN-032/oseltamivir combination. Moreover, an unchallenged and untreated mouse population is used as a positive control. The TCN-032/oseltamivir combination provides a therapeutic benefit that is comparable to the unchallenged and untreated positive control.
- FIG. 24 is a graph depicting the percent survival versus days post-infection for mouse populations challenged with 10 fold LD 50 (10 LD 50 ) dosage of H5N1 (A/VN/1203/04) influenza A virus and subsequently treated with either PBS (administration control), antibody isotype control, isotype control/oseltamivir, oseltamivir, TCN-032 antibody, or the TCN-032/oseltamivir combination.
- PBS administration control
- isotype control/oseltamivir isotype control/oseltamivir
- oseltamivir oseltamivir
- TCN-032 antibody or the TCN-032/oseltamivir combination.
- TCN-032/oseltamivir combination Statistically significant differences in percent survival are demonstrated between the following: TCN-032 vs. isotype control (p ⁇ 0.001), TCN-032/oseltamivir vs.
- TCN-032/oseltamivir vs. untreated p ⁇ 0.0003
- the combinatorial treatment is distinguishable from either the TCN-032 or the oseltamivir treatments alone as providing a potential synergistic effect.
- FIG. 25 is a graph depicting the percent (%) weight change versus days post-infection for mouse populations challenged with 10 fold LD 50 (10 LD 50 ) dosage of H5N1 (A/VN/1203/04) influenza A virus and subsequently treated with either PBS (administration control), antibody isotype control, isotype control/oseltamivir, oseltamivir, TCN-032 antibody, or the TCN-032/oseltamivir combination. Moreover, an unchallenged and untreated mouse population is used as a positive control.
- TCN-032/oseltamivir combination provide a therapeutic benefit that is comparable to the unchallenged and untreated control, but the combinatorial treatment is distinguishable from either the TCN-032 or the oseltamivir treatments alone as providing a potential synergistic effect.
- FIG. 26 is a graph depicting the percent survival versus days post-infection for mouse populations challenged with 20 fold LD 50 (20 LD 50 ) dosage of H5N1 (A/VN/1203/04) influenza A virus and subsequently treated with either PBS (administration control), antibody isotype control, isotype control/oseltamivir, oseltamivir, TCN-032 antibody, or the TCN-032/oseltamivir combination.
- PBS administration control
- isotype control/oseltamivir isotype control/oseltamivir
- oseltamivir oseltamivir
- TCN-032 antibody or the TCN-032/oseltamivir combination.
- TCN-032/oseltamivir vs. oseltamivir isotype control/oseltamivir (p ⁇ 0.012), and TCN-032/oseltamivir vs. oseltamivir (p ⁇ 0.029).
- the combinatorial treatment is distinguishable from either the TCN-032 or the oseltamivir treatments alone as providing a potential synergistic effect.
- FIG. 27 is a graph depicting the percent (%) weight change versus days post-infection for mouse populations challenged with 20 fold LD 50 (20 LD 50 ) dosage of H5N1 (A/VN/1203/04) influenza A virus and subsequently treated with either PBS (administration control), antibody isotype control, isotype control/oseltamivir, oseltamivir, TCN-032 antibody, or the TCN-032/oseltamivir combination. Moreover, an unchallenged and untreated mouse population is used as a control. The TCN-032/oseltamivir combination provides a therapeutic benefit that is comparable to the unchallenged and untreated control.
- FIG. 28 is a schematic depiction of the experiment performed in Examples 14, 15, 18 and 19.
- FIG. 29 is a graph depicting the percent survival versus days post-infection for mouse populations challenged with 5 fold LD 50 (5 LD 50 ) dosage of H5N1 (VN1203) influenza A virus and subsequently treated with an antibody isotype negative control (2N9), a positive-control antibody (14C2), the anti-M2e antibody (TCN-032, a/k/a 8I10), or the anti-M2e antibody (TCN-031, a/k/a 23k12).
- a population of mice was also challenged but untreated to serve as another control (UT/C) group.
- FIG. 30 is a graph depicting the percent survival versus days post-infection for mouse populations challenged with 5 fold LD 50 (5 LD 50 ) dosage of H5N1 (VN1203) influenza A virus and subsequently treated with either the anti-M2e antibody (TCN-032, a/k/a 8I10) or the anti-M2e antibody (TCN-031, a/k/a 23k12), or either oseltamivir beginning at four hours post-infection and continuing for five days or oseltamivir beginning at 1 day post-infection and continuing for five days.
- TCN-032, a/k/a 8I10 the anti-M2e antibody
- TCN-031, a/k/a 23k12 anti-M2e antibody
- FIG. 31 is a graph depicting the percent survival versus days post-infection for mouse populations challenged with 5 fold LD 50 (5 LD 50 ) dosage of H5N1 (VN1203) influenza A virus and subsequently treated with the anti-M2e antibody (TCN-032, a/k/a 8I10), the anti-M2e antibody (TCN-031, a/k/a 23k12), a positive control antibody (TCN-040, a/k/a 14C2), an isotype negative control antibody (2N9), a PBS placebo (administration control), oseltamivir (a/k/a TamifluTM) beginning at four hours post-infection and continuing for five days, or oseltamivir beginning at 1 day post-infection and continuing for five days.
- 5 LD 50 5 fold LD 50 dosage of H5N1 (VN1203) influenza A virus and subsequently treated with the anti-M2e antibody (TCN-032, a/k/a 8I10), the anti-M
- mice were also challenged but untreated to serve as another control (UT/C) group.
- a second population of control mice was neither challenged nor treated (untreated/unchallenged), and, therefore, represent healthy mice.
- the results show that mice are protected from lethal avian H5N1 flu infection (5M LD 50 VN1203/04) after treatment with anti-M2e antibodies (including TCN-031 and TCN-032).
- FIG. 32 is a graph depicting the percent survival versus days post-infection for mouse populations challenged with 5 fold LD 50 (5 LD 50 ) dosage of H5N1 (VN1203) influenza A virus and subsequently treated with the anti-M2e antibody (TCN-032, a/k/a 8I10), the anti-M2e antibody (TCN-031, a/k/a 23k12), oseltamivir (a/k/a TamifluTM) beginning at four hours post-infection and continuing for five days, or oseltamivir beginning at 1 day post-infection and continuing for five days.
- TN-032, a/k/a 8I10 the anti-M2e antibody
- TCN-031, a/k/a 23k12 the anti-M2e antibody
- oseltamivir a/k/a TamifluTM
- FIG. 33 is a schematic depiction of the experiment performed in Example 16.
- FIG. 34 is a graph depicting the percent survival versus days post-infection for mouse populations challenged with 10 fold LD 50 (10 LD 50 ) dosage of H1N1 (A/Solomon Islands/06) influenza A virus and subsequently treated on days 1 and 3, post-infection, with the anti-M2e antibody (TCN-032, a/k/a 8I10), the anti-M2e antibody (TCN-031, a/k/a 23k12), a positive control antibody (TCN-040, a/k/a 14C2), an isotype negative control antibody (2N9), a PBS placebo (administration control), or oseltamivir (a/k/a TamifluTM).
- Statistically significant differences in percent survival are demonstrated between the following: oseltamivir vs. PBS (p ⁇ 0.0001).
- FIG. 35 is a graph depicting the percent survival versus days post-infection for mouse populations challenged with 10 fold LD 50 (10 LD 50 ) dosage of H1N1 (A/Solomon Islands/06) influenza A virus and subsequently treated on days 3 and 5, post-infection, with the anti-M2e antibody (TCN-032, a/k/a 8I10), the anti-M2e antibody (TCN-031, a/k/a 23k12), a positive control antibody (TCN-040, a/k/a 14C2), an isotype negative control antibody (2N9), a PBS placebo (administration control), or oseltamivir (a/k/a TamifluTM).
- Statistically significant differences in percent survival are demonstrated between the following: oseltamivir vs. PBS (p ⁇ 0.034).
- FIG. 36 is a schematic depiction of the experiment performed in Example 17.
- FIG. 37 is a graph depicting the percent survival versus days post-infection for mouse populations challenged with 4 fold LD 50 (4 LD 50 ) dosage of H1N1 (A/NMS/33) influenza A virus and subsequently treated with the anti-M2e antibody (TCN-032, a/k/a 8I10), the anti-M2e antibody (TCN-031, a/k/a 23k12), a positive control antibody (TCN-040, a/k/a 14C2), an isotype negative control antibody (2N9), a PBS placebo (administration control), or oseltamivir (a/k/a TamifluTM).
- TCN-032 vs. isotype negative control p ⁇ 0.021
- TCN-040 vs. isotype negative control p ⁇ 0.002
- oseltamivir vs. PBS p ⁇ 0.0004.
- FIG. 38 is a graph depicting the percent survival versus days post-infection for mouse populations challenged with 2 fold LD 50 (2 LD 50 ) dosage of H1N1 (A/NMS/33) influenza A virus and subsequently treated with the anti-M2e antibody (TCN-032, a/k/a 8I10), the anti-M2e antibody (TCN-031, a/k/a 23k12), a positive control antibody (TCN-040, a/k/a 14C2), an isotype negative control antibody (2N9), a PBS placebo (administration control), or oseltamivir (a/k/a TamifluTM).
- TCN-040 vs. isotype negative control (p ⁇ 0.002)
- oseltamivir vs. PBS p ⁇ 0.0005).
- FIG. 39 is a graph depicting the percent survival versus days post-infection for mouse populations challenged with 5 fold LD 50 (5 LD 50 ) dosage of H1N1 (A/PR/8/34) influenza A virus and subsequently treated with the anti-M2e antibody (TCN-032, a/k/a 8I10), the anti-M2e antibody (TCN-031, a/k/a 23k12), a positive control antibody (TCN-040, a/k/a 14C2), an isotype negative control antibody (2N9), a PBS placebo (administration control), or oseltamivir (a/k/a TamifluTM) beginning four hours post-infection.
- TCN-032, a/k/a 8I10 the anti-M2e antibody
- TCN-031, a/k/a 23k12 a positive control antibody
- TN-040, a/k/a 14C2 a positive control antibody
- 2N9 isotype negative control antibody
- PBS placebo administration control
- TCN-031 vs. isotype negative control p ⁇ 0.049
- TCN-032 vs. isotype negative control p ⁇ 0.019
- oseltamivir +4 hr vs. PBS p ⁇ 0.002
- FIG. 40 is a graph depicting the percent survival versus days post-infection for mouse populations challenged with 2.5 fold LD 50 (2.5 LD 50 ) dosage of H1N1 (WSLH34939) influenza A virus and subsequently treated with the anti-M2e antibody (TCN-032, a/k/a 8I10), the anti-M2e antibody (TCN-031, a/k/a 23k12), a positive control antibody (TCN-040, a/k/a 14C2), an isotype negative control antibody (2N9), or a PBS placebo (administration control).
- FIG. 41 is a schematic depiction of the experiment performed in Example 20.
- FIG. 42 is a graph depicting the percent survival versus days post-infection for mouse populations challenged with 5 fold LD 50 (5 LD 50 ) dosage of H5N1 (VN1203) influenza A virus and subsequently treated with 20 mg/kg of the anti-M2e antibody (TCN-032, a/k/a 8I10), 20 mg/kg of the anti-M2e antibody (TCN-031, a/k/a 23k12), a positive control antibody (TCN-040, a/k/a 14C2), an isotype negative control antibody (2N9), a PBS placebo (administration control), oseltamivir (a/k/a TamifluTM) provided once per day (qd), or oseltamivir provided twice per day (bid).
- 5 LD 50 5 fold LD 50 dosage of H5N1 (VN1203) influenza A virus and subsequently treated with 20 mg/kg of the anti-M2e antibody (TCN-032, a/k/a 8I10), 20 mg
- FIG. 43 is a graph depicting the percent survival versus days post-infection for mouse populations challenged with 5 fold LD 50 (5 LD 50 ) dosage of H5N1 (VN1203) influenza A virus and subsequently treated with 40 mg/kg of the anti-M2e antibody (TCN-032, a/k/a 8I10), 40 mg/kg of the anti-M2e antibody (TCN-031, a/k/a 23k12), a positive control antibody (TCN-040, a/k/a 14C2), an isotype negative control antibody (2N9), a PBS placebo (administration control), oseltamivir (a/k/a TamifluTM) provided once per day (qd), or oseltamivir provided twice per day (bid).
- 5 LD 50 5 fold LD 50 dosage of H5N1 (VN1203) influenza A virus and subsequently treated with 40 mg/kg of the anti-M2e antibody (TCN-032, a/k/a 8I10), 40 mg
- TCN-032 vs isotype negative control (p ⁇ 0.004), oseltamivir qd vs. PBS (p ⁇ 0.006), and oseltamivir bid vs. PBS (p ⁇ 0.0001).
- FIG. 44A-F is a series of representative photographs depicting the immunohistological staining of tissue harvested from mice included in the experiment conducted in Example 20.
- Panels A-C show the lung (A), liver (B), and brain (C) tissue of virus-challenged mice which were treated with TCN-031.
- Panels D-F show the lung (D), liver (E), and brain (F) tissue of virus-challenged mice from the control groups (i.e. those receiving the PBS placebo).
- FIG. 45 is a series of graphs depicting the log of the plaque-forming units (p.f.u.) of the influenza virus per gram (pfu/g) of tissue a function of the type of therapy or control administered to each mouse population described in Example 20.
- the results show that treatment with anti-M2e antibody therapy (either TCN-031 or TCN-032) limit viral spread from the airway, as evidenced by the decreased viral titre in the liver and brain compared to the lungs.
- FIG. 46 is a schematic depiction of the experiment performed in Example 21.
- FIG. 47 is a graph depicting the percent survival versus days post-infection for mouse populations challenged with 5 fold LD 50 (5 LD 50 ) dosage of H5N1 (VN1203/04) influenza A virus and subsequently treated on days 1, 3, and 5, with 40 mg/kg of the anti-M2e antibody (TCN-032, a/k/a 8I10), 40 mg/kg of the anti-M2e antibody (TCN-031, a/k/a 23k12), a positive control antibody (TCN-040, a/k/a 14C2), an isotype negative control antibody (2N9), a PBS placebo (administration control), oseltamivir (a/k/a TamifluTM) provided once per day (qd), or oseltamivir provided twice per day (bid).
- TCN-032, a/k/a 8I10 40 mg/kg of the anti-M2e antibody
- TCN-031, a/k/a 23k12 a positive control antibody
- mice A population of mice was challenged and untreated as a negative control group. In contrast, another population of mice was unchallenged and untreated as a control group, and, therefore, these mice represent healthy individuals.
- Statistically significant differences in percent survival are demonstrated between the following: TCN-031 vs. isotype negative control (p ⁇ 0.0008), TCN-032 vs. isotype negative control (p ⁇ 0.004), TCN-031 vs. untreated/challenged (p ⁇ 0.0007), and TCN-032 vs. untreated/challenged (p ⁇ 0.003).
- mice are protected from lethal avian H5N1 flu infection (5 MLD50 VN1203/04) after 800 ⁇ g (40 mg/kg) day 1, 3, and 5 treatment with anti-M2e monoclonal antibodies (including TCN-031 and TCN-032).
- FIG. 48 is a graph depicting the percent survival versus days post-infection for mouse populations challenged with 5 fold LD 50 (5 LD 50 ) dosage of H5N1 (VN1203/04) influenza A virus and subsequently treated on days 2, 4, and 6, with 40 mg/kg of the anti-M2e antibody (TCN-032, a/k/a 8I10), 40 mg/kg of the anti-M2e antibody (TCN-031, a/k/a 23k12), a positive control antibody (TCN-040, a/k/a 14C2), an isotype negative control antibody (2N9), a PBS placebo (administration control), oseltamivir (a/k/a TamifluTM) provided once per day (qd), or oseltamivir provided twice per day (bid).
- TCN-032, a/k/a 8I10 40 mg/kg of the anti-M2e antibody
- TCN-031, a/k/a 23k12 a positive control antibody
- mice A population of mice was challenged and untreated as a negative control group. In contrast, another population of mice was unchallenged and untreated as a control group, and, therefore, these mice represent healthy individuals.
- Statistically significant differences in percent survival are demonstrated between the following: TCN-031 vs. isotype negative control (p ⁇ 0.001), TCN-032 vs. isotype negative control (p ⁇ 0.009), TCN-031 vs. untreated/challenged (p ⁇ 0.0005), and TCN-032 vs. untreated/challenged (p ⁇ 0.003).
- mice are protected from lethal avian H5N1 flu infection (5 MLD50 VN1203/04) after 800 ⁇ g (40 mg/kg) day 2, 4, and 6 treatment with anti-M2e monoclonal antibodies (including TCN-031 and TCN-032).
- FIG. 49 is a graph depicting the percent survival versus days post-infection for mouse populations challenged with 5 fold LD 50 (5 LD 50 ) dosage of H5N1 (VN1203/04) influenza A virus and subsequently treated on days 3, 5, and 7, with 40 mg/kg of the anti-M2e antibody (TCN-032, a/k/a 8I10), 40 mg/kg of the anti-M2e antibody (TCN-031, a/k/a 23k12), a positive control antibody (TCN-040, a/k/a 14C2), an isotype negative control antibody (2N9), a PBS placebo (administration control), oseltamivir (a/k/a TamifluTM) provided once per day (qd), or oseltamivir provided twice per day (bid).
- TCN-032, a/k/a 8I10 40 mg/kg of the anti-M2e antibody
- TCN-031, a/k/a 23k12 a positive control antibody
- mice A population of mice was challenged and untreated as a negative control group. In contrast, another population of mice was unchallenged and untreated as a control group, and, therefore, these mice represent healthy individuals.
- Statistically significant differences in percent survival are demonstrated between the following: TCN-031 vs. isotype negative control (p ⁇ 0.039), TCN-031 vs. untreated/challenged (p ⁇ 0.0002), TCN-032 vs. untreated/challenged (p ⁇ 0.023), and TCN-040 vs. untreated/challenged (p ⁇ 0.010).
- mice are protected from lethal avian H5N1 flu infection (5 MLD50 VN1203/04) after 800 ⁇ g (40 mg/kg) day 3, 5, and 7 treatment with anti-M2e monoclonal antibodies (including TCN-031 and TCN-032).
- FIG. 50 is a graph depicting the percent survival versus days post-infection for mouse populations challenged with 5 fold LD 50 (5 LD 50 ) dosage of H5N1 (VN1203/04) influenza A virus and subsequently treated on days 4, 6, and 8, with 40 mg/kg of the anti-M2e antibody (TCN-032, a/k/a 8I10), 40 mg/kg of the anti-M2e antibody (TCN-031, a/k/a 23k12), a positive control antibody (TCN-040, a/k/a 14C2), an isotype negative control antibody (2N9), a PBS placebo (administration control), oseltamivir (a/k/a TamifluTM) provided once per day (qd), or oseltamivir provided twice per day (bid).
- TCN-032, a/k/a 8I10 40 mg/kg of the anti-M2e antibody
- TCN-031, a/k/a 23k12 a positive control antibody
- mice A population of mice was challenged and untreated as a negative control group. In contrast, another population of mice was unchallenged and untreated as a control group, and, therefore, these mice represent healthy individuals.
- Statistically significant differences in percent survival are demonstrated between the following: TCN-031 vs. isotype negative control (p ⁇ 0.046), TCN-031 vs. untreated/challenged (p ⁇ 0.0009), TCN-032 vs. untreated/challenged (p ⁇ 0.002), and TCN-040 vs. untreated/challenged (p ⁇ 0.003).
- mice are protected from lethal avian H5N1 flu infection (5 MLD50 VN1203/04) after 800 ⁇ g (40 mg/kg) day 4, 6, and 8 treatment with anti-M2e monoclonal antibodies (including TCN-031 and TCN-032).
- FIG. 51 is a graph depicting the percent weight remained versus days post-infection for mouse populations challenged with 5 fold LD 50 (5 LD 50 ) dosage of H5N1 (VN1203/04) influenza A virus and subsequently treated on days 1, 3, and 5, with 40 mg/kg of the anti-M2e antibody (TCN-032, a/k/a 8I10), 40 mg/kg of the anti-M2e antibody (TCN-031, a/k/a 23k12), a positive control antibody (TCN-040, a/k/a 14C2), an isotype negative control antibody (2N9), a PBS placebo (administration control), oseltamivir (a/k/a TamifluTM) provided once per day (qd), or oseltamivir provided twice per day (bid).
- a population of mice was challenged and untreated as a negative control group. In contrast, another population of mice was unchallenged and untreated as a control group, and, therefore, these mice represent healthy individuals.
- FIG. 52 is a graph depicting the percent weight remained versus days post-infection for mouse populations challenged with 5 fold LD 50 (5 LD 50 ) dosage of H5N1 (VN1203/04) influenza A virus and subsequently treated on days 2, 4, and 6, with 40 mg/kg of the anti-M2e antibody (TCN-032, a/k/a 8I10), 40 mg/kg of the anti-M2e antibody (TCN-031, a/k/a 23k12), a positive control antibody (TCN-040, a/k/a 14C2), an isotype negative control antibody (2N9), a PBS placebo (administration control), oseltamivir (a/k/a TamifluTM) provided once per day (qd), or oseltamivir provided twice per day (bid).
- a population of mice was challenged and untreated as a negative control group. In contrast, another population of mice was unchallenged and untreated as a control group, and, therefore, these mice represent healthy individuals.
- FIG. 53 is a graph depicting the percent weight remained versus days post-infection for mouse populations challenged with 5 fold LD 50 (5 LD 50 ) dosage of H5N1 (VN1203/04) influenza A virus and subsequently treated on days 3, 5, and 7, with 40 mg/kg of the anti-M2e antibody (TCN-032, a/k/a 8I10), 40 mg/kg of the anti-M2e antibody (TCN-031, a/k/a 23k12), a positive control antibody (TCN-040, a/k/a 14C2), an isotype negative control antibody (2N9), a PBS placebo (administration control), oseltamivir (a/k/a TamifluTM) provided once per day (qd), or oseltamivir provided twice per day (bid).
- a population of mice was challenged and untreated as a negative control group. In contrast, another population of mice was unchallenged and untreated as a control group, and, therefore, these mice represent healthy individuals.
- FIG. 54 is a graph depicting the percent weight remained versus days post-infection for mouse populations challenged with 5 fold LD 50 (5 LD 50 ) dosage of H5N1 (VN1203/04) influenza A virus and subsequently treated on days 4, 6, and 8, with 40 mg/kg of the anti-M2e antibody (TCN-032, a/k/a 8I10), 40 mg/kg of the anti-M2e antibody (TCN-031, a/k/a 23k12), a positive control antibody (TCN-040, a/k/a 14C2), an isotype negative control antibody (2N9), a PBS placebo (administration control), oseltamivir (a/k/a TamifluTM) provided once per day (qd), or oseltamivir provided twice per day (bid).
- a population of mice was challenged and untreated as a negative control group. In contrast, another population of mice was unchallenged and untreated as a control group, and, therefore, these mice represent healthy individuals.
- FIG. 55 is a schematic depiction of the experiment performed in Example 22.
- FIG. 56 is a graph depicting the percent survival versus days post-infection for mouse populations challenged with 5 fold LD 50 (5 LD 50 ) dosage of H5N1 (ANN/1203/04) influenza A virus and subsequently treated on days 1, 3, and 5, with 20 mg/kg of either the anti-M2e antibody (TCN-032, a/k/a 8I10) or an isotype negative control antibody (2N9), a PBS placebo (administration control), oseltamivir (a/k/a TamifluTM) provided twice per day (bid) at 10 mg/kg, a combination of TCN-032/oseltamivir, or a combination of isotype-control/oseltamivir.
- TCN-032/oseltamivir a combination of isotype-control/oseltamivir.
- mice A population of mice was challenged and untreated as another negative control group (PBS administration control). Statistically significant differences in percent survival are demonstrated between the following: TCN-032 vs. isotype negative control (p ⁇ 0.027), TCN-032/oseltamivir vs. isotype-control/oseltamivir (p ⁇ 0.012), TCN-032 vs. untreated/challenged (p ⁇ 0.031), TCN-032/oseltamivir vs. untreated/challenged (p ⁇ 0.0001), and oseltamivir vs. untreated/challenged (p ⁇ 0.0001).
- FIG. 57 is a graph depicting the percent weight change versus days post-infection for mouse populations challenged with 5 fold LD 50 (5 LD 50 ) dosage of H5N1 (A/VN/1203/04) influenza A virus and subsequently treated on days 1, 3, and 5, with 20 mg/kg of either the anti-M2e antibody (TCN-032, a/k/a 8I10) or an isotype negative control antibody (2N9), a PBS placebo (administration control), oseltamivir (a/k/a TamifluTM) provided twice per day (bid) at 10 mg/kg, a combination of TCN-032/oseltamivir, or a combination of isotype-control/oseltamivir.
- a population of mice was challenged and untreated as another negative control group (PBS administration control). Additionally, a population of mice was unchallenged and untreated as a control group.
- FIG. 58 is a graph depicting the percent survival versus days post-infection for mouse populations challenged with 10 fold LD 50 (10 LD 50 ) dosage of H5N1 (A/VN/1203/04) influenza A virus and subsequently treated on days 1, 3, and 5, with 20 mg/kg of either the anti-M2e antibody (TCN-032, a/k/a 8I10) or an isotype negative control antibody (2N9), a PBS placebo (administration control), oseltamivir (a/k/a TamifluTM) provided twice per day (bid) at 10 mg/kg, a combination of TCN-032/oseltamivir, or a combination of isotype-control/oseltamivir.
- TCN-032/oseltamivir a combination of TCN-032/oseltamivir
- mice A population of mice was challenged and untreated as another negative control group (PBS administration control). Statistically significant differences in percent survival are demonstrated between the following: TCN-032 vs. isotype negative control (p ⁇ 0.001), TCN-032/oseltamivir vs. oseltamivir (p ⁇ 0.029), TCN-032 vs. untreated/challenged (p ⁇ 0.037), and TCN-032/oseltamivir vs. untreated/challenged (p ⁇ 0.0003).
- FIG. 59 is a graph depicting the percent weight change versus days post-infection for mouse populations challenged with 10 fold LD 50 (10LD 50 ) dosage of H5N1 (A/VN/1203/04) influenza A virus and subsequently treated on days 1, 3, and 5, with 20 mg/kg of either the anti-M2e antibody (TCN-032, a/k/a 8I10) or an isotype negative control antibody (2N9), a PBS placebo (administration control), oseltamivir (a/k/a TamifluTM) provided twice per day (bid) at 10 mg/kg, a combination of TCN-032/oseltamivir, or a combination of isotype-control/oseltamivir.
- a population of mice was challenged and untreated as another negative control group (PBS administration control). Additionally, a population of mice was unchallenged and untreated as a control group.
- FIG. 60 is a graph depicting the percent survival versus days post-infection for mouse populations challenged with 20 fold LD 50 (20LD 50 ) dosage of H5N1 (A/VN/1203/04) influenza A virus and subsequently treated on days 1, 3, and 5, with 20 mg/kg of either the anti-M2e antibody (TCN-032, a/k/a 8I10) or an isotype negative control antibody (2N9), a PBS placebo (administration control), oseltamivir (a/k/a TamifluTM) provided twice per day (bid) at 10 mg/kg, a combination of TCN-032/oseltamivir, or a combination of isotype-control/oseltamivir.
- TCN-032/oseltamivir a combination of isotype-control/oseltamivir.
- mice A population of mice was challenged and untreated as another negative control group (PBS administration control). Statistically significant differences in percent survival are demonstrated between the following: TCN-032 vs. isotype negative control (p ⁇ 0.0002), TCN-032/oseltamivir vs. isotype-control/oseltamivir (p ⁇ 0.012), and TCN-032/oseltamivir vs. oseltamivir (p ⁇ 0.029).
- FIG. 61 is a graph depicting the percent weight change versus days post-infection for mouse populations challenged with 20 fold LD 50 (20 LD 50 ) dosage of H5N1 (ANN/1203/04) influenza A virus and subsequently treated on days 1, 3, and 5, with 20 mg/kg of either the anti-M2e antibody (TCN-032, a/k/a 8I10) or an isotype negative control antibody (2N9), a PBS placebo (administration control), oseltamivir (a/k/a TamifluTM) provided twice per day (bid) at 10 mg/kg, a combination of TCN-032/oseltamivir, or a combination of isotype-control/oseltamivir.
- a population of mice was challenged and untreated as another negative control group (PBS administration control). Additionally, a population of mice was unchallenged and untreated as a control group.
- FIG. 62 is a schematic depiction of the experiment performed in Example 23.
- FIG. 63 is a pair of graphs depicting the percent survival versus days post-infection for mouse populations in a first and a second study, which were challenged with 20 fold LD 50 (20 LD 50 ) dosage of H5N1 (ANN/1203/04) influenza A virus and subsequently treated on days 1, 3, and 5, with 20 mg/kg of either the anti-M2e antibody (TCN-032, a/k/a 8I10) or an isotype negative control antibody (2N9), oseltamivir (a/k/a TamifluTM) provided twice per day (bid) at 10 mg/kg, a combination of TCN-032/oseltamivir, or a combination of isotype-control/oseltamivir.
- TCN-032/oseltamivir a combination of TCN-032/oseltamivir
- a combination of isotype-control/oseltamivir A population of mice was challenged and untreated as another negative control group (PBS administration control).
- FIG. 64 is a series of graphs depicting the percent survival versus days post-infection for mouse populations challenged with 20 fold LD 50 (20 LD 50 ) dosage of H5N1 (ANN/1203/04) influenza A virus and subsequently treated on days 1, 3, and 5 (upper left), days 3, 5, and 7 (upper right), days 4, 6, and 8 (lower left), or days 5, 7, and 9 (lower right), with 20 mg/kg of either the anti-M2e antibody (TCN-032, a/k/a 8I10) or an isotype negative control antibody (2N9), oseltamivir (a/k/a TamifluTM) provided twice per day (bid) at 10 mg/kg, a combination of TCN-032/oseltamivir, or a combination of isotype-control/oseltamivir.
- TCN-032/oseltamivir a combination of TCN-032/oseltamivir
- mice A population of mice was challenged and untreated as another negative control group (PBS administration control). A further population of mice was unchallenged and untreated as a control.
- the combination therapy including the anti-M2e antibody TCN-032 and oseltamivir demonstrates superior properties, and specifically, a synergistic relationship with respect to the results of either the TCN-032 or oseltamivir therapy alone.
- the combined therapy resulted in a 90% survival rate, whereas the TCN-032 monotherapy resulted in a 10% survival rate and the oseltamivir therapy resulted in extinction of the population prior to the end of the therapy (upper right graph).
- the combined therapy provides an effect that is greater than the additive effects of either monotherapy provided alone.
- FIG. 65 is a series of graphs depicting the percent weight change versus days post-infection for mouse populations challenged with 20 fold LD 50 (20 LD 50 ) dosage of H5N1 (A/VN/1203/04) influenza A virus and subsequently treated on days 1, 3, and 5 (upper left), days 3, 5, and 7 (upper right), days 4, 6, and 8 (lower left), or days 5, 7, and 9 (lower right), with 20 mg/kg of either the anti-M2e antibody (TCN-032, a/k/a 8I10) or an isotype negative control antibody (2N9), oseltamivir (a/k/a TamifluTM) provided twice per day (bid) at 10 mg/kg, a combination of TCN-032/oseltamivir, or a combination of isotype-control/oseltamivir.
- a population of mice was challenged and untreated as another negative control group (PBS administration control). A further population of mice was unchallenged and untreated as a control.
- FIG. 66 is a schematic depiction of the experiment performed in Example 24.
- FIG. 67 is a graph depicting the percent survival versus days post-infection for mouse populations challenged with 1 ⁇ fold LD 90 (1 ⁇ LD 90 ) dosage of H5N1 (A/Vietnam/1203/04) influenza A virus that were treated on days ⁇ 1 and 2, post-treatment with 20 mg/kg of either the anti-M2e antibody (TCN-032, a/k/a 8110, or TCN-01, a/k/a 23K12), a positive-control antibody (14C2), or an isotype negative control antibody (2N9).
- TCN-031 23K12
- TCN-032 (8I10) vs. isotype negative control (2N9) (p ⁇ 0.029)
- positive-control antibody (14C2) vs. isotype negative control (2N9) p ⁇ 0.0035.
- FIG. 68 is a series of graphs depicting anti-M2e-mediated Antibody-Dependent Cell-mediated Cytotoxicity (ADCC).
- MDCK cells infected with influenza A virus A/Soloman Islands/3/2006
- an anti-M2e monoclonal antibody e.g. TCN-031 or TCN-032
- anti-CMV antibody an isotype-matched negative control
- NK human natural killer cells isolated from a single human donor.
- Cytolysis was quantified by measuring released lactate dehydrogenase (LDH) (left-hand graphs). Potency of ADCC-mediated lysis was determined by the effector-to-target ratios provided in the right-hand graphs (raw data for specific lysis percentage in top graph and corrected specific lysis percentage shown in bottom graph).
- LDH lactate dehydrogenase
- FIG. 69 is a series of graphs depicting data gathered from a duplicate experiment of that described in Example 26 and the description FIG. 68 .
- FIG. 70 is a series of photographs depicting the anti-M2e antibody immunohistochemical profile. Staining of three full sections of frozen lung tissue were examined individually as well as tissue microarray (TMA) slides (Biochain-FDA Standard Frozen Tissue Array, cat# T6234701, lot# B203071) using antibodies TCN-031-FITC and TCN-032-FITC at a concentration of 1.25 ⁇ g/ml. Subsets of cells within the positive control cell line were strongly positive with these conditions.
- TMA tissue microarray
- FIG. 71 is a series of photographs depicting the anti-M2e antibody immunohistochemical profile. Staining of three full sections of frozen lung tissue were examined individually as well as tissue microarray (TMA) slides (Biochain-FDA Standard Frozen Tissue Array, cat# T6234701, lot# B203071) using antibodies TCN-031-FITC and TCN-032-FITC at a concentration of 1.25 ⁇ g/ml. Subsets of cells within the positive control cell line were strongly positive with these conditions.
- TMA tissue microarray
- FIG. 72 is a schematic diagram of the 96-well CDC assay protocol used in Example 29.
- FIG. 73 is a series of graphs depicting the CDC assay readout (the protocol for which is depicted in FIG. 72 ) in relative light units (RLU) per human complement percent (%) for the anti-M2e antibody TCN-032 and the negative-control, anti-CMV, antibody (TCN-202).
- RLU relative light units
- the standard curve of target cell titration shown in the center was used to determine specific target cell killing efficacy of TCN-032, depicted as specific lysis percent (%) per human complement percent (%).
- the results of this experiment demonstrate that maximal target lysis was obtained with between 5-10% complement (volume by volume, v/v).
- FIG. 74 is a schematic diagram of the 96-well homogeneous CDC assay protocol used in Example 29.
- FIG. 75 is a series of graphs depicting the CDC assay readout (the protocol for which is depicted in FIG. 74 ) in relative light units (RLU) per human complement percent (%) for the anti-M2e antibody TCN-032 and the negative-control, anti-CMV, antibody (TCN-202).
- RLU relative light units
- the standard curve of target cell titration shown in the center was used to determine specific target cell killing efficacy of TCN-032, depicted as specific lysis percent (%) per human complement percent (%).
- the results of this experiment demonstrate that Maximal target lysis with minimal negligible background lysis was obtained with approximately 6.25% complement (v/v).
- FIG. 76 is a series of graphs depicting the analysis of temperature-stressed TCN-032 in the homogenous CDC assay (the protocol for which is depicted in FIG. 74 ).
- the assay readout is provided in cells per well as a function of monoclonal antibody concentration (nanograms/milliliter, ng/ml) for the anti-M2e antibody TCN-032 stressed to 50° C., 60° C. and 70° C., respectively, as well as the negative-control, anti-CMV, antibody (TCN-202).
- the standard curve of target cell titration shown in the center was used to determine specific target cell killing efficacy of TCN-032, depicted as specific lysis percent (%) per human complement percent (%).
- the results of this experiment demonstrate that TCN-032 stressed at greater than 60° C. (>60° C.) showed diminished CDC activity.
- the anti-M2e antibody, TCN-032 demonstrated exceptional stability even when stressed to 50° C.
- the present invention provides fully human monoclonal antibodies specific against the extracellular domain of the matrix 2 (M2) polypeptide.
- the antibodies are respectively referred to herein as huM2e antibodies.
- M2 is a 96 amino acid transmembrane protein present as a homotetramer on the surface of influenza virus and virally infected cells.
- M2 contains a 23 amino acid ectodomain (M2e) that is highly conserved across influenza A strains. Few amino acid changes have occurred since the 1918 pandemic strain thus M2e is an attractive target for influenza therapies.
- monoclonal antibodies specific to the M2 ectodomain (M2e) were derived upon immunizations with a peptide corresponding to the linear sequence of M2e.
- the present invention provides a novel process whereby full-length M2 is expressed in cell lines, which allows for the identification of human antibodies that bound this cell-expressed M2e.
- the huM2e antibodies have been shown to bind conformational determinants on the M2-transfected cells, as well as native M2, either on influenza infected cells, or on the virus itself.
- the huM2e antibodies did not bind the linear M2e peptide, but they do bind several natural M2 variants, also expressed upon cDNA transfection into cell lines.
- this invention has allowed for the identification and production of human monoclonal antibodies that exhibit novel specificity for a very broad range of influenza A virus strains. These antibodies may be used diagnostically to identify influenza A infection and therapeutically to treat influenza A infection.
- the huM2e antibodies of the invention have one or more of the following characteristics: the huM2e antibody binds a) to an epitope in the extracellular domain of the matrix 2 (M2) polypeptide of an influenza virus; b) binds to influenza A infected cells; and/or c) binds to influenza A virus (i.e., virions).
- the huM2e antibodies of the invention eliminate influenza infected cells through immune effector mechanisms, such as ADCC, and promote direct viral clearance by binding to influenza virions.
- the huM2e antibodies of the invention bind to the amino-terminal region of the M2e polypeptide.
- the huM2e antibodies of the invention bind to the amino-terminal region of the M2e polypeptide wherein the N-terminal methionine residue is absent.
- Exemplary M2e sequences include those sequences listed on Table 1 below
- H3N2 MSLLTEVETPTRNGWECRYSDSSD SEQ ID NO: 16 2004 A GUANGZHOU.333.99 H9N2 MSFLTEVETLTRNGWECRCSDSSD SEQ ID NO: 17 A HONG KONG.1073.99 H9N2 MSLLTEVETLTRNGWECKCRDSSD SEQ ID NO: 18 A HONG KONG.1.68 H3N2 MSLLTEVETPIRNEWGCRCNDSSD SEQ ID NO: 19 A SWINE.HONG H3N2 MSLLTEVETPIRSEWGCRCNDSGD SEQ ID NO: 20 KONG.126.1982 A NEW YORK.703.1995 H3N2 MSLLTEVETPIRNEWECRCNGSSD SEQ ID NO: 21 A SWINE.QUEBEC.192.81 H1N1 MSLPTEVETPIRNEWGCRCNDSSD SEQ ID NO: 22 A PUERTO RICO.8.34 H1N1 MSLLTEVETPIRNEWGCRCNGSSD SEQ ID NO: 23 A HONG
- H9N2 MSLLTEVETPTRNGWGCRCSDSSD SEQ ID NO: 31 48.01 A SWINE.KOREA.S5.2005 H1N2 MSLLTEVETPTRNGWECKCNDSSD SEQ ID NO: 32 A HONG KONG.1073.99 H9N2 MSLLTEVETLTRNGWECKCSDSSD SEQ ID NO: 33 A WISCONSIN.3523.88 H1N1 MSLLTEVETPIRNEWGCKCNDSSD SEQ ID NO: 34 A X-31 VACCINE STRAIN H3N2 MSFLTEVETPIRNEWGCRCNGSSD SEQ ID NO: 35 A CHICKEN.ROSTOCK.8.
- the huM2e antibodies of the invention bind to a M2e that wholly or partially includes the amino acid residues from position 2 to position 7 of M2e when numbered in accordance with SEQ ID NO: 1.
- the huM2e antibodies of the invention bind wholly or partially to the amino acid sequence SLLTEVET (SEQ ID NO: 41)
- the huM2e antibodies of the invention bind wholly or partially to the amino acid sequence SLLTEV (SEQ ID NO: 42)
- the huM2e antibodies of the invention bind to non-linear epitope of the M2e protein.
- the huM2e antibodies bind to an epitope comprising position 2, 5, and 6 of the M2e polypeptide when numbered in accordance to SEQ ID NO: 1 where the amino acid at a) position 2 is a serine; b) position 5 is a threonine; and c) position 6 is a glutamic acid.
- Exemplary huM2e monoclonal antibodies that binds to this epitope are the 8I10, 21B15 or 23K12 antibodies described herein.
- the 8I10 antibody includes a heavy chain variable region (SEQ ID NO: 44) encoded by the nucleic acid sequence shown below in SEQ ID NO: 43, and a light chain variable region (SEQ ID NO: 46) encoded by the nucleic acid sequence shown in SEQ ID NO: 45.
- amino acids encompassing the CDRs as defined by Chothia, C. et al. (1989, Nature, 342: 877-883) are underlined and those defined by Kabat E. A. et al. (1991, Sequences of Proteins of Immunological Interest, 5 th edit., NIH Publication no. 91-3242 U.S. Department of Health and Human Services) are highlighted in bold in the sequences below.
- the heavy chain CDRs of the 8I10 antibody have the following sequences per Kabat definition: NYYWS (SEQ ID NO: 72), FIYYGGNTKYNPSLKS (SEQ ID NO: 74) and ASCSGGYCILD (SEQ ID NO: 76).
- the light chain CDRs of the 8I10 antibody have the following sequences per Kabat definition: RASQNIYKYLN (SEQ ID NO: 59), AASGLQS (SEQ ID NO: 61) and QQSYSPPLT (SEQ ID NO: 63).
- the heavy chain CDRs of the 8I10 antibody have the following sequences per Chothia definition: GSSISN (SEQ ID NO: 109), FIYYGGNTK (SEQ ID NO: 110) and ASCSGGYCILD (SEQ ID NO: 76).
- the light chain CDRs of the 8I10 antibody have the following sequences per Chothia definition: RASQNIYKYLN (SEQ ID NO: 59), AASGLQS (SEQ ID NO: 61) and QQSYSPPLT (SEQ ID NO: 63).
- the 21B15 antibody includes antibody includes a heavy chain variable region (SEQ ID NO: 44) encoded by the nucleic acid sequence shown below in SEQ ID NO: 47, and a light chain variable region (SEQ ID NO: 46) encoded by the nucleic acid sequence shown in SEQ ID NO: 48.
- the heavy chain CDRs of the 21B15 antibody have the following sequences per Kabat definition: NYYWS (SEQ ID NO: 72), FIYYGGNTKYNPSLKS (SEQ ID NO: 74) and ASCSGGYCILD (SEQ ID NO: 76).
- the light chain CDRs of the 21B15 antibody have the following sequences per Kabat definition: RASQNIYKYLN (SEQ ID NO: 59), AASGLQS (SEQ ID NO: 61) and QQSYSPPLT (SEQ ID NO: 63).
- the heavy chain CDRs of the 21B15 antibody have the following sequences per Chothia definition: GSSISN (SEQ ID NO: 109), FIYYGGNTK (SEQ ID NO 110) and ASCSGGYCILD (SEQ ID NO: 76).
- the light chain CDRs of the 21B15 antibody have the following sequences per Chothia definition: RASQNIYKYLN (SEQ ID NO: 59), AASGLQS (SEQ ID NO: 61) and QQSYSPPLT (SEQ ID NO: 63).
- the 23K12 antibody includes antibody includes a heavy chain variable region (SEQ ID NO: 50) encoded by the nucleic acid sequence shown below in SEQ ID NO: 49, and a light chain variable region (SEQ ID NO: 52) encoded by the nucleic acid sequence shown in SEQ ID NO: 51.
- SEQ ID NO: 50 heavy chain variable region
- SEQ ID NO: 52 light chain variable region
- the heavy chain CDRs of the 23K12 antibody have the following sequences per Kabat definition: SNYMS (SEQ ID NO: 103), VIYSGGSTYYADSVK (SEQ ID NO: 105) and CLSRMRGYGLDV (SEQ ID NO: 107).
- the light chain CDRs of the 23K12 antibody have the following sequences per Kabat definition: RTSQSISSYLN (SEQ ID NO: 92), AASSLQSGVPSRF (SEQ ID NO: 94) and QQSYSMPA (SEQ ID NO: 96).
- the heavy chain CDRs of the 23K12 antibody have the following sequences per Chothia definition: GFTVSSN (SEQ ID NO: 112), VIYSGGSTY (SEQ ID NO: 113) and CLSRMRGYGLDV (SEQ ID NO: 107).
- the light chain CDRs of the 23K12 antibody have the following sequences per Chothia definition: RTSQSISSYLN (SEQ ID NO: 92), AASSLQSGVPSRF (SEQ ID NO: 94) and QQSYSMPA (SEQ ID NO: 96).
- the 3241_G23 antibody (also referred to herein as G23) includes antibody includes a heavy chain variable region (SEQ ID NO: 116) encoded by the nucleic acid sequence shown below in SEQ ID NO: 115, and a light chain variable region (SEQ ID NO: 118) encoded by the nucleic acid sequence shown in SEQ ID NO: 117.
- the heavy chain CDRs of the G23 antibody have the following sequences per Kabat definition: GGGYSWN (SEQ ID NO: 179), FMFHSGSPRYNPTLKS (SEQ ID NO: 180) and VGQMDKYYAMDV (SEQ ID NO: 181).
- the light chain CDRs of the G23 antibody have the following sequences per Kabat definition: RASQSIGAYVN (SEQ ID NO: 184), GASNLQS (SEQ ID NO: 185) and QQTYSTPIT (SEQ ID NO: 186).
- the heavy chain CDRs of the G23 antibody have the following sequences per Chothia definition: GGPVSGGG (SEQ ID NO: 182), FMFHSGSPR (SEQ ID NO: 183) and VGQMDKYYAMDV (SEQ ID NO: 181).
- the light chain CDRs of the G23 antibody have the following sequences per Chothia definition: RASQSIGAYVN (SEQ ID NO: 184), GASNLQS (SEQ ID NO: 185) and QQTYSTPIT (SEQ ID NO: 186).
- the 3244_I10 antibody (also referred to herein as I10) includes antibody includes a heavy chain variable region (SEQ ID NO: 120) encoded by the nucleic acid sequence shown below in SEQ ID NO: 119, and a light chain variable region (SEQ ID NO: 122) encoded by the nucleic acid sequence shown in SEQ ID NO: 121.
- the heavy chain CDRs of the I10 antibody have the following sequences per Kabat definition: SDYWS (SEQ ID NO: 187), FFYNGGSTKYNPSLKS (SEQ ID NO: 188) and HDAKFSGSYYVAS (SEQ ID NO: 189).
- the light chain CDRs of the I10 antibody have the following sequences per Kabat definition: RASQSISTYLN (SEQ ID NO: 192), GATNLQS (SEQ ID NO: 193) and QQSYNTPLI (SEQ ID NO: 194).
- the heavy chain CDRs of the I10 antibody have the following sequences per Chothia definition: GGSITS (SEQ ID NO: 190), FFYNGGSTK (SEQ ID NO: 191) and HDAKFSGSYYVAS (SEQ ID NO: 189).
- the light chain CDRs of the I10 antibody have the following sequences per Chothia definition: RASQSISTYLN (SEQ ID NO: 192), GATNLQS (SEQ ID NO: 193) and QQSYNTPLI (SEQ ID NO: 194).
- VH nucleotide sequence (SEQ ID NO: 119) CAGGTCCAGCTGCAGGAGTCGGGCCCAGGACTGCTGAAGCCTTCGGACACCCTGGCCCTCAC TTGCACTGTCTCTGGTGGCTCCATCACCAGTGACTACTGGAGCTGGATCCGGCAACCCCCAG GGAGGGGACTGGACTGGATCGGATTCTTCTATAACGGCGGAAGCACCAAGTACAATCCCTCC CTCAAGAGTCGAGTCACCATTTCAGCGGACACGTCCAAGAACCAGTTGTCCCTGAAATTGAC CTCTGTGACCGCCGCAGACACGGGCGTGTATTATTGTGCGAGACATGATGCCAAATTTAGTG GGAGCTACTACGTTGCCTCCTGGGGCCAGGGAACCCGAGTCACCGTCTCGAGC >3244_I10 VH amino acid sequence (SEQ ID NO: 120) Kabat Bold, Chothia underlined QVQLQESGPGLLKPSDTLALTCTVS GGSIT S DYWS W
- the 3243_J07 antibody (also referred to herein as J07) includes antibody includes a heavy chain variable region (SEQ ID NO: 124) encoded by the nucleic acid sequence shown below in SEQ ID NO: 123, and a light chain variable region (SEQ ID NO: 126) encoded by the nucleic acid sequence shown in SEQ ID NO: 125.
- the heavy chain CDRs of the J07 antibody have the following sequences per Kabat definition: SDYWS (SEQ ID NO: 187), FFYNGGSTKYNPSLKS (SEQ ID NO: 188) and HDVKFSGSYYVAS (SEQ ID NO: 195).
- the light chain CDRs of the J07 antibody have the following sequences per Kabat definition: RASQSISTYLN (SEQ ID NO: 192), GATNLQS (SEQ ID NO: 193) and QQSYNTPLI (SEQ ID NO: 194).
- the heavy chain CDRs of the J07 antibody have the following sequences per Chothia definition: GGSITS (SEQ ID NO: 190), FFYNGGSTK (SEQ ID NO: 191) and HDVKFSGSYYVAS (SEQ ID NO: 195).
- the light chain CDRs of the J07 antibody have the following sequences per Chothia definition: RASQSISTYLN (SEQ ID NO: 192), GATNLQS (SEQ ID NO: 193) and QQSYNTPLI (SEQ ID NO: 194).
- the 3259_J21 antibody (also referred to herein as J21) includes antibody includes a heavy chain variable region (SEQ ID NO: 128) encoded by the nucleic acid sequence shown below in SEQ ID NO: 127, and a light chain variable region (SEQ ID NO: 130) encoded by the nucleic acid sequence shown in SEQ ID NO: 129.
- the heavy chain CDRs of the J21 antibody have the following sequences per Kabat definition: SYNWI (SEQ ID NO: 196), HIYDYGRTFYNSSLQS (SEQ ID NO: 197) and PLGILHYYAMDL (SEQ ID NO: 198).
- the light chain CDRs of the J21 antibody have the following sequences per Kabat definition: RASQSIDKFLN (SEQ ID NO: 199), GASNLHS (SEQ ID NO: 200) and QQSFSVPA (SEQ ID NO: 201).
- the heavy chain CDRs of the J21 antibody have the following sequences per Chothia definition: GGSISS (SEQ ID NO: 202), HIYDYGRTF (SEQ ID NO: 203) and PLGILHYYAMDL (SEQ ID NO: 198).
- the light chain CDRs of the J21 antibody have the following sequences per Chothia definition: RASQSIDKFLN (SEQ ID NO: 199), GASNLHS (SEQ ID NO: 200) and QQSFSVPA (SEQ ID NO: 201).
- the 3245_O19 antibody (also referred to herein as O19) includes a heavy chain variable region (SEQ ID NO: 132) encoded by the nucleic acid sequence shown below in SEQ ID NO: 131, and a light chain variable region (SEQ ID NO: 134) encoded by the nucleic acid sequence shown in SEQ ID NO: 133.
- the heavy chain CDRs of the O19 antibody have the following sequences per Kabat definition: STYMN (SEQ ID NO: 204), VFYSETRTYYADSVKG (SEQ ID NO: 205) and VQRLSYGMDV (SEQ ID NO: 206).
- the light chain CDRs of the 019 antibody have the following sequences per Kabat definition: RASQSISTYLN (SEQ ID NO: 192), GASTLQS (SEQ ID NO: 207) and QQTYSIPL (SEQ ID NO: 208).
- the heavy chain CDRs of the O19 antibody have the following sequences per Chothia definition: GLSVSS (SEQ ID NO: 209), VFYSETRTY (SEQ ID NO: 210) and VQRLSYGMDV (SEQ ID NO: 206).
- the light chain CDRs of the O19 antibody have the following sequences per Chothia definition: RASQSISTYLN (SEQ ID NO: 192), GASTLQS (SEQ ID NO: 207) and QQTYSIPL (SEQ ID NO: 208).
- the 3244_H04 antibody (also referred to herein as H04) includes antibody includes a heavy chain variable region (SEQ ID NO: 136) encoded by the nucleic acid sequence shown below in SEQ ID NO: 135, and a light chain variable region (SEQ ID NO: 138) encoded by the nucleic acid sequence shown in SEQ ID NO: 137.
- the heavy chain CDRs of the H04 antibody have the following sequences per Kabat definition: STYMN (SEQ ID NO: 204), VFYSETRTYYADSVKG (SEQ ID NO: 205) and VQRLSYGMDV (SEQ ID NO: 206).
- the light chain CDRs of the H04 antibody have the following sequences per Kabat definition: RASQSISTYLN (SEQ ID NO: 192), GASSLQS (SEQ ID NO: 211) and QQTYSIPL (SEQ ID NO: 208).
- the heavy chain CDRs of the H04 antibody have the following sequences per Chothia definition: GLSVSS (SEQ ID NO: 209), VFYSETRTY (SEQ ID NO: 210) and VQRLSYGMDV (SEQ ID NO: 206).
- the light chain CDRs of the H04 antibody have the following sequences per Chothia definition: RASQSISTYLN (SEQ ID NO: 192), GASSLQS (SEQ ID NO: 211) and QQTYSIPL (SEQ ID NO: 208).
- the 3136_G05 antibody (also referred to herein as G05) includes antibody includes a heavy chain variable region (SEQ ID NO: 140) encoded by the nucleic acid sequence shown below in SEQ ID NO: 139, and a light chain variable region (SEQ ID NO: 142) encoded by the nucleic acid sequence shown in SEQ ID NO: 141.
- SEQ ID NO: 140 heavy chain variable region
- SEQ ID NO: 142 light chain variable region
- the heavy chain CDRs of the G05 antibody have the following sequences per Kabat definition: SDFWS (SEQ ID NO: 212), YVYNRGSTKYSPSLKS (SEQ ID NO: 213) and NGRSSTSWGIDV (SEQ ID NO: 214).
- the light chain CDRs of the G05 antibody have the following sequences per Kabat definition: RASQSISTYLH (SEQ ID NO: 215), AASSLQS (SEQ ID NO: 216) and QQSYSPPLT (SEQ ID NO: 63).
- the heavy chain CDRs of the G05 antibody have the following sequences per Chothia definition: GGSISS (SEQ ID NO: 202), YVYNRGSTK (SEQ ID NO: 217) and NGRSSTSWGIDV (SEQ ID NO: 214).
- the light chain CDRs of the G05 antibody have the following sequences per Chothia definition: RASQSISTYLH (SEQ ID NO: 215), AASSLQS (SEQ ID NO: 216) and QQSYSPPLT (SEQ ID NO: 63).
- the 3252_C13 antibody (also referred to herein as C13) includes antibody includes a heavy chain variable region (SEQ ID NO: 144) encoded by the nucleic acid sequence shown below in SEQ ID NO: 143, and a light chain variable region (SEQ ID NO: 146) encoded by the nucleic acid sequence shown in SEQ ID NO: 145.
- the heavy chain CDRs of the C13 antibody have the following sequences per Kabat definition: SDYWS (SEQ ID NO: 187), YIYNRGSTKYTPSLKS (SEQ ID NO: 218) and HVGGHTYGIDY (SEQ ID NO: 219).
- the light chain CDRs of the C13 antibody have the following sequences per Kabat definition: RASQSISNYLN (SEQ ID NO: 220), AASSLQS (SEQ ID NO: 216) and QQSYNTPIT (SEQ ID NO: 221).
- the heavy chain CDRs of the C13 antibody have the following sequences per Chothia definition: GASISS (SEQ ID NO: 222), YIYNRGSTK (SEQ ID NO: 223) and HVGGHTYGIDY (SEQ ID NO: 219).
- the light chain CDRs of the C13 antibody have the following sequences per Chothia definition: RASQSISNYLN (SEQ ID NO: 220), AASSLQS (SEQ ID NO: 216) and QQSYNTPIT (SEQ ID NO: 221).
- the 3259_J06 antibody (also referred to herein as J06) includes antibody includes a heavy chain variable region (SEQ ID NO: 148) encoded by the nucleic acid sequence shown below in SEQ ID NO: 147, and a light chain variable region (SEQ ID NO: 150) encoded by the nucleic acid sequence shown in SEQ ID NO: 149.
- the heavy chain CDRs of the J06 antibody have the following sequences per Kabat definition: SDYWS (SEQ ID NO: 187), YIYNRGSTKYTPSLKS (SEQ ID NO: 218) and HVGGHTYGIDY (SEQ ID NO: 219).
- the light chain CDRs of the J06 antibody have the following sequences per Kabat definition: RASQSISNYLN (SEQ ID NO: 220), AASSLQS (SEQ ID NO: 216) and QQSYNTPIT (SEQ ID NO: 221).
- the heavy chain CDRs of the J06 antibody have the following sequences per Chothia definition: GASISS (SEQ ID NO: 222), YIYNRGSTK (SEQ ID NO: 223) and HVGGHTYGIDY (SEQ ID NO: 219).
- the light chain CDRs of the J06 antibody have the following sequences per Chothia definition: RASQSISNYLN (SEQ ID NO: 220), AASSLQS (SEQ ID NO: 216) and QQSYNTPIT (SEQ ID NO: 221).
- the 3410_I23 antibody (also referred to herein as I23) includes antibody includes a heavy chain variable region (SEQ ID NO: 152) encoded by the nucleic acid sequence shown below in SEQ ID NO: 151, and a light chain variable region (SEQ ID NO: 154) encoded by the nucleic acid sequence shown in SEQ ID NO: 153.
- the heavy chain CDRs of the I23 antibody have the following sequences per Kabat definition: SYSWS (SEQ ID NO: 224), YLYYSGSTKYNPSLKS (SEQ ID NO: 225) and TGSESTTGYGMDV (SEQ ID NO: 226).
- the light chain CDRs of the I23 antibody have the following sequences per Kabat definition: RASQSISTYLN (SEQ ID NO: 192), AASSLHS (SEQ ID NO: 227) and QQSYSPPIT (SEQ ID NO: 228).
- the heavy chain CDRs of the I23 antibody have the following sequences per Chothia definition: GDSISS (SEQ ID NO: 229), YLYYSGSTK (SEQ ID NO: 230) and TGSESTTGYGMDV (SEQ ID NO: 226).
- the light chain CDRs of the I23 antibody have the following sequences per Chothia definition: RASQSISTYLN (SEQ ID NO: 192), AASSLHS (SEQ ID NO: 227) and QQSYSPPIT (SEQ ID NO: 228).
- the 3139_P23 antibody (also referred to herein as P23) includes antibody includes a heavy chain variable region (SEQ ID NO: 156) encoded by the nucleic acid sequence shown below in SEQ ID NO:155, and a light chain variable region (SEQ ID NO: 158) encoded by the nucleic acid sequence shown in SEQ ID NO:157.
- the heavy chain CDRs of the P23 antibody have the following sequences per Kabat definition: NSFWG (SEQ ID NO: 318), YVYNSGNTKYNPSLKS (SEQ ID NO: 231) and HDDASHGYSIS (SEQ ID NO: 232).
- the light chain CDRs of the P23 antibody have the following sequences per Kabat definition: RASQTISTYLN (SEQ ID NO: 233), AASGLQS (SEQ ID NO: 61) and QQSYNTPLT (SEQ ID NO: 234).
- the heavy chain CDRs of the P23 antibody have the following sequences per Chothia definition: GGSISN (SEQ ID NO: 258), YVYNSGNTK (SEQ ID NO: 259) and HDDASHGYSIS (SEQ ID NO: 232).
- the light chain CDRs of the P23 antibody have the following sequences per Chothia definition: RASQTISTYLN (SEQ ID NO: 233), AASGLQS (SEQ ID NO: 61) and QQSYNTPLT (SEQ ID NO: 234).
- the 3248_P18 antibody (also referred to herein as P18) includes antibody includes a heavy chain variable region (SEQ ID NO:160) encoded by the nucleic acid sequence shown below in SEQ ID NO:159, and a light chain variable region (SEQ ID NO:162) encoded by the nucleic acid sequence shown in SEQ ID NO:161.
- the heavy chain CDRs of the P18 antibody have the following sequences per Kabat definition: AYHWS (SEQ ID NO: 235), HIFDSGSTYYNPSLKS (SEQ ID NO: 236) and PLGSRYYYGMDV (SEQ ID NO: 237).
- the light chain CDRs of the P18 antibody have the following sequences per Kabat definition: RASQSISRYLN (SEQ ID NO: 238), GASTLQN (SEQ ID NO: 239) and QQSYSVPA (SEQ ID NO: 240).
- the heavy chain CDRs of the P18 antibody have the following sequences per Chothia definition: GGSISA (SEQ ID NO: 260), HIFDSGSTY (SEQ ID NO: 261) and PLGSRYYYGMDV (SEQ ID NO: 237).
- the light chain CDRs of the P18 antibody have the following sequences per Chothia definition: RASQSISRYLN (SEQ ID NO: 238), GASTLQN (SEQ ID NO: 239) and QQSYSVPA (SEQ ID NO: 240).
- the 3253_P10 antibody (also referred to herein as P10) includes antibody includes a heavy chain variable region (SEQ ID NO: 164) encoded by the nucleic acid sequence shown below in SEQ ID NO: 163, and a light chain variable region (SEQ ID NO: 166) encoded by the nucleic acid sequence shown in SEQ ID NO: 165.
- the heavy chain CDRs of the P10 antibody have the following sequences per Kabat definition: SDYWS (SEQ ID NO: 187), FFYNGGSTKYNPSLKS (SEQ ID NO: 188) and HDAKFSGSYYVAS (SEQ ID NO: 189).
- the light chain CDRs of the P10 antibody have the following sequences per Kabat definition: RASQSISTYLN (SEQ ID NO: 192), GATDLQS (SEQ ID NO: 241) and QQSYNTPLI (SEQ ID NO: 194).
- the heavy chain CDRs of the P10 antibody have the following sequences per Chothia definition: GGSITS (SEQ ID NO: 190), FFYNGGSTK (SEQ ID NO: 191) and HDAKFSGSYYVAS (SEQ ID NO: 189).
- the light chain CDRs of the P10 antibody have the following sequences per Chothia definition: RASQSISTYLN (SEQ ID NO: 192), GATDLQS (SEQ ID NO: 241) and QQSYNTPLI (SEQ ID NO: 194).
- VH nucleotide sequence (SEQ ID NO: 163) CAGGTCCAGCTGCAGGAGTCGGGCCCAGGACTGCTGAAGCCTTCGGACACCCTGGCCCTCAC TTGCACTGTCTCTGGTGGCTCCATCACCAGTGACTACTGGAGCTGGATCCGGCAACCCCCAG GGAGGGGACTGGACTGGATCGGATTCTTCTATAACGGCGGGAGCACCAAGTACAATCCCTCC CTCAAGAGTCGAGTCACCATATCAGCGGACACGTCCAAGAACCAGTTGTCCCTGAAATTGAC CTCTGTGACCGCCGCAGACACGGGCGTGTATTATTGTGCGAGACATGATGCCAAATTTAGTG GGAGCTACTACGTTGCCTCCTGGGGCCAGGGAACCCGAGTCACCGTCTCGAGC >3253_P10 VH amino acid sequence (SEQ ID NO: 164) Kabat Bold, Chothia underlined QVQLQESGPGLLKPSDTLALTCTVS GGSIT S DYWS WIR
- the 3260_D19 antibody (also referred to herein as D19) includes antibody includes a heavy chain variable region (SEQ ID NO: 168) encoded by the nucleic acid sequence shown below in SEQ ID NO: 167, and a light chain variable region (SEQ ID NO: 170) encoded by the nucleic acid sequence shown in SEQ ID NO:169.
- the heavy chain CDRs of the D19 antibody have the following sequences per Kabat definition: DNYIN (SEQ ID NO: 242), VFYSADRTSYADSVKG (SEQ ID NO: 243) and VQKSYYGMDV (SEQ ID NO: 244).
- the light chain CDRs of the D19 antibody have the following sequences per Kabat definition: RASQSISRYLN (SEQ ID NO: 238), GASSLQS (SEQ ID NO: 211) and QQTFSIPL (SEQ ID NO: 245).
- the heavy chain CDRs of the D19 antibody have the following sequences per Chothia definition: GFSVSD (SEQ ID NO: 247), VFYSADRTS (SEQ ID NO: 246) and VQKSYYGMDV (SEQ ID NO: 244).
- the light chain CDRs of the D19 antibody have the following sequences per Chothia definition: RASQSISRYLN (SEQ ID NO: 238), GASSLQS (SEQ ID NO: 211) and QQTFSIPL (SEQ ID NO: 245).
- the 3362_B11 antibody (also referred to herein as B11) includes antibody includes a heavy chain variable region (SEQ ID NO: 172) encoded by the nucleic acid sequence shown below in SEQ ID NO: 171, and a light chain variable region (SEQ ID NO: 174) encoded by the nucleic acid sequence shown in SEQ ID NO: 173.
- the heavy chain CDRs of the B11 antibody have the following sequences per Kabat definition: SGAYYWT (SEQ ID NO: 248), YIYYSGNTYYNPSLKS (SEQ ID NO: 249) and AASTSVLGYGMDV (SEQ ID NO: 250).
- the light chain CDRs of the B11 antibody have the following sequences per Kabat definition: RASQSISRYLN (SEQ ID NO: 238), AASSLQS (SEQ ID NO: 216) and QQSYSTPLT (SEQ ID NO: 251).
- the heavy chain CDRs of the B11 antibody have the following sequences per Chothia definition: GDSITSGA (SEQ ID NO: 252), YIYYSGNTY (SEQ ID NO: 253) and AASTSVLGYGMDV (SEQ ID NO: 250).
- the light chain CDRs of the B11 antibody have the following sequences per Chothia definition: RASQSISRYLN (SEQ ID NO: 238), AASSLQS (SEQ ID NO: 216) and QQSYSTPLT (SEQ ID NO: 251).
- the 3242_P05 antibody (also referred to herein as P05) includes antibody includes a heavy chain variable region (SEQ ID NO: 176) encoded by the nucleic acid sequence shown below in SEQ ID NO: 175, and a light chain variable region (SEQ ID NO: 178) encoded by the nucleic acid sequence shown in SEQ ID NO 177.
- the heavy chain CDRs of the P05 antibody have the following sequences per Kabat definition: VSDNYIN (SEQ ID NO: 254), VFYSADRTSYAD (SEQ ID NO: 256) and VQKSYYGMDV (SEQ ID NO: 244).
- the light chain CDRs of the P05 antibody have the following sequences per Kabat definition: RASQSISRYLN (SEQ ID NO: 238), GASSLQS (SEQ ID NO: 211) and QQTFSIPL (SEQ ID NO: 245).
- the heavy chain CDRs of the P05 antibody have the following sequences per Chothia definition: SGFSV (SEQ ID NO: 257), VFYSADRTS (SEQ ID NO: 246) and VQKSYYGMDV (SEQ ID NO: 244).
- the light chain CDRs of the P05 antibody have the following sequences per Chothia definition:
- the light chain CDRs of the P05 antibody have the following sequences per Kabat definition: RASQSISRYLN (SEQ ID NO: 238), GASSLQS (SEQ ID NO: 211) and QQTFSIPL (SEQ ID NO: 245).
- VH nucleotide sequence (SEQ ID NO: 175) GACATGCAGCTGGTGGAGTCTGGAGGAGGCTTGGTCCCGCCGGGGGGGTCCCTGAGACTCTC CTGCGCAGCCTCTGGGTTTTCCGTCAGTGACAACTACATAAACTGGGTCCGCCAGGCTCCAG GGAAGGGGCTGGACTGGGTCTCAGTCTTTTATAGTGCTGATAGAACATCCTACGCAGACTCC GTGAAGGGCCGATTCACCGTCTCCAGCCACGATTCCAAGAACACAGTGTACCTTCAAATGAA CAGTCTGAGAGCTGAGGACACGGCCGTTTATTACTGTGCGAGAGTTCAGAAGTCCTATTACG GTATGGACGTCTGGGGCCAAGGGACCACGGTCACCGTCTCGAGC >3242_P05 VH amino acid sequence (SEQ ID NO: 176) Kabat Bold, Chothia underlined DMQLVESGGGLVPPGGSLRLSCAA SGFS V SDNYIN WVRQAPGKGLDWVS
- HuM2e antibodies of the invention also include antibodies that include a heavy chain variable amino acid sequence that is at least 90%, 92%, 95%, 97% 98%, 99% or more identical the amino acid sequence of SEQ ID NO: 44 or 49. and/or a light chain variable amino acid that is at least 90%, 92%, 95%, 97% 98%, 99% or more identical the amino acid sequence of SEQ ID NO: 46 or 52.
- the monoclonal antibody is an antibody that binds to the same epitope as 8I10, 21B15, 23K12, 3241_G23, 3244_I10, 3243_J07, 3259_J21, 3245_O19, 3244_H04, 3136_G05, 3252_C13, 3255_J06, 3420_I23, 3139_P23, 3248_P18, 3253_P10, 3260_D19, 3362_B11, or 3242_P05.
- the heavy chain of a M2e antibody is derived from a germ line V (variable) gene such as, for example, the IgHV4 or the IgHV3 germline gene.
- the M2e antibodies of the invention include a variable heavy chain (V H ) region encoded by a human IgHV4 or the IgHV3 germline gene sequence.
- An IgHV4 germline gene sequence is shown, e.g., in Accession numbers L10088, M29812, M95114, X56360 and M95117.
- An IgHV3 germline gene sequence is shown, e.g., in Accession numbers X92218, X70208, Z27504, M99679 and AB019437.
- the M2e antibodies of the invention include a V H region that is encoded by a nucleic acid sequence that is at least 80% homologous to the IgHV4 or the IgHV3 germline gene sequence.
- the nucleic acid sequence is at least 90%, 95%, 96%, 97% homologous to the IgHV4 or the IgHV3 germline gene sequence, and more preferably, at least 98%, 99% homologous to the IgHV4 or the IgHV3 germline gene sequence.
- the V H region of the M2e antibody is at least 80% homologous to the amino acid sequence of the V H region encoded by the IgHV4 or the IgHV3 V H germline gene sequence.
- the amino acid sequence of V H region of the M2e antibody is at least 90%, 95%, 96%, 97% homologous to the amino acid sequence encoded by the IgHV4 or the IgHV3 germline gene sequence, and more preferably, at least 98%, 99% homologous to the sequence encoded by the IgHV4 or the IgHV3 germline gene sequence.
- the M2e antibodies of the invention also include a variable light chain (V L ) region encoded by a human IgKV1 germline gene sequence.
- V L variable light chain
- a human IgKV1 V L germline gene sequence is shown, e.g., Accession numbers X59315, X59312, X59318, J00248, and Y14865.
- the M2e antibodies include a V L region that is encoded by a nucleic acid sequence that is at least 80% homologous to the IgKV1 germline gene sequence.
- the nucleic acid sequence is at least 90%, 95%, 96%, 97% homologous to the IgKV1 germline gene sequence, and more preferably, at least 98%, 99% homologous to the IgKV1 germline gene sequence.
- the V L region of the M2e antibody is at least 80% homologous to the amino acid sequence of the V L region encoded the IgKV1 germline gene sequence.
- the amino acid sequence of V L region of the M2e antibody is at least 90%, 95%, 96%, 97% homologous to the amino acid sequence encoded by the IgKV1 germline gene sequence, and more preferably, at least 98%, 99% homologous to the sequence encoded by e the IgKV1 germline gene sequence.
- antibody as used herein includes monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments, so long as they exhibit the desired biological activity.
- immunoglobulin Ig is used interchangeably with “antibody” herein.
- an “isolated antibody” is one that has been separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials that would interfere with diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes.
- the antibody is purified: (1) to greater than 95% by weight of antibody as determined by the Lowry method, and most preferably more than 99% by weight; (2) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator; or (3) to homogeneity by SDS-PAGE under reducing or non-reducing conditions using Coomassie blue or, preferably, silver stain.
- Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present. Ordinarily, however, isolated antibody will be prepared by at least one purification step.
- the basic four-chain antibody unit is a heterotetrameric glycoprotein composed of two identical light (L) chains and two identical heavy (H) chains.
- An IgM antibody consists of five of the basic heterotetramer units along with an additional polypeptide called a J chain, and therefore, contains ten antigen binding sites, while secreted IgA antibodies can polymerize to form polyvalent assemblages comprising 2-5 of the basic 4-chain units along with J chain.
- the 4-chain unit is generally about 150,000 daltons.
- Each L chain is linked to an H chain by one covalent disulfide bond, while the two H chains are linked to each other by one or more disulfide bonds depending on the H chain isotype.
- Each H and L chain also has regularly spaced intrachain disulfide bridges.
- Each H chain has at the N-terminus, a variable domain (V H ) followed by three constant domains (C H ) for each of the ⁇ and ⁇ chains and four C H domains for ⁇ and ⁇ isotypes.
- Each L chain has at the N-terminus, a variable domain (V L ) followed by a constant domain (C L ) at its other end.
- the V L is aligned with the V H and the C L is aligned with the first constant domain of the heavy chain (C H 1). Particular amino acid residues are believed to form an interface between the light chain and heavy chain variable domains.
- the pairing of a V H and V L together forms a single antigen-binding site.
- immunoglobulins can be assigned to different classes or isotypes. There are five classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, having heavy chains designated alpha ( ⁇ ), delta ( ⁇ ), epsilon ( ⁇ ), gamma ( ⁇ ) and mu ( ⁇ ), respectively.
- the ⁇ and ⁇ classes are further divided into subclasses on the basis of relatively minor differences in C H sequence and function, e.g., humans express the following subclasses: IgG1, IgG2, IgG3, IgG4, IgA1, and IgA2.
- variable refers to the fact that certain segments of the V domains differ extensively in sequence among antibodies.
- the V domain mediates antigen binding and defines specificity of a particular antibody for its particular antigen.
- variability is not evenly distributed across the 110-amino acid span of the variable domains.
- the V regions consist of relatively invariant stretches called framework regions (FRs) of 15-30 amino acids separated by shorter regions of extreme variability called “hypervariable regions” that are each 9-12 amino acids long.
- FRs framework regions
- hypervariable regions that are each 9-12 amino acids long.
- the variable domains of native heavy and light chains each comprise four FRs, largely adopting a ⁇ -sheet configuration, connected by three hypervariable regions, which form loops connecting, and in some cases forming part of, the ⁇ -sheet structure.
- the hypervariable regions in each chain are held together in close proximity by the FRs and, with the hypervariable regions from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)).
- the constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody dependent cellular cytotoxicity (ADCC).
- hypervariable region when used herein refers to the amino acid residues of an antibody that are responsible for antigen binding.
- the hypervariable region generally comprises amino acid residues from a “complementarity determining region” or “CDR” (e.g., around about residues 24-34 (L1), 50-56 (L2) and 89-97 (L3) in the V L , and around about 31-35 (H1), 50-65 (H2) and 95-102 (H3) in the V H when numbered in accordance with the Kabat numbering system; Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md.
- CDR complementarity determining region
- residues from a “hypervariable loop” e.g., residues 24-34 (L1), 50-56 (L2) and 89-97 (L3) in the V L , and 26-32 (H1), 52-56 (H2) and 95-101 (H3) in the V H when numbered in accordance with the Chothia numbering system; Chothia and Lesk, J. Mol. Biol.
- residues from a “hypervariable loop”/CDR e.g., residues 27-38 (L1), 56-65 (L2) and 105-120 (L3) in the V L , and 27-38 (H1), 56-65 (H2) and 105-120 (H3) in the V H when numbered in accordance with the IMGT numbering system; Lefranc, M. P. et al. Nucl. Acids Res. 27:209-212 (1999), Ruiz, M. e al. Nucl. Acids Res. 28:219-221 (2000)).
- the antibody has symmetrical insertions at one or more of the following points 28, 36 (L1), 63, 74-75 (L2) and 123 (L3) in the V L , and 28, 36 (H1), 63, 74-75 (H2) and 123 (H3) in the V H when numbered in accordance with AHo; Honneger, A. and Plunkthun, A. J. Mol. Biol. 309:657-670 (2001)).
- germline nucleic acid residue is meant the nucleic acid residue that naturally occurs in a germline gene encoding a constant or variable region.
- “Germline gene” is the DNA found in a germ cell (i.e., a cell destined to become an egg or in the sperm).
- a “germline mutation” refers to a heritable change in a particular DNA that has occurred in a germ cell or the zygote at the single-cell stage, and when transmitted to offspring, such a mutation is incorporated in every cell of the body.
- a germline mutation is in contrast to a somatic mutation which is acquired in a single body cell.
- nucleotides in a germline DNA sequence encoding for a variable region are mutated (i.e., a somatic mutation) and replaced with a different nucleotide.
- the term “monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to polyclonal antibody preparations that include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen. In addition to their specificity, the monoclonal antibodies are advantageous in that they may be synthesized uncontaminated by other antibodies. The modifier “monoclonal” is not to be construed as requiring production of the antibody by any particular method.
- the monoclonal antibodies useful in the present invention may be prepared by the hybridoma methodology first described by Kohler et al., Nature, 256:495 (1975), or may be made using recombinant DNA methods in bacterial, eukaryotic animal or plant cells (see, e.g., U.S. Pat. No. 4,816,567).
- the “monoclonal antibodies” may also be isolated from phage antibody libraries using the techniques described in Clackson et al., Nature, 352:624-628 (1991) and Marks et al., J. Mol. Biol., 222:581-597 (1991), for example.
- the monoclonal antibodies herein include “chimeric” antibodies in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (see U.S. Pat. No. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA, 81:6851-6855 (1984)).
- the present invention provides variable domain antigen-binding sequences derived from human antibodies.
- chimeric antibodies of primary interest herein include antibodies having one or more human antigen binding sequences (e.g., CDRs) and containing one or more sequences derived from a non-human antibody, e.g., an FR or C region sequence.
- chimeric antibodies of primary interest herein include those comprising a human variable domain antigen binding sequence of one antibody class or subclass and another sequence, e.g., FR or C region sequence, derived from another antibody class or subclass.
- Chimeric antibodies of interest herein also include those containing variable domain antigen-binding sequences related to those described herein or derived from a different species, such as a non-human primate (e.g., Old World Monkey, Ape, etc).
- Chimeric antibodies also include primatized and humanized antibodies.
- chimeric antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance. For further details, see Jones et al., Nature 321:522-525 (1986); Riechmann et al., Nature 332:323-329 (1988); and Presta, Curr. Op. Struct. Biol. 2:593-596 (1992).
- a “humanized antibody” is generally considered to be a human antibody that has one or more amino acid residues introduced into it from a source that is non-human. These non-human amino acid residues are often referred to as “import” residues, which are typically taken from an “import” variable domain. Humanization is traditionally performed following the method of Winter and co-workers (Jones et al., Nature, 321:522-525 (1986); Reichmann et al., Nature, 332:323-327 (1988); Verhoeyen et al., Science, 239:1534-1536 (1988)), by substituting import hypervariable region sequences for the corresponding sequences of a human antibody. Accordingly, such “humanized” antibodies are chimeric antibodies (U.S. Pat. No. 4,816,567) wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species.
- human antibody is an antibody containing only sequences present in an antibody naturally produced by a human. However, as used herein, human antibodies may comprise residues or modifications not found in a naturally occurring human antibody, including those modifications and variant sequences described herein. These are typically made to further refine or enhance antibody performance.
- an “intact” antibody is one that comprises an antigen-binding site as well as a C L and at least heavy chain constant domains, C H 1, C H 2 and C H 3.
- the constant domains may be native sequence constant domains (e.g., human native sequence constant domains) or amino acid sequence variant thereof.
- the intact antibody has one or more effector functions.
- antibody fragment comprises a portion of an intact antibody, preferably the antigen binding or variable region of the intact antibody.
- antibody fragments include Fab, Fab′, F(ab′) 2 , and Fv fragments; diabodies; linear antibodies (see U.S. Pat. No. 5,641,870; Zapata et al., Protein Eng. 8(10): 1057-1062 [1995]); single-chain antibody molecules; and multispecific antibodies formed from antibody fragments.
- a functional fragment or analog of an antibody is a compound having qualitative biological activity in common with a full-length antibody.
- a functional fragment or analog of an anti-IgE antibody is one that can bind to an IgE immunoglobulin in such a manner so as to prevent or substantially reduce the ability of such molecule from having the ability to bind to the high affinity receptor, Fc ⁇ RI.
- Papain digestion of antibodies produces two identical antigen-binding fragments, called “Fab” fragments, and a residual “Fc” fragment, a designation reflecting the ability to crystallize readily.
- the Fab fragment consists of an entire L chain along with the variable region domain of the H chain (V H ), and the first constant domain of one heavy chain (C H 1).
- Each Fab fragment is monovalent with respect to antigen binding, i.e., it has a single antigen-binding site.
- Pepsin treatment of an antibody yields a single large F(ab′) 2 fragment that roughly corresponds to two disulfide linked Fab fragments having divalent antigen-binding activity and is still capable of cross-linking antigen.
- Fab′ fragments differ from Fab fragments by having additional few residues at the carboxy terminus of the C H 1 domain including one or more cysteines from the antibody hinge region.
- Fab′-SH is the designation herein for Fab′ in which the cysteine residue(s) of the constant domains bear a free thiol group.
- F(ab′) 2 antibody fragments originally were produced as pairs of Fab′ fragments that have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
- the “Fc” fragment comprises the carboxy-terminal portions of both H chains held together by disulfides.
- the effector functions of antibodies are determined by sequences in the Fc region, which region is also the part recognized by Fc receptors (FcR) found on certain types of cells.
- “Fv” is the minimum antibody fragment that contains a complete antigen-recognition and -binding site. This fragment consists of a dimer of one heavy- and one light-chain variable region domain in tight, non-covalent association. From the folding of these two domains emanate six hypervariable loops (three loops each from the H and L chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
- Single-chain Fv also abbreviated as “sFv” or “scFv” are antibody fragments that comprise the V H and V L antibody domains connected into a single polypeptide chain.
- the sFv polypeptide further comprises a polypeptide linker between the V H and V L domains that enables the sFv to form the desired structure for antigen binding.
- diabodies refers to small antibody fragments prepared by constructing sFv fragments (see preceding paragraph) with short linkers (about 5-10 residues) between the V H and V L domains such that inter-chain but not intra-chain pairing of the V domains is achieved, resulting in a bivalent fragment, i.e., fragment having two antigen-binding sites.
- Bispecific diabodies are heterodimers of two “crossover” sFv fragments in which the V H and V L domains of the two antibodies are present on different polypeptide chains.
- Diabodies are described more fully in, for example, EP 404,097; WO 93/11161; and Hollinger et al., Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993).
- an antibody that “internalizes” is one that is taken up by (i.e., enters) the cell upon binding to an antigen on a mammalian cell (e.g., a cell surface polypeptide or receptor).
- the internalizing antibody will of course include antibody fragments, human or chimeric antibody, and antibody conjugates.
- internalization in vivo is contemplated.
- the number of antibody molecules internalized will be sufficient or adequate to kill a cell or inhibit its growth, especially an infected cell.
- the uptake of a single antibody molecule into the cell is sufficient to kill the target cell to which the antibody binds.
- certain toxins are highly potent in killing such that internalization of one molecule of the toxin conjugated to the antibody is sufficient to kill the infected cell.
- an antibody is said to be “immunospecific,” “specific for” or to “specifically bind” an antigen if it reacts at a detectable level with the antigen, preferably with an affinity constant, K a , of greater than or equal to about 10 4 M ⁇ 1 , or greater than or equal to about 10 5 M ⁇ 1 , greater than or equal to about 10 6 M ⁇ 1 , greater than or equal to about 10 7 M ⁇ 1 , or greater than or equal to 10 8 M ⁇ 1 .
- HuM2e antibody specifically binds to M2e if it binds with a K D of less than or equal to 10 ⁇ 4 M, less than or equal to about 10 ⁇ 5 M, less than or equal to about 10 ⁇ 6 M, less than or equal to 10 ⁇ 7 M, or less than or equal to 10 ⁇ 8 M.
- K D dissociation constant
- Affinities of antibodies can be readily determined using conventional techniques, for example, those described by Scatchard et al. ( Ann. N.Y. Acad. Sci. USA 51:660 (1949)).
- Binding properties of an antibody to antigens, cells or tissues thereof may generally be determined and assessed using immunodetection methods including, for example, immunofluorescence-based assays, such as immuno-histochemistry (IHC) and/or fluorescence-activated cell sorting (FACS).
- immunodetection methods including, for example, immunofluorescence-based assays, such as immuno-histochemistry (IHC) and/or fluorescence-activated cell sorting (FACS).
- an antibody having a “biological characteristic” of a designated antibody is one that possesses one or more of the biological characteristics of that antibody which distinguish it from other antibodies.
- an antibody with a biological characteristic of a designated antibody will bind the same epitope as that bound by the designated antibody and/or have a common effector function as the designated antibody.
- antagonist antibody is used in the broadest sense, and includes an antibody that partially or fully blocks, inhibits, or neutralizes a biological activity of an epitope, polypeptide, or cell that it specifically binds.
- Methods for identifying antagonist antibodies may comprise contacting a polypeptide or cell specifically bound by a candidate antagonist antibody with the candidate antagonist antibody and measuring a detectable change in one or more biological activities normally associated with the polypeptide or cell.
- an “antibody that inhibits the growth of infected cells” or a “growth inhibitory” antibody is one that binds to and results in measurable growth inhibition of infected cells expressing or capable of expressing an M2e epitope bound by an antibody.
- Preferred growth inhibitory antibodies inhibit growth of infected cells by greater than 20%, preferably from about 20% to about 50%, and even more preferably, by greater than 50% (e.g., from about 50% to about 100%) as compared to the appropriate control, the control typically being infected cells not treated with the antibody being tested.
- Growth inhibition can be measured at an antibody concentration of about 0.1 to 30 ⁇ g/ml or about 0.5 nM to 200 nM in cell culture, where the growth inhibition is determined 1-10 days after exposure of the infected cells to the antibody. Growth inhibition of infected cells in vivo can be determined in various ways known in the art.
- the antibody is growth inhibitory in vivo if administration of the antibody at about 1 ⁇ g/kg to about 100 mg/kg body weight results in reduction the percent of infected cells or total number of infected cells within about 5 days to 3 months from the first administration of the antibody, preferably within about 5 to 30 days.
- An antibody that “induces apoptosis” is one which induces programmed cell death as determined by binding of annexin V, fragmentation of DNA, cell shrinkage, dilation of endoplasmic reticulum, cell fragmentation, and/or formation of membrane vesicles (called apoptotic bodies).
- the cell is an infected cell.
- phosphatidyl serine (PS) translocation can be measured by annexin binding; DNA fragmentation can be evaluated through DNA laddering; and nuclear/chromatin condensation along with DNA fragmentation can be evaluated by any increase in hypodiploid cells.
- PS phosphatidyl serine
- the antibody that induces apoptosis is one that results in about 2 to 50 fold, preferably about 5 to 50 fold, and most preferably about 10 to 50 fold, induction of annexin binding relative to untreated cell in an annexin binding assay.
- Antibody effector functions refer to those biological activities attributable to the Fc region (a native sequence Fc region or amino acid sequence variant Fc region) of an antibody, and vary with the antibody isotype. Examples of antibody effector functions include: C1q binding and complement dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g., B cell receptor); and B cell activation.
- ADCC antibody-dependent cell-mediated cytotoxicity
- FcRs Fc receptors
- cytotoxic cells e.g., Natural Killer (NK) cells, neutrophils, and macrophages
- NK cells Natural Killer cells
- neutrophils neutrophils
- macrophages cytotoxic cells
- the antibodies “arm” the cytotoxic cells and are required for such killing.
- the primary cells for mediating ADCC, NK cells express Fc ⁇ RIII only, whereas monocytes express Fc ⁇ RI, Fc ⁇ RII and Fc ⁇ RIII.
- ADCC activity of a molecule of interest is summarized in Table 3 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol 9:457-92 (1991).
- an in vitro ADCC assay such as that described in U.S. Pat. No. 5,500,362 or U.S. Pat. No. 5,821,337 may be performed.
- Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells.
- PBMC peripheral blood mononuclear cells
- NK Natural Killer
- ADCC activity of the molecule of interest may be assessed in vivo, e.g., in a animal model such as that disclosed in Clynes et al., PNAS (USA) 95:652-656 (1998).
- Fc receptor or “FcR” describes a receptor that binds to the Fc region of an antibody.
- the FcR is a native sequence human FcR.
- a preferred FcR is one that binds an IgG antibody (a gamma receptor) and includes receptors of the Fc ⁇ RI, Fc ⁇ RII, and Fc ⁇ RIII subclasses, including allelic variants and alternatively spliced forms of these receptors.
- FC ⁇ RII receptors include Fc ⁇ RIIA (an “activating receptor”) and Fc ⁇ RIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof.
- Activating receptor Fc ⁇ RIIA contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain.
- Inhibiting receptor Fc ⁇ RIIB contains an immunoreceptor tyrosine-based inhibition motif (ITIM) in its cytoplasmic domain.
- ITAM immunoreceptor tyrosine-based activation motif
- ITIM immunoreceptor tyrosine-based inhibition motif
- FcR FcR
- FcRn neonatal receptor
- Human effector cells are leukocytes that express one or more FcRs and perform effector functions. Preferably, the cells express at least Fc ⁇ RIII and perform ADCC effector function. Examples of human leukocytes that mediate ADCC include PBMC, NK cells, monocytes, cytotoxic T cells and neutrophils; with PBMCs and NK cells being preferred.
- the effector cells may be isolated from a native source, e.g., from blood.
- “Complement dependent cytotoxicity” or “CDC” refers to the lysis of a target cell in the presence of complement. Activation of the classical complement pathway is initiated by the binding of the first component of the complement system (C1q) to antibodies (of the appropriate subclass) that are bound to their cognate antigen.
- C1q the first component of the complement system
- a CDC assay e.g., as described in Gazzano-Santoro et al., J. Immunol. Methods 202:163 (1996), may be performed.
- influenza A and “Influenzavirus A” refer to a genus of the Orthomyxoviridae family of viruses.
- Influenzavirus A includes only one species: influenza A virus which causes influenza in birds, humans, pigs, and horses. Strains of all subtypes of influenza A virus have been isolated from wild birds, although disease is uncommon. Some isolates of influenza A virus cause severe disease both in domestic poultry and, rarely, in humans.
- a “mammal” for purposes of treating n infection refers to any mammal, including humans, domestic and farm animals, and zoo, sports, or pet animals, such as dogs, cats, cattle, horses, sheep, pigs, goats, rabbits, etc.
- the mammal is human.
- Treating” or “treatment” or “alleviation” refers to both therapeutic treatment and prophylactic or preventative measures; wherein the object is to prevent or slow down (lessen) the targeted pathologic condition or disorder.
- Those in need of treatment include those already with the disorder as well as those prone to have the disorder or those in whom the disorder is to be prevented.
- a subject or mammal is successfully “treated” for an infection if, after receiving a therapeutic amount of an antibody according to the methods of the present invention, the patient shows observable and/or measurable reduction in or absence of one or more of the following: reduction in the number of infected cells or absence of the infected cells; reduction in the percent of total cells that are infected; and/or relief to some extent, one or more of the symptoms associated with the specific infection; reduced morbidity and mortality, and improvement in quality of life issues.
- the above parameters for assessing successful treatment and improvement in the disease are readily measurable by routine procedures familiar to a physician.
- terapéuticaally effective amount refers to an amount of an antibody or a drug effective to “treat” a disease or disorder in a subject or mammal. See preceding definition of “treating.”
- Chronic administration refers to administration of the agent(s) in a continuous mode as opposed to an acute mode, so as to maintain the initial therapeutic effect (activity) for an extended period of time.
- Intermittent administration is treatment that is not consecutively done without interruption, but rather is cyclic in nature.
- Administration “in combination with” one or more further therapeutic agents includes simultaneous (concurrent) and consecutive administration in any order.
- Carriers as used herein include pharmaceutically acceptable carriers, excipients, or stabilizers that are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed. Often the physiologically acceptable carrier is an aqueous pH buffered solution.
- physiologically acceptable carriers include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid; low molecular weight (less than about 10 residues) polypeptide; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and/or nonionic surfactants such as TWEENTM polyethylene glycol (PEG), and PLURONICSTM.
- buffers such as phosphate, citrate, and other organic acids
- antioxidants including ascorbic acid
- proteins such as serum albumin, ge
- cytotoxic agent refers to a substance that inhibits or prevents the function of cells and/or causes destruction of cells.
- the term is intended to include radioactive isotopes (e.g., At 211 , I 131 , I 125 , Y 90 , Re 186 , Re 188 , Sm 153 , Bi 212 , P 32 and radioactive isotopes of Lu), chemotherapeutic agents e.g., methotrexate, adriamicin, vinca alkaloids (vincristine, vinblastine, etoposide), doxorubicin, melphalan, mitomycin C, chlorambucil, daunorubicin or other intercalating agents, enzymes and fragments thereof such as nucleolytic enzymes, antibiotics, and toxins such as small molecule toxins or enzymatically active toxins of bacterial, fungal, plant or animal origin, including fragments and/or variants thereof, and the various anti
- a “growth inhibitory agent” when used herein refers to a compound or composition which inhibits growth of a cell, either in vitro or in vivo.
- growth inhibitory agents include agents that block cell cycle progression, such as agents that induce G1 arrest and M-phase arrest.
- Classical M-phase blockers include the vinca alkaloids (vincristine, vinorelbine and vinblastine), taxanes, and topoisomerase II inhibitors such as doxorubicin, epirubicin, daunorubicin, etoposide, and bleomycin.
- DNA alkylating agents such as tamoxifen, prednisone, dacarbazine, mechlorethamine, cisplatin, methotrexate, 5-fluorouracil, and ara-C.
- DNA alkylating agents such as tamoxifen, prednisone, dacarbazine, mechlorethamine, cisplatin, methotrexate, 5-fluorouracil, and ara-C.
- DNA alkylating agents such as tamoxifen, prednisone, dacarbazine, mechlorethamine, cisplatin, methotrexate, 5-fluorouracil, and ara-C.
- Docetaxel (TAXOTERETM, Rhone-Poulenc Rorer), derived from the European yew, is a semisynthetic analogue of paclitaxel (TAXOL®, Bristol-Myers Squibb). Paclitaxel and docetaxel promote the assembly of microtubules from tubulin dimers and stabilize microtubules by preventing depolymerization, which results in the inhibition of mitosis in cells.
- Label refers to a detectable compound or composition that is conjugated directly or indirectly to the antibody so as to generate a “labeled” antibody.
- the label may be detectable by itself (e.g., radioisotope labels or fluorescent labels) or, in the case of an enzymatic label, may catalyze chemical alteration of a substrate compound or composition that is detectable.
- epitope tagged refers to a chimeric polypeptide comprising a polypeptide fused to a “tag polypeptide.”
- the tag polypeptide has enough residues to provide an epitope against which an antibody can be made, yet is short enough such that it does not interfere with activity of the polypeptide to which it is fused.
- the tag polypeptide is also preferably fairly unique so that the antibody does not substantially cross-react with other epitopes.
- Suitable tag polypeptides generally have at least six amino acid residues and usually between about 8 and 50 amino acid residues (preferably, between about 10 and 20 amino acid residues).
- a “small molecule” is defined herein to have a molecular weight below about 500 Daltons.
- nucleic acid and “polynucleotide” are used interchangeably herein to refer to single- or double-stranded RNA, DNA, or mixed polymers.
- Polynucleotides may include genomic sequences, extra-genomic and plasmid sequences, and smaller engineered gene segments that express, or may be adapted to express polypeptides.
- isolated nucleic acid is a nucleic acid that is substantially separated from other genome DNA sequences as well as proteins or complexes such as ribosomes and polymerases, which naturally accompany a native sequence.
- the term embraces a nucleic acid sequence that has been removed from its naturally occurring environment, and includes recombinant or cloned DNA isolates and chemically synthesized analogues or analogues biologically synthesized by heterologous systems.
- a substantially pure nucleic acid includes isolated forms of the nucleic acid. Of course, this refers to the nucleic acid as originally isolated and does not exclude genes or sequences later added to the isolated nucleic acid by the hand of man.
- polypeptide is used in its conventional meaning, i.e., as a sequence of amino acids.
- the polypeptides are not limited to a specific length of the product.
- Peptides, oligopeptides, and proteins are included within the definition of polypeptide, and such terms may be used interchangeably herein unless specifically indicated otherwise.
- This term also does not refer to or exclude post-expression modifications of the polypeptide, for example, glycosylations, acetylations, phosphorylations and the like, as well as other modifications known in the art, both naturally occurring and non-naturally occurring.
- a polypeptide may be an entire protein, or a subsequence thereof.
- Particular polypeptides of interest in the context of this invention are amino acid subsequences comprising CDRs and being capable of binding an antigen or Influenza A-infected cell.
- isolated polypeptide is one that has been identified and separated and/or recovered from a component of its natural environment.
- the isolated polypeptide will be purified (1) to greater than 95% by weight of polypeptide as determined by the Lowry method, and most preferably more than 99% by weight, (2) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE under reducing or non-reducing conditions using Coomassie blue or, preferably, silver stain.
- Isolated polypeptide includes the polypeptide in situ within recombinant cells since at least one component of the polypeptide's natural environment will not be present. Ordinarily, however, isolated polypeptide will be prepared by at least one purification step.
- a “native sequence” polynucleotide is one that has the same nucleotide sequence as a polynucleotide derived from nature.
- a “native sequence” polypeptide is one that has the same amino acid sequence as a polypeptide (e.g., antibody) derived from nature (e.g., from any species).
- Such native sequence polynucleotides and polypeptides can be isolated from nature or can be produced by recombinant or synthetic means.
- a polynucleotide “variant,” as the term is used herein, is a polynucleotide that typically differs from a polynucleotide specifically disclosed herein in one or more substitutions, deletions, additions and/or insertions. Such variants may be naturally occurring or may be synthetically generated, for example, by modifying one or more of the polynucleotide sequences of the invention and evaluating one or more biological activities of the encoded polypeptide as described herein and/or using any of a number of techniques well known in the art.
- a polypeptide “variant,” as the term is used herein, is a polypeptide that typically differs from a polypeptide specifically disclosed herein in one or more substitutions, deletions, additions and/or insertions. Such variants may be naturally occurring or may be synthetically generated, for example, by modifying one or more of the above polypeptide sequences of the invention and evaluating one or more biological activities of the polypeptide as described herein and/or using any of a number of techniques well known in the art.
- Modifications may be made in the structure of the polynucleotides and polypeptides of the present invention and still obtain a functional molecule that encodes a variant or derivative polypeptide with desirable characteristics.
- a functional molecule that encodes a variant or derivative polypeptide with desirable characteristics.
- one skilled in the art will typically change one or more of the codons of the encoding DNA sequence.
- amino acids may be substituted for other amino acids in a protein structure without appreciable loss of its ability to bind other polypeptides (e.g., antigens) or cells. Since it is the binding capacity and nature of a protein that defines that protein's biological functional activity, certain amino acid sequence substitutions can be made in a protein sequence, and, of course, its underlying DNA coding sequence, and nevertheless obtain a protein with like properties. It is thus contemplated that various changes may be made in the peptide sequences of the disclosed compositions, or corresponding DNA sequences that encode said peptides without appreciable loss of their biological utility or activity.
- a polypeptide variant will contain one or more conservative substitutions.
- a “conservative substitution” is one in which an amino acid is substituted for another amino acid that has similar properties, such that one skilled in the art of peptide chemistry would expect the secondary structure and hydropathic nature of the polypeptide to be substantially unchanged.
- the hydropathic index of amino acids may be considered.
- the importance of the hydropathic amino acid index in conferring interactive biologic function on a protein is generally understood in the art (Kyte and Doolittle, 1982). It is accepted that the relative hydropathic character of the amino acid contributes to the secondary structure of the resultant protein, which in turn defines the interaction of the protein with other molecules, for example, enzymes, substrates, receptors, DNA, antibodies, antigens, and the like.
- Each amino acid has been assigned a hydropathic index on the basis of its hydrophobicity and charge characteristics (Kyte and Doolittle, 1982).
- hydrophilicity values have been assigned to amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.0 ⁇ 1); glutamate (+3.0 ⁇ 1); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); threonine ( ⁇ 0.4); proline ( ⁇ 0.5 ⁇ 1); alanine ( ⁇ 0.5); histidine ( ⁇ 0.5); cysteine ( ⁇ 1.0); methionine ( ⁇ 1.3); valine ( ⁇ 1.5); leucine ( ⁇ 1.8); isoleucine ( ⁇ 1.8); tyrosine ( ⁇ 2.3); phenylalanine ( ⁇ 2.5); tryptophan ( ⁇ 3.4).
- an amino acid can be substituted for another having a similar hydrophilicity value and still obtain a biologically equivalent, and in particular, an immunologically equivalent protein.
- substitution of amino acids whose hydrophilicity values are within ⁇ 2 is preferred, those within ⁇ 1 are particularly preferred, and those within ⁇ 0.5 are even more particularly preferred.
- amino acid substitutions are generally therefore based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like.
- Exemplary substitutions that take various of the foregoing characteristics into consideration are well known to those of skill in the art and include: arginine and lysine; glutamate and aspartate; serine and threonine; glutamine and asparagine; and valine, leucine and isoleucine.
- Amino acid substitutions may further be made on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity and/or the amphipathic nature of the residues.
- negatively charged amino acids include aspartic acid and glutamic acid
- positively charged amino acids include lysine and arginine
- amino acids with uncharged polar head groups having similar hydrophilicity values include leucine, isoleucine and valine; glycine and alanine; asparagine and glutamine; and serine, threonine, phenylalanine and tyrosine.
- variant polypeptides differ from a native sequence by substitution, deletion or addition of five amino acids or fewer.
- Variants may also (or alternatively) be modified by, for example, the deletion or addition of amino acids that have minimal influence on the immunogenicity, secondary structure and hydropathic nature of the polypeptide.
- Polypeptides may comprise a signal (or leader) sequence at the N-terminal end of the protein, which co-translationally or post-translationally directs transfer of the protein.
- the polypeptide may also be conjugated to a linker or other sequence for ease of synthesis, purification or identification of the polypeptide (e.g., poly-His), or to enhance binding of the polypeptide to a solid support.
- a polypeptide may be conjugated to an immunoglobulin Fc region.
- two sequences are said to be “identical” if the sequence of nucleotides or amino acids in the two sequences is the same when aligned for maximum correspondence, as described below. Comparisons between two sequences are typically performed by comparing the sequences over a comparison window to identify and compare local regions of sequence similarity.
- a “comparison window” as used herein refers to a segment of at least about 20 contiguous positions, usually 30 to about 75, 40 to about 50, in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
- Optimal alignment of sequences for comparison may be conducted using the Megalign program in the Lasergene suite of bioinformatics software (DNASTAR, Inc., Madison, Wis.), using default parameters.
- This program embodies several alignment schemes described in the following references: Dayhoff, M. O. (1978) A model of evolutionary change in proteins—Matrices for detecting distant relationships. In Dayhoff, M. O. (ed.) Atlas of Protein Sequence and Structure, National Biomedical Research Foundation, Washington D.C. Vol. 5, Suppl. 3, pp. 345-358; Hein J. (1990) Unified Approach to Alignment and Phylogenes pp. 626-645 Methods in Enzymology vol.
- optimal alignment of sequences for comparison may be conducted by the local identity algorithm of Smith and Waterman (1981) Add. APL. Math 2:482, by the identity alignment algorithm of Needleman and Wunsch (1970) J. Mol. Biol. 48:443, by the search for similarity methods of Pearson and Lipman (1988) Proc. Natl. Acad. Sci. USA 85: 2444, by computerized implementations of these algorithms (GAP, BESTFIT, BLAST, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group (GCG), 575 Science Dr., Madison, Wis.), or by inspection.
- BLAST and BLAST 2.0 are described in Altschul et al. (1977) Nucl. Acids Res. 25:3389-3402 and Altschul et al. (1990) J. Mol. Biol. 215:403-410, respectively.
- BLAST and BLAST 2.0 can be used, for example with the parameters described herein, to determine percent sequence identity for the polynucleotides and polypeptides of the invention.
- Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information.
- cumulative scores can be calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always >0) and N (penalty score for mismatching residues; always ⁇ 0). Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached.
- the BLAST algorithm parameters W, T and X determine the sensitivity and speed of the alignment.
- a scoring matrix can be used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached.
- the BLAST algorithm parameters W, T and X determine the sensitivity and speed of the alignment.
- the “percentage of sequence identity” is determined by comparing two optimally aligned sequences over a window of comparison of at least 20 positions, wherein the portion of the polynucleotide or polypeptide sequence in the comparison window may comprise additions or deletions (i.e., gaps) of 20 percent or less, usually 5 to 15 percent, or 10 to 12 percent, as compared to the reference sequences (which does not comprise additions or deletions) for optimal alignment of the two sequences.
- the percentage is calculated by determining the number of positions at which the identical nucleic acid bases or amino acid residues occur in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the reference sequence (i.e., the window size) and multiplying the results by 100 to yield the percentage of sequence identity.
- “Homology” refers to the percentage of residues in the polynucleotide or polypeptide sequence variant that are identical to the non-variant sequence after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent homology.
- polynucleotide and polypeptide variants have at least 70%, at least 75%, at least 80%, at least 90%, at least 95%, at least 98%, or at least 99% polynucleotide or polypeptide homology with a polynucleotide or polypeptide described herein.
- Vector includes shuttle and expression vectors.
- the plasmid construct will also include an origin of replication (e.g., the ColE1 origin of replication) and a selectable marker (e.g., ampicillin or tetracycline resistance), for replication and selection, respectively, of the plasmids in bacteria.
- An “expression vector” refers to a vector that contains the necessary control sequences or regulatory elements for expression of the antibodies including antibody fragment of the invention, in bacterial or eukaryotic cells. Suitable vectors are disclosed below.
- the present invention includes HuM2e antibodies comprising a polypeptide of the present invention, including those polypeptides encoded by a polynucleotide sequence set forth in Example 1 and amino acid sequences set forth in Example 1 and 2, and fragments and variants thereof.
- the antibody is an antibody designated herein as 8i10, 21B15, 23K12, 3241_G23, 3244_I10, 3243_J07, 3259_J21, 3245_O19, 3244_H04, 3136_G05, 3252_C13, 3255_J06, 3420_I23, 3139_P23, 3248_P18, 3253_P10, 3260_D19, 3362_B11, or 3242_P05.
- These antibodies preferentially bind to or specifically bind to influenza A infected cells as compared to uninfected control cells of the same cell type.
- the antibodies of the present invention bind to the M2 protein.
- the present invention provides HuM2e antibodies that bind to epitopes within M2e that are only present in the native conformation, i.e., as expressed in cells.
- these antibodies fail to specifically bind to an isolated M2e polypeptide, e.g., the 23 amino acid residue M2e fragment. It is understood that these antibodies recognize non-linear (i.e. conformational) epitope(s) of the M2 peptide.
- M2 protein may be used as vaccines to prevent the development of influenza infection within a subject.
- the antibodies of the present invention may be polyclonal or monoclonal antibodies. However, in preferred embodiments, they are monoclonal. In particular embodiments, antibodies of the present invention are fully human antibodies. Methods of producing polyclonal and monoclonal antibodies are known in the art and described generally, e.g., in U.S. Pat. No. 6,824,780. Typically, the antibodies of the present invention are produced recombinantly, using vectors and methods available in the art, as described further below. Human antibodies may also be generated by in vitro activated B cells (see U.S. Pat. Nos. 5,567,610 and 5,229,275).
- Human antibodies may also be produced in transgenic animals (e.g., mice) that are capable of producing a full repertoire of human antibodies in the absence of endogenous immunoglobulin production.
- transgenic animals e.g., mice
- J H antibody heavy-chain joining region
- Such animals may be genetically engineered to produce human antibodies comprising a polypeptide of the present invention.
- antibodies of the present invention are chimeric antibodies that comprise sequences derived from both human and non-human sources.
- these chimeric antibodies are humanized or PrimatizedTM.
- humanized antibodies are typically human antibodies in which some hypervariable region residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies.
- chimeric antibodies also include fully human antibodies wherein the human hypervariable region or one or more CDRs are retained, but one or more other regions of sequence have been replaced by corresponding sequences from a non-human animal.
- chimeric antibodies are prepared by a process of analysis of the parental sequences and various conceptual chimeric products using three-dimensional models of the parental human and non-human sequences. Three-dimensional immunoglobulin models are commonly available and are familiar to those skilled in the art. Computer programs are available which illustrate and display probable three-dimensional conformational structures of selected candidate immunoglobulin sequences.
- antibodies can be divided into five different classes, based on differences in the amino acid sequences in the constant region of the heavy chains. All immunoglobulins within a given class have very similar heavy chain constant regions. These differences can be detected by sequence studies or more commonly by serological means (i.e. by the use of antibodies directed to these differences).
- Antibodies, or fragments thereof, of the present invention may be any class, and may, therefore, have a gamma, mu, alpha, delta, or epsilon heavy chain.
- a gamma chain may be gamma 1, gamma 2, gamma 3, or gamma 4; and an alpha chain may be alpha 1 or alpha 2.
- an antibody of the present invention, or fragment thereof is an IgG.
- IgG is considered the most versatile immunoglobulin, because it is capable of carrying out all of the functions of immunoglobulin molecules.
- IgG is the major Ig in serum, and the only class of Ig that crosses the placenta. IgG also fixes complement, although the IgG4 subclass does not. Macrophages, monocytes, PMN's and some lymphocytes have Fc receptors for the Fc region of IgG. Not all subclasses bind equally well: IgG2 and IgG4 do not bind to Fc receptors.
- IgG is an opsonin that enhances phagocytosis. Binding of IgG to Fc receptors on other types of cells results in the activation of other functions.
- Antibodies of the present invention may be of any IgG subclass.
- an antibody, or fragment thereof, of the present invention is an IgE.
- IgE is the least common serum Ig since it binds very tightly to Fc receptors on basophils and mast cells even before interacting with antigen. As a consequence of its binding to basophils and mast cells, IgE is involved in allergic reactions. Binding of the allergen to the IgE on the cells results in the release of various pharmacological mediators that result in allergic symptoms. IgE also plays a role in parasitic helminth diseases. Eosinophils have Fc receptors for IgE and binding of eosinophils to IgE-coated helminths results in killing of the parasite. IgE does not fix complement.
- antibodies of the present invention, and fragments thereof comprise a variable light chain that is either kappa or lambda.
- the lamba chain may be any of subtype, including, e.g., lambda 1, lambda 2, lambda 3, and lambda 4.
- the present invention further provides antibody fragments comprising a polypeptide of the present invention.
- antibody fragments comprising a polypeptide of the present invention.
- the smaller size of the fragments allows for rapid clearance, and may lead to improved access to certain tissues, such as solid tumors.
- antibody fragments include: Fab, Fab′, F(ab′) 2 and Fv fragments; diabodies; linear antibodies; single-chain antibodies; and multispecific antibodies formed from antibody fragments.
- F(ab′) 2 fragments can be isolated directly from recombinant host cell culture.
- Fab and F(ab′) 2 fragment with increased in vivo half-life comprising a salvage receptor binding epitope residues are described in U.S. Pat. No. 5,869,046. Other techniques for the production of antibody fragments will be apparent to the skilled practitioner.
- the antibody of choice is a single chain Fv fragment (scFv). See WO 93/16185; U.S. Pat. Nos. 5,571,894; and 5,587,458.
- Fv and sFv are the only species with intact combining sites that are devoid of constant regions. Thus, they are suitable for reduced nonspecific binding during in vivo use.
- sFv fusion proteins may be constructed to yield fusion of an effector protein at either the amino or the carboxy terminus of an sFv. See Antibody Engineering, ed. Borrebaeck, supra.
- the antibody fragment may also be a “linear antibody”, e.g., as described in U.S. Pat. No. 5,641,870 for example. Such linear antibody fragments may be monospecific or bispecific.
- antibodies of the present invention are bispecific or multi-specific.
- Bispecific antibodies are antibodies that have binding specificities for at least two different epitopes.
- Exemplary bispecific antibodies may bind to two different epitopes of a single antigen.
- Other such antibodies may combine a first antigen binding site with a binding site for a second antigen.
- an anti-M2e arm may be combined with an arm that binds to a triggering molecule on a leukocyte, such as a T-cell receptor molecule (e.g., CD3), or Fc receptors for IgG (Fc ⁇ R), such as Fc ⁇ RI (CD64), Fc ⁇ RII (CD32) and Fc ⁇ RIII (CD16), so as to focus and localize cellular defense mechanisms to the infected cell.
- a triggering molecule on a leukocyte such as a T-cell receptor molecule (e.g., CD3), or Fc receptors for IgG (Fc ⁇ R), such as Fc ⁇ RI (CD64), Fc ⁇ RII (CD32) and Fc ⁇ RIII (CD16), so as to focus and localize cellular defense mechanisms to the infected cell.
- Bispecific antibodies may also be used to localize cytotoxic agents to infected cells.
- bispecific antibodies possess an M2e-binding arm and an arm that binds the cytotoxic agent (e.g., saporin, anti-interferon- ⁇ , vinca alkaloid, ricin A chain, methotrexate or radioactive isotope hapten).
- Bispecific antibodies can be prepared as full length antibodies or antibody fragments (e.g., F(ab′) 2 bispecific antibodies).
- WO 96/16673 describes a bispecific anti-ErbB2/anti-Fc ⁇ RIII antibody and U.S. Pat. No. 5,837,234 discloses a bispecific anti-ErbB2/anti-Fc ⁇ RI antibody. A bispecific anti-ErbB2/Fc ⁇ antibody is shown in WO98/02463.
- U.S. Pat. No. 5,821,337 teaches a bispecific anti-ErbB2/anti-CD3 antibody.
- bispecific antibodies are known in the art. Traditional production of full length bispecific antibodies is based on the co-expression of two immunoglobulin heavy chain-light chain pairs, where the two chains have different specificities (Millstein et al., Nature, 305:537-539 (1983)). Because of the random assortment of immunoglobulin heavy and light chains, these hybridomas (quadromas) produce a potential mixture of ten different antibody molecules, of which only one has the correct bispecific structure. Purification of the correct molecule, which is usually done by affinity chromatography steps, is rather cumbersome, and the product yields are low. Similar procedures are disclosed in WO 93/08829, and in Traunecker et al., EMBO J., 10:3655-3659 (1991).
- antibody variable domains with the desired binding specificities are fused to immunoglobulin constant domain sequences.
- the fusion is with an Ig heavy chain constant domain, comprising at least part of the hinge, C H 2, and C H 3 regions. It is preferred to have the first heavy-chain constant region (C H 1) containing the site necessary for light chain bonding, present in at least one of the fusions.
- DNAs encoding the immunoglobulin heavy chain fusions and, if desired, the immunoglobulin light chain are inserted into separate expression vectors, and are co-transfected into a suitable host cell.
- the bispecific antibodies are composed of a hybrid immunoglobulin heavy chain with a first binding specificity in one arm, and a hybrid immunoglobulin heavy chain-light chain pair (providing a second binding specificity) in the other arm. It was found that this asymmetric structure facilitates the separation of the desired bispecific compound from unwanted immunoglobulin chain combinations, as the presence of an immunoglobulin light chain in only one half of the bispecific molecule provides for a facile way of separation. This approach is disclosed in WO 94/04690. For further details of generating bispecific antibodies see, for example, Suresh et al., Methods in Enzymology, 121:210 (1986).
- the interface between a pair of antibody molecules can be engineered to maximize the percentage of heterodimers that are recovered from recombinant cell culture.
- the preferred interface comprises at least a part of the C H 3 domain.
- one or more small amino acid side chains from the interface of the first antibody molecule are replaced with larger side chains (e.g., tyrosine or tryptophan).
- Compensatory “cavities” of identical or similar size to the large side chain(s) are created on the interface of the second antibody molecule by replacing large amino acid side chains with smaller ones (e.g., alanine or threonine). This provides a mechanism for increasing the yield of the heterodimer over other unwanted end-products such as homodimers.
- Bispecific antibodies include cross-linked or “heteroconjugate” antibodies.
- one of the antibodies in the heteroconjugate can be coupled to avidin, the other to biotin.
- Such antibodies have, for example, been proposed to target immune system cells to unwanted cells (U.S. Pat. No. 4,676,980), and for treatment of HIV infection (WO 91/00360, WO 92/200373, and EP 03089).
- Heteroconjugate antibodies may be made using any convenient cross-linking methods. Suitable cross-linking agents are well known in the art, and are disclosed in U.S. Pat. No. 4,676,980, along with a number of cross-linking techniques.
- bispecific antibodies can be prepared using chemical linkage.
- Brennan et al., Science, 229: 81 (1985) describe a procedure wherein intact antibodies are proteolytically cleaved to generate F(ab′) 2 fragments. These fragments are reduced in the presence of the dithiol complexing agent, sodium arsenite, to stabilize vicinal dithiols and prevent intermolecular disulfide formation.
- the Fab′ fragments generated are then converted to thionitrobenzoate (TNB) derivatives.
- One of the Fab′-TNB derivatives is then reconverted to the Fab′-thiol by reduction with mercaptoethylamine and is mixed with an equimolar amount of the other Fab′-TNB derivative to form the bispecific antibody.
- the bispecific antibodies produced can be used as agents for the selective immobilization of enzymes.
- bispecific antibodies have been produced using leucine zippers.
- the leucine zipper peptides from the Fos and Jun proteins were linked to the Fab′ portions of two different antibodies by gene fusion.
- the antibody homodimers were reduced at the hinge region to form monomers and then re-oxidized to form the antibody heterodimers. This method can also be utilized for the production of antibody homodimers.
- the fragments comprise a V H connected to a V L by a linker that is too short to allow pairing between the two domains on the same chain. Accordingly, the V H and V L domains of one fragment are forced to pair with the complementary V L and V H domains of another fragment, thereby forming two antigen-binding sites.
- Another strategy for making bispecific antibody fragments by the use of single-chain Fv (sFv) dimers has also been reported. See Gruber et al., J. Immunol., 152:5368 (1994).
- Antibodies with more than two valencies are contemplated.
- trispecific antibodies can be prepared. Tun et al., J. Immunol. 147: 60 (1991).
- a multivalent antibody may be internalized (and/or catabolized) faster than a bivalent antibody by a cell expressing an antigen to which the antibodies bind.
- the antibodies of the present invention can be multivalent antibodies with three or more antigen binding sites (e.g., tetravalent antibodies), which can be readily produced by recombinant expression of nucleic acid encoding the polypeptide chains of the antibody.
- the multivalent antibody can comprise a dimerization domain and three or more antigen binding sites.
- the preferred dimerization domain comprises (or consists of) an Fc region or a hinge region.
- the antibody will comprise an Fc region and three or more antigen binding sites amino-terminal to the Fc region.
- the preferred multivalent antibody herein comprises (or consists of) three to about eight, but preferably four, antigen binding sites.
- the multivalent antibody comprises at least one polypeptide chain (and preferably two polypeptide chains), wherein the polypeptide chain(s) comprise two or more variable domains.
- the polypeptide chain(s) may comprise VD1-(X1) n -VD2-(X2) n -Fc, wherein VD1 is a first variable domain, VD2 is a second variable domain, Fc is one polypeptide chain of an Fc region, X1 and X2 represent an amino acid or polypeptide, and n is 0 or 1.
- the polypeptide chain(s) may comprise: VH-CH1-flexible linker-VH-CH1-Fc region chain; or VH-CH1-VH-CH1-Fc region chain.
- the multivalent antibody herein preferably further comprises at least two (and preferably four) light chain variable domain polypeptides.
- the multivalent antibody herein may, for instance, comprise from about two to about eight light chain variable domain polypeptides.
- the light chain variable domain polypeptides contemplated here comprise a light chain variable domain and, optionally, further comprise a C L domain.
- Antibodies of the present invention further include single chain antibodies.
- antibodies of the present invention are internalizing antibodies.
- Amino acid sequence modification(s) of the antibodies described herein are contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the antibody.
- Amino acid sequence variants of the antibody may be prepared by introducing appropriate nucleotide changes into a polynucleotide that encodes the antibody, or a chain thereof, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of, residues within the amino acid sequences of the antibody. Any combination of deletion, insertion, and substitution may be made to arrive at the final antibody, provided that the final construct possesses the desired characteristics.
- the amino acid changes also may alter post-translational processes of the antibody, such as changing the number or position of glycosylation sites. Any of the variations and modifications described above for polypeptides of the present invention may be included in antibodies of the present invention.
- a useful method for identification of certain residues or regions of an antibody that are preferred locations for mutagenesis is called “alanine scanning mutagenesis” as described by Cunningham and Wells in Science, 244:1081-1085 (1989).
- a residue or group of target residues are identified (e.g., charged residues such as arg, asp, his, lys, and glu) and replaced by a neutral or negatively charged amino acid (most preferably alanine or polyalanine) to affect the interaction of the amino acids with PSCA antigen.
- Those amino acid locations demonstrating functional sensitivity to the substitutions then are refined by introducing further or other variants at, or for, the sites of substitution.
- the site for introducing an amino acid sequence variation is predetermined, the nature of the mutation per se need not be predetermined. For example, to analyze the performance of a mutation at a given site, ala scanning or random mutagenesis is conducted at the target codon or region and the expressed anti-antibody variants are screened for the desired activity.
- Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues.
- terminal insertions include an antibody with an N-terminal methionyl residue or the antibody fused to a cytotoxic polypeptide.
- Other insertional variants of an antibody include the fusion to the N- or C-terminus of the antibody to an enzyme (e.g., for ADEPT) or a polypeptide that increases the serum half-life of the antibody.
- variants are an amino acid substitution variant. These variants have at least one amino acid residue in the antibody molecule replaced by a different residue.
- the sites of greatest interest for substitutional mutagenesis include the hypervariable regions, but FR alterations are also contemplated. Conservative and non-conservative substitutions are contemplated.
- Substantial modifications in the biological properties of the antibody are accomplished by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain.
- cysteine residue not involved in maintaining the proper conformation of the antibody also may be substituted, generally with serine, to improve the oxidative stability of the molecule and prevent aberrant crosslinking.
- cysteine bond(s) may be added to the antibody to improve its stability (particularly where the antibody is an antibody fragment such as an Fv fragment).
- substitutional variant involves substituting one or more hypervariable region residues of a parent antibody.
- the resulting variant(s) selected for further development will have improved biological properties relative to the parent antibody from which they are generated.
- a convenient way for generating such substitutional variants involves affinity maturation using phage display. Briefly, several hypervariable region sites (e.g., 6-7 sites) are mutated to generate all possible amino substitutions at each site.
- the antibody variants thus generated are displayed in a monovalent fashion from filamentous phage particles as fusions to the gene III product of M13 packaged within each particle. The phage-displayed variants are then screened for their biological activity (e.g., binding affinity) as herein disclosed.
- alanine scanning mutagenesis can be performed to identify hypervariable region residues contributing significantly to antigen binding.
- Such contact residues and neighboring residues are candidates for substitution according to the techniques elaborated herein.
- Another type of amino acid variant of the antibody alters the original glycosylation pattern of the antibody. By altering is meant deleting one or more carbohydrate moieties found in the antibody, and/or adding one or more glycosylation sites that are not present in the antibody.
- N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue.
- the tripeptide sequences asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain.
- X is any amino acid except proline
- O-linked glycosylation refers to the attachment of one of the sugars N-aceylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
- glycosylation sites to the antibody is conveniently accomplished by altering the amino acid sequence such that it contains one or more of the above-described tripeptide sequences (for N-linked glycosylation sites).
- the alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the original antibody (for O-linked glycosylation sites).
- the antibody of the invention is modified with respect to effector function, e.g., so as to enhance antigen-dependent cell-mediated cyotoxicity (ADCC) and/or complement dependent cytotoxicity (CDC) of the antibody.
- ADCC antigen-dependent cell-mediated cyotoxicity
- CDC complement dependent cytotoxicity
- This may be achieved by introducing one or more amino acid substitutions in an Fc region of the antibody.
- cysteine residue(s) may be introduced in the Fc region, thereby allowing interchain disulfide bond formation in this region.
- the homodimeric antibody thus generated may have improved internalization capability and/or increased complement-mediated cell killing and antibody-dependent cellular cytotoxicity (ADCC). See Caron et al., J. Exp Med. 176:1191-1195 (1992) and Shopes, B. J. Immunol.
- Homodimeric antibodies with enhanced anti-infection activity may also be prepared using heterobifunctional cross-linkers as described in Wolff et al., Cancer Research 53:2560-2565 (1993).
- an antibody can be engineered which has dual Fc regions and may thereby have enhanced complement lysis and ADCC capabilities. See Stevenson et al., Anti-Cancer Drug Design 3:219-230 (1989).
- a salvage receptor binding epitope refers to an epitope of the Fc region of an IgG molecule (e.g., IgG 1 , IgG 2 , IgG 3 , or IgG 4 ) that is responsible for increasing the in vivo serum half-life of the IgG molecule.
- Antibodies of the present invention may also be modified to include an epitope tag or label, e.g., for use in purification or diagnostic applications.
- the invention also pertains to therapy with immunoconjugates comprising an antibody conjugated to an anti-cancer agent such as a cytotoxic agent or a growth inhibitory agent. Chemotherapeutic agents useful in the generation of such immunoconjugates have been described above.
- Conjugates of an antibody and one or more small molecule toxins such as a calicheamicin, maytansinoids, a trichothene, and CC1065, and the derivatives of these toxins that have toxin activity, are also contemplated herein.
- an antibody (full length or fragments) of the invention is conjugated to one or more maytansinoid molecules.
- Maytansinoids are mitototic inhibitors that act by inhibiting tubulin polymerization. Maytansine was first isolated from the east African shrub Maytenus serrata (U.S. Pat. No. 3,896,111). Subsequently, it was discovered that certain microbes also produce maytansinoids, such as maytansinol and C-3 maytansinol esters (U.S. Pat. No. 4,151,042). Synthetic maytansinol and derivatives and analogues thereof are disclosed, for example, in U.S. Pat. Nos.
- maytansine and maytansinoids have been conjugated to antibodies specifically binding to tumor cell antigens.
- Immunoconjugates containing maytansinoids and their therapeutic use are disclosed, for example, in U.S. Pat. Nos. 5,208,020, 5,416,064 and European Patent EP 0 425 235 B1.
- Liu et al., Proc. Natl. Acad. Sci. USA 93:8618-8623 (1996) described immunoconjugates comprising a maytansinoid designated DM1 linked to the monoclonal antibody C242 directed against human colorectal cancer.
- the conjugate was found to be highly cytotoxic towards cultured colon cancer cells, and showed antitumor activity in an in vivo tumor growth assay.
- Antibody-maytansinoid conjugates are prepared by chemically linking an antibody to a maytansinoid molecule without significantly diminishing the biological activity of either the antibody or the maytansinoid molecule.
- An average of 3-4 maytansinoid molecules conjugated per antibody molecule has shown efficacy in enhancing cytotoxicity of target cells without negatively affecting the function or solubility of the antibody, although even one molecule of toxin/antibody would be expected to enhance cytotoxicity over the use of naked antibody.
- Maytansinoids are well known in the art and can be synthesized by known techniques or isolated from natural sources. Suitable maytansinoids are disclosed, for example, in U.S. Pat. No.
- Preferred maytansinoids are maytansinol and maytansinol analogues modified in the aromatic ring or at other positions of the maytansinol molecule, such as various maytansinol esters.
- linking groups known in the art for making antibody conjugates, including, for example, those disclosed in U.S. Pat. No. 5,208,020 or EP Patent 0 425 235 B1, and Chari et al., Cancer Research 52: 127-131 (1992).
- the linking groups include disulfide groups, thioether groups, acid labile groups, photolabile groups, peptidase labile groups, or esterase labile groups, as disclosed in the above-identified patents, disulfide and thioether groups being preferred.
- Immunoconjugates may be made using a variety of bifunctional protein coupling agents such as N-succinimidyl-3-(2-pyridyldithio)propionate (SPDP), succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate, iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCL), active esters (such as disuccinimidyl suberate), aldehydes (such as glutareldehyde), bis-azido compounds (such as bis (p-azidobenzoyl)hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as toluene 2,6-diisocyanate), and bis-active fluorine compounds (such as 1,5-difluoro-2,4-d
- Particularly preferred coupling agents include N-succinimidyl-3-(2-pyridyldithio)propionate (SPDP) (Carlsson et al., Biochem. J. 173:723-737 [1978]) and N-succinimidyl-4-(2-pyridylthio) pentanoate (SPP) to provide for a disulfide linkage.
- SPDP N-succinimidyl-3-(2-pyridyldithio)propionate
- SPP N-succinimidyl-4-(2-pyridylthio) pentanoate
- a ricin immunotoxin can be prepared as described in Vitetta et al., Science 238: 1098 (1987).
- Carbon-14-labeled 1-isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid is an exemplary chelating agent for conjugation of radionucleotide to the antibody. See WO94/11026.
- the linker may be a “cleavable linker” facilitating release of the cytotoxic drug in the cell.
- an acid-labile linker Cancer Research 52: 127-131 (1992); U.S. Pat. No. 5,208,020 may be used.
- Another immunoconjugate of interest comprises an antibody conjugated to one or more calicheamicin molecules.
- the calicheamicin family of antibiotics is capable of producing double-stranded DNA breaks at sub-picomolar concentrations.
- Another drug that the antibody can be conjugated is QFA which is an antifolate.
- QFA is an antifolate.
- agents that can be conjugated to the antibodies of the invention include BCNU, streptozoicin, vincristine and 5-fluorouracil, the family of agents known collectively LL-E33288 complex described in U.S. Pat. Nos. 5,053,394, 5,770,710, as well as esperamicins (U.S. Pat. No. 5,877,296).
- Enzymatically active toxins and fragments thereof that can be used include, e.g., diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa ), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin and the tricothecenes. See, for example, WO 93/21232.
- the present invention further includes an immunoconjugate formed between an antibody and a compound with nucleolytic activity (e.g., a ribonuclease or a DNA endonuclease such as a deoxyribonuclease; DNase).
- a compound with nucleolytic activity e.g., a ribonuclease or a DNA endonuclease such as a deoxyribonuclease; DNase.
- the antibody For selective destruction of infected cells, the antibody includes a highly radioactive atom.
- a variety of radioactive isotopes are available for the production of radioconjugated anti-PSCA antibodies. Examples include At 211 , I 131 , I 125 , Y 90 , Re 186 , Rc 188 , Sm 153 , Bi 212 , P 32 , Pb 212 and radioactive isotopes of Lu.
- the conjugate When used for diagnosis, it may comprise a radioactive atom for scintigraphic studies, for example tc 99m or I 123 , or a spin label for nuclear magnetic resonance (NMR) imaging (also known as magnetic resonance imaging, MRI), such as iodine-123, iodine-131, indium-111, fluorine-19, carbon-13, nitrogen-15, oxygen-17, gadolinium, manganese or iron.
- NMR nuclear magnetic resonance
- the radio- or other label is incorporated in the conjugate in known ways.
- the peptide may be biosynthesized or may be synthesized by chemical amino acid synthesis using suitable amino acid precursors involving, for example, fluorine-19 in place of hydrogen.
- Labels such as tc 99m or I 123 , Re 186 , Re 188 and In 111 can be attached via a cysteine residue in the peptide.
- Yttrium-90 can be attached via a lysine residue.
- the IODOGEN method (Fraker et al. (1978) Biochem. Biophys. Res. Commun. 80: 49-57 can be used to incorporate iodine-123. “Monoclonal Antibodies in Immunoscintigraphy” (Chatal, CRC Press 1989) describes other methods in detail.
- a fusion protein comprising the antibody and cytotoxic agent is made, e.g., by recombinant techniques or peptide synthesis.
- the length of DNA may comprise respective regions encoding the two portions of the conjugate either adjacent one another or separated by a region encoding a linker peptide which does not destroy the desired properties of the conjugate.
- the antibodies of the present invention are also used in antibody dependent enzyme mediated prodrug therapy (ADET) by conjugating the antibody to a prodrug-activating enzyme which converts a prodrug (e.g., a peptidyl chemotherapeutic agent, see WO81/01145) to an active anti-cancer drug (see, e.g., WO 88/07378 and U.S. Pat. No. 4,975,278).
- a prodrug e.g., a peptidyl chemotherapeutic agent, see WO81/01145
- an active anti-cancer drug see, e.g., WO 88/07378 and U.S. Pat. No. 4,975,278.
- the enzyme component of the immunoconjugate useful for ADEPT includes any enzyme capable of acting on a prodrug in such a way so as to convert it into its more active, cytotoxic form.
- Enzymes that are useful in the method of this invention include, but are not limited to, alkaline phosphatase useful for converting phosphate-containing prodrugs into free drugs; arylsulfatase useful for converting sulfate-containing prodrugs into free drugs; cytosine deaminase useful for converting non-toxic 5-fluorocytosine into the anti-cancer drug, 5-fluorouracil; proteases, such as serratia protease, thermolysin, subtilisin, carboxypeptidases and cathepsins (such as cathepsins B and L), that are useful for converting peptide-containing prodrugs into free drugs; D-alanylcarboxypeptidases, useful for converting prodrugs that contain D-amino acid substituents
- antibodies with enzymatic activity can be used to convert the prodrugs of the invention into free active drugs (see, e.g., Massey, Nature 328: 457-458 (1987)).
- Antibody-abzyme conjugates can be prepared as described herein for delivery of the abzyme to a infected cell population.
- the enzymes of this invention can be covalently bound to the antibodies by techniques well known in the art such as the use of the heterobifunctional crosslinking reagents discussed above.
- fusion proteins comprising at least the antigen binding region of an antibody of the invention linked to at least a functionally active portion of an enzyme of the invention can be constructed using recombinant DNA techniques well known in the art (see, e.g., Neuberger et al., Nature, 312: 604-608 (1984).
- the antibody may be linked to one of a variety of nonproteinaceous polymers, e.g., polyethylene glycol, polypropylene glycol, polyoxyalkylenes, or copolymers of polyethylene glycol and polypropylene glycol.
- the antibody also may be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization (for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate)microcapsules, respectively), in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules), or in macroemulsions.
- colloidal drug delivery systems for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
- a “liposome” is a small vesicle composed of various types of lipids, phospholipids and/or surfactant that is useful for delivery of a drug to a mammal.
- the components of the liposome are commonly arranged in a bilayer formation, similar to the lipid arrangement of biological membranes.
- Liposomes containing the antibody are prepared by methods known in the art, such as described in Epstein et al., Proc. Natl. Acad. Sci. USA, 82:3688 (1985); Hwang et al., Proc. Natl. Acad. Sci., USA, 77:4030 (1980); U.S. Pat. Nos. 4,485,045 and 4,544,545; and WO97/38731 published Oct. 23, 1997. Liposomes with enhanced circulation time are disclosed in U.S. Pat. No. 5,013,556.
- Particularly useful liposomes can be generated by the reverse phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol and PEG-derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired a diameter.
- Fab′ fragments of the antibody of the present invention can be conjugated to the liposomes as described in Martin et al., J. Biol. Chem. 257: 286-288 (1982) via a disulfide interchange reaction. A chemotherapeutic agent is optionally contained within the liposome. See Gabizon et al., J. National Cancer Inst. 81(19)1484 (1989).
- Antibodies of the present invention, or fragments thereof, may possess any of a variety of biological or functional characteristics.
- these antibodies are Influenza A specific or M2 protein specific antibodies, indicating that they specifically bind to or preferentially bind to Influenza A or the M2 protein thereof, respectively, as compared to a normal control cell.
- the antibodies are HuM2e antibodies, indicating that they specifically bind to a M2e protein, preferably to an epitope of the M2e domain that is only present when the M2 protein is expressed in cells or present on a virus, as compared to a normal control cell.
- an antibody of the present invention is an antagonist antibody, which partially or fully blocks or inhibits a biological activity of a polypeptide or cell to which it specifically or preferentially binds.
- an antibody of the present invention is a growth inhibitory antibody, which partially or fully blocks or inhibits the growth of an infected cell to which it binds.
- an antibody of the present invention induces apoptosis.
- an antibody of the present invention induces or promotes antibody-dependent cell-mediated cytotoxicity or complement dependent cytotoxicity.
- the present invention provides novel methods for the identification of HuM2e antibodies, as exemplified in Example 4. These methods may be readily adapted to identify antibodies specific for other polypeptides expressed on the cell surface by infectious agents, or even polypeptides expressed on the surface of an infectious agent itself.
- the methods include obtaining serum samples from patients that have been infected with or vaccinated against an infectious agent. These serum samples are then screened to identify those that contain antibodies specific for a particular polypeptide associated with the infectious agent, such as, e.g., a polypeptide specifically expressed on the surface of cells infected with the infectious agent, but not uninfected cells.
- the serum samples are screened by contacting the samples with a cell that has been transfected with an expression vector that expresses the polypeptide expressed on the surface of infected cells.
- mononuclear and/or B cells obtained from the same patient are used to identify a cell or clone thereof that produces the antibody, using any of the methods described herein or available in the art.
- cDNAs encoding the variable regions or fragments thereof of the antibody may be cloned using standard RT-PCR vectors and primers specific for conserved antibody sequences, and subcloned in to expression vectors used for the recombinant production of monoclonal antibodies specific for the infectious agent polypeptide of interest.
- the present invention provides a method of identifying an antibody that specifically binds influenza A-infected cells, comprising: contacting an Influenza A virus or a cell expressing the M2 protein with a biological sample obtained from a patient having been infected by Influenza A; determining an amount of antibody in the biological sample that binds to the cell; and comparing the amount determined with a control value, wherein if the value determined is at least two-fold greater than the control value, an antibody that specifically binds influenza A-infected cells is indicated.
- the cells expressing an M2 protein are cells infected with an Influenza A virus or cells that have been transfected with a polynucleotide that expressed the M2 protein.
- the cells may express a portion of the M2 protein that includes the M2e domain and enough additional M2 sequence that the protein remains associated with the cell and the M2e domain is presented on the cell surface in the same manner as when present within full length M2 protein.
- the M2e-expressing cells or virus described above are used to screen the biological sample obtained from a patient infected with influenza A for the presence of antibodies that preferentially bind to the cell expressing the M2 polypeptide using standard biological techniques.
- the antibodies may be labeled, and the presence of label associated with the cell detected, e.g., using FMAT or FACs analysis.
- the biological sample is blood, serum, plasma, bronchial lavage, or saliva. Methods of the present invention may be practiced using high throughput techniques.
- Identified human antibodies may then be characterized further. For example the particular conformational epitopes with in the M2e protein that are necessary or sufficient for binding of the antibody may be determined, e.g., using site-directed mutagenesis of expressed M2e polypeptides. These methods may be readily adapted to identify human antibodies that bind any protein expressed on a cell surface. Furthermore, these methods may be adapted to determine binding of the antibody to the virus itself, as opposed to a cell expressing recombinant M2e or infected with the virus.
- Polynucleotide sequences encoding the antibodies, variable regions thereof, or antigen-binding fragments thereof may be subcloned into expression vectors for the recombinant production of HuM2e antibodies. In one embodiment, this is accomplished by obtaining mononuclear cells from the patient from the serum containing the identified HuM2e antibody was obtained; producing B cell clones from the mononuclear cells; inducing the B cells to become antibody-producing plasma cells; and screening the supernatants produced by the plasma cells to determine if it contains the HuM2e antibody.
- RT-PCR reverse-transcription polymerase chain reaction
- B cells isolated from peripheral blood or lymph nodes are sorted, e.g., based on their being CD19 positive, and plated, e.g., as low as a single cell specificity per well, e.g., in 96, 384, or 1536 well configurations.
- the cells are induced to differentiate into antibody-producing cells, e.g., plasma cells, and the culture supernatants are harvested and tested for binding to cells expressing the infectious agent polypeptide on their surface using, e.g., FMAT or FACS analysis. Positive wells are then subjected to whole well RT-PCR to amplify heavy and light chain variable regions of the IgG molecule expressed by the clonal daughter plasma cells.
- the resulting PCR products encoding the heavy and light chain variable regions, or portions thereof, are subcloned into human antibody expression vectors for recombinant expression.
- the resulting recombinant antibodies are then tested to confirm their original binding specificity and may be further tested for pan-specificity across various strains of isolates of the infectious agent.
- a method of identifying HuM2e antibodies is practiced as follows. First, full length or approximately full length M2 cDNAs are transfected into a cell line for expression of M2 protein. Secondly, individual human plasma or sera samples are tested for antibodies that bind the cell-expressed M2. And lastly, MAbs derived from plasma- or serum-positive individuals are characterized for binding to the same cell-expressed M2. Further definition of the fine specificities of the MAbs can be performed at this point.
- HuM2e antibodies including antibodies specific for (a) epitopes in a linear M2e peptide, (b) common epitopes in multiple variants of M2e, (c) conformational determinants of an M2 homotetramer, and (d) common conformational determinants of multiple variants of the M2 homotetramer.
- the last category is particularly desirable, as this specificity is perhaps specific for all A strains of influenza.
- Polynucleotides that encode the HuM2e antibodies or portions thereof of the present invention may be isolated from cells expressing HuM2e antibodies, according to methods available in the art and described herein, including amplification by polymerase chain reaction using primers specific for conserved regions of human antibody polypeptides. For example, light chain and heavy chain variable regions may be cloned from the B cell according to molecular biology techniques described in WO 92/02551; U.S. Pat. No. 5,627,052; or Babcook et al., Proc. Natl. Acad. Sci. USA 93:7843-48 (1996).
- polynucleotides encoding all or a region of both the heavy and light chain variable regions of the IgG molecule expressed by the clonal daughter plasma cells expressing the HuM2e antibody are subcloned and sequenced.
- the sequence of the encoded polypeptide may be readily determined from the polynucleotide sequence.
- Isolated polynucleotides encoding a polypeptide of the present invention may be subcloned into an expression vector to recombinantly produce antibodies and polypeptides of the present invention, using procedures known in the art and described herein.
- Binding properties of an antibody (or fragment thereof) to M2e or infected cells or tissues may generally be determined and assessed using immunodetection methods including, for example, immunofluorescence-based assays, such as immuno-histochemistry (IHC) and/or fluorescence-activated cell sorting (FACS). Immunoassay methods may include controls and procedures to determine whether antibodies bind specifically to M2e from one or more specific strains of Influenza A, and do not recognize or cross-react with normal control cells.
- immunodetection methods including, for example, immunofluorescence-based assays, such as immuno-histochemistry (IHC) and/or fluorescence-activated cell sorting (FACS).
- Immunoassay methods may include controls and procedures to determine whether antibodies bind specifically to M2e from one or more specific strains of Influenza A, and do not recognize or cross-react with normal control cells.
- the methods of the present invention typically include the isolation or purification of B cells from a biological sample previously obtained from a patient or subject.
- the patient or subject may be currently or previously diagnosed with or suspect or having a particular disease or infection, or the patient or subject may be considered free or a particular disease or infection.
- the patient or subject is a mammal and, in particular embodiments, a human.
- the biological sample may be any sample that contains B cells, including but not limited to, lymph node or lymph node tissue, pleural effusions, peripheral blood, ascites, tumor tissue, or cerebrospinal fluid (CSF).
- B cells are isolated from different types of biological samples, such as a biological sample affected by a particular disease or infection.
- any biological sample comprising B cells may be used for any of the embodiments of the present invention.
- the B cells are induced to produce antibodies, e.g., by culturing the B cells under conditions that support B cell proliferation or development into a plasmacyte, plasmablast, or plasma cell.
- the antibodies are then screened, typically using high throughput techniques, to identify an antibody that specifically binds to a target antigen, e.g., a particular tissue, cell, infectious agent, or polypeptide.
- a target antigen e.g., a particular tissue, cell, infectious agent, or polypeptide.
- the specific antigen, e.g., cell surface polypeptide bound by the antibody is not known, while in other embodiments, the antigen specifically bound by the antibody is known.
- B cells may be isolated from a biological sample, e.g., a tumor, tissue, peripheral blood or lymph node sample, by any means known and available in the art.
- B cells are typically sorted by FACS based on the presence on their surface of a B cell-specific marker, e.g., CD19, CD138, and/or surface IgG.
- a B cell-specific marker e.g., CD19, CD138, and/or surface IgG.
- other methods known in the art may be employed, such as, e.g., column purification using CD19 magnetic beads or IgG-specific magnetic beads, followed by elution from the column.
- magnetic isolation of B cells utilizing any marker may result in loss of certain B cells. Therefore, in certain embodiments, the isolated cells are not sorted but, instead, phicol-purified mononuclear cells isolated from tumor are directly plated to the appropriate or desired number of specificities per well.
- the B cells are typically plated at low density (e.g., a single cell specificity per well, 1-10 cells per well, 10-100 cells per well, 1-100 cells per well, less than 10 cells per well, or less than 100 cells per well) in multi-well or microtitre plates, e.g., in 96, 384, or 1536 well configurations.
- the methods of the present invention may include the step of subsequently diluting cells in a well identified as producing an antigen-specific antibody, until a single cell specificity per well is achieved, thereby facilitating the identification of the B cell that produces the antigen-specific antibody.
- Cell supernatants or a portion thereof and/or cells may be frozen and stored for future testing and later recovery of antibody polynucleotides.
- the B cells are cultured under conditions that favor the production of antibodies by the B cells.
- the B cells may be cultured under conditions favorable for B cell proliferation and differentiation to yield antibody-producing plasmablast, plasmacytes, or plasma cells.
- the B cells are cultured in the presence of a B cell mitogen, such as lipopolysaccharide (LPS) or CD40 ligand.
- B cells are differentiated to antibody-producing cells by culturing them with feed cells and/or other B cell activators, such as CD40 ligand.
- Cell culture supernatants or antibodies obtained therefrom may be tested for their ability to bind to a target antigen, using routine methods available in the art, including those described herein.
- culture supernatants are tested for the presence of antibodies that bind to a target antigen using high-throughput methods.
- B cells may be cultured in multi-well microtitre dishes, such that robotic plate handlers may be used to simultaneously sample multiple cell supernatants and test for the presence of antibodies that bind to a target antigen.
- antigens are bound to beads, e.g., paramagnetic or latex beads) to facilitate the capture of antibody/antigen complexes.
- antigens and antibodies are fluorescently labeled (with different labels) and FACS analysis is performed to identify the presence of antibodies that bind to target antigen.
- antibody binding is determined using FMATTM analysis and instrumentation (Applied Biosystems, Foster City, Calif.).
- FMATTM is a fluorescence macro-confocal platform for high-throughput screening, which mix-and-read, non-radioactive assays using live cells or beads.
- the antibody is considered to preferentially bind a particular target antigen if at least two-fold, at least three-fold, at least five-fold, or at least ten-fold more antibody binds to the particular target antigen as compared to the amount that binds a control sample.
- Polynucleotides encoding antibody chains, variable regions thereof, or fragments thereof may be isolated from cells utilizing any means available in the art.
- polynucleotides are isolated using polymerase chain reaction (PCR), e.g., reverse transcription-PCR (RT-PCR) using oligonucleotide primers that specifically bind to heavy or light chain encoding polynucleotide sequences or complements thereof using routine procedures available in the art.
- PCR polymerase chain reaction
- RT-PCR reverse transcription-PCR
- positive wells are subjected to whole well RT-PCR to amplify the heavy and light chain variable regions of the IgG molecule expressed by the clonal daughter plasma cells. These PCR products may be sequenced.
- the resulting PCR products encoding the heavy and light chain variable regions or portions thereof are then subcloned into human antibody expression vectors and recombinantly expressed according to routine procedures in the art (see, e.g., U.S. Pat. No. 7,112,439).
- the nucleic acid molecules encoding a tumor-specific antibody or fragment thereof, as described herein, may be propagated and expressed according to any of a variety of well-known procedures for nucleic acid excision, ligation, transformation, and transfection.
- expression of an antibody fragment may be preferred in a prokaryotic host cell, such as Escherichia coli (see, e.g., Pluckthun et al., Methods Enzymol.
- expression of the antibody or an antigen-binding fragment thereof may be preferred in a eukaryotic host cell, including yeast (e.g., Saccharomyces cerevisiae, Schizosaccharomyces pombe , and Pichia pastoris ); animal cells (including mammalian cells); or plant cells.
- yeast e.g., Saccharomyces cerevisiae, Schizosaccharomyces pombe , and Pichia pastoris
- animal cells including mammalian cells
- suitable animal cells include, but are not limited to, myeloma, COS, CHO, or hybridoma cells.
- plant cells include tobacco, corn, soybean, and rice cells.
- a nucleic acid vector may be designed for expressing foreign sequences in a particular host system, and then polynucleotide sequences encoding the tumor-specific antibody (or fragment thereof) may be inserted.
- the regulatory elements will vary according to the particular host.
- One or more replicable expression vectors containing a polynucleotide encoding a variable and/or constant region may be prepared and used to transform an appropriate cell line, for example, a non-producing myeloma cell line, such as a mouse NSO line or a bacterium, such as E. coli , in which production of the antibody will occur.
- an appropriate cell line for example, a non-producing myeloma cell line, such as a mouse NSO line or a bacterium, such as E. coli , in which production of the antibody will occur.
- the polynucleotide sequence in each vector should include appropriate regulatory sequences, particularly a promoter and leader sequence operatively linked to the variable domain sequence.
- Particular methods for producing antibodies in this way are generally well known and routinely used. For example, molecular biology procedures are described by Sambrook et al.
- regions of polynucleotides encoding the recombinant antibodies may be sequenced. DNA sequencing can be performed as described in Sanger et al. ( Proc. Natl. Acad. Sci. USA 74:5463 (1977)) and the Amersham International plc sequencing handbook and including improvements thereto.
- the resulting recombinant antibodies or fragments thereof are then tested to confirm their original specificity and may be further tested for pan-specificity, e.g., with related infectious agents.
- an antibody identified or produced according to methods described herein is tested for cell killing via antibody dependent cellular cytotoxicity (ADCC) or apoptosis, and/or well as its ability to internalize.
- ADCC antibody dependent cellular cytotoxicity
- polynucleotide compositions in other aspects, provides polynucleotide compositions.
- these polynucleotides encode a polypeptide of the invention, e.g., a region of a variable chain of an antibody that binds to Influenza A, M2, or M2e.
- Polynucleotides of the invention are single-stranded (coding or antisense) or double-stranded DNA (genomic, cDNA or synthetic) or RNA molecules.
- RNA molecules include, but are not limited to, HnRNA molecules, which contain introns and correspond to a DNA molecule in a one-to-one manner, and mRNA molecules, which do not contain introns.
- coding or non-coding sequences are present within a polynucleotide of the present invention.
- a polynucleotide is linked to other molecules and/or support materials of the invention.
- Polynucleotides of the invention are used, e.g., in hybridization assays to detect the presence of an Influenza A antibody in a biological sample, and in the recombinant production of polypeptides of the invention.
- polynucleotide compositions include some or all of a polynucleotide sequence set forth in Example 1, complements of a polynucleotide sequence set forth in Example 1, and degenerate variants of a polynucleotide sequence set forth in Example 1.
- the polynucleotide sequences set forth herein encode polypeptides capable of preferentially binding a Influenza A-infected cell as compared to a normal control uninfected cell, including a polypeptide having a sequence set forth in Examples 1 or 2.
- the invention includes all polynucleotides that encode any polypeptide of the present invention.
- the invention provides polynucleotide variants having substantial identity to the sequences set forth in FIG. 1 , for example those comprising at least 70% sequence identity, preferably at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% or higher, sequence identity compared to a polynucleotide sequence of this invention, as determined using the methods described herein, (e.g., BLAST analysis using standard parameters).
- BLAST analysis e.g., BLAST analysis using standard parameters.
- polynucleotide variants contain one or more substitutions, additions, deletions and/or insertions, preferably such that the immunogenic binding properties of the polypeptide encoded by the variant polynucleotide is not substantially diminished relative to a polypeptide encoded by a polynucleotide sequence specifically set forth herein.
- the present invention provides polynucleotide fragments comprising various lengths of contiguous stretches of sequence identical to or complementary to one or more of the sequences disclosed herein.
- polynucleotides are provided by this invention that comprise at least about 10, 15, 20, 30, 40, 50, 75, 100, 150, 200, 300, 400, 500 or 1000 or more contiguous nucleotides of one or more of the sequences disclosed herein as well as all intermediate lengths there between.
- intermediate lengths is meant to describe any length between the quoted values, such as 16, 17, 18, 19, etc.; 21, 22, 23, etc.; 30, 31, 32, etc.; 50, 51, 52, 53, etc.; 100, 101, 102, 103, etc.; 150, 151, 152, 153, etc.; including all integers through 200-500; 500-1,000, and the like.
- polynucleotide compositions are provided that are capable of hybridizing under moderate to high stringency conditions to a polynucleotide sequence provided herein, or a fragment thereof, or a complementary sequence thereof.
- Hybridization techniques are well known in the art of molecular biology.
- suitable moderately stringent conditions for testing the hybridization of a polynucleotide of this invention with other polynucleotides include prewashing in a solution of 5 ⁇ SSC, 0.5% SDS, 1.0 mM EDTA (pH 8.0); hybridizing at 50° C.-60° C., 5 ⁇ SSC, overnight; followed by washing twice at 65° C.
- hybridization can be readily manipulated, such as by altering the salt content of the hybridization solution and/or the temperature at which the hybridization is performed.
- suitable highly stringent hybridization conditions include those described above, with the exception that the temperature of hybridization is increased, e.g., to 60-65° C. or 65-70° C.
- the polypeptide encoded by the polynucleotide variant or fragment has the same binding specificity (i.e., specifically or preferentially binds to the same epitope or Influenza A strain) as the polypeptide encoded by the native polynucleotide.
- the polynucleotides described above, e.g., polynucleotide variants, fragments and hybridizing sequences encode polypeptides that have a level of binding activity of at least about 50%, preferably at least about 70%, and more preferably at least about 90% of that for a polypeptide sequence specifically set forth herein.
- polynucleotides of the present invention may be combined with other DNA sequences, such as promoters, polyadenylation signals, additional restriction enzyme sites, multiple cloning sites, other coding segments, and the like, such that their overall length may vary considerably.
- a nucleic acid fragment of almost any length is employed, with the total length preferably being limited by the ease of preparation and use in the intended recombinant DNA protocol.
- illustrative polynucleotide segments with total lengths of about 10,000, about 5000, about 3000, about 2,000, about 1,000, about 500, about 200, about 100, about 50 base pairs in length, and the like, (including all intermediate lengths) are included in many implementations of this invention.
- mutagenesis of the disclosed polynucleotide sequences is performed in order to alter one or more properties of the encoded polypeptide, such as its binding specificity or binding strength.
- Techniques for mutagenesis are well-known in the art, and are widely used to create variants of both polypeptides and polynucleotides.
- a mutagenesis approach such as site-specific mutagenesis, is employed for the preparation of variants and/or derivatives of the polypeptides described herein. By this approach, specific modifications in a polypeptide sequence are made through mutagenesis of the underlying polynucleotides that encode them.
- Site-specific mutagenesis allows the production of mutants through the use of specific oligonucleotide sequences include the nucleotide sequence of the desired mutation, as well as a sufficient number of adjacent nucleotides, to provide a primer sequence of sufficient size and sequence complexity to form a stable duplex on both sides of the deletion junction being traversed. Mutations are employed in a selected polynucleotide sequence to improve, alter, decrease, modify, or otherwise change the properties of the polynucleotide itself, and/or alter the properties, activity, composition, stability, or primary sequence of the encoded polypeptide.
- the polynucleotide sequences provided herein are used as probes or primers for nucleic acid hybridization, e.g., as PCR primers.
- other uses are also encompassed by the invention, such as the use of the sequence information for the preparation of mutant species primers, or primers for use in preparing other genetic constructions.
- nucleic acid segments of the invention that include a sequence region of at least about 15 nucleotide long contiguous sequence that has the same sequence as, or is complementary to, a 15 nucleotide long contiguous sequence disclosed herein is particularly useful.
- Longer contiguous identical or complementary sequences e.g., those of about 20, 30, 40, 50, 100, 200, 500, 1000 (including all intermediate lengths) including full length sequences, and all lengths in between, are also used in certain embodiments.
- Polynucleotide molecules having sequence regions consisting of contiguous nucleotide stretches of 10-14, 15-20, 30, 50, or even of 100-200 nucleotides or so (including intermediate lengths as well), identical or complementary to a polynucleotide sequence disclosed herein, are particularly contemplated as hybridization probes for use in, e.g., Southern and Northern blotting, and/or primers for use in, e.g., polymerase chain reaction (PCR).
- Smaller fragments are generally used in hybridization embodiments, wherein the length of the contiguous complementary region may be varied, such as between about 15 and about 100 nucleotides, but larger contiguous complementarity stretches may be used, according to the length complementary sequences one wishes to detect.
- hybridization probe of about 15-25 nucleotides in length allows the formation of a duplex molecule that is both stable and selective.
- Molecules having contiguous complementary sequences over stretches greater than 12 bases in length are generally preferred, though, in order to increase stability and selectivity of the hybrid, and thereby improve the quality and degree of specific hybrid molecules obtained.
- Nucleic acid molecules having gene-complementary stretches of 15 to 25 contiguous nucleotides, or even longer where desired, are generally preferred.
- Hybridization probes are selected from any portion of any of the sequences disclosed herein. All that is required is to review the sequences set forth herein, or to any continuous portion of the sequences, from about 15-25 nucleotides in length up to and including the full length sequence, that one wishes to utilize as a probe or primer.
- the choice of probe and primer sequences is governed by various factors. For example, one may wish to employ primers from towards the termini of the total sequence.
- Polynucleotide of the present invention are readily prepared by, for example, directly synthesizing the fragment by chemical means, as is commonly practiced using an automated oligonucleotide synthesizer. Also, fragments are obtained by application of nucleic acid reproduction technology, such as the PCRTM technology of U.S. Pat. No. 4,683,202, by introducing selected sequences into recombinant vectors for recombinant production, and by other recombinant DNA techniques generally known to those of skill in the art of molecular biology.
- vectors and host cells comprising a nucleic acid of the present invention, as well as recombinant techniques for the production of a polypeptide of the present invention.
- Vectors of the invention include those capable of replication in any type of cell or organism, including, e.g., plasmids, phage, cosmids, and mini chromosomes.
- vectors comprising a polynucleotide of the present invention are vectors suitable for propagation or replication of the polynucleotide, or vectors suitable for expressing a polypeptide of the present invention. Such vectors are known in the art and commercially available.
- Polynucleotides of the present invention are synthesized, whole or in parts that are then combined, and inserted into a vector using routine molecular and cell biology techniques, including, e.g., subcloning the polynucleotide into a linearized vector using appropriate restriction sites and restriction enzymes.
- Polynucleotides of the present invention are amplified by polymerase chain reaction using oligonucleotide primers complementary to each strand of the polynucleotide. These primers also include restriction enzyme cleavage sites to facilitate subcloning into a vector.
- the replicable vector components generally include, but are not limited to, one or more of the following: a signal sequence, an origin of replication, and one or more marker or selectable genes.
- the nucleotide sequences encoding the polypeptide, or functional equivalents are inserted into an appropriate expression vector, i.e., a vector that contains the necessary elements for the transcription and translation of the inserted coding sequence.
- an appropriate expression vector i.e., a vector that contains the necessary elements for the transcription and translation of the inserted coding sequence.
- Methods well known to those skilled in the art are used to construct expression vectors containing sequences encoding a polypeptide of interest and appropriate transcriptional and translational control elements. These methods include in vitro recombinant DNA techniques, synthetic techniques, and in vivo genetic recombination. Such techniques are described, for example, in Sambrook, J., et al.
- a variety of expression vector/host systems are utilized to contain and express polynucleotide sequences. These include, but are not limited to, microorganisms such as bacteria transformed with recombinant bacteriophage, plasmid, or cosmid DNA expression vectors; yeast transformed with yeast expression vectors; insect cell systems infected with virus expression vectors (e.g., baculovirus); plant cell systems transformed with virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or with bacterial expression vectors (e.g., Ti or pBR322 plasmids); or animal cell systems.
- microorganisms such as bacteria transformed with recombinant bacteriophage, plasmid, or cosmid DNA expression vectors
- yeast transformed with yeast expression vectors e.g., insect cell systems infected with virus expression vectors (e.g., baculovirus)
- plant cell systems transformed with virus expression vectors e.g., cauliflower mosaic virus,
- control elements or “regulatory sequences” present in an expression vector are those non-translated regions of the vector, e.g., enhancers, promoters, 5′ and 3′ untranslated regions, that interact with host cellular proteins to carry out transcription and translation. Such elements may vary in their strength and specificity. Depending on the vector system and host utilized, any number of suitable transcription and translation elements, including constitutive and inducible promoters, are used.
- promoters suitable for use with prokaryotic hosts include the phoa promoter, ⁇ -lactamase and lactose promoter systems, alkaline phosphatase promoter, a tryptophan (trp) promoter system, and hybrid promoters such as the tac promoter.
- phoa promoter ⁇ -lactamase and lactose promoter systems
- alkaline phosphatase promoter alkaline phosphatase promoter
- trp tryptophan
- hybrid promoters such as the tac promoter.
- Promoters for use in bacterial systems also usually contain a Shine-Dalgarno sequence operably linked to the DNA encoding the polypeptide.
- Inducible promoters such as the hybrid lacZ promoter of the PBLUESCRIPT phagemid (Stratagene, La Jolla, Calif.) or PSPORT1 plasmid (Gibco BRL, Gaithersburg, Md.) and the like are used.
- a variety of promoter sequences are known for eukaryotes and any are used according to the present invention.
- Virtually all eukaryotic genes have an AT-rich region located approximately 25 to 30 bases upstream from the site where transcription is initiated.
- Another sequence found 70 to 80 bases upstream from the start of transcription of many genes is a CNCAAT region where N may be any nucleotide.
- N may be any nucleotide.
- At the 3′ end of most eukaryotic genes is an AATAAA sequence that may be the signal for addition of the poly A tail to the 3′ end of the coding sequence. All of these sequences are suitably inserted into eukaryotic expression vectors.
- promoters from mammalian genes or from mammalian viruses are generally preferred.
- Polypeptide expression from vectors in mammalian host cells are controlled, for example, by promoters obtained from the genomes of viruses such as polyoma virus, fowlpox virus, adenovirus (e.g., Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus (CMV), a retrovirus, hepatitis-B virus and most preferably Simian Virus 40 (SV40), from heterologous mammalian promoters, e.g., the actin promoter or an immunoglobulin promoter, and from heat-shock promoters, provided such promoters are compatible with the host cell systems.
- viruses such as polyoma virus, fowlpox virus, adenovirus (e.g., Adenovirus 2), bovine papilloma virus, avian sarcoma virus,
- vectors based on SV40 or EBV may be advantageously used with an appropriate selectable marker.
- a suitable expression vector is pcDNA-3.1 (Invitrogen, Carlsbad, Calif.), which includes a CMV promoter.
- a number of viral-based expression systems are available for mammalian expression of polypeptides.
- sequences encoding a polypeptide of interest may be ligated into an adenovirus transcription/translation complex consisting of the late promoter and tripartite leader sequence. Insertion in a non-essential E1 or E3 region of the viral genome may be used to obtain a viable virus that is capable of expressing the polypeptide in infected host cells (Logan, J. and Shenk, T. (1984) Proc. Natl. Acad. Sci. 81:3655-3659).
- transcription enhancers such as the Rous sarcoma virus (RSV) enhancer, may be used to increase expression in mammalian host cells.
- RSV Rous sarcoma virus
- any of a number of expression vectors are selected depending upon the use intended for the expressed polypeptide.
- vectors that direct high level expression of fusion proteins that are readily purified are used.
- Such vectors include, but are not limited to, the multifunctional E. coli cloning and expression vectors such as BLUESCRIPT (Stratagene), in which the sequence encoding the polypeptide of interest may be ligated into the vector in frame with sequences for the amino-terminal Met and the subsequent 7 residues of ⁇ -galactosidase, so that a hybrid protein is produced; pIN vectors (Van Heeke, G. and S. M. Schuster (1989) J. Biol. Chem.
- pGEX Vectors are also used to express foreign polypeptides as fusion proteins with glutathione S-transferase (GST).
- GST glutathione S-transferase
- fusion proteins are soluble and can easily be purified from lysed cells by adsorption to glutathione-agarose beads followed by elution in the presence of free glutathione.
- Proteins made in such systems are designed to include heparin, thrombin, or factor XA protease cleavage sites so that the cloned polypeptide of interest can be released from the GST moiety at will.
- yeast Saccharomyces cerevisiae
- promoters such as alpha factor, alcohol oxidase, and PGH
- suitable promoter sequences for use with yeast hosts include the promoters for 3-phosphoglycerate kinase or other glycolytic enzymes, such as enolase, glyceraldehyde-3-phosphate dehydrogenase, hexokinase, pyruvate decarboxylase, phosphofructokinase, glucose-6-phosphate isomerase, 3-phosphoglycerate mutase, pyruvate kinase, triosephosphate isomerase, phosphoglucose isomerase, and glucokinase.
- 3-phosphoglycerate kinase or other glycolytic enzymes such as enolase, glyceraldehyde-3-phosphate dehydrogenase, hexokinase, pyruvate decarboxylase, phosphof
- yeast promoters that are inducible promoters having the additional advantage of transcription controlled by growth conditions include the promoter regions for alcohol dehydrogenase 2, isocytochrome C, acid phosphatase, degradative enzymes associated with nitrogen metabolism, metallothionein, glyceraldehyde-3-phosphate dehydrogenase, and enzymes responsible for maltose and galactose utilization. Suitable vectors and promoters for use in yeast expression are further described in EP 73,657. Yeast enhancers also are advantageously used with yeast promoters.
- sequences encoding polypeptides are driven by any of a number of promoters.
- viral promoters such as the 35S and 19S promoters of CaMV are used alone or in combination with the omega leader sequence from TMV (Takamatsu, N. (1987) EMBO J. 3:173-311.
- plant promoters such as the small subunit of RUBISCO or heat shock promoters are used (Coruzzi, G. et al. (1984) EMBO J. 3:1671-1680; Broglie, R. et al. (1984) Science 224:838-843; and Winter, J., et al. (1991) Results Probl. Cell Differ.
- constructs can be introduced into plant cells by direct DNA transformation or pathogen-mediated transfection. Such techniques are described in a number of generally available reviews (see, e.g., Hobbs, S. or Murry, L. E. in McGraw Hill Yearbook of Science and Technology (1992) McGraw Hill, New York, N.Y.; pp. 191-196).
- An insect system is also used to express a polypeptide of interest.
- Autographa californica nuclear polyhedrosis virus (AcNPV) is used as a vector to express foreign genes in Spodoptera frugiperda cells or in Trichoplusia larvae .
- the sequences encoding the polypeptide are cloned into a non-essential region of the virus, such as the polyhedrin gene, and placed under control of the polyhedrin promoter.
- Successful insertion of the polypeptide-encoding sequence renders the polyhedrin gene inactive and produce recombinant virus lacking coat protein.
- the recombinant viruses are then used to infect, for example, S.
- Specific initiation signals are also used to achieve more efficient translation of sequences encoding a polypeptide of interest. Such signals include the ATG initiation codon and adjacent sequences. In cases where sequences encoding the polypeptide, its initiation codon, and upstream sequences are inserted into the appropriate expression vector, no additional transcriptional or translational control signals may be needed. However, in cases where only coding sequence, or a portion thereof, is inserted, exogenous translational control signals including the ATG initiation codon are provided. Furthermore, the initiation codon is in the correct reading frame to ensure correct translation of the inserted polynucleotide. Exogenous translational elements and initiation codons are of various origins, both natural and synthetic.
- Enhancer sequences are known, including, e.g., those identified in genes encoding globin, elastase, albumin, ⁇ -fetoprotein, and insulin.
- an enhancer from a eukaryotic cell virus is used. Examples include the SV40 enhancer on the late side of the replication origin (bp 100-270), the cytomegalovirus early promoter enhancer, the polyoma enhancer on the late side of the replication origin, and adenovirus enhancers.
- the enhancer is spliced into the vector at a position 5′ or 3′ to the polypeptide-encoding sequence, but is preferably located at a site 5′ from the promoter.
- Expression vectors used in eukaryotic host cells typically also contain sequences necessary for the termination of transcription and for stabilizing the mRNA. Such sequences are commonly available from the 5′ and, occasionally 3′, untranslated regions of eukaryotic or viral DNAs or cDNAs. These regions contain nucleotide segments transcribed as polyadenylated fragments in the untranslated portion of the mRNA encoding anti-PSCA antibody.
- One useful transcription termination component is the bovine growth hormone polyadenylation region. See WO94/11026 and the expression vector disclosed therein.
- Suitable host cells for cloning or expressing the DNA in the vectors herein are the prokaryote, yeast, plant or higher eukaryote cells described above.
- suitable prokaryotes for this purpose include eubacteria, such as Gram-negative or Gram-positive organisms, for example, Enterobacteriaceae such as Escherichia , e.g., E. coli, Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella , e.g., Salmonella typhimurium, Serratia , e.g., Serratia marcescans , and Shigella , as well as Bacilli such as B. subtilis and B.
- Enterobacteriaceae such as Escherichia , e.g., E. coli, Enterobacter, Erwinia, Klebsiella, Proteus
- Salmonella e.g., Salmonella typhimurium
- Serratia
- E. coli cloning host is E. coli 294 (ATCC 31,446), although other strains such as E. coli B, E. coli X1776 (ATCC 31,537), and E. coli W3110 (ATCC 27,325) are suitable. These examples are illustrative rather than limiting.
- Saccharomyces cerevisiae or common baker's yeast, is the most commonly used among lower eukaryotic host microorganisms.
- a number of other genera, species, and strains are commonly available and used herein, such as Schizosaccharomyces pombe; Kluyveromyces hosts such as, e.g., K. lactis, K. fragilis (ATCC 12,424), K. bulgaricus (ATCC 16,045), K. wickeramii (ATCC 24,178), K. waltii (ATCC 56,500), K. drosophilarum (ATCC 36,906), K. thermotolerans , and K.
- a host cell strain is chosen for its ability to modulate the expression of the inserted sequences or to process the expressed protein in the desired fashion.
- modifications of the polypeptide include, but are not limited to, acetylation, carboxylation. glycosylation, phosphorylation, lipidation, and acylation.
- Post-translational processing that cleaves a “prepro” form of the protein is also used to facilitate correct insertion, folding and/or function.
- Different host cells such as CHO, COS, HeLa, MDCK, HEK293, and WI38, which have specific cellular machinery and characteristic mechanisms for such post-translational activities, are chosen to ensure the correct modification and processing of the foreign protein.
- antibody heavy and light chains, or fragments thereof are expressed from the same or separate expression vectors. In one embodiment, both chains are expressed in the same cell, thereby facilitating the formation of a functional antibody or fragment thereof.
- Full length antibody, antibody fragments, and antibody fusion proteins are produced in bacteria, in particular when glycosylation and Fc effector function are not needed, such as when the therapeutic antibody is conjugated to a cytotoxic agent (e.g., a toxin) and the immunoconjugate by itself shows effectiveness in infected cell destruction.
- a cytotoxic agent e.g., a toxin
- the immunoconjugate by itself shows effectiveness in infected cell destruction.
- TIR translation initiation region
- coli cell paste in a soluble fraction can be purified through, e.g., a protein A or G column depending on the isotype. Final purification can be carried out using a process similar to that used for purifying antibody expressed e.g., in CHO cells.
- Suitable host cells for the expression of glycosylated polypeptides and antibodies are derived from multicellular organisms.
- invertebrate cells include plant and insect cells.
- Numerous baculoviral strains and variants and corresponding permissive insect host cells from hosts such as Spodoptera frugiperda (caterpillar), Aedes aegypti (mosquito), Aedes albopicius (mosquito), Drosophila melanogaster (fruitfly), and Bombyx mori have been identified.
- a variety of viral strains for transfection are publicly available, e.g., the L-1 variant of Autographa californica NPV and the Bm-5 strain of Bombyx mori NPV, and such viruses are used as the virus herein according to the present invention, particularly for transfection of Spodoptera frugiperda cells.
- Plant cell cultures of cotton, corn, potato, soybean, petunia, tomato, and tobacco are also utilized as hosts.
- mammalian host cell lines used in the methods of the invention are monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol. 36:59 (1977)); baby hamster kidney cells (BHK, ATCC CCL 10); Chinese hamster ovary cells/ ⁇ DHFR (CHO, Urlaub et al., Proc. Natl. Acad. Sci. USA 77:4216 (1980)); mouse sertoli cells (TM4, Mather, Biol.
- COS-7 monkey kidney CV1 line transformed by SV40
- human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol. 36:59 (1977)
- baby hamster kidney cells BHK, ATCC CCL 10
- Chinese hamster ovary cells/ ⁇ DHFR CHO, Urlaub et al., Proc.
- monkey kidney cells (CV1 ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL-1587); human cervical carcinoma cells (HELA, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51); TR1 cells (Mather et al., Annals N.Y. Acad. Sci. 383:44-68 (1982)); MRC 5 cells; FS4 cells; and a human hepatoma line (Hep G2).
- Host cells are transformed with the above-described expression or cloning vectors for polypeptide production and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.
- stable expression is generally preferred.
- cell lines that stably express a polynucleotide of interest are transformed using expression vectors that contain viral origins of replication and/or endogenous expression elements and a selectable marker gene on the same or on a separate vector. Following the introduction of the vector, cells are allowed to grow for 1-2 days in an enriched media before they are switched to selective media.
- the purpose of the selectable marker is to confer resistance to selection, and its presence allows growth and recovery of cells that successfully express the introduced sequences. Resistant clones of stably transformed cells are proliferated using tissue culture techniques appropriate to the cell type.
- a plurality of selection systems are used to recover transformed cell lines. These include, but are not limited to, the herpes simplex virus thymidine kinase (Wigler, M. et al. (1977) Cell 11:223-32) and adenine phosphoribosyltransferase (Lowy, I. et al. (1990) Cell 22:817-23) genes that are employed in tk ⁇ or aprt ⁇ cells, respectively. Also, antimetabolite, antibiotic or herbicide resistance is used as the basis for selection; for example, dhfr, which confers resistance to methotrexate (Wigler, M. et al. (1980) Proc. Natl. Acad. Sci.
- npt which confers resistance to the aminoglycosides, neomycin and G-418 (Colbere-Garapin, F. et al. (1981) J. Mol. Biol. 150:1-14); and als or pat, which confer resistance to chlorsulfuron and phosphinotricin acetyltransferase, respectively (Murry, supra). Additional selectable genes have been described. For example, trpB allows cells to utilize indole in place of tryptophan, and hisD allows cells to utilize histinol in place of histidine (Hartman, S. C. and R. C. Mulligan (1988) Proc. Natl. Acad. Sci.
- marker gene expression suggests that the gene of interest is also present, its presence and expression is confirmed.
- sequence encoding a polypeptide is inserted within a marker gene sequence, recombinant cells containing sequences are identified by the absence of marker gene function.
- a marker gene is placed in tandem with a polypeptide-encoding sequence under the control of a single promoter. Expression of the marker gene in response to induction or selection usually indicates expression of the tandem gene as well.
- host cells that contain and express a desired polynucleotide sequence are identified by a variety of procedures known to those of skill in the art. These procedures include, but are not limited to, DNA-DNA or DNA-RNA hybridizations and protein bioassay or immunoassay techniques which include, for example, membrane, solution, or chip based technologies for the detection and/or quantification of nucleic acid or protein.
- a variety of protocols for detecting and measuring the expression of polynucleotide-encoded products, using either polyclonal or monoclonal antibodies specific for the product are known in the art.
- Nonlimiting examples include enzyme-linked immunosorbent assay (ELISA), radioimmunoassay (RIA), and fluorescence activated cell sorting (FACS).
- ELISA enzyme-linked immunosorbent assay
- RIA radioimmunoassay
- FACS fluorescence activated cell sorting
- a two-site, monoclonal-based immunoassay utilizing monoclonal antibodies reactive to two non-interfering epitopes on a given polypeptide is preferred for some applications, but a competitive binding assay may also be employed.
- Means for producing labeled hybridization or PCR probes for detecting sequences related to polynucleotides include oligolabeling, nick translation, end-labeling or PCR amplification using a labeled nucleotide.
- the sequences, or any portions thereof are cloned into a vector for the production of an mRNA probe.
- Such vectors are known in the art, are commercially available, and are used to synthesize RNA probes in vitro by addition of an appropriate RNA polymerase such as T7, T3, or SP6 and labeled nucleotides.
- reporter molecules or labels include, but are not limited to, radionuclides, enzymes, fluorescent, chemiluminescent, or chromogenic agents as well as substrates, cofactors, inhibitors, magnetic particles, and the like.
- polypeptide produced by a recombinant cell is secreted or contained intracellularly depending on the sequence and/or the vector used.
- Expression vectors containing polynucleotides of the invention are designed to contain signal sequences that direct secretion of the encoded polypeptide through a prokaryotic or eukaryotic cell membrane.
- a polypeptide of the invention is produced as a fusion polypeptide further including a polypeptide domain that facilitates purification of soluble proteins.
- purification-facilitating domains include, but are not limited to, metal chelating peptides such as histidine-tryptophan modules that allow purification on immobilized metals, protein A domains that allow purification on immobilized immunoglobulin, and the domain utilized in the FLAGS extension/affinity purification system (Amgen, Seattle, Wash.).
- the inclusion of cleavable linker sequences such as those specific for Factor XA or enterokinase (Invitrogen. San Diego, Calif.) between the purification domain and the encoded polypeptide are used to facilitate purification.
- An exemplary expression vector provides for expression of a fusion protein containing a polypeptide of interest and a nucleic acid encoding 6 histidine residues (SEQ ID NO: 319) preceding a thioredoxin or an enterokinase cleavage site.
- the histidine residues facilitate purification on IMIAC (immobilized metal ion affinity chromatography) as described in Porath, J. et al. (1992, Prot. Exp. Purif. 3:263-281) while the enterokinase cleavage site provides a means for purifying the desired polypeptide from the fusion protein.
- IMIAC immobilized metal ion affinity chromatography
- a polypeptide of the present invention is fused with a heterologous polypeptide, which may be a signal sequence or other polypeptide having a specific cleavage site at the N-terminus of the mature protein or polypeptide.
- the heterologous signal sequence selected preferably is one that is recognized and processed (i.e., cleaved by a signal peptidase) by the host cell.
- the signal sequence is selected, for example, from the group of the alkaline phosphatase, penicillinase, 1pp, or heat-stable enterotoxin II leaders.
- the signal sequence is selected from, e.g., the yeast invertase leader, a factor leader (including Saccharomyces and Kluyveromyces ⁇ factor leaders), or acid phosphatase leader, the C. albicans glucoamylase leader, or the signal described in WO 90/13646.
- yeast invertase leader e.g., the yeast invertase leader, a factor leader (including Saccharomyces and Kluyveromyces ⁇ factor leaders), or acid phosphatase leader, the C. albicans glucoamylase leader, or the signal described in WO 90/13646.
- mammalian signal sequences as well as viral secretory leaders for example, the herpes simplex gD signal, are available.
- the polypeptide or antibody When using recombinant techniques, the polypeptide or antibody is produced intracellularly, in the periplasmic space, or directly secreted into the medium. If the polypeptide or antibody is produced intracellularly, as a first step, the particulate debris, either host cells or lysed fragments, are removed, for example, by centrifugation or ultrafiltration. Carter et al., Bio/Technology 10:163-167 (1992) describe a procedure for isolating antibodies that are secreted to the periplasmic space of E. coli . Briefly, cell paste is thawed in the presence of sodium acetate (pH 3.5), EDTA, and phenylmethylsulfonylfluoride (PMSF) over about 30 min.
- sodium acetate pH 3.5
- EDTA EDTA
- PMSF phenylmethylsulfonylfluoride
- the polypeptide or antibody composition prepared from the cells are purified using, for example, hydroxylapatite chromatography, gel electrophoresis, dialysis, and affinity chromatography, with affinity chromatography being the preferred purification technique.
- affinity chromatography is the preferred purification technique.
- the suitability of protein A as an affinity ligand depends on the species and isotype of any immunoglobulin Fc domain that is present in the polypeptide or antibody. Protein A is used to purify antibodies or fragments thereof that are based on human ⁇ 1 , ⁇ 2 , or ⁇ 4 heavy chains (Lindmark et al., J. Immunol. Meth. 62:1-13 (1983)).
- Protein G is recommended for all mouse isotypes and for human ⁇ 3 (Guss et al., EMBO J. 5:15671575 (1986)).
- the matrix to which the affinity ligand is attached is most often agarose, but other matrices are available. Mechanically stable matrices such as controlled pore glass or poly(styrenedivinyl)benzene allow for faster flow rates and shorter processing times than can be achieved with agarose.
- the polypeptide or antibody comprises a C H 3 domain
- the Bakerbond ABXTM resin J. T. Baker, Phillipsburg, N.J.
- the mixture comprising the polypeptide or antibody of interest and contaminants are subjected to low pH hydrophobic interaction chromatography using an elution buffer at a pH between about 2.5-4.5, preferably performed at low salt concentrations (e.g., from about 0-0.25M salt).
- the invention further includes pharmaceutical formulations including a polypeptide, antibody, or modulator of the present invention, at a desired degree of purity, and a pharmaceutically acceptable carrier, excipient, or stabilizer (Remingion's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)).
- pharmaceutical formulations are prepared to enhance the stability of the polypeptide or antibody during storage, e.g., in the form of lyophilized formulations or aqueous solutions.
- Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include, e.g., buffers such as acetate, Tris, phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine
- the therapeutic formulation preferably comprises the polypeptide or antibody at a concentration of between 5-200 mg/ml, preferably between 10-100 mg/ml.
- the formulations herein also contain one or more additional therapeutic agents suitable for the treatment of the particular indication, e.g., infection being treated, or to prevent undesired side-effects.
- the additional therapeutic agent has an activity complementary to the polypeptide or antibody of the resent invention, and the two do not adversely affect each other.
- an additional or second antibody, anti-viral agent, anti-infective agent and/or cardioprotectant is added to the formulation.
- Such molecules are suitably present in the pharmaceutical formulation in amounts that are effective for the purpose intended.
- the active ingredients are also entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and polymethylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions.
- colloidal drug delivery systems for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
- sustained-release preparations are prepared. Suitable examples of sustained-release preparations include, but are not limited to, semi-permeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g., films, or microcapsules. Nonlimiting examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat. No.
- copolymers of L-glutamic acid and ⁇ ethyl-L-glutamate copolymers of L-glutamic acid and ⁇ ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOTTM (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), and poly-D-( ⁇ )-3-hydroxyburyric acid.
- LUPRON DEPOTTM injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate
- poly-D-( ⁇ )-3-hydroxyburyric acid poly-D-( ⁇ )-3-hydroxyburyric acid.
- Formulations to be used for in vivo administration are preferably sterile. This is readily accomplished by filtration through sterile filtration membranes.
- Antibodies and fragments thereof, and therapeutic compositions, of the invention specifically bind or preferentially bind to infected cells or tissue, as compared to normal control cells and tissue.
- these influenza A antibodies are used to detect infected cells or tissues in a patient, biological sample, or cell population, using any of a variety of diagnostic and prognostic methods, including those described herein.
- the ability of an anti-M2e specific antibody to detect infected cells depends upon its binding specificity, which is readily determined by testing its ability to bind to infected cells or tissues obtained from different patients, and/or from patients infected with different strains of Influenza A.
- Diagnostic methods generally involve contacting a biological sample obtained from a patient, such as, e.g., blood, serum, saliva, urine, sputum, a cell swab sample, or a tissue biopsy, with an Influenza A, e.g., HuM2e antibody and determining whether the antibody preferentially binds to the sample as compared to a control sample or predetermined cut-off value, thereby indicating the presence of infected cells.
- at least two-fold, three-fold, or five-fold more HuM2e antibody binds to an infected cell as compared to an appropriate control normal cell or tissue sample.
- a pre-determined cut-off value is determined, e.g., by averaging the amount of HuM2e antibody that binds to several different appropriate control samples under the same conditions used to perform the diagnostic assay of the biological sample being tested.
- Bound antibody is detected using procedures described herein and known in the art.
- diagnostic methods of the invention are practiced using HuM2e antibodies that are conjugated to a detectable label, e.g., a fluorophore, to facilitate detection of bound antibody.
- detectable label e.g., a fluorophore
- methods of secondary detection of the HuM2e antibody include, for example, RIA, ELISA, precipitation, agglutination, complement fixation and immuno-fluorescence.
- the HuM2e antibodies are labeled.
- the label is detected directly.
- Exemplary labels that are detected directly include, but are not limited to, radiolabels and fluorochromes.
- labels are moieties, such as enzymes, that must be reacted or derivatized to be detected.
- isotope labels are 99 Tc, 14 C, 131 I, 125 I, 3 H, 32 P and 35 S.
- Fluorescent materials that are used include, but are not limited to, for example, fluorescein and its derivatives, rhodamine and its derivatives, auramine, dansyl, umbelliferone, luciferia, 2,3-dihydrophthalazinediones, horseradish peroxidase, alkaline phosphatase, lysozyme, and glucose-6-phosphate dehydrogenase.
- An enzyme label is detected by any of the currently utilized colorimetric, spectrophotometric, fluorospectro-photometric or gasometric techniques. Many enzymes which are used in these procedures are known and utilized by the methods of the invention. Nonlimiting examples are peroxidase, alkaline phosphatase, ⁇ -glucuronidase, ⁇ -D-glucosidase, ⁇ -D-galactosidase, urease, glucose oxidase plus peroxidase, galactose oxidase plus peroxidase and acid phosphatase.
- the antibodies are tagged with such labels by known methods. For instance, coupling agents such as aldehydes, carbodiimides, dimaleimide, imidates, succinimides, bid-diazotized benzadine and the like are used to tag the antibodies with the above-described fluorescent, chemiluminescent, and enzyme labels.
- An enzyme is typically combined with an antibody using bridging molecules such as carbodiimides, periodate, diisocyanates, glutaraldehyde and the like.
- bridging molecules such as carbodiimides, periodate, diisocyanates, glutaraldehyde and the like.
- HuM2e antibodies of the present invention are capable of differentiating between patients with and patients without an Influenza A infection, and determining whether or not a patient has an infection, using the representative assays provided herein.
- a biological sample is obtained from a patient suspected of having or known to have an Influenza A infection.
- the biological sample includes cells from the patient.
- the sample is contacted with an HuM2e antibody, e.g., for a time and under conditions sufficient to allow the HuM2e antibody to bind to infected cells present in the sample.
- the sample is contacted with an HuM2e antibody for 10 seconds, 30 seconds, 1 minute, 5 minutes, 10 minutes, 30 minutes, 1 hour, 6 hours, 12 hours, 24 hours, 3 days or any point in between.
- the amount of bound HuM2e antibody is determined and compared to a control value, which may be, e.g., a pre-determined value or a value determined from normal tissue sample.
- a control value which may be, e.g., a pre-determined value or a value determined from normal tissue sample.
- An increased amount of antibody bound to the patient sample as compared to the control sample is indicative of the presence of infected cells in the patient sample.
- a biological sample obtained from a patient is contacted with an HuM2e antibody for a time and under conditions sufficient to allow the antibody to bind to infected cells. Bound antibody is then detected, and the presence of bound antibody indicates that the sample contains infected cells.
- This embodiment is particularly useful when the HuM2e antibody does not bind normal cells at a detectable level.
- HuM2e antibodies possess different binding and specificity characteristics. Depending upon these characteristics, particular HuM2e antibodies are used to detect the presence of one or more strains of Influenza A. For example, certain antibodies bind specifically to only one or several strains of Influenza virus, whereas others bind to all or a majority of different strains of Influenza virus. Antibodies specific for only one strain of Influenza A are used to identify the strain of an infection.
- antibodies that bind to an infected cell preferably generate a signal indicating the presence of an infection in at least about 20% of patients with the infection being detected, more preferably at least about 30% of patients. Alternatively, or in addition, the antibody generates a negative signal indicating the absence of the infection in at least about 90% of individuals without the infection being detected.
- Each antibody satisfies the above criteria; however, antibodies of the present invention are used in combination to improve sensitivity.
- kits useful in performing diagnostic and prognostic assays using the antibodies of the present invention include kits useful in performing diagnostic and prognostic assays using the antibodies of the present invention.
- Kits of the invention include a suitable container comprising a HuM2e antibody of the invention in either labeled or unlabeled form.
- the kit further includes reagents for performing the appropriate indirect assay.
- the kit includes one or more suitable containers including enzyme substrates or derivatizing agents, depending on the nature of the label. Control samples and/or instructions are also included.
- Passive immunization has proven to be an effective and safe strategy for the prevention and treatment of viral diseases. (See Keller et al., Clin. Microbiol. Rev. 13:602-14 (2000); Casadevall, Nat. Biotechnol. 20:114 (2002); Shibata et al., Nat. Med. 5:204-10 (1999); and Igarashi et al., Nat. Med. 5:211-16 (1999), each of which are incorporated herein by reference)). Passive immunization using human monoclonal antibodies provide an immediate treatment strategy for emergency prophylaxis and treatment of influenza
- HuM2e antibodies and fragments thereof, and therapeutic compositions, of the invention specifically bind or preferentially bind to infected cells, as compared to normal control uninfected cells and tissue.
- these HuM2e antibodies are used to selectively target infected cells or tissues in a patient, biological sample, or cell population.
- the present invention provides methods of regulating (e.g., inhibiting) the growth of infected cells, methods of killing infected cells, and methods of inducing apoptosis of infected cells. These methods include contacting an infected cell with an HuM2e antibody of the invention. These methods are practiced in vitro, ex vivo, and in vivo.
- antibodies of the invention are intrinsically therapeutically active.
- antibodies of the invention are conjugated to a cytotoxic agent or growth inhibitory agent, e.g., a radioisotope or toxin, which is used in treating infected cells bound or contacted by the antibody.
- the invention provides methods of treating or preventing infection in a patient, including the steps of providing an HuM2e antibody of the invention to a patient diagnosed with, at risk of developing, or suspected of having an Influenza A infection.
- the methods of the invention are used in the first-line treatment of the infection, follow-on treatment, or in the treatment of a relapsed or refractory infection.
- Treatment with an antibody of the invention is a standalone treatment.
- treatment with an antibody of the invention is one component or phase of a combination therapy regime, in which one or more additional therapeutic agents are also used to treat the patient.
- Subjects at risk for an influenza virus-related diseases or disorders include patients who have come into contact with an infected person or who have been exposed to the influenza virus in some other way. Administration of a prophylactic agent can occur prior to the manifestation of symptoms characteristic of the influenza virus-related disease or disorder, such that a disease or disorder is prevented or, alternatively, delayed in its progression.
- the huM2e is administered substantially contemporaneously with or following infection of the subject, i.e., therapeutic treatment.
- the antibody provides a therapeutic benefit.
- a therapeutic benefit includes reducing or decreasing progression, severity, frequency, duration or probability of one or more symptoms or complications of influenza infection, virus titer, virus replication or an amount of a viral protein of one or more influenza strains.
- a therapeutic benefit includes hastening or accelerating a subject's recovery from influenza infection.
- a method includes administering to the subject an amount of a huM2e antibody effective to prevent an increase in influenza virus titer, virus replication or an amount of an influenza viral protein of one or more influenza strains or isolates in the subject.
- a method includes administering to the subject an amount of huM2e antibody that specifically binds influenza M2 effective to protect the subject from infection, or effective to decrease susceptibility of the subject to infection, by one or more influenza strains/isolates or subtypes.
- the subject is further administered with a second agent such as, but not limited to, an influenza virus antibody, an anti-viral drug such as a neuraminidase inhibitor, a HA inhibitor, a sialic acid inhibitor or an M2 ion channel inhibitor, a viral entry inhibitor or a viral attachment inhibitor.
- a second agent such as, but not limited to, an influenza virus antibody, an anti-viral drug such as a neuraminidase inhibitor, a HA inhibitor, a sialic acid inhibitor or an M2 ion channel inhibitor, a viral entry inhibitor or a viral attachment inhibitor.
- the M2 ion channel inhibitor is for example amantadine or rimantadine.
- the neuraminidase inhibitor for example zanamivir, or oseltamivir phosphate.
- Symptoms or complications of influenza infection that can be reduced or decreased include, for example, chills, fever, cough, sore throat, nasal congestion, sinus congestion, nasal infection, sinus infection, body ache, head ache, fatigue, pneumonia, bronchitis, ear infection, ear ache or death.
- the patient is usually administered or provided a pharmaceutical formulation including a HuM2e antibody of the invention.
- the antibodies of the invention are administered to the patient in therapeutically effective amounts (i.e., amounts that eliminate or reduce the patient's viral burden).
- the antibodies are administered to a human patient, in accord with known methods, such as intravenous administration, e.g., as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intracerobrospinal, subcutaneous, intra-articular, intrasynovial, intrathecal, oral, topical, or inhalation routes.
- the antibodies may be administered parenterally, when possible, at the target cell site, or intravenously. Intravenous or subcutaneous administration of the antibody is preferred in certain embodiments.
- Therapeutic compositions of the invention are administered to a patient or subject systemically, parenterally, or locally.
- the antibodies are formulated in a unit dosage injectable form (solution, suspension, emulsion) in association with a pharmaceutically acceptable, parenteral vehicle.
- a pharmaceutically acceptable, parenteral vehicle examples include water, saline, Ringer's solution, dextrose solution, and 5% human serum albumin.
- Nonaqueous vehicles such as fixed oils and ethyl oleate are also used.
- Liposomes are used as carriers.
- the vehicle contains minor amounts of additives such as substances that enhance isotonicity and chemical stability, e.g., buffers and preservatives.
- the antibodies are typically formulated in such vehicles at concentrations of about 1 mg/ml to 10 mg/ml.
- the dose and dosage regimen depends upon a variety of factors readily determined by a physician, such as the nature of the infection and the characteristics of the particular cytotoxic agent or growth inhibitory agent conjugated to the antibody (when used), e.g., its therapeutic index, the patient, and the patient's history.
- a therapeutically effective amount of an antibody is administered to a patient.
- the amount of antibody administered is in the range of about 0.01 mg/kg to about 100 mg/kg of patient body weight, or more preferably, in the range of about 0.1 mg/kg to about 40 mg/kg of patient body weight.
- 0.1 mg/kg to about 40 mg/kg body weight (e.g., about 0.1-40 mg/kg/dose) of antibody is an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion.
- the amount of antibody administered is in the range of 0.01 mg/kg to 0.1 mg/kg, 0.1 mg/kg to 0.10 mg/kg, 0.10 mg/kg to 1 mg/kg, 1 mg/kg to 10 mg/kg, 10 mg/kg to 20 mg/kg, 20 mg/kg to 30 mg/kg, 30 mg/kg to 40 mg/kg, 40 mg/kg to 50 mg/kg, 50 mg/kg to 60 mg/kg, 60 mg/kg to 70 mg/kg, 70 mg/kg to 80 mg/kg, 80 mg/kg to 90 mg/kg, or 90 mg/kg to 100 mg/kg of patient body weight.
- the amount of antibody administered is in the range of 0.01 mg/kg to 100 mg/kg, 0.1 mg/kg to 60 mg/kg, 10 mg/kg to 40 mg/kg, 20 mg/kg to 30 mg/kg of patient body weight or any range in between.
- the progress of this therapy is readily monitored by conventional methods and assays and based on criteria known to the physician or other persons of skill in the art.
- an immunoconjugate including the antibody conjugated with a cytotoxic agent is administered to the patient.
- the immunoconjugate is internalized by the cell, resulting in increased therapeutic efficacy of the immunoconjugate in killing the cell to which it binds.
- the cytotoxic agent targets or interferes with the nucleic acid in the infected cell. Examples of such cytotoxic agents are described above and include, but are not limited to, maytansinoids, calicheamicins, ribonucleases and DNA endonucleases.
- the combined administration includes co-administration, using separate formulations or a single pharmaceutical formulation, and consecutive administration in either order, wherein preferably there is a time period while both (or all) active agents simultaneously exert their biological activities.
- Preferably such combined therapy results in a synergistic therapeutic effect.
- an antibody of the invention it is desirable to combine administration of an antibody of the invention with another antibody directed against another antigen associated with the infectious agent.
- the invention provides methods of administration of the antibody by gene therapy.
- administration of nucleic acid encoding the antibody is encompassed by the expression “administering a therapeutically effective amount of an antibody”. See, for example, PCT Patent Application Publication WO96/07321 concerning the use of gene therapy to generate intracellular antibodies.
- anti-M2e antibodies of the invention are used to determine the structure of bound antigen, e.g., conformational epitopes, the structure of which is then used to develop a vaccine having or mimicking this structure, e.g., through chemical modeling and SAR methods. Such a vaccine could then be used to prevent Influenza A infection.
- Fully human monoclonal antibodies specific for M2 and capable of binding to influenza A infected cells and the influenza virus itself were identified in patient serum, as described below.
- the M2 cDNA is encoded by the following polynucleotide sequence and SEQ ID NO: 53: ATGAGTCTTCTAACCGAGGTCGAAACGCCTATCAGAAACGAATGGGGGTGCAGATGCAACGA TTCAAGTGATCCTCTTGTTGTTGCCGCAAGTATCATTGGGATCCTGCACTTGATATTGTGGA TTCTTGATCGTCTTTTTTTCAAATGCATTTATCGTCTCTTTAAACACGGTCTGAAAAGAGGG CCTTCTACGGAAGGAGTACCAGAGTCTATGAGGGAAGAATATCGAAAGGAACAGCAGAGTGC TGTGGATGCTGACGATAGTCATTTTGTCAACATAGAGCTGGAG
- the M2 cDNA is encoded by the following polynucleotide sequence (corresponding to Genbank Accession No.
- M2 The cell surface expression of M2 was confirmed using the anti-M2e peptide specific MAb 14C2.
- the human MAbs identified through this process proved to bind to conformational epitopes on the M2 homotetramer. They bound to the original 293-M2 transfectant, as well as to the two other cell-expressed M2 variants.
- the 14C2 MAb in addition to binding the M2e peptide, proved to be more sensitive to the M2 variant sequences. Moreover, 14C2 does not readily bind influenza virions, while the conformation specific anti-M2 MAbs did.
- the methods of the invention provide for the identification of M2 MAbs from normal human immune responses to influenza without a need for specific immunization of M2. If used for immunotherapy, these fully human MAbs have the potential to be better tolerated by patients that humanized mouse antibodies. Additionally, and in contrast to 14C2 and the Gemini Biosciences MAbs, which bind to linear M2e peptide, the MAbs of the invention bind to conformational epitopes of M2, and are specific not only for cells infected with A strain influenza, but also for the virus itself. Another advantage of the MAbs of the invention is that they each bind all of the M2 variants yet tested, indicating that they are not restricted to a specific linear amino acid sequence.
- Mononuclear or B cells expressing three of the MAbs identified in human serum as described in Example 1 were diluted into clonal populations and induced to produce antibodies.
- Antibody containing supernatants were screened for binding to 293 FT cells stably transfected with the full length M2E protein from influenza strain Influenza subtype H1N1.
- Supernatants which showed positive staining/binding were re-screened again on 293 FT cells stably transfected with the full length M2E protein from influenza strain Influenza subtype H1N1 and on vector alone transfected cells as a control.
- variable regions of the antibodies were then rescue cloned from the B cell wells whose supernatants showed positive binding.
- Transient transfections were performed in 293 FT cells to reconstitute and produce these antibodies.
- Reconstituted antibody supernatants were screened for binding to 293 FT cells stably transfected with the full length M2E protein as detailed above to identify the rescued anti-M2E antibodies.
- Three different antibodies were identified: 8i10, 21B15 and 23K12.
- a fourth additional antibody clone was isolated by the rescue screens, 4C2. However, it was not unique and had the exact same sequence as clone 8i10 even though it came from a different donor than clone 8i10.
- the Kappa LC variable region of the anti M2 clone 8i10 was cloned as Hind III to BsiW1 fragment (see below), and is encoded by the following polynucleotide sequences, and SEQ ID NO: 54 (top) and SEQ ID NO: 55 (bottom):
- the translation of the 8i10 Kappa LC variable region is as follows, polynucleotide sequence (above, SEQ ID NO: 54, top) and amino acid sequence (below, corresponding to residues 1-131 of SEQ ID NO: 56):
- the amino acid sequence of the 8i10 Kappa LC variable region is as follows, with specific domains identified below (CDR sequences defined according to Kabat methods):
- Nonunderlined bases represent pcDNA3.1 vector sequences; underlined bases represent the cloned antibody sequences.
- the antibodies described herein have also been cloned into the expression vector pCEP4.
- the 8i10 Gamma HC variable region was cloned as a Hind III to Xho 1 fragment, and is encoded the following polynucleotide sequences, and SEQ ID NO: 67 (top) and SEQ ID NO: 68 (bottom).
- the translation of the 8i10 Gamma HC is as follows, polynucleotide sequence (above, SEQ ID NO: 67, top) and amino acid sequence (below, corresponding to residues 1-138 of SEQ ID NO: 69):
- amino acid sequence of the 8i10 Gamma HC is as follows with specific domains identified below (CDR sequences defined according to Kabat methods):
- SEQ ID NO: 70 MKHLWFFLLLVAAPSWVLS VH leader (SEQ ID NO: 71) QVQLQESGPGLVKPSETLSLTCTVSGSSIS FR1 (SEQ ID NO: 72) NYYWS CDR1 (SEQ ID NO: 73) WIRQSPGKGLEWIG FR2 (SEQ ID NO: 74) FIYYGGNTKYNPSLKS CDR2 (SEQ ID NO: 75) RVTISQDTSKSQVSLTMSSVTAAESAVYFCAR FR3 (SEQ ID NO: 76) ASCSGGYCILD CDR3 (SEQ ID NO: 77) YWGQGTLVTVS FR4 (SEQ ID NO: 270) YWGQGTLVTVSS Long FR4
- Nonunderlined bases represent pcDNA3.1 vector sequences; underlined bases represent the cloned antibody sequences.
- the framework 4 (FR4) region of the Gamma HC normally ends with two serines (SS), so that the full framework 4 region should be WGQGTLVTVSS (SEQ ID NO: 80).
- the original vector did not adjust for the silent mutation made when the Xho1 site (CTCGAG, SEQ ID NO: 81) was created and contained an “A” nucleotide downstream of the Xho1 site, which caused an amino acid change at the end of framework 4: a serine to arginine (S to R) substitution present in all the working Gamma HC clones.
- CTCGAG CCGAG
- SEQ ID NO: 81 the full framework 4 region reads WGQGTLVTVSR (SEQ ID NO: 82).
- Future constructs are being created wherein the base downstream of the Xho 1 site is a “C” nucleotide.
- the creation of the Xho 1 site used for cloning of the Gamma HC variable region sequences in alternative embodiments is a silent mutation and restores the framework 4 amino acid sequence to its proper WGQGTLVTVSS (SEQ ID NO: 80). This is true for all M2 Gamma HC clones described herein.
- the Kappa LC variable region of the anti M2 clone 21B15 was cloned as Hind III to BsiW1 fragment, and is encoded by the following polynucleotide sequences and SEQ ID NO: 83 and SEQ ID NO: 84:
- the translation of the 21B15 Kappa LC variable region is as follows, polynucleotide sequence (above, SEQ ID NO: 83, top) and amino acid sequence (below, corresponding to SEQ ID NO: 320):
- the amino acid sequence of the 21B15 Kappa LC variable region is as follows, with specific domains identified below (CDR sequences defined according to Kabat methods):
- the primer used to clone the Kappa LC variable region extended across a region of diversity and had wobble base position in its design.
- a D or E amino acid could occur in the framework 4 region.
- the amino acid in this position in the rescued antibody may not be the original parental amino acid that was produced in the B cell.
- the position is an E.
- DIKRT D in framework 4
- the native antibody from the B cell may have had an E in this position.
- the 21B15 Gamma HC variable region was cloned as a Hind III to Xho 1 fragment, and is encoded by the following polynucleotide sequences and SEQ ID NO: 85 (top), and SEQ ID NO: 86 (bottom):
- the translation of the 21B15 Gamma HC is as follows, polynucleotide sequence (above, SEQ ID NO: 87, top) and amino acid sequence (below, corresponding to residues 1-138 of SEQ ID NO: 69):
- the amino acid sequence of the 21B15 Gamma HC is as follows, with specific domains identified below (CDR sequences defined according to Kabat methods):
- SEQ ID NO: 70 MKHLWFFLLLVAAPSWVLS VH leader (SEQ ID NO: 71) QVQLQESGPGLVKPSETLSLTCTVSGSSIS FR1 (SEQ ID NO: 72) NYYWS CDR1 (SEQ ID NO: 73) WIRQSPGKGLEWIG FR2 (SEQ ID NO: 74) FIYYGGNTKYNPSLKS CDR2 (SEQ ID NO: 75) RVTISQDTSKSQVSLTMSSVTAAESAVYFCAR FR3 (SEQ ID NO: 76) ASCSGGYCILD CDR3 (SEQ ID NO: 77) YWGQGTLVTVS FR4
- the Kappa LC variable region of the anti M2 clone 23K12 was cloned as Hind III to BsiW1 fragment (see below), and is encoded by the following polynucleotide sequences SEQ ID NO: 88 (top) and SEQ ID NO: 89 (below).
- the translation of the 23K12 Kappa LC variable region is as follows, polynucleotide sequence (above, SEQ ID NO: 90, top) and amino acid sequence (below, corresponding to SEQ ID NO: 91).
- the amino acid sequence of the 23K12 Kappa LC variable region is as follows, with specific domains identified below (CDR sequences defined according to Kabat methods):
- the 23K12 Gamma HC variable region was cloned as a Hind III to Xho 1 fragment, and is encoded by the following polynucleotide sequences and SEQ ID NO: 97 (top) and SEQ ID NO: 98 (bottom).
- the translation of the 23K12 Gamma HC variable region is as follows, polynucleotide sequence (above, SEQ ID NO: 99, top), and amino acid sequence (below, corresponding to SEQ ID NO: 100):
- the amino acid sequence of the 23K12 Gamma HC variable region is as follows, with specific domains identified below (CDR sequences defined according to Kabat methods):
- Clones 8I10 and 21B15 came from two different donors, yet they have the same exact Gamma HC and differ in the Kappa LC by only one amino acid at position 4 in the framework 1 region (amino acids M versus V, see above), (excluding the D versus E wobble position in framework 4 of the Kappa LC).
- the antibodies described above were produced in milligram quantities by larger scale transient transfections in 293 PEAK cells. Crude un-purified antibody supernatants were used to examine antibody binding to influenza A/Puerto Rico/8/1932 (PR8) virus on ELISA plates, and were compared to the binding of the control antibody 14C2, which was also produced by larger scale transient transfection.
- the anti-M2 recombinant human monoclonal antibodies bound to influenza while the control antibody did not ( FIG. 9 ).
- binding was also tested on MDCK cells infected with the PR8 virus ( FIG. 10 ).
- the antibodies were purified over protein A columns from the supernatants. FACs analysis was performed using purified antibodies at a concentration of 1 ⁇ g per ml to examine the binding of the antibodies to transiently transfected 293 PEAK cells expressing the M2 proteins on the cell surface. Binding was measured testing binding to mock transfected cells and cells transiently transfected with the Influenza subtype H1N1, A/Fort Worth/1/50, or A/Hong Kong/483/1997 HK483 M2 proteins. As a positive control the antibody 14C2 was used. Unstained and secondary antibody alone controls helped determined background. Specific staining for cells transfected with the M2 protein was observed for all three clones.
- Antibodies 21B15, 23K12, and 8I10 bound to the surface of 293-HEK cells stably expressing the M2 protein, but not to vector transfected cells (see FIG. 1 ). In addition, binding of these antibodies was not competed by the presence of 5 mg/ml 24-mer M2 peptide, whereas the binding of the control chimeric mouse V-region/human IgG1 kappa 14C2 antibody (hu14C2) generated against the linear M2 peptide was completely inhibited by the M2 peptide (see FIG. 1 ). These data confirm that these antibodies bind to conformational epitopes present in M2e expressed on the cell or virus surface, as opposed to the linear M2e peptide.
- UV-inactivated influenza A virus (A/PR/8/34) (Applied Biotechnologies) was plated in 384-well MaxiSorp plates (Nunc) at 1.2 ⁇ g/ml in PBS, with 25 ⁇ l/well, and was incubated at 4° C. overnight. The plates were then washed three times with PBS, and blocked with 1% Nonfat dry milk in PBS, 50 ⁇ l/well, and then were incubated at room temp for 1 hr. After a second wash with PBS, MAbs were added at the indicated concentrations in triplicate, and the plates were incubated at room temp for 1 hour.
- M2 variants (including those with a high pathology phenotype in vivo) were selected for analysis. See FIG. 3A for sequences.
- M2 cDNA constructs were transiently transfected in HEK293 cells and analyzed as follows: To analyze the transient transfectants by FACS, cells on 10 cm tissue culture plates were treated with 0.5 ml Cell Dissociation Buffer (Invitrogen), and harvested. Cells were washed in PBS containing 1% FBS, 0.2% NaN 3 (FACS buffer), and resuspended in 0.6 ml FACS buffer supplemented with 100 ⁇ g/ml rabbit IgG. Each transfectant was mixed with the indicated MAbs at 1 ⁇ g/ml in 0.2 ml FACS buffer, with 5 ⁇ 10 5 to 10 6 cells per sample.
- FACS buffer 1% FBS, 0.2% NaN 3
- alanine was substituted at individual amino acid positions as indicated by site-directed mutagenesis.
- FIGS. 4A and 4B show that the epitope is in a highly conserved region of the amino terminus of the M2 polypeptide. As shown in FIGS. 4A , 4 B and FIG. 8 , the epitope includes the serine at position 2, the threonine at position 5 and the glutamic acid at position 6 of the M2 polypeptide.
- M2 protein representing influenza strain A/HK/483/1997 sequence was stably expressed in the CHO (Chinese Hamster Ovary) cell line DG44.
- Cells were treated with Cell Dissociation Buffer (Invitrogen), and harvested.
- Cells were washed in PBS containing 1% FBS, 0.2% NaN 3 (FACS buffer), and resuspended at 10 7 cells/ml in FACS buffer supplemented with 100 ⁇ g/ml rabbit IgG.
- the cells were pre-bound by either MAb (or the 2N9 control) at 10 ⁇ g/ml for 1 hr at 4° C., and were then washed with FACS buffer.
- mAbs 8i10 and 23K12 The cross reactivity of mAbs 8i10 and 23K12 to other M2 peptide variants was assessed by ELISA. Peptide sequences are shown in FIGS. 6A and 6B . Additionally, a similar ELISA assay was used to determine binding activity to M2 truncated peptides.
- each flat bottom 384 well plate (Nunc) was coated with a concentration of 2 ⁇ g/mL peptide and 25 ⁇ L/well of PBS buffer overnight at 4° C. Plates were washed three times and blocked with 1% Milk/PBS for one hour at room temperature. After washing three times, MAb titers were added and incubated for one hour at room temperature. Diluted HRP conjugated goat anti-human immunoglobulin FC specific (Pierce) was added to each well after washing three times. Plates were incubated for one hour at room temperature and washed three times. 1-StepTM Ultra-TMB-ELISA (Pierce) was added at 25 ⁇ l/well, and the reaction proceeded in the dark at room temp. The assay was stopped with 25 ⁇ l/well 1N H 2 SO 4 , and light absorbance at 450 nm (A450) was read on a SpectroMax Plus plate reader. Results are shown in FIGS. 6A and 6B .
- mice Female BALB/c mice were randomized into 5 groups of 10. One day prior (Day ⁇ 1 (minus one)) and two days post infection (Day +2 (plus two), 200 ⁇ g of antibody was given via 200 ⁇ l intra-peritoneal injection. On Day 0 (zero), an approximate LD90 (lethal dose 90) of A/Vietnam/1203/04 influenza virus, in a volume of 30 ⁇ l was given intra-nasally. Survival rate was observed from Day 1 through Day 28 post-infection. Results are shown in FIG. 7 .
- Full length M2 cDNA (A/Hong Kong/483/97) were synthesized (Blue Heron Technology) and cloned into the plasmid vector pcDNA3.1 which was then transfected into CHO cells with Lipofectamine (Invitrogen) to create a stable pool of CHO-HK M2-expressing cells.
- Lipofectamine Invitrogen
- 20 ⁇ l samples of supernatant from transient transfections from each of the IgG heavy and light chain combinations was used to stain the CHO-HK M2 stable cell line. Bound anti-M2 mabs were visualized on viable cells with Alexafluor 647-conjugated goat anti-Human IgG H&L antibody (Invitrogen). Flow cytometry was performed with a FACSCanto, and analysis on the accompanying FACSDiva software (Becton Dickenson).
- Purified Influenza A (A/Puerto Rico/8/34) inactivated by ⁇ -propiolactone (Advanced Biotechnologies, Inc.) was biotinylated (EZ-Link Sulfo-NHS-LC-Biotin, Pierce) and adsorbed for 16 hours at 4° C. to 384-well plates in 25 ⁇ l PBS that were pre-coated with neutravidin (Pierce). Plates were blocked with BSA in PBS, samples of supernatant from transient transfections from each of the IgG heavy and light chain combinations were added at a final dilution of 1:5, followed by HRP-conjugated goat anti-human Fc antibody (Pierce), and developed with TMB substrate (ThermoFisher).
- Influenza remains a serious public health threat throughout the world. Vaccines and antivirals are available that can provide protection from infection. However, new viral strains emerge continuously because of the plasticity of the influenza genome which necessitates annual reformulation of vaccine antigens, and resistance to antivirals can appear rapidly and become entrenched in circulating virus populations. In addition, the spread of new pandemic strains is difficult to contain due to the time required to engineer and manufacture effective vaccines. Monoclonal antibodies that target highly conserved viral epitopes might offer an alternative protection paradigm.
- strain composition of influenza vaccines must be determined prior to the influenza season on an annual basis, and predicting in advance which strains will become dominant is challenging. Moreover, the emergence of strains that evade vaccine-induced, protective immune responses is relatively rapid which often results in inadequate protection (Carrat F and A. Flahault A. (2007) Vaccine 25:6852-6862).
- Antiviral drugs include oseltamivir and zanamivir which inhibit the function of the viral protein neuraminidase (NA), and adamantanes which inhibit the ion channel function of the viral M2 protein (Gubareva L. V. et al. (2000) Lancet 355:827-835; Wang C. et al. (1993) J Virol 67:5585-5594). Antiviral agents are effective for sensitive virus strains but viral resistance can develop quickly and has the potential to render these drugs ineffective.
- NA neuraminidase
- M2e ectodomain of the viral M2 protein
- HA or NA ectodomain of the viral M2 protein
- Monoclonal antibodies to M2e have been shown to be protective in vivo (Wang R, et al. (2008) Antiviral Res 80:168-177; Liu W. et al. (2004) Immunol Lett 93:131-6; Fu T. M. et al. (2008) Virology 385:218-226; Treanor J. J. et al. (1990) J Virol 64:1375-1357; Beerli R, et al.
- M2 protein or peptides derived from M2e sequence have been used as immunogens to generate anti-M2e antibodies in animals or as vaccine candidates.
- mAbs directly from human B cells that bind to the M2 protein displayed on virus particles and on virus-infected cells.
- these antibodies protect mice from a lethal influenza A virus challenge and that they can recognize M2 variants derived from a wide range of human and animal influenza A virus isolates. This combination of properties may enhance the utility of these antibodies to prevent and treat influenza A virus infections.
- IgG + memory B cells of M2e-seropositive subjects Serum samples from 140 healthy adult, United States-sourced donors were tested for reactivity with M2e expressed on the surface of HEK293 cells that were transfected with a viral M2 gene (derived from A/Fort Worth/50 H1N1). IgG + memory B cells from 5 of the 23 M2e-seropositive subjects were cultured under conditions where they proliferated and differentiated into IgG-secreting plasma cells.
- V H and V L immunoglobulin heavy and light chain variable region
- the two more distantly related mAbs 62B11 and 41G23 utilize the germline V gene segment IGHV4-31*03 which has only 5 amino acid residue differences from the germline V gene segment IGHV4-59*01 of group A. All of these mAbs utilize the same light chain V gene, IGKV1-39*01 or its allele IGKV1D-39*01 and show evidence of somatic hypermutation from the germline heavy or kappa chain sequence ( FIG. 12 ).
- Competitive binding experiments showed that all of these human mAbs appear to bind similar sites on native M2e expressed on the surface of Chinese hamster ovary (CHO) cells ( FIG. 13 ).
- One mAb was selected for further characterization from each of groups A and B, designated TCN-031 and TCN-032, respectively.
- TCN-031 and TCN-032 bound directly to an H1N1 virus (A/Puerto Rico/8/34) with high avidity, with half-maximal binding at about 100 ng/mL ( FIG. 14 a ).
- Fab fragments prepared from TCN-031 and TCN-032 bound virus with affinities (KD) of 14 and 3 nM, respectively, as determined by surface plasmon resonance (Table 4).
- the human mAbs did not bind appreciably to a 23 amino acid synthetic peptide corresponding to the M2e domain of an H1N1 virus (A/Fort Worth/1/50) ( FIG. 14 b ).
- a chimeric derivative of the murine anti-M2e mAb 14C2 (ch14C2), which was originally generated by immunization with purified M2 (Zebedee S. L. and R. A. Lamb (1988) J Virol 62:2762-2772), exhibited the opposite behavior to that observed with the human mAbs, with little binding to virus but robust binding to the isolated 23mer M2e peptide with half-maximal binding to peptide at 10 ng/mL ( FIGS. 14 a and 14 b ).
- mice were challenged intranasally with 5 ⁇ LD 50 units of a high-pathogenicity H5N1 virus (A/Vietnam/1203/04) and both human mAbs were protective when treatment was initiated one day after viral challenge.
- 5 ⁇ LD 50 units of a high-pathogenicity H5N1 virus A/Vietnam/1203/04
- mice that were subjected to similar treatment regimens with a subclass-matched, irrelevant control mAb 2N9, which targets the AD2 epitope of the gp116 portion of the human cytomegalovirus gB, or with a vehicle control were protected to a lesser extent, or not at all, resulting in 70-80% survival for mice treated with human mAbs versus 20% survival for control mAb and 0% survival for vehicle ( FIG. 15 a ).
- the anti-M2e mAb ch14C2 did not confer substantial protection in this model (20% survival; FIG. 15 a ), though this mAb has been shown to reduce the titer of virus in the lungs of mice infected with other strains of influenza virus (Treanor J. J.
- mice treated with ch14C2 provided a similar survival benefit to that of the human anti-M2e mAbs ( FIG. 15 c ).
- the human anti-M2e mAbs and ch14C2 bound to cell surface-expressed M2e from A/Vietnam/1203/04 and A/Puerto Rico/8/34 viruses ( FIG. 19 b , Table 6) and cells infected with A/Puerto Rico/8/34 ( FIG. 14 c ).
- Mechanisms for antibody-mediated protection could include killing of infected host cells by antibody-dependent cell-mediated cytotoxicity or complement-dependent cytotoxicity (Wang R. et al. (2008) Antiviral Res 80:168-177; Jegerlehner A. (2004) J Immunol 172:5598-5605).
- mice had similar lung lesions across all groups, although mice in the TCN-031 and TCN-032 groups had a tendency toward less viral antigen expression in the lung.
- lesions were not detected in mice in the TCN-31 group and only one of three mice in the TCN-032 group showed some evidence of viral antigens in the brain.
- Pathological changes/viral antigens +++ severe/many, ++ moderate/moderate, + mild/few, ⁇ scant/rare, ⁇ not observed/negative.
- the M2e sequence at the top is from A/Brevig Mission/1/18 (H1N1) and is used as the reference sequence for alignment of the M2 ectodomain amino acids 1-23 of 43 wild-type variants. Grey boxes denote amino acid identity with the reference sequence and white boxes are amino acid replacement mutations. This list of non-identical sequences, except for HK, VN, and D20, was derived from M2 sequences used in references 11 and 27. Sequence data are from The Influenza Virus Resource at the National Center for Biotechnology Information (http://www.ncbi.nlm.nih.gov/genomes/FLU/FLU.html).
- TCN-031 and TCN-032 recognize a core sequence of SLLTE at positions 1-5 of the N-terminus of mature M2e. This is supported by data which show that these mAbs compete effectively with each other for binding to M2e expressed on the surface of CHO cells ( FIG. 20 ).
- ch14C2 binds to a site that is spatially distinct and downstream of the SLLTE core that is recognized by the human anti-M2e mAbs.
- 14C2 binds a relatively broad, linear epitope with the sequence EVERTPIRNEW at positions 5-14 of processed M2e (Wang R, et al. (2008) Antiviral Res 80:168-177).
- TCN-031 and TCN-032 While the epitopes recognized by TCN-031 and TCN-032 are likely very similar, there were some differences between these human mAbs in their binding to several of the M2e mutants. For instance, TCN-031 appears to have a greater dependence than TCN-032 on residues 2 (L) and 3 (L) of the mature M2e sequence ( FIG. 19 a ).
- the VH regions of these two human mAbs utilize different variable, diversity, and joining gene segments which may explain the minor differences in binding observed between these mAbs.
- despite the differences in their VH make-up these human mAbs utilize the same germline kappa chain V gene segments, albeit with distinct kappa chain joining segments.
- the viral M gene segment that encodes M2 also encodes the internal viral protein M1 via differential splicing. However, the splice site is located downstream of the shared N-terminus of M2 and M1 resulting in two distinct mature polypeptides with an identical 8 amino acid N-terminal sequence (Lamb R. A. and P. W. Choppin (1981) Virology 112:729-737).
- the core human anti-M2e antibody epitope SLLTE is present in ⁇ 98% of the 1364 unique full-length M2e sequences catalogued in the NCBI Influenza Database, including 97%, 98% and 98% of the human, swine and avian viruses, respectively.
- 14C2 and Z3G1 (Wang R. et al. (2008) Antiviral Res 80:168-177) bind sequences that are conserved in less than 40% of influenza A viruses, and conservation within this region is even lower in avian and swine viruses (Table 7).
- the linear M2e epitopes recognized by peptide-elicited antibodies may be more sensitive to escape mutations and natural substitutions that are present in some viral isolates.
- P10L and P10H escape mutations to mAb 14C2 have been mapped to the central portion of M2e (Zharikova D. et al. (2005) J Virol 79:6644-6654) and those same substitutions also occur in M2e variants from some highly pathogenic H5N1 strains.
- monoclonal antibodies with specificities similar to that of 14C2 are likely to have limited utility as broad spectrum therapeutic agents.
- mice immunized with M2e-derived peptides produced antibodies with a range of specificities within M2e, including the conserved N-terminus and also downstream regions (Fu T. M. et al. (2008) Virology 385:218-226).
- Broadly protective anti-influenza mAbs can be used in passive immunotherapy to protect or treat humans in the event of outbreaks from highly pathogenic, pandemic viral strains.
- a critical test of the potential for such mAbs as immunotherapeutic agents is whether they are capable of recognizing virus strains that may evolve from future viral reassortment events.
- the human anti-M2e mAbs TCN-031 and TCN-032 were tested for their ability to recognize the current H1N1 swine-origin pandemic strain (S-OIV). These mAbs were derived from human blood samples taken in 2007 or earlier, prior to the time that this strain is thought to have emerged in humans (Neumann G. et al.
- PBMC peripheral blood mononuclear cells
- cells were seeded in 384-well microtiter plates in the presence of feeder cells and conditioned media generated from mitogen-stimulated human T cells from healthy donors. The culture supernatants were collected 8 days later and screened in a high throughput format for binding reactivity to M2 protein expressed on HEK 293 cells stably transfected with influenza virus M2 (A/Fort Worth/50 H1N1) using fluorescent imaging (FMAT system, Applied Biosystems).
- variable domain genes were PCR amplified using VH, V ⁇ , and V ⁇ family-specific primers with flanking restriction sites (Walker L. et al. (2009) Science 326:289-293). PCR reactions producing an amplicon of the expected size were identified using 96-well E-gels (Invitrogen) and the variable domain amplicons were cloned into the pTT5 expression vector (National Research of Canada, Ottawa, Canada) containing human IgG1, Ig ⁇ , or Ig ⁇ constant regions.
- VH pool was combined with the corresponding V ⁇ , or V ⁇ pools from individual BCC wells and was transiently transfected in 293-6E cells to generate recombinant antibody.
- Conditioned media was harvested 3-5 days after transfection and assayed for antibody binding to M2 protein expressed on HEK 293 cells.
- Individual clones were isolated from positive pools and unique VH and VL genes were identified by sequencing. From these, monoclonal antibodies were subsequently expressed and re-assayed for binding activity.
- UV-inactivated H1N1 A/Puerto Rico/8/34 (PR8) virus (Advanced Biotechnologies, Inc.) was passively adsorbed to 384-well plates in 25 ⁇ L PBS/well for 16 hr at 4° C., or PR8 inactivated by ⁇ -propiolactone (Advanced Biotechnologies, Inc.) was biotinylated (EZ-Link Sulfo-NHS-LC-Biotin, Pierce) and likewise adsorbed to plates coated with neutravidin (Pierce). Virus-coated and biotinylated virus-coated plates were blocked with PBS containing 1% milk or BSA, respectively.
- Binding of mAbs at the indicated concentrations was detected with HRP-conjugated goat anti-human Fc antibody (Pierce) and visualized with TMB substrate (ThermoFisher).
- the M2e peptide, SLLTEVETPIRNEWGCRCNDSSD (Genscript) was passively adsorbed at 1 ⁇ g/mL and antibody binding to the peptide was detected by the same method.
- MDCK cells were treated with PR8 at multiplicity of infection (MOI) of 60:1 for 1 hr at 37° C. after which the culture media was replaced. The infected MDCK cells were further cultured for 16 hr before harvesting for cell staining with the indicated mAbs. Bound anti-M2 mAbs were visualized on viable cells with Alexafluor 647-conjugated goat anti-Human IgG H&L antibody (Invitrogen). Flow cytometry was performed on FACSCanto equipped with the FACSDiva software (Becton Dickenson).
- M2 cDNA mutants were synthesized with single ala mutations at each position of the ectodomain representing A/Fort Worth/1/1950 (D20), as well as were the forty-three naturally occurring variants of M2 (Blue Heron Technology). They were cloned into the plasmid vector pcDNA3.1. After transient transfection with Lipofectamine (Invitrogen), HEK293 cells were treated with 1 ⁇ g/mL of the indicated mAbs in PBS supplemented with 1% fetal bovine serum and 0.2% NaN3 (FACS buffer).
- Bound anti-M2 mAbs were visualized on viable cells with Alexafluor 647-conjugated goat anti-Human IgG H&L antibody (Invitrogen). Flow cytometry was performed with FACSCanto equipped with the FACSDiva software (Becton Dickenson). The relative binding to the naturally occurring variants was expressed as the percentage of the respective mAb staining of the D20 transiently transfected cells, using the formula of Normalized MFI (%) 100 ⁇ (MFIexperimental ⁇ MFImock transfected)/(MFID20 ⁇ MFImock transfected).
- mice Female 6-8 week old BALB/C mice were innoculated intranasally with 5 ⁇ LD 50 of A/Vietnam/1203/04 ( FIGS. 15 a and b ) or 6 groups of 5 mice were innoculated intranasally with 5 ⁇ LD 50 A/Puerto Rico/8/34 ( FIGS. 15 c and d ).
- mice received intraperitoneal injections of 400 ⁇ g/200 ⁇ L dose of the anti-M2e mAbs TCN-031 TCN-032, control human mAb 2N9, control chimeric mAb ch14C2, PBS, or were left untreated.
- Mice were weighed daily for 2 weeks and were euthanized when weight loss exceeded 20% (H5N1 study shown in FIGS. 15 a and 15 b and H1N1 study shown in FIGS. 15 c and 15 d ) of the pre-infection body weight.
- MDCK cells were infected with media alone or media containing A/California/4/2009 (H1N1) or A/Memphis/14/1996 (H1N1) at an MOI of approximately 1 and were cultured for 24 hours at 37° C.
- the cells were detached from the tissue culture plates with trypsin, washed extensively, and then fixed in 2% paraformaldehyde for 15 minutes.
- the cells were incubated with 1 ⁇ g/ml of the indicated antibodies and the primary antibody binding was detected with Alexafluor 647-conjugated goat anti-Human IgG H&L antibody (Invitrogen).
- the cells were analyzed with a Becton Dickinson FACSCalibur and data were processed using FlowJo software.
- Transient transfection supernatant containing antibody was screened for binding to 293 cells stably transfected with M2 from H1N1 (A/Fort Worth/50 H1N1), or mock transfected cells, in the presence or absence of the M2e peptide SLLTEVETPIRNEWGCRCNDSSD (Genscript) at 5 ⁇ g/mL.
- Bound anti-M2 mAbs were detected with anti-huIgG Fc FMAT Blue at 700 ng/ml in DMEM with 10% FCS and visualized by fluorescent imaging (FMAT system, Applied Biosystems).
- mice Groups of ten (10) mice were challenged with influenza A infection, and, specifically, with H5N1 (A/VN/1203/04) at a dosage of 5-20 fold the LD 50 , which is a standardized measure for expressing and comparing the toxicity of a compound.
- the LD 50 is a dose that kills half (50%) of the animals tested, and, therefore, the “LD” is an abbreviation for lethal dose.
- mice were treated with an anti-M2e antibody (e.g. TCN-032) or an isotype negative-control at a dosage of 20 mg/kg, once a day. Either the M2e or the control antibody was administered on days one (1), three (3), and five (5).
- an anti-M2e antibody e.g. TCN-032
- an isotype negative-control at a dosage of 20 mg/kg, once a day.
- Either the M2e or the control antibody was administered on days one (1), three (3), and five (5).
- challenged mice were treated with an antiviral drug having neuraminidase inhibitor activity, (e.g. oseltamivir, oseltamivir phosphate, or TamifluTM), at a dosage of 10 mg/kg BID (twice, or two times, a day).
- an antiviral drug having neuraminidase inhibitor activity e.g. oseltamivir, oseltamivir phosphate, or TamifluTM
- the antiviral drug having neuraminidase inhibitor activity e.g. oseltamivir, oseltamivir phosphate, or TamifluTM
- mice were “untreated.” These mice were administered phosphate buffered saline (PBS) rather than the M2e antibody, oseltamivir, or the M2e antibody/oseltamivir combination therapy.
- PBS phosphate buffered saline
- FIG. 22 shows that at 5 fold the LD 50 (5LD 50 ), the combinatorial therapy of the anti-M2e antibody (TCN-032) and the antiviral drug (oseltamivir) promoted survival of every mouse throughout the entire 15 day study post-infection.
- TCN-032 the anti-M2e antibody
- oseltamivir the antiviral drug
- the difference in percent survival between the combinatorial therapy and the untreated condition is very statistically significant (p ⁇ 0.0001).
- the term statistically significant is meant to describe, for instance, a p-value of less than 0.05 (p ⁇ 0.05), and preferably, a p-value of less than 0.01 (p ⁇ 0.01). Most preferably, a statistically significant value describes a p-value of less than 0.001 (p ⁇ 0.001).
- FIG. 23 shows that at 5 fold the LD 50 (5LD 50 ), the combinatorial therapy of the anti-M2e antibody (TCN-032) and the antiviral drug (oseltamivir) insulates the subject from deleterious weight change throughout the entire 15 day study post-infection.
- the benefit of the combinatorial therapy was comparable to the weight observed for a population of unchallenged and untreated mice.
- FIG. 24 shows that at 10 fold the LD 50 (10LD 50 ), the combinatorial therapy of the anti-M2e antibody (TCN-032) and the antiviral drug (oseltamivir) not only prolongs survival of every mouse throughout the entire 15 day study post-infection, but also surpasses the individual therapeutic capacities of treatment with either the TCN-032 antibody or the oseltamivir drug alone. Whereas mice begin to die at day 8-9 when provided either the TCN-032 antibody or the oseltamivir drug alone, every mouse survived to the conclusion of the 15 day study when provided TCN-032/oseltamivir combinatorial therapy.
- the difference in percent survival between the combinatorial therapy and the untreated condition is very statistically significant (p ⁇ 0.0003).
- the difference in percent survival between the combinatorial therapy and treatment with oseltamivir alone is also statistically significant (p ⁇ 0.029).
- FIG. 25 shows that at 10 fold the LD 50 (10LD 50 ), the combinatorial therapy of the anti-M2e antibody (TCN-032) and the antiviral drug (oseltamivir) not only insulates the subject from deleterious weight change throughout the entire 15 day study post-infection, but also surpasses the individual therapeutic capacities of treatment with either the TCN-032 antibody or the oseltamivir drug alone.
- the benefit of the combinatorial therapy was comparable to the weight observed for a population of unchallenged and untreated mice.
- FIG. 26 shows that at 20 fold the LD 50 (20LD 50 ), the combinatorial therapy of the anti-M2e antibody (TCN-032) and the antiviral drug (oseltamivir) not only prolongs survival of every mouse throughout the entire 15 day study post-infection, but also surpasses the individual therapeutic capacities of treatment with either the TCN-032 antibody or the oseltamivir drug alone. As shown during the challenge at 10LD 50 , the difference in percent survival between the combinatorial therapy and treatment with oseltamivir alone is also statistically significant (p ⁇ 0.029).
- FIG. 27 shows that at 20 fold the LD 50 (20LD 50 ), the combinatorial therapy of the anti-M2e antibody (TCN-032) and the antiviral drug (oseltamivir) not only insulates the subject from deleterious weight change throughout the entire 15 day study post-infection, but also surpasses the individual therapeutic capacities of treatment with either the TCN-032 antibody or the oseltamivir drug alone.
- the benefit of the combinatorial therapy was comparable to the weight observed for a population of unchallenged and untreated mice.
- balb/c female mice were challenged with influenza A infection, and, specifically, with H5N1 (A/Vietnam/1203/04, (VN1203)) at a dosage of 5 fold the LD 50 (5LD 50 , also written 5 ⁇ LD 50 or 5 ⁇ MLD 50 ).
- mice were treated with an anti-M2e antibody or an isotype negative-control at 20 mg/kg (or 400 ⁇ g/treatment), once per day. Either the M2e or the control antibody was administered on days one (1), three (3), and five (5).
- the anti-M2e antibody was either TCN-031 (also known as 23K12) or TCN-032 (also known as 8i10).
- challenged mice were treated with an antiviral drug having neuraminidase inhibitor activity, (e.g. oseltamivir, oseltamivir phosphate, or TamifluTM), at a dosage of 10 mg/kg BID (“bis in die”, twice, or two times, a day).
- an antiviral drug having neuraminidase inhibitor activity e.g. oseltamivir, oseltamivir phosphate, or TamifluTM
- the antiviral drug having neuraminidase inhibitor activity e.g. oseltamivir, oseltamivir phosphate, or TamifluTM
- mice were “untreated.” These mice were administered phosphate buffered saline (PBS) rather than the M2e antibody, oseltamivir, or the M2e antibody/oseltamivir combination therapy.
- PBS phosphate buffered saline
- mice were left unchallenged and untreated as further controls.
- Treatments including the PBS control, were administered by intraperitoneal injection.
- mice in all experimental and control groups were euthanized when their post-infection weight loss exceeded 20% of their pre-infection weight.
- FIG. 29 shows that at 5 fold the LD 50 (5LD 50 ), the percentage of survival within mouse populations that were treated with either TCN-031 or TCN-032 was substantially higher than the percentage survival of either the positive or negative control antibodies (i.e. treatment with the M2e antibodies lead to an 80% survival rate at day 14, treatment with control antibodies lead to a 20% survival rate at day 14, and the untreated group had completely expired by day 10).
- FIG. 30 shows that at 5 fold the LD 50 (5LD 50 ), the percentage of survival within mouse populations that were treated with either TCN-031 or TCN-032 was substantially higher than the percentage survival of those mouse populations treated with oseltamivir at 10 mg/kg (either for a treatment+4-hour or treatment+1 day regime) (i.e. treatment with the M2e antibodies-lead to an 80% survival rate at day 14, oseltamivir treatment beginning four hours post-infection alone lead to a 20% survival rate at day 14, and oseltamivir treatment beginning one (1) day post-infection caused the mouse population to completely expire by day 11).
- One explanation for the superior performance of the anti-M2e antibodies is the fact that the epitope of the TCN-031 and TCN-032 anti-M2e antibodies is present in greater than 98% of influenza viruses, including non-human viruses.
- balb/c female mice were challenged with influenza A infection, and, specifically, with H5N1 (A/Vietnam/1203/04, (VN1203)) at a dosage of 5 fold the LD 50 (5LD 50 , also written 5 ⁇ LD 50 or 5 ⁇ MLD 50 ).
- mice were treated with an anti-M2e antibody or an isotype negative-control at 20 mg/kg (or 400 ⁇ g/treatment), once per day. Either the M2e or the control antibody was administered on days one (1), three (3), and five (5).
- the anti-M2e antibody was either TCN-031 (also known as 23K12) or TCN-032 (also known as 8i10).
- challenged mice were treated with an antiviral drug having neuraminidase inhibitor activity, (e.g. oseltamivir, oseltamivir phosphate, or TamifluTM), at a dosage of 10 mg/kg q.d. (quaque die, i.e. once a day).
- the antiviral drug having neuraminidase inhibitor activity (e.g. oseltamivir, oseltamivir phosphate, or TamifluTM), was provided on days one (1) through five (5).
- mice were “untreated.” These mice were administered phosphate buffered saline (PBS) rather than the M2e antibody, oseltamivir, or the M2e antibody/oseltamivir combination therapy.
- PBS phosphate buffered saline
- mice were left unchallenged and untreated as further controls.
- Treatments including the PBS control, were administered by intraperitoneal injection.
- mice in all experimental and control groups were euthanized when their post-infection weight loss exceeded 20% of their pre-infection weight.
- FIG. 31 shows that at 5 fold the LD 50 (5MLD 50 ), that the percentage of survival within mouse populations that were treated with either TCN-031 or TCN-032 was substantially higher than the percentage survival of either the positive or negative control antibodies (i.e. treatment with the M2e antibodies lead to an 80% survival rate at day 14, treatment with control antibodies lead to a 20% survival rate at day 14, and the untreated group had completely expired by day 10). Moreover, the percentage of survival within mouse populations that were treated with either TCN-031 or TCN-032 was substantially higher than the percentage survival of those mouse populations treated with oseltamivir at 10 mg/kg (either beginning four-hours post-infection or beginning one-hour post-infection) (i.e. oseltamivir treatment beginning four-hours post-infection alone lead to a 20% survival rate at day 14 whereas oseltamivir treatment beginning one-hour post-infection lead to the complete expiration of the mouse population by day 12).
- FIG. 32 shows that oseltamivir (TamifluTM) fails to protect against infection or death at 5 fold the LD 50 (5MLD 50 ), even when the compound is administered within four hours of infection.
- the percent survival of this study population was only 20% on day 14.
- the groups treated with an anti-M2e antibody alone demonstrated an 80% survival rate at day 14.
- balb/c female mice were challenged with influenza A infection, and, specifically, with H1N1 (A/Solomon Islands/06 (H1N1)) at a dosage of 10 fold the LD 50 (10LD 50 , also written 10XLD 50 or 10 ⁇ MLD 50 ).
- H1N1 A/Solomon Islands/06
- mice were treated with an anti-M2e antibody or an isotype negative-control at 20 mg/kg (or 400 ⁇ g/treatment). Either the M2e or the control antibody was administered on either days one (1) and three (3) or days three (3) and five (5) ( FIG. 33 ).
- the anti-M2e antibody was either TCN-031 (also known as 23K12) or TCN-032 (also known as 8i10).
- challenged mice were treated with an antiviral drug having neuraminidase inhibitor activity, (e.g. oseltamivir, oseltamivir phosphate, or TamifluTM), at a dosage of 10 mg/kg bid (“bis in die”, twice, or two times, a day).
- the antiviral drug having neuraminidase inhibitor activity (e.g. oseltamivir, oseltamivir phosphate, or TamifluTM), was provided according to one of the following schedules: 1) day one (1) bid, day three (3) bid, or days one (1) through five (5) bid.
- mice were “untreated.” These mice were administered phosphate buffered saline (PBS) rather than the M2e antibody, oseltamivir, or the M2e antibody/oseltamivir combination therapy.
- PBS phosphate buffered saline
- mice were left unchallenged and untreated as further controls.
- Treatments including the PBS control, were administered by intraperitoneal injection.
- mice in all experimental and control groups were not euthanized.
- the individual survival and weight parameters were determined. Percent survival and average weights were calculated.
- FIG. 34 shows that at 10 fold the LD 50 (10MLD 50 ), and with antibody therapy administered on days 1 and 3 ( FIG. 33 ), the mice receiving the anti-M2e antibody, TCN-032 demonstrated the most prolonged survival.
- the TCN-032 treatment group out-performed the group who received oseltamivir therapy.
- FIG. 35 shows that at 10 fold the LD 50 (10MLD 50 ), and with antibody therapy administered on days 3 and 5 ( FIG. 33 ), about 10% of mice receiving either the anti-M2e therapy (TCN-032) or oseltamivir therapy both survived until day 21, at which point the study was completed. These conditions both out-performed the PBS placebo, or administration control.
- balb/c female mice were challenged with influenza A infection, and, specifically, with H1N1 (A/NWS/33 (H1N1)) at a dosage of 2 or 4 fold the LD 50 (2LD 50 or 4 LD 50 ).
- H1N1 A/NWS/33 (H1N1)
- mice were treated with an anti-M2e antibody or an isotype negative-control at 20 mg/kg (or 400 ⁇ g/treatment). Either the M2e or the control antibody was administered at either 4 hours or 72 hours (3 days) post-infection ( FIG. 36 ).
- the anti-M2e antibody was either TCN-031 (also known as 23K12) or TCN-032 (also known as 8i10).
- challenged mice were treated with an antiviral drug having neuraminidase inhibitor activity, (e.g. oseltamivir, oseltamivir phosphate, or TamifluTM), at a dosage of 10 mg/kg bid (“bis in die”, twice, or two times, a day).
- an antiviral drug having neuraminidase inhibitor activity e.g. oseltamivir, oseltamivir phosphate, or TamifluTM
- mice were “untreated.” These mice were administered phosphate buffered saline (PBS) rather than the M2e antibody, oseltamivir, or the M2e antibody/oseltamivir combination therapy.
- PBS phosphate buffered saline
- mice were left unchallenged and untreated as further controls.
- Treatments including the PBS control, were administered by intraperitoneal injection.
- mice in all experimental and control groups were not euthanized.
- the individual survival and weight parameters were determined. Percent survival and average weights were calculated.
- FIG. 37 shows that at 4 fold the LD 50 (4MLD 50 ), that the percentage of survival within mouse populations that were treated with the TCN-032 M2e antibody was substantially higher than the percentage survival of either the negative control antibody or the PBS placebo (i.e. treatment with the TCN-032 antibody lead to an 40% survival rate at day 21, treatment with negative-control antibody lead to expiration of the treatment group by day 12, and treatment with the PBS placebo lead to an approximately 25% survival rate at day 21).
- the increased percent survival of the group treated with the TCN-032 anti-M2e antibody compared to the isotype control is statistically significant (p ⁇ 0.021).
- Treatment with oseltamivir or the positive control produced a 100% survival rate or a 60% survival rate, respectively.
- FIG. 38 shows that at 2 fold the LD 50 (2MLD 50 ), that the percentage of survival within mouse populations that were treated with either the TCN-032 or TCN-031 M2e antibody was substantially higher than the percentage survival of either the negative control antibody or the PBS placebo (i.e. treatment with the TCN-032 antibody lead to a 55% survival rate at day 21, treatment with the TCN-031 antibody lead to a 50% survival rate at day 21, treatment with negative-control antibody lead an approximately 20% survival rate at day 21, and treatment with the PBS placebo lead to an approximately 20% survival rate at day 21). Treatment with either oseltamivir or the positive control produced a 90% survival rate.
- balb/c female mice were challenged with influenza A infection, and, specifically, with H1N1 (A/PR/8/34 (H1N1)) at a dosage of 5 fold the LD 50 (5LD 50 ).
- mice were treated with an anti-M2e antibody or an isotype negative-control at 20 mg/kg (or 400 ⁇ g/treatment). Either the M2e or the control antibody was administered at days one (1), three (3), and five (5), post-infection ( FIG. 28 ).
- the anti-M2e antibody was either TCN-031 (also known as 23K12) or TCN-032 (also known as 8i10).
- challenged mice were treated with an antiviral drug having neuraminidase inhibitor activity, (e.g. oseltamivir, oseltamivir phosphate, or TamifluTM), at a dosage of 10 mg/kg, four (4) hours post-infection.
- an antiviral drug having neuraminidase inhibitor activity e.g. oseltamivir, oseltamivir phosphate, or TamifluTM
- mice were “untreated.” These mice were administered phosphate buffered saline (PBS) rather than the M2e antibody, oseltamivir, or the M2e antibody/oseltamivir combination therapy.
- PBS phosphate buffered saline
- mice were left unchallenged and untreated as further controls.
- Treatments including the PBS control, were administered by intraperitoneal injection.
- mice in all experimental and control groups were euthanized when their post-infection weight loss exceeded 20% of their pre-infection weight.
- FIG. 39 shows that at 5 fold the LD 50 (5MLD 50 ), that the percentage of survival within mouse populations that were treated with either the TCN-032 or TCN-031 M2e antibody was substantially higher than the percentage survival of either the negative control antibody or the PBS placebo (i.e. treatment with the TCN-032, TCN-031, or positive-control antibody lead to a 60% survival rate at day 21, treatment with either the negative-control antibody or the PBS placebo lead to extinction of the mouse population by day 7-8). Treatment with oseltamivir produced an 80% survival rate.
- balb/c female mice were challenged with influenza A infection, and, specifically, with H1N1 (A/WI/WSLH34939/09 (H1N1)) at a dosage of 2.5 fold the LD 50 (2.5LD 50 ).
- mice were treated with an anti-M2e antibody or an isotype negative-control at 20 mg/kg (or 400 ⁇ g/treatment). Either the M2e or the control antibody was administered at days one (1), three (3), and five (5), post-infection ( FIG. 28 ).
- the anti-M2e antibody was either TCN-031 (also known as 23K12) or TCN-032 (also known as 8i10).
- challenged mice were treated with an antiviral drug having neuraminidase inhibitor activity, (e.g. oseltamivir, oseltamivir phosphate, or TamifluTM), at a dosage of 10 mg/kg.
- an antiviral drug having neuraminidase inhibitor activity e.g. oseltamivir, oseltamivir phosphate, or TamifluTM
- an antiviral drug having neuraminidase inhibitor activity e.g. oseltamivir, oseltamivir phosphate, or TamifluTM
- mice were “untreated.” These mice were administered phosphate buffered saline (PBS) rather than the M2e antibody, oseltamivir, or the M2e antibody/oseltamivir combination therapy.
- PBS phosphate buffered saline
- mice were left unchallenged and untreated as further controls.
- Treatments including the PBS control, were administered by intraperitoneal injection.
- mice in all experimental and control groups were euthanized when their post-infection weight loss exceeded 20% of their pre-infection weight.
- FIG. 40 shows that at 2.5 fold the LD 50 (2.5MLD 50 ), that the percentage of survival within mouse populations that were treated with either the TCN-032 or TCN-031 M2e antibody was substantially higher than the percentage survival of the positive control antibody, the negative control antibody, or the PBS placebo (i.e. treatment with the TCN-031 or TCN-032 lead to an 80% or 60% survival rate, respectively, at day 21, treatment with the positive-control antibody lead to a 40% survival rate at day 21, treatment with either the negative-control antibody or the PBS placebo lead to a 20% survival rate at day 21).
- 2.5MLD 50 2.5MLD 50
- mice were challenged with influenza A infection, and, specifically, with H5N1 (VN1203/04 (H5N1)) at a dosage of 5 fold the LD 50 (5LD 50 ).
- H5N1 VN1203/04 (H5N1)
- mice were treated with an anti-M2e antibody or an isotype negative-control at either 20 mg/kg or 40 mg/kg.
- the 20 mg/kg dosage groups included 19 mice each whereas the 40 mg/kg dosages groups included 5 mice each.
- Either the M2e or the control antibody was administered at days one (1), three (3), and five (5), post-infection ( FIG. 41 ).
- the anti-M2e antibody was either TCN-031 (also known as 23K12) or TCN-032 (also known as 8i10).
- a positive control antibody, ch14C2 (also known as TCN-040), and a negative, isotype-control antibody, 2N9, were used.
- challenged mice were treated with an antiviral drug having neuraminidase inhibitor activity, (e.g. oseltamivir, oseltamivir phosphate, or TamifluTM), at a dosage of 10 mg/kg, either q.d. (once per day) or bid (twice a day) beginning at day one (1) following infection and continuing for five (5) days ( FIG. 41 ).
- an antiviral drug having neuraminidase inhibitor activity e.g. oseltamivir, oseltamivir phosphate, or TamifluTM
- mice were “untreated.” These mice were administered phosphate buffered saline (PBS) rather than the M2e antibody, oseltamivir, or the M2e antibody/oseltamivir combination therapy.
- PBS phosphate buffered saline
- mice were left unchallenged and untreated as further controls.
- Treatments including the PBS control, were administered by 200 ⁇ l intraperitoneal injection.
- mice from the 20 mg/kg study groups were taken at days three (3) and six (6) post-infection to determine lung, brain, and liver viral load titration.
- mice from the 40 mg/kg study groups were taken at day six (6) post-infection for histopathological examination.
- FIG. 42 shows that at 5 fold the LD 50 (5MLD 50 ), and with respect to the study groups receiving 20 mg/kg dosages of the anti-M2e antibody therapy, the percentage of survival within mouse populations that were treated with either the TCN-032 or TCN-031 M2e antibody was substantially higher than the percentage survival of either the negative control antibody or the PBS placebo (i.e. treatment with the TCN-032 or TCN-031 lead to an 80% or 70% survival rate, respectively, at day 14, treatment with the negative-control antibody lead to a 20% survival rate at day 14, and treatment with the PBS placebo lead to extinction of the mouse population by day 14).
- Oseltamivir treatment that was administered twice per day out-performed the anti-M2e antibody therapy however, oseltamivir treatment that was administered once per day was less effective than the anti-M2e antibody therapy (treatment with the TCN-032 or TCN-031 lead to an 80% or 70% survival rate, respectively, at day 14, treatment with the oseltamivir bid lead to a 90% survival rate at day 14, and treatment with oseltamivir q.d. lead to a 50% survival rate at day 14).
- the increased percent survival demonstrated by mouse populations receiving TCN-032 versus the isotype negative control is statistically significant (p ⁇ 0.012).
- the increased percent survival demonstrated by mouse populations receiving oseltamivir, either q.d. or bid, versus the PBS placebo is statistically significant (q.d. p ⁇ 0.006 and bid p ⁇ 0.0001).
- FIG. 43 shows that at 5 fold the LD 50 (5MLD 50 ), and with respect to the study groups receiving 40 mg/kg dosages of the anti-M2e antibody therapy, that the percentage of survival within mouse populations that were treated with either the TCN-032 or TCN-031 M2e antibody was substantially higher than the percentage survival of either the negative control antibody or the PBS placebo (i.e. treatment with the TCN-032 or TCN-031 lead to a 100% or 80% survival rate, respectively, at day 14, treatment with the negative-control antibody lead to a 40% survival rate at day 14, and treatment with the PBS placebo lead to extinction of the mouse population by day 14).
- the increased percent survival demonstrated by mouse populations receiving TCN-032 versus the isotype negative control is statistically significant (p ⁇ 0.004).
- the increased percent survival demonstrated by mouse populations receiving oseltamivir, either q.d. or bid, versus the PBS placebo is statistically significant (q.d. p ⁇ 0.006 and bid p ⁇ 0.0001).
- Anti-M2e antibodies limit viral spread from the subject's airway to other tissues (Table 7).
- FIG. 44 provided representative photographs of the data provided in Table 7, showing that anti-M2e antibodies, including TCN-031 and TCN-032, limit viral spread from the subject's airway to other tissues.
- FIG. 44A shows that in a viral-challenged mouse who received the TCN-031 therapy, lung lesions with viral antigens are distributed in multiple lung lobes, but the lesions tend to be restricted to one part of each lung lobe.
- FIG. 44B shows in a viral-challenged mouse who received the TCN-031 therapy, no inflammatory lesions or viral antigens were detected.
- FIG. 44C shows that in a viral-challenged mouse who received the TCN-031 therapy, no inflammatory lesions or viral antigens were detected.
- FIG. 44A shows that in a viral-challenged mouse who received the TCN-031 therapy, lung lesions with viral antigens are distributed in multiple lung lobes, but the lesions tend to be restricted to one part of each lung
- FIG. 44D shows that in a viral-challenged mouse who received the PBS placebo, lung lesions with viral antigens in a part of the lung lobe.
- FIG. 44E shows that in a viral-challenged mouse who received the PBS placebo, a small necrotic lesion with viral antigens is present.
- FIG. 44F shows that in a viral-challenged mouse who received the PBS placebo, extensive staining of viral antigens can be found in the neuron and glial cells.
- FIG. 45 provides a quantification of the analysis provided in Table 7 and FIG. 44 .
- the data show that treatment with either anti-M2e antibody (TCN-031 or TCN-032), limits the spread of the influenza virus from the airway to unrelated tissues. Specifically, in the anti-M2e treatment conditions, the influenza viral titre is decreased in the liver and brain at both 3 and 6 days compared to the lung.
- mice Groups of ten (10) mice were challenged with influenza A infection, and, specifically, with H5N1 (VN1203/04 (H5N1)) at a dosage of 5 fold the LD 50 (5LD 50 ).
- H5N1 VN1203/04 (H5N1)
- mice were treated with an anti-M2e antibody or an isotype negative-control at 40 mg/kg (800 ⁇ g).
- Either the M2e or the control antibody was administered according to one of the following schedules: 1) at days one (1), three (3), and five (5) post-infection, 2) at days two (2), four (4) and six (6) post-infection, 3) at days three (3), five (5), and seven (7) post-infection, or 4) at days four (4), six (6) and eight (8) post-infection ( FIG. 46 ).
- the anti-M2e antibody was either TCN-031 (also known as 23K12) or TCN-032 (also known as 8i10).
- a positive control antibody, ch14C2 also known as TCN-040
- a negative, isotype-control antibody, 2N9 were used.
- mice were “untreated.” These mice were administered phosphate buffered saline (PBS) rather than the M2e antibody, oseltamivir, or the M2e antibody/oseltamivir combination therapy.
- PBS phosphate buffered saline
- mice were left unchallenged and untreated as further controls.
- Treatments including the PBS control, were administered by 200 ⁇ l intraperitoneal injection.
- FIG. 47 shows that at 5 fold the LD 50 (5MLD 50 ), and when the anti-M2e therapy is provided at days 1, 3, and 5 following infection, the percentage of survival within mouse populations that were treated with either the TCN-032 or TCN-031 M2e antibody was substantially higher than the percentage survival of the groups treated with the positive control antibody, the negative control antibody, or the PBS placebo (i.e. treatment with the TCN-031 or TCN-032 lead to a 50% or 40% survival rate, respectively, at day 14, treatment with the positive-control antibody lead to extinction of the mouse population by day 12, treatment with the negative-control antibody lead to extinction of the mouse population by day 9, and treatment with the PBS placebo lead to extinction of the mouse population by day 8).
- mice receiving either TCN-031 or TCN-032 versus the isotype negative control were statistically significant (TCN-031, p ⁇ 0.0008 and TCN-032, p ⁇ 0.004).
- the increased percent survival demonstrated by mouse populations receiving either TCN-031 or TCN-032 versus the untreated but challenged control was also statistically significant (TCN-031, p ⁇ 0.0007 and TCN-032, p ⁇ 0.003).
- FIG. 48 shows that at 5 fold the LD 50 (5MLD 50 ), and when the anti-M2e therapy is provided at days 2, 4, and 6 following infection, the same general trends are true, however, the two M2e therapies are equally effective (i.e. treatment with either the TCN-031 or TCN-032 lead to a 50% survival rate at day 14).
- the increased percent survival demonstrated by mouse populations receiving either TCN-031 or TCN-032 versus the isotype negative control was statistically significant (TCN-031, p ⁇ 0.001 and TCN-032, p ⁇ 0.009).
- TCN-031, p ⁇ 0.0005 and TCN-032, p ⁇ 0.003 was also statistically significant.
- FIG. 49 shows that at 5 fold the LD 50 (5MLD 50 ), and when the anti-M2e therapy is provided at days 3, 5, and 7 following infection, the percentage of survival within mouse populations that were treated with the TCN-031 M2e antibody was substantially higher than the percentage survival of the groups treated with the positive control antibody, the negative control antibody, or the PBS placebo (i.e. treatment with TCN-031 lead to a 50% survival rate at day 14, treatment with the positive-control antibody lead to a 20% survival rate at day 14, treatment with the negative-control antibody lead to a 10% survival rate at day 14, treatment with the PBS placebo lead to a 10% survival rate at day 14, and the untreated but challenged mouse population was driven to extinction by day 9).
- the TCN-031 antibody therapy was more effective than the TCN-032 antibody therapy.
- the TCN-032 antibody therapy performed equally well as the positive-control antibody.
- the increased percent survival demonstrated by mouse populations receiving the TCN-031 antibody versus the isotype negative control was statistically significant (p ⁇ 0.039).
- the increased percent survival demonstrated by mouse populations receiving either TCN-031 or TCN-032 antibody therapy versus the untreated but challenged control was also statistically significant (TCN-031, p ⁇ 0.0002 and TCN-032, p ⁇ 0.023).
- FIG. 50 shows that at 5 fold the LD 50 (5MLD 50 ), and when the anti-M2e therapy is provided at days 4, 6, and 8 following infection, the same general trends are true, however, the two M2e therapies are equally effective (i.e. treatment with either the TCN-031 or TCN-032 lead to a 60% survival rate at day 14).
- the increased percent survival demonstrated by mouse populations receiving the TCN-031 antibody versus the isotype negative control was statistically significant (p ⁇ 0.046).
- the increased percent survival demonstrated by mouse populations receiving either the TCN-031 or TCN-032 antibody versus the untreated but challenged control was also statistically significant (TCN-031, p ⁇ 0.0009 and TCN-032, p ⁇ 0.002).
- FIG. 51 shows that at 5 fold the LD 50 (5MLD 50 ), and when the anti-M2e therapy is provided at days 1, 3, and 5 following infection, the percentage of weight remaining within mouse populations that were treated with either the TCN-031 or TCN-032 M2e antibody was either similar to (in the case of TCN-032) or substantially higher (in the case of TCN-031) than the percentage of weight remaining within mouse populations that were treated with the positive control antibody.
- the TCN-031 antibody therapy was more effective than the TCN-032 antibody therapy.
- the TCN-032 antibody therapy performed equally well as or better than the positive-control antibody, as evidenced by the similar trend in the data but the extension of the data in the TCN-032-treated group to the completion of the study.
- FIG. 52 shows that at 5 fold the LD 50 (5MLD 50 ), and when the anti-M2e therapy is provided at days 2, 4, and 6 following infection, the percentage of weight remaining within mouse populations that were treated with either the TCN-031 or TCN-032 M2e antibody was similarly higher than the percentage of weight remaining within mouse populations that were treated with the positive control antibody.
- the performance of the two M2e antibodies is highly similar until the last data point, when the weight of the animals in the TCN-031-treated group appears to recover sharply.
- FIG. 53 shows that at 5 fold the LD 50 (5MLD 50 ), and when the anti-M2e therapy is provided at days 3, 5, and 7 following infection, the percentage of weight remaining within mouse populations that were treated with either the TCN-031 or TCN-032 M2e antibody was higher than the percentage of weight remaining within mouse populations that were treated with the positive control antibody. Also, using this regimen, the recovery of weight loss in the TCN-032-treated mice appears to be stronger than the recovery of weight loss in the TCN-031-treated mice. However, at all points, the weight loss of the TCN-031 anti-M2e antibody treated groups is less severe than the positive-control antibody. In fact, at day 14, the weight of the mice in the TCN-032 treated group is equivalent to the mice in the untreated and unchallenged group.
- FIG. 54 shows that at 5 fold the LD 50 (5MLD 50 ), and when the anti-M2e therapy is provided at days 4, 6, and 8 following infection, the percentage of weight remaining within mouse populations that were treated with either the TCN-031 or TCN-032 M2e antibody was surpassed by the percentage of weight remaining within mouse populations that were treated with the positive control antibody.
- the values of percent weight remaining for the two anti-M2e antibody therapies were similar throughout the experiment.
- balb/c female mice were challenged with influenza A infection, and, specifically, with H5N1 (A/Vietnam/1203/04 (VN1203)) at a dosage of 5 ⁇ , 10 ⁇ , or 20 ⁇ MLD 50 .
- mice Challenged mice were treated with an anti-M2e antibody (TCN-032, also known as 8i10) or an isotype negative-control (TCN-202) at 20 mg/kg (400 ⁇ g). Either the M2e or the control antibody was administered at days one (1), three (3), and five (5) post-infection ( FIG. 55 ). Antibody treatments were administered by intraperitoneal injection.
- TCN-032, also known as 8i10 an anti-M2e antibody
- TCN-202 isotype negative-control
- challenged mice were treated with an antiviral drug having neuraminidase inhibitor activity, (e.g. oseltamivir, oseltamivir phosphate, or TamifluTM), at a dosage of 10 mg/kg, bid (twice a day) beginning at day one (1) following infection and continuing for five (5) days ( FIG. 55 ).
- an antiviral drug having neuraminidase inhibitor activity e.g. oseltamivir, oseltamivir phosphate, or TamifluTM
- Oseltamivir was administered orally.
- mice were “untreated.” These mice were administered phosphate buffered saline (PBS) rather than the M2e antibody, oseltamivir, or the M2e antibody/oseltamivir combination therapy.
- PBS phosphate buffered saline
- mice were left unchallenged and untreated as further controls.
- mice were euthanized when their post-infection weight loss exceeded 30% of their pre-infection weight.
- FIG. 56 shows that at 5 fold the LD 50 (5 ⁇ MLD 50 ), the percentage of survival within mouse populations that were treated with either the oseltamivir monotherapy or the combined therapy of TCN-032 and oseltamivir completely protected mice throughout the study by preventing influenza-infection mediated death.
- Administration of the TCN-032 M2e antibody alone provided substantial protection above the control conditions i.e. treatment with the TCN-032 anti-M2e antibody monotherapy lead to a 60% survival rate at day 15, treatment with the isotype-control antibody lead to a 10% survival rate at day 15, and treatment with PBS (the untreated condition or administration control) lead to less than a 10% survival rate at day 15).
- mice populations receiving the TCN-032 anti-M2e antibody monotherapy versus the isotype negative control were statistically significant (p ⁇ 0.027).
- mouse populations receiving the combined therapy of TCN-032 and oseltamivir versus the combined therapy of the isotype negative control and oseltamivir was also statistically significant (p ⁇ 0.012).
- the increased survival demonstrated by populations receiving the TCN-032 antibody, the combined therapy (TCN-032 and oseltamivir), and the oseltamivir monotherapy were statistically significant (TCN-032 p ⁇ 0.031, TCN-032 and oseltamivir p ⁇ 0.0001, and oseltamivir p ⁇ 0.0001).
- FIG. 57 shows that at 5 fold the LD 50 (5 ⁇ MLD 50 ), the percentage of weight remaining within mouse populations that were treated with either the oseltamivir monotherapy or the combined therapy of TCN-032 and oseltamivir completely protected mice throughout the study by preventing influenza-infection mediated weight loss or death.
- FIG. 58 shows that at 10 fold the LD 50 (10 ⁇ MLD 50 ), the percentage of survival within mouse populations that were treated with the combined therapy of TCN-032 and oseltamivir completely protected mice throughout the study by preventing influenza-infection mediated death.
- treatment with the TCN-032 anti-M2e antibody monotherapy lead to a 70% survival rate at day 15, treatment with oseltamivir monotherapy lead to a 60% survival rate at day 15, treatment with the isotype-control antibody lead to extinction of the mouse population by day 12, and treatment with PBS (the untreated condition or administration control) lead a 20% survival rate at day 15).
- the increased percent survival demonstrated by mouse populations receiving the TCN-032 anti-M2e antibody monotherapy versus the isotype negative control was statistically significant (p ⁇ 0.001).
- the increased percent survival demonstrated by mouse populations receiving the combined therapy of TCN-032 and oseltamivir versus the oseltamivir monotherapy was also statistically significant (p ⁇ 0.029).
- FIG. 59 shows that at 10 fold the LD 50 (10 ⁇ MLD 50 ), the percentage of weight remaining within mouse populations that were treated with the combined therapy of TCN-032 and oseltamivir completely protected mice throughout the study by preventing influenza-infection mediated weight loss or death.
- FIG. 60 shows that at 20 fold the LD 50 (20 ⁇ MLD 50 ), the percentage of survival within mouse populations that were treated with the combined therapy of TCN-032 and oseltamivir completely protected mice throughout the study by preventing influenza-infection mediated death.
- TCN-032 and oseltamivir act in a synergistic manner to completely protect a subject from a lethal influenza challenge.
- the increased percent survival demonstrated by mouse populations receiving the TCN-032 anti-M2e antibody monotherapy versus the isotype negative control was statistically significant (p ⁇ 0.002).
- the increased percent survival demonstrated by mouse populations receiving the combined therapy of TCN-032 and oseltamivir versus and the combined therapy including the isotype-control antibody and oseltamivir was statistically significant (p ⁇ 0.012).
- the increased percent survival demonstrated by mouse populations receiving the combined therapy of TCN-032 and oseltamivir versus and the oseltamivir monotherapy was also statistically significant (p ⁇ 0.029).
- FIG. 61 shows that at 20 fold the LD 50 (20 ⁇ MLD 50 ), the percentage of weight remaining within mouse populations that were treated with the combined therapy of TCN-032 and oseltamivir completely protected mice throughout the study by preventing influenza-infection mediated weight loss or death.
- balb/c female mice were challenged with influenza A infection, and, specifically, with H5N1 (A/Vietnam/1203/04 (VN1203)) at a dosage of 20 ⁇ MLD 50 .
- mice were treated with an anti-M2e antibody (TCN-032, also known as 8i10) or an isotype negative-control (TCN-202) at 20 mg/kg.
- Either the M2e or the control antibody was administered according to one of the following schedules: 1) administered at days one (1), three (3), and five (5) post-infection, 2) administered at days three (3), five (5), and seven (7) post-infection, 3) administered at days four (4), six (6) and eight (8) post-infection, or 4) administered at days five (5), seven (7) and nine (9) post-infection, ( FIG. 62 ).
- Antibody treatments were administered by intraperitoneal injection.
- challenged mice were treated with an antiviral drug having neuraminidase inhibitor activity, (e.g. oseltamivir, oseltamivir phosphate, or TamifluTM), at a dosage of 10 mg/kg, bid (twice a day) beginning at day one (1), three (3), four (4), or five (5) post-infection and continuing for five (5) days ( FIG. 62 ).
- an antiviral drug having neuraminidase inhibitor activity e.g. oseltamivir, oseltamivir phosphate, or TamifluTM
- bid twice a day beginning at day one (1), three (3), four (4), or five (5) post-infection and continuing for five (5) days ( FIG. 62 ).
- Oseltamivir was administered orally.
- mice were “untreated.” These mice were administered phosphate buffered saline (PBS) rather than the M2e antibody, oseltamivir, or the M2e antibody/oseltamivir combination therapy.
- PBS phosphate buffered saline
- mice were left unchallenged and untreated as further controls.
- FIG. 63 shows that at 20 fold the LD 50 (20 ⁇ MLD 50 ), and with respect to the first study, the percentage of survival within mouse populations that were treated with the combined therapy of TCN-032 and oseltamivir completely protected mice throughout the study by preventing influenza-infection mediated death.
- TCN-032 and oseltamivir act in a synergistic manner to completely protect a subject from a lethal influenza challenge.
- Administration of the TCN-032 M2e antibody alone provided some protection above the control conditions (i.e.
- TCN-032 anti-M2e antibody monotherapy lead to a 10% survival rate at day 14
- treatment with oseltamivir monotherapy lead to extinction of the mouse population by day 11
- treatment with PBS (Administration control) lead to extinction of the mouse population by day 11).
- Study one was performed in June 2010. The goal of this study was to determine if the combination of an anti-M2e antibody and oseltamivir produced synergistic results. Moreover, it was determined how significant of a viral challenge the combination therapy could protect against. Study two was performed in October 2010. At this time, only a viral challenge at the 20 ⁇ LD50 level was used, however, the day to first treatment initiation was varied between Day 1, 3, 4 or 5. This had the effect of “bridging” from Study 1 to Study 2, because the Day 1 treatment group of Study 2 is essentially an exact repeat of the 20 ⁇ LD50 challenge group in Study 1.
- the viral challenge administered in Study 2 though it was designed to be identical to that administered in the 20 ⁇ LD 50 group of Study 1, was more lethal. This result happened because so few viral particles were needed. 1 ⁇ LD50 is equivalent to approximately 2 viral particles. Thus, even a little variation in the preparation of the viral challenge stock can cascade into a big difference in lethality.
- FIG. 64 shows that at 20 fold the LD 50 (20 ⁇ MLD 50 ), and when the antibody therapies are administered at days 1, 3, and 5, post-infection, the percentage of survival within mouse populations that were treated with the combined therapy of TCN-032 and oseltamivir completely protected mice throughout the study by preventing influenza-infection mediated death in 90% of mice. This survival rate closely approximates the 100% percent survival rate of the unchallenged and untreated control mouse population.
- Administration of the TCN-032 M2e antibody alone provided some protection above the control conditions (i.e.
- TCN-032 anti-M2e antibody monotherapy lead to a 10% survival rate at day 14
- treatment with oseltamivir monotherapy lead to extinction of the mouse population by day 11
- treatment with PBS (Administration control) lead to extinction of the mouse population by day 11).
- FIG. 64 shows that at 20 fold the LD 50 (20 ⁇ MLD 50 ), and when the antibody therapies are administered at days 3, 5, and 7, post-infection, the percentage of survival within mouse populations that were treated with the combined therapy of TCN-032 and oseltamivir partially protected mice throughout the study by preventing influenza-infection mediated death in 50% of mice.
- Administration of the TCN-032 M2e antibody alone provided similar protection above the control conditions i.e. treatment with the TCN-032 anti-M2e antibody monotherapy lead to a 40% survival rate at day 14
- treatment with oseltamivir monotherapy lead to extinction of the mouse population by day 9
- treatment with PBS administering control
- FIG. 64 shows that at 20 fold the LD 50 (20 ⁇ MLD 50 ), and when the antibody therapies are administered at days 4, 6, and 8, post-infection, the percentage of survival within mouse populations that were treated with either the combined therapy of TCN-032 and oseltamivir or the TCN-032 antibody monotherapy partially protected mice throughout the study by preventing influenza-infection mediated death in approximately 70% of mice.
- Administration of the oseltamivir monotherapy alone provided less protection than the control condition (i.e. treatment with oseltamivir monotherapy lead to extinction of the mouse population by day 9 whereas treatment with PBS (Administration control) lead to extinction of the mouse population by day 11).
- FIG. 64 shows that at 20 fold the LD 50 (20 ⁇ MLD 50 ), and when the antibody therapies are administered at days 5, 7, and 9, post-infection, the percentage of survival within mouse populations that were treated with the combined therapy of TCN-032 and oseltamivir protected mice throughout the study by preventing influenza-infection mediated death in approximately 40% of mice.
- treatment with the TCN-032 anti-M2e antibody monotherapy lead to a 40% survival rate at day 14
- treatment with the TCN-031 anti-M2e antibody monotherapy lead to a 10% survival rate at day 14
- treatment with oseltamivir monotherapy lead to extinction of the mouse population by day 9
- treatment with PBS administering control
- FIG. 65 shows that at 20 fold the LD 50 (20 ⁇ MLD 50 ), and when the antibody therapies are administered at days 1, 3, and 5, post-infection, the percentage of weight remaining within mouse populations that were treated with the combined therapy of TCN-032 and oseltamivir substantially protected mice throughout the study by preventing significant influenza-infection mediated weight loss or death.
- the percentage weight remaining at every time-point for the mice treated with the combined therapy of TCN-032 and oseltamivir is highly similar to the unchallenged and untreated mice, which approximate a healthy subject.
- FIG. 65 shows that at 20 fold the LD 50 (20 ⁇ MLD 50 ), and when the antibody therapies are administered at either days 3, 5, and 7, or days 4, 6, and 8, post-infection, the percentage of weight remaining within mouse populations that were treated with the combined therapy of TCN-032 and oseltamivir was substantially higher throughout the study than the percentage of weight remaining in the untreated control group (PBS administration controls). Thus, the combined therapy of TCN-032 and oseltamivir prevented significant influenza-infection mediated weight loss or death.
- FIG. 65 shows that at 20 fold the LD 50 (20 ⁇ MLD 50 ), and when the antibody therapies are administered at days 5, 7, and 9, post-infection, the percentage of weight remaining within mouse populations that were treated with the combined therapy of TCN-032 and oseltamivir was similar to the percentage of weight remaining in the untreated control group (PBS administration controls) until about day 10, when the combination therapy substantially restored the weight of the mouse population and decreased the loss by approximately half. Interestingly, the TCN-032 antibody monotherapy group recovered its weight loss by the end of the study.
- balb/c female mice were challenged with influenza A infection, and, specifically, with H5N1 (A/Vietnam/1203/04 (VN1203)) at a dosage of 1 ⁇ LD 90 .
- mice Challenged mice were treated with an anti-M2e antibody (TCN-032, also known as 8i10, or TCN-031, also known as 23k12), a positive control antibody (ch14C2), or an isotype negative-control (2N9) at 10 mg/kg, bid (twice a day) (200 ⁇ g/treatment). Either the anti-M2e or the control antibody was administered at days minus-one ( ⁇ 1, i.e. one day before infection), and two (2) post-infection, ( FIG. 66 ). Antibody treatments were administered by intraperitoneal injection.
- TCN-032 also known as 8i10, or TCN-031, also known as 23k12
- ch14C2 positive control antibody
- 2N9 isotype negative-control
- a control group of challenged mice were left unchallenged and untreated.
- FIG. 67 shows that at 1 ⁇ IC 90 , the human anti-M2e monoclonal antibodies, i.e. TCN-031 (23K12) and TCN-032 (8I10), are protective in a rodent lethal challenge model of H5N1 infection.
- the increased survival demonstrated by populations receiving the TCN-031 antibody, the TCN-032 antibody), and the positive-control antibody were statistically significant (TCN-031 p ⁇ 0.004, TCN-032 p ⁇ 0.0035, and positive-control p ⁇ 0.029).
- Table 8 provides a summary of the in vivo lethal challenge experiments described herein. As the table and the data reveal, anti-M2e antibodies of the invention are protective against influenza infection.
- ADCC Anti-M2e Antibody-Dependent Cell-Mediated Cytotoxicity
- MDCK cells were infected with influenza A virus (A/Soloman Islands/3/2006). These cells were then pre-incubated with either an anti-M2e monoclonal antibody (e.g. TCN-031 or TCN-032) or an isotype-matched negative control (anti-CMV antibody). The infected and pre-incubated MDCK cells were then contacted to human natural killer (NK) cells isolated from a single human donor. Cytolysis was quantified by measuring released lactate dehydrogenase (LDH). Two independent experiments were performed.
- an anti-M2e monoclonal antibody e.g. TCN-031 or TCN-032
- anti-CMV antibody isotype-matched negative control
- FIG. 68 shows that approximately the same amount of LDH was released following induction of ADCC by pre-incubation with the anti-M2e antibodies and contacting of the MDCK cells with human NK cells (left-hand graphs).
- the anti-M2e antibodies mediated more effective ADCC than the negative-control antibody, as evidenced by the decreased LDH release following treatment with the negative-control antibody.
- the ADCC mediated lysis induced by the anti-M2e antibodies was also specific for the infected cells, as evidenced by the favorable effector-to-target ratios in the graphs on the right of the figure.
- FIG. 69 confirms the results shown in FIG. 68 .
- anti-M2e monoclonal antibodies of the invention mediate or induce ADCC.
- Anti-M2e monoclonal antibody e.g. TCN-031 or TCN-032
- affinities were determined using FAb fragments of the monoclonal antibodies on whole PR8 virus. The results are provided in Table 9.
- TMA tissue microarray
- FIGS. 70 and 71 demonstrate that the anti-M2e antibodies of the invention (e.g. TCN-031 and TCN-032) do not cross-react with non-infected tissue. In fact, no significant cross-reactivity was observed with a panel of 30 human tissues from three normal human donors.
- the anti-M2e antibodies of the invention e.g. TCN-031 and TCN-032
- Flow cytometric analysis of temperature-stressed anti-M2e antibody supported development of CDC assay as secondary potency assay.
- a 96-well CDC assay was developed via detection of cell viability with CellTiter-Glo luminescence kit ( FIG. 72 ).
- Cell viability was determined using a low-passage M2-expressing CHO cell line (DG44.VNM2).
- FIG. 73 shows that the anti-M2e antibody TCN-032 (also known as 8i10) is more potent than the negative-control, anti-CMV, antibody (TCN-202, also known as 2N9).
- TCN-032 specifically lysed a greater percentage of M2-expressing CHO cells (DG44.VNM2) than the negative-control antibody in the presence of a greater percentage of human complement. Maximal cell lysis was obtained between 5-10% complement (volume to volume, v/v).
- the 96-well CDC assay was converted to a homogeneous format to enhance assay performance and streamline workflow ( FIG. 74 ).
- FIG. 75 confirms and clarifies the results of FIG. 73 .
- the anti-M2e antibody TCN-032 also known as 8i10 is more potent than either the negative-control, anti-CMV, antibody (TCN-202, also known as 2N9) or the no monoclonal antibody control.
- TCN-032 specifically lysed a greater percentage of M2-expressing CHO cells (DG44.VNM2) than either the negative-control antibody or the no-antibody control in the presence of a greater percentage of human complement. Maximal target cell lysis with minimal negligible background lysis was obtained with approximately 6.25% complement (volume to volume, v/v).
- FIG. 76 shows that the anti-M2e antibody TCN-032 demonstrated diminished CDC activity when it is stressed at greater than 60° C. (>60° C.).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Virology (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Organic Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Mycology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Communicable Diseases (AREA)
- Pulmonology (AREA)
- Genetics & Genomics (AREA)
- Microbiology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Emergency Medicine (AREA)
- Oncology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US13/418,923 US20120315277A1 (en) | 2011-03-15 | 2012-03-13 | Compositions and Methods for the Therapy and Diagnosis of Influenza |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201161453101P | 2011-03-15 | 2011-03-15 | |
| US13/418,923 US20120315277A1 (en) | 2011-03-15 | 2012-03-13 | Compositions and Methods for the Therapy and Diagnosis of Influenza |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20120315277A1 true US20120315277A1 (en) | 2012-12-13 |
Family
ID=45852774
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/418,923 Abandoned US20120315277A1 (en) | 2011-03-15 | 2012-03-13 | Compositions and Methods for the Therapy and Diagnosis of Influenza |
Country Status (13)
| Country | Link |
|---|---|
| US (1) | US20120315277A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP2685968A1 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2014509591A (cg-RX-API-DMAC7.html) |
| KR (1) | KR20140012131A (cg-RX-API-DMAC7.html) |
| CN (1) | CN103533929A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2012229188A1 (cg-RX-API-DMAC7.html) |
| BR (1) | BR112013023576A2 (cg-RX-API-DMAC7.html) |
| CA (1) | CA2829968A1 (cg-RX-API-DMAC7.html) |
| IL (1) | IL228403A0 (cg-RX-API-DMAC7.html) |
| MX (1) | MX2013010367A (cg-RX-API-DMAC7.html) |
| SG (1) | SG193402A1 (cg-RX-API-DMAC7.html) |
| TW (1) | TW201300410A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2012125614A1 (cg-RX-API-DMAC7.html) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20130158238A1 (en) * | 2007-11-12 | 2013-06-20 | Theraclone Sciences, Inc. | Compositions and Methods for the Therapy and Diagnosis of Influenza |
| US20140363441A1 (en) * | 2013-04-22 | 2014-12-11 | Theraclone Sciences, Inc. | Compositions and methods for the therapy and diagnosis of influenza |
| US11773176B2 (en) | 2020-01-24 | 2023-10-03 | Aprilbio Co., Ltd. | Multispecific antibodies, compositions comprising the same, and vectors and uses thereof |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2970446A1 (en) | 2013-03-15 | 2016-01-20 | Amgen Research (Munich) GmbH | Antibody constructs for influenza m2 and cd3 |
| US20230265168A1 (en) * | 2020-07-09 | 2023-08-24 | Beijing Kawin Technology Share-Holding Co., Ltd. | Antibody binding to hepatitis b virus surface antigen and application of antibody |
Citations (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1996007321A1 (en) * | 1994-09-06 | 1996-03-14 | The Uab Research Foundation | Methods for modulating protein function in cells using intracellular antibody homologues |
| US5530102A (en) * | 1993-01-12 | 1996-06-25 | Gristina; Anthony G. | Methods and compositions for the direct concentrated delivery of passive immunity |
| US5763483A (en) * | 1995-12-29 | 1998-06-09 | Gilead Sciences, Inc. | Carbocyclic compounds |
| US20040053999A1 (en) * | 1997-09-17 | 2004-03-18 | Bischofberger Norbert W. | Novel compounds and methods for synthesis and therapy |
| WO2006061723A2 (en) * | 2004-12-06 | 2006-06-15 | Kirin Beer Kabushiki Kaisha | Human monoclonal antibodies to influenza m2 protein and methods of making and using same |
| WO2008033105A1 (en) * | 2006-09-13 | 2008-03-20 | Dso National Laboratories | Hemagglutinin antibody and uses thereof |
| US20090226433A1 (en) * | 2007-11-12 | 2009-09-10 | Spaltudaq Corp. | Compositions and methods for the therapy and diagnosis of influenza |
| US20110033476A1 (en) * | 2007-11-12 | 2011-02-10 | Theraclone Sciences Inc. | Compositions and methods for the therapy and diagnosis of influenza |
| US20110070235A1 (en) * | 2009-08-14 | 2011-03-24 | Grandea Iii Andres G | Compositions and methods for the therapy and diagnosis of influenza |
| US20120121603A1 (en) * | 2009-05-20 | 2012-05-17 | Theraclone Sciences, Inc. | Compositions And Methods For The Therapy And Diagnosis Of Influenza |
| US20120207760A1 (en) * | 2011-02-14 | 2012-08-16 | Theraclone Sciences, Inc. | Compositions and Methods for the Therapy and Diagnosis of Influenza |
Family Cites Families (82)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
| US3896111A (en) | 1973-02-20 | 1975-07-22 | Research Corp | Ansa macrolides |
| US4151042A (en) | 1977-03-31 | 1979-04-24 | Takeda Chemical Industries, Ltd. | Method for producing maytansinol and its derivatives |
| US4137230A (en) | 1977-11-14 | 1979-01-30 | Takeda Chemical Industries, Ltd. | Method for the production of maytansinoids |
| FR2413974A1 (fr) | 1978-01-06 | 1979-08-03 | David Bernard | Sechoir pour feuilles imprimees par serigraphie |
| US4265814A (en) | 1978-03-24 | 1981-05-05 | Takeda Chemical Industries | Matansinol 3-n-hexadecanoate |
| US4307016A (en) | 1978-03-24 | 1981-12-22 | Takeda Chemical Industries, Ltd. | Demethyl maytansinoids |
| JPS5562090A (en) | 1978-10-27 | 1980-05-10 | Takeda Chem Ind Ltd | Novel maytansinoid compound and its preparation |
| JPS5566585A (en) | 1978-11-14 | 1980-05-20 | Takeda Chem Ind Ltd | Novel maytansinoid compound and its preparation |
| JPS55164687A (en) | 1979-06-11 | 1980-12-22 | Takeda Chem Ind Ltd | Novel maytansinoid compound and its preparation |
| US4256746A (en) | 1978-11-14 | 1981-03-17 | Takeda Chemical Industries | Dechloromaytansinoids, their pharmaceutical compositions and method of use |
| JPS55102583A (en) | 1979-01-31 | 1980-08-05 | Takeda Chem Ind Ltd | 20-acyloxy-20-demethylmaytansinoid compound |
| JPS55162791A (en) | 1979-06-05 | 1980-12-18 | Takeda Chem Ind Ltd | Antibiotic c-15003pnd and its preparation |
| JPS55164685A (en) | 1979-06-08 | 1980-12-22 | Takeda Chem Ind Ltd | Novel maytansinoid compound and its preparation |
| JPS55164686A (en) | 1979-06-11 | 1980-12-22 | Takeda Chem Ind Ltd | Novel maytansinoid compound and its preparation |
| US4309428A (en) | 1979-07-30 | 1982-01-05 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| JPS5645483A (en) | 1979-09-19 | 1981-04-25 | Takeda Chem Ind Ltd | C-15003phm and its preparation |
| JPS5645485A (en) | 1979-09-21 | 1981-04-25 | Takeda Chem Ind Ltd | Production of c-15003pnd |
| EP0028683A1 (en) | 1979-09-21 | 1981-05-20 | Takeda Chemical Industries, Ltd. | Antibiotic C-15003 PHO and production thereof |
| WO1981001145A1 (en) | 1979-10-18 | 1981-04-30 | Univ Illinois | Hydrolytic enzyme-activatible pro-drugs |
| WO1982001188A1 (en) | 1980-10-08 | 1982-04-15 | Takeda Chemical Industries Ltd | 4,5-deoxymaytansinoide compounds and process for preparing same |
| US4450254A (en) | 1980-11-03 | 1984-05-22 | Standard Oil Company | Impact improvement of high nitrile resins |
| US4554101A (en) | 1981-01-09 | 1985-11-19 | New York Blood Center, Inc. | Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity |
| US4315929A (en) | 1981-01-27 | 1982-02-16 | The United States Of America As Represented By The Secretary Of Agriculture | Method of controlling the European corn borer with trewiasine |
| US4313946A (en) | 1981-01-27 | 1982-02-02 | The United States Of America As Represented By The Secretary Of Agriculture | Chemotherapeutically active maytansinoids from Trewia nudiflora |
| JPS57192389A (en) | 1981-05-20 | 1982-11-26 | Takeda Chem Ind Ltd | Novel maytansinoid |
| US4485045A (en) | 1981-07-06 | 1984-11-27 | Research Corporation | Synthetic phosphatidyl cholines useful in forming liposomes |
| NZ201705A (en) | 1981-08-31 | 1986-03-14 | Genentech Inc | Recombinant dna method for production of hepatitis b surface antigen in yeast |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| DD266710A3 (de) | 1983-06-06 | 1989-04-12 | Ve Forschungszentrum Biotechnologie | Verfahren zur biotechnischen Herstellung van alkalischer Phosphatase |
| US4544545A (en) | 1983-06-20 | 1985-10-01 | Trustees University Of Massachusetts | Liposomes containing modified cholesterol for organ targeting |
| US4879231A (en) | 1984-10-30 | 1989-11-07 | Phillips Petroleum Company | Transformation of yeasts of the genus pichia |
| US4683202A (en) | 1985-03-28 | 1987-07-28 | Cetus Corporation | Process for amplifying nucleic acid sequences |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| GB8610600D0 (en) | 1986-04-30 | 1986-06-04 | Novo Industri As | Transformation of trichoderma |
| US5567610A (en) | 1986-09-04 | 1996-10-22 | Bioinvent International Ab | Method of producing human monoclonal antibodies and kit therefor |
| IL85035A0 (en) | 1987-01-08 | 1988-06-30 | Int Genetic Eng | Polynucleotide molecule,a chimeric antibody with specificity for human b cell surface antigen,a process for the preparation and methods utilizing the same |
| GB8705477D0 (en) | 1987-03-09 | 1987-04-15 | Carlton Med Prod | Drug delivery systems |
| US4975278A (en) | 1988-02-26 | 1990-12-04 | Bristol-Myers Company | Antibody-enzyme conjugates in combination with prodrugs for the delivery of cytotoxic agents to tumor cells |
| US5770701A (en) | 1987-10-30 | 1998-06-23 | American Cyanamid Company | Process for preparing targeted forms of methyltrithio antitumor agents |
| US5606040A (en) | 1987-10-30 | 1997-02-25 | American Cyanamid Company | Antitumor and antibacterial substituted disulfide derivatives prepared from compounds possessing a methyl-trithio group |
| US5053394A (en) | 1988-09-21 | 1991-10-01 | American Cyanamid Company | Targeted forms of methyltrithio antitumor agents |
| GB8823869D0 (en) | 1988-10-12 | 1988-11-16 | Medical Res Council | Production of antibodies |
| US5175384A (en) | 1988-12-05 | 1992-12-29 | Genpharm International | Transgenic mice depleted in mature t-cells and methods for making transgenic mice |
| FR2646437B1 (fr) | 1989-04-28 | 1991-08-30 | Transgene Sa | Nouvelles sequences d'adn, leur application en tant que sequence codant pour un peptide signal pour la secretion de proteines matures par des levures recombinantes, cassettes d'expression, levures transformees et procede de preparation de proteines correspondant |
| EP0402226A1 (en) | 1989-06-06 | 1990-12-12 | Institut National De La Recherche Agronomique | Transformation vectors for yeast yarrowia |
| DE3920358A1 (de) | 1989-06-22 | 1991-01-17 | Behringwerke Ag | Bispezifische und oligospezifische, mono- und oligovalente antikoerperkonstrukte, ihre herstellung und verwendung |
| AU641673B2 (en) | 1989-06-29 | 1993-09-30 | Medarex, Inc. | Bispecific reagents for aids therapy |
| US5013556A (en) | 1989-10-20 | 1991-05-07 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
| CA2026147C (en) | 1989-10-25 | 2006-02-07 | Ravi J. Chari | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5229275A (en) | 1990-04-26 | 1993-07-20 | Akzo N.V. | In-vitro method for producing antigen-specific human monoclonal antibodies |
| WO1992002551A1 (en) | 1990-08-02 | 1992-02-20 | B.R. Centre Limited | Methods for the production of proteins with a desired function |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| WO1992003918A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5571894A (en) | 1991-02-05 | 1996-11-05 | Ciba-Geigy Corporation | Recombinant antibodies specific for a growth factor receptor |
| CA2102511A1 (en) | 1991-05-14 | 1992-11-15 | Paul J. Higgins | Heteroconjugate antibodies for treatment of hiv infection |
| CA2103059C (en) | 1991-06-14 | 2005-03-22 | Paul J. Carter | Method for making humanized antibodies |
| CA2116774C (en) | 1991-09-19 | 2003-11-11 | Paul J. Carter | Expression in e. coli antibody fragments having at least a cysteine present as a free thiol. use for the production of bifunctional f(ab') 2 antibodies |
| FI941572L (fi) | 1991-10-07 | 1994-05-27 | Oncologix Inc | Anti-erbB-2-monoklonaalisten vasta-aineiden yhdistelmä ja käyttömenetelmä |
| WO1993008829A1 (en) | 1991-11-04 | 1993-05-13 | The Regents Of The University Of California | Compositions that mediate killing of hiv-infected cells |
| DK1136556T3 (da) | 1991-11-25 | 2005-10-03 | Enzon Inc | Fremgangsmåde til fremstilling af multivalente antigen-bindende proteiner |
| DE69333807T2 (de) | 1992-02-06 | 2006-02-02 | Chiron Corp., Emeryville | Marker für krebs und biosynthetisches bindeprotein dafür |
| ZA932522B (en) | 1992-04-10 | 1993-12-20 | Res Dev Foundation | Immunotoxins directed against c-erbB-2(HER/neu) related surface antigens |
| CA2140280A1 (en) | 1992-08-17 | 1994-03-03 | Avi J. Ashkenazi | Bispecific immunoadhesins |
| DE69329503T2 (de) | 1992-11-13 | 2001-05-03 | Idec Pharma Corp | Therapeutische Verwendung von chimerischen und markierten Antikörpern, die gegen ein Differenzierung-Antigen gerichtet sind, dessen Expression auf menschliche B Lymphozyt beschränkt ist, für die Behandlung von B-Zell-Lymphoma |
| US5773001A (en) | 1994-06-03 | 1998-06-30 | American Cyanamid Company | Conjugates of methyltrithio antitumor agents and intermediates for their synthesis |
| US5789199A (en) | 1994-11-03 | 1998-08-04 | Genentech, Inc. | Process for bacterial production of polypeptides |
| US6214388B1 (en) | 1994-11-09 | 2001-04-10 | The Regents Of The University Of California | Immunoliposomes that optimize internalization into target cells |
| CA2207869A1 (en) | 1994-12-02 | 1996-06-06 | Chiron Corporation | Method of promoting an immune response with a bispecific antibody |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US5840523A (en) | 1995-03-01 | 1998-11-24 | Genetech, Inc. | Methods and compositions for secretion of heterologous polypeptides |
| US5641870A (en) | 1995-04-20 | 1997-06-24 | Genentech, Inc. | Low pH hydrophobic interaction chromatography for antibody purification |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5739277A (en) | 1995-04-14 | 1998-04-14 | Genentech Inc. | Altered polypeptides with increased half-life |
| US5714586A (en) | 1995-06-07 | 1998-02-03 | American Cyanamid Company | Methods for the preparation of monomeric calicheamicin derivative/carrier conjugates |
| US5837234A (en) | 1995-06-07 | 1998-11-17 | Cytotherapeutics, Inc. | Bioartificial organ containing cells encapsulated in a permselective polyether suflfone membrane |
| US5712374A (en) | 1995-06-07 | 1998-01-27 | American Cyanamid Company | Method for the preparation of substantiallly monomeric calicheamicin derivative/carrier conjugates |
| DE19544393A1 (de) | 1995-11-15 | 1997-05-22 | Hoechst Schering Agrevo Gmbh | Synergistische herbizide Mischungen |
| US5922845A (en) | 1996-07-11 | 1999-07-13 | Medarex, Inc. | Therapeutic multispecific compounds comprised of anti-Fcα receptor antibodies |
| US6824780B1 (en) | 1999-10-29 | 2004-11-30 | Genentech, Inc. | Anti-tumor antibody compositions and methods of use |
| BRPI0406662A (pt) | 2003-01-09 | 2005-12-20 | Macrogenics Inc | Vetor, célula, método de identificar um mab, e, composição |
-
2012
- 2012-03-13 BR BR112013023576A patent/BR112013023576A2/pt not_active IP Right Cessation
- 2012-03-13 EP EP12709488.6A patent/EP2685968A1/en not_active Withdrawn
- 2012-03-13 WO PCT/US2012/028883 patent/WO2012125614A1/en not_active Ceased
- 2012-03-13 JP JP2013558105A patent/JP2014509591A/ja active Pending
- 2012-03-13 KR KR1020137026811A patent/KR20140012131A/ko not_active Withdrawn
- 2012-03-13 CA CA2829968A patent/CA2829968A1/en not_active Abandoned
- 2012-03-13 US US13/418,923 patent/US20120315277A1/en not_active Abandoned
- 2012-03-13 MX MX2013010367A patent/MX2013010367A/es unknown
- 2012-03-13 CN CN201280023182.3A patent/CN103533929A/zh active Pending
- 2012-03-13 SG SG2013068267A patent/SG193402A1/en unknown
- 2012-03-13 AU AU2012229188A patent/AU2012229188A1/en not_active Abandoned
- 2012-03-14 TW TW101108672A patent/TW201300410A/zh unknown
-
2013
- 2013-09-12 IL IL228403A patent/IL228403A0/en unknown
Patent Citations (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5530102A (en) * | 1993-01-12 | 1996-06-25 | Gristina; Anthony G. | Methods and compositions for the direct concentrated delivery of passive immunity |
| WO1996007321A1 (en) * | 1994-09-06 | 1996-03-14 | The Uab Research Foundation | Methods for modulating protein function in cells using intracellular antibody homologues |
| US5763483A (en) * | 1995-12-29 | 1998-06-09 | Gilead Sciences, Inc. | Carbocyclic compounds |
| US20040053999A1 (en) * | 1997-09-17 | 2004-03-18 | Bischofberger Norbert W. | Novel compounds and methods for synthesis and therapy |
| WO2006061723A2 (en) * | 2004-12-06 | 2006-06-15 | Kirin Beer Kabushiki Kaisha | Human monoclonal antibodies to influenza m2 protein and methods of making and using same |
| WO2008033105A1 (en) * | 2006-09-13 | 2008-03-20 | Dso National Laboratories | Hemagglutinin antibody and uses thereof |
| US20090226433A1 (en) * | 2007-11-12 | 2009-09-10 | Spaltudaq Corp. | Compositions and methods for the therapy and diagnosis of influenza |
| US20110033476A1 (en) * | 2007-11-12 | 2011-02-10 | Theraclone Sciences Inc. | Compositions and methods for the therapy and diagnosis of influenza |
| US8057796B2 (en) * | 2007-11-12 | 2011-11-15 | Theraclone Sciences, Inc. | Compositions and methods for the therapy and diagnosis of influenza |
| US8114402B2 (en) * | 2007-11-12 | 2012-02-14 | Theraclone Sciences, Inc. | Compositions and methods for the therapy and diagnosis of influenza |
| US8460671B2 (en) * | 2007-11-12 | 2013-06-11 | Theraclone Sciences, Inc. | Compositions and methods for the therapy and diagnosis of influenza |
| US20130158238A1 (en) * | 2007-11-12 | 2013-06-20 | Theraclone Sciences, Inc. | Compositions and Methods for the Therapy and Diagnosis of Influenza |
| US20120121603A1 (en) * | 2009-05-20 | 2012-05-17 | Theraclone Sciences, Inc. | Compositions And Methods For The Therapy And Diagnosis Of Influenza |
| US20110070235A1 (en) * | 2009-08-14 | 2011-03-24 | Grandea Iii Andres G | Compositions and methods for the therapy and diagnosis of influenza |
| US20120207760A1 (en) * | 2011-02-14 | 2012-08-16 | Theraclone Sciences, Inc. | Compositions and Methods for the Therapy and Diagnosis of Influenza |
Non-Patent Citations (11)
| Title |
|---|
| CDC "Vaccine Effectiveness- How Well Does the Flu Vaccine Work?" Centers for Disease Control and Prevention Fact Sheet. 01/31/2014. * |
| Fang Y, Banner D, Kelvin AA, Huang SS, Paige CJ, Corfe SA, Kane KP, Bleackley RC, Rowe T, Leon AJ, Kelvin DJ. Seasonal H1N1 influenza virus infection induces cross-protective pandemic H1N1 virus immunity through a CD8-independent, B cell-dependent mechanism. J Virol. 2012 Feb;86(4):2229-38. Epub 2011 Nov 30. * |
| Grandea A. III, Hammond PW, Olsen O, Cox T, Renshaw M, Hammond P, Chan-Hui PY, Mitcham J, Cieplak W, Stewart S, Grantham M, Pekosz A, Kiso M, Shinya K, Hatta M, Kawaoka Y, Moyle M. Monoclonal antibody TCN-032 heavy chain variable region, partial [Homo sapiens]. GenBank Acc. No: ADK23853.1. Dep. 07/18/2010. * |
| Grandea A. III, Hammond PW, Olsen O, Cox T, Renshaw M, Hammond P, Chan-Hui PY, Mitcham J, Cieplak W, Stewart S, Grantham M, Pekosz A, Kiso M, Shinya K, Hatta M, Kawaoka Y, Moyle M. Monoclonal antibody TCN-032 light chain variable region, partial [Homo sapiens]. GenBank Acc. No: ADK23870.1. Dep. 07/18/2010. * |
| Grandea AG 3rd, et. al. Human antibodies reveal a protective epitope that is highly conserved among human and nonhuman influenza A viruses. Proc Natl Acad Sci U S A. 2010 Jul 13;107(28):12658-63. Epub 2010 Jul 1. With Supp. Information. * |
| Grandea et. al. NCBI GenBank Acc. No. ADK23853. Monoclonal antibody TCN-032 heavy chain variable region [Homo sapiens]. 07/18/2010. * |
| Grandea et. al. NCBI GenBank Acc. No. ADK23870. Monoclonal antibody TCN-032 light chain variable region [Homo sapiens]. 07/18/2010. * |
| Keller MA, Stiehm ER. Passive immunity in prevention and treatment of infectious diseases. Clin Microbiol Rev. 2000 Oct;13(4):602-14. * |
| Roche. "Factsheet: Tamiflu". 15 Dec. 2005. * |
| TAMIFLU® (oseltamivir phosphate). Package Insert. Genentech, Inc. 12/2012 * |
| Weltzin R, Monath TP. Intranasal antibody prophylaxis for protection against viral disease. Clin Microbiol Rev. 1999 Jul;12(3):383-93. * |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20130158238A1 (en) * | 2007-11-12 | 2013-06-20 | Theraclone Sciences, Inc. | Compositions and Methods for the Therapy and Diagnosis of Influenza |
| US20140363441A1 (en) * | 2013-04-22 | 2014-12-11 | Theraclone Sciences, Inc. | Compositions and methods for the therapy and diagnosis of influenza |
| US11773176B2 (en) | 2020-01-24 | 2023-10-03 | Aprilbio Co., Ltd. | Multispecific antibodies, compositions comprising the same, and vectors and uses thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| TW201300410A (zh) | 2013-01-01 |
| IL228403A0 (en) | 2013-12-31 |
| CA2829968A1 (en) | 2012-09-20 |
| JP2014509591A (ja) | 2014-04-21 |
| MX2013010367A (es) | 2014-04-14 |
| SG193402A1 (en) | 2013-10-30 |
| WO2012125614A1 (en) | 2012-09-20 |
| AU2012229188A1 (en) | 2013-09-26 |
| BR112013023576A2 (pt) | 2016-12-06 |
| EP2685968A1 (en) | 2014-01-22 |
| KR20140012131A (ko) | 2014-01-29 |
| CN103533929A (zh) | 2014-01-22 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20140363441A1 (en) | Compositions and methods for the therapy and diagnosis of influenza | |
| US8114402B2 (en) | Compositions and methods for the therapy and diagnosis of influenza | |
| US8900590B2 (en) | Anti-hemagglutinin antibody compositions and methods of use thereof | |
| WO2011019932A9 (en) | Compositions and methods for the therapy and diagnosis of influenza | |
| US8858948B2 (en) | Compositions and methods for the therapy and diagnosis of influenza | |
| US20130158238A1 (en) | Compositions and Methods for the Therapy and Diagnosis of Influenza | |
| US20120315277A1 (en) | Compositions and Methods for the Therapy and Diagnosis of Influenza | |
| AU2013206604A1 (en) | Compositions and Methods for the Therapy and Diagnosis of Influenza | |
| HK1147767B (en) | Compositions and methods for the therapy and diagnosis of influenza |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: THERACLONE SCIENCES, INC., WASHINGTON Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:GRANDEA, III, ANDRES G.;KING, GORDON;COX, THOMAS C.;AND OTHERS;SIGNING DATES FROM 20120321 TO 20120405;REEL/FRAME:028096/0604 |
|
| AS | Assignment |
Owner name: MIDCAP FINANCIAL TRUST, MARYLAND Free format text: SECURITY INTEREST;ASSIGNOR:THERACLONE SCIENCES, INC.;REEL/FRAME:037146/0817 Effective date: 20151001 |
|
| AS | Assignment |
Owner name: THERACLONE SCIENCES, INC., WASHINGTON Free format text: RELEASE BY SECURED PARTY;ASSIGNOR:MIDCAP FINANCIAL TRUST, AS AGENT FOR LENDERS;REEL/FRAME:037396/0957 Effective date: 20151223 |
|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |